Dbfetch

ID   CP001989; SV 1; circular; genomic DNA; STD; PRO; 99694 BP.
XX
AC   CP001989;
XX
PR   Project:PRJNA30165;
XX
DT   21-APR-2010 (Rel. 104, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Bacillus megaterium QM B1551 plasmid pBM600, complete sequence.
XX
KW   .
XX
OS   Bacillus megaterium QM B1551
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
OG   Plasmid pBM600
XX
RN   [1]
RP   1-99694
RX   DOI; 10.1128/JB.00449-11.
RX   PUBMED; 21705586.
RA   Eppinger M., Bunk B., Johns M.A., Edirisinghe J.N., Kutumbaka K.K.,
RA   Koenig S.S., Huot Creasy H., Rosovitz M.J., Riley D.R., Daugherty S.,
RA   Martin M., Elbourne L.D., Paulsen I., Biedendieck R., Braun C.,
RA   Grayburn S., Dhingra S., Lukyanchuk V., Ball B., Ul-Qamar R., Seibel J.,
RA   Bremer E., Jahn D., Ravel J., Vary P.S.;
RT   "Genome sequences of the biotechnologically important Bacillus megaterium
RT   strains QM B1551 and DSM319";
RL   J. Bacteriol. 193(16):4199-4213(2011).
XX
RN   [2]
RP   1-99694
RA   Eppinger M., Bunk B., Johns M.A., Edirisinghe J.N., Kutumbaka K.K.,
RA   Riley D.R., Huot-Creasy H., Koenig S.S.K., Galens K., Orvis J., Creasy T.,
RA   Biedendieck R., Braun C., Grayburn S., Jahn D., Vary P.S., Ravel J.;
RT   ;
RL   Submitted (05-FEB-2010) to the INSDC.
RL   Institute for Genome Sciences, University of Maryland School of Medicine,
RL   801 West Baltimore St, Baltimore, MD 21201, USA
XX
DR   MD5; 086606d1223866ca358d690ecffced12.
DR   BioSample; SAMN02603354.
DR   EnsemblGenomes-Gn; BMQ_pBM60031.
DR   EnsemblGenomes-Gn; BMQ_pBM60095.
DR   EnsemblGenomes-Tr; BMQ_pBM60031.
DR   EnsemblGenomes-Tr; BMQ_pBM60095.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF01458; rli23.
DR   PubMed; 11251820.
DR   PubMed; 14602653.
DR   PubMed; 15933003.
DR   PubMed; 21705586.
XX
CC   Bacteria available from the Bacillus Genetic Stock Center,
CC   (http://www.bgsc.org/), The Ohio State University, 776 Biological
CC   Sciences Building, 484 West 12th Avenue, Columbus. Ohio 43210 under
CC   inventory No. 7A116 or from Patricia S. Vary (pvary@niu.edu), Dept.
CC   of Biological Sciences, Northern Illinois University, DeKalb, IL
CC   60115.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..99694
FT                   /organism="Bacillus megaterium QM B1551"
FT                   /plasmid="pBM600"
FT                   /strain="QM B1551"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:545693"
FT   gene            1..1383
FT                   /locus_tag="BMQ_pBM60001"
FT   CDS             1..1383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60001"
FT                   /product="replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60001"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72434"
FT                   /db_xref="GOA:D5E3Q9"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Q9"
FT                   /protein_id="ADE72434.1"
FT                   /translation="MKKSNVVQPYDLESINIKNWVTKSNILIESTYKLSLQEQRILLIM
FT                   ASKVQPNDETLKTYRFRAKDFIEIVGNKKGTGFYSYLKEIVNGLQTKILTIKEKGRQRN
FT                   YNWVITSIYEENEGYITLQFHPSLKYLFLELKEKFTSYQLENVVRLNSVYSIRIYELLK
FT                   QYERLRKRELTLEELRHFLAIEPTKYKQYGHFKSKVLAVAQKEINNKTDINFEFVEIKT
FT                   GRKVTSIEFIITSSSALNGTSSSKETKLKSTQSSLDLLDNEKENGLYHDLVSLGVKPQK
FT                   IKWVLSEFAKEQVERNVKYTQGRLVIGDITHPHSYVIKAIQKDYAKVSQESKIATPKKS
FT                   TRKELVPDFMIEAEDKEKAFETLTLKEKQELFYEENGNQIEFEKRLLQFQELRKMLVLN
FT                   SEEPNQEELKKAQEAAVREVLRNMNEDLRKREEVGLKPRLINDFENKELREIYRTFLHK
FT                   QV"
FT   gene            1561..2493
FT                   /locus_tag="BMQ_pBM60002"
FT   CDS             1561..2493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60002"
FT                   /product="phage integrase/recombinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60002"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72435"
FT                   /db_xref="GOA:D5E3R0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3R0"
FT                   /protein_id="ADE72435.1"
FT                   /translation="MDIPLLVQHFLIHLHETGKKHSTVSMYKHDLMAFFKWLNQHSPDI
FT                   TPGILPEEKSCYEEYLTYLKEKNLSEANLRRVASHLNRLLEYHNLTDQFGALKATTKKQ
FT                   RDLVDSDFITEKDTFSLLNSVVSKKNLTETQLQIHKYIAPRNYSILILMLHYGLTLNEV
FT                   VSLNINDINFSQNELTIITNKGKRVLELSKDDKKIIYNYFSDIPSLFKPKDYTDDPLFL
FT                   SFHPQKKVYWYDYNLNKPKRISLIGVKRMIEKEVERSGIQAKVRSTQFRNSCILNKISE
FT                   GYSNESLIYYFGLSSRHALYRYKRYLETQ"
FT   gene            3645..4220
FT                   /locus_tag="BMQ_pBM60003"
FT   CDS             3645..4220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60003"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60003"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72436"
FT                   /db_xref="GOA:D5E3R1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR025052"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3R1"
FT                   /protein_id="ADE72436.1"
FT                   /translation="MSKNLDEEVVYTLKDTVKLTGLSIDLVRLYEKEFNLQIQRTEGGH
FT                   RRYNKSNIDLLIEIKKRIQEQNWSYKMINQWLQGEIIPESIEVQSNLEKKVGSLEDKVQ
FT                   ELLDRSEKGEQFQFALIQRLDEQSQLIKQLTEKLSSQDKYIENNLEKRDEKLTNAIREI
FT                   SDTKKLIAAAQENLESKPKSFWHRIFRG"
FT   gene            complement(4810..5094)
FT                   /locus_tag="BMQ_pBM60004"
FT   CDS             complement(4810..5094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60004"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72437"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3R2"
FT                   /protein_id="ADE72437.1"
FT                   /translation="MPKHRTSDERRSSRRTSDGRRTSSSNRGTSSNGFRLDGLRQGDRI
FT                   EVFSAGNQLNGVGTFIRIRDGFLVWVNEDGNITSTSLDTISISRVPGTM"
FT   gene            complement(5637..5798)
FT                   /locus_tag="BMQ_pBM60005"
FT   CDS             complement(5637..5798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60005"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72438"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3R3"
FT                   /protein_id="ADE72438.1"
FT                   /translation="MLRKFLFYYPQIFLLFSWLNPPLYIYNDATLTIIEKIIEFAWAIF
FT                   SELGLCPF"
FT   gene            6193..6771
FT                   /locus_tag="BMQ_pBM60006"
FT   CDS             6193..6771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60006"
FT                   /product="thermophilic serine proteinase"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60006"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72439"
FT                   /db_xref="GOA:D5E3R4"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3R4"
FT                   /protein_id="ADE72439.1"
FT                   /translation="MPLLHLDSSEFTKNTQIIVKFKEDVCEETQLEIHHKNKCTILDHN
FT                   NELNFQVLHSKKDINTLIKVYNKLEEVEYAEPNYMLKAFYTTPNDPLFAYQYGPQKVQA
FT                   PDAWDVMTSNGNIKIAIIDTGVQLNHPELAVKLWPGYNFVEGDLNPNDGNGHGTHVAGI
FT                   AGALTENSLGIAGMAPSASIIPVRALDNI"
FT   gene            6781..6963
FT                   /locus_tag="BMQ_pBM60007"
FT   CDS             6781..6963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60007"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72440"
FT                   /db_xref="GOA:D5E3R5"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3R5"
FT                   /protein_id="ADE72440.1"
FT                   /translation="MSNIANAITYSTNAGAKVINLSLGSSQGSVTDPSSISTWDYVLNS
FT                   MHNIDSLTLSFTFYK"
FT   gene            7247..7933
FT                   /locus_tag="BMQ_pBM60008"
FT   CDS             7247..7933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60008"
FT                   /product="putative papain-like cysteine peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60008"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72441"
FT                   /db_xref="InterPro:IPR014903"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3R6"
FT                   /protein_id="ADE72441.1"
FT                   /translation="MNLQDIRGSYDLMLGLGSWCGPSLNLRRHNWRRFSFPLDWMISNS
FT                   ISDVSRLLRNRFTGFMEFQNLQRTDGYAHFLDDGVAIFPEEGGAEPVNAHFIHDTYYNI
FT                   ISVHDFPIIPNVDWTVMYPSYKEKLNQRIARFLEKVENSSSILFIRWGAASPEEAIELK
FT                   SVLSELTKGSFNILLLQPAEGLKNVIDMHWTIDGVCSVQVPMDEPNNELVWDYVLNGVS
FT                   LSNYWN"
FT   gene            8352..9443
FT                   /locus_tag="BMQ_pBM60009"
FT   CDS             8352..9443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60009"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60009"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72442"
FT                   /db_xref="GOA:D5E3R7"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3R7"
FT                   /protein_id="ADE72442.1"
FT                   /translation="MKVMTILGTRPEIIRLSLIIGKLDDYATEHILVHTGQNFTASLSE
FT                   VFFQELNVRQPDYILANQQLTLGEQLSKMYKELEGIFLKEKPDKILVLGDTNSGLSTIL
FT                   AERMGIPVVHMEAGNRCFDLEVPEEKNRRIIDSISSFNLPYTPQSKENLLREGIPSNRI
FT                   IVSGNPINEVLTYYESRIEDSKILNKLSLKEGDYFLVTAHRAENVDHEDRLLEIIKGIN
FT                   MVAEYYQKRVICSIHPRTKSRIEHSSLVNIHPLVELHNPFGFFDFVKLEKNAYCVLTDS
FT                   GTVQEECCLFHVPTVTIRKTTERPETIECGSNMLSGISADQILNCVHVMVNQLKNWSYP
FT                   EGYGHLNVSDKVIKVVLGGIKGV"
FT   gene            9436..10422
FT                   /gene="flaA1"
FT                   /locus_tag="BMQ_pBM60010"
FT   CDS             9436..10422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaA1"
FT                   /locus_tag="BMQ_pBM60010"
FT                   /product="UDP-GlcNAc C6 dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60010"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72443"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3R8"
FT                   /protein_id="ADE72443.1"
FT                   /translation="MFDNKTILVTGGTGSWGYELVKQLLTHNPKEIRVFSRNESNQFTM
FT                   KQEFDNHPKLSFIIGDIKEREALMESCQDVNYVFHLAALKHVPVCEDQPIEALKTNVHG
FT                   TQNVIDAAISCNVDRVVYISTDKASNPANFYGLSKAMGERLIIHANTLNTNTKFVCIRG
FT                   GNVLGTNGSVIHVFKKQIQEKGKIGITHPNMTRFFLTLEDAIKLVFKATFESLGGEIFV
FT                   MKMPTCKIIDLANVLIEASGKETIEIETLGIRPGEKIHELLLSEYESTTTVTYDDEYFV
FT                   ILPPIHIEGLKEYYAPYTLVNLEKYDSSKETISKEAIREMLLKGGFI"
FT   gene            10423..11247
FT                   /locus_tag="BMQ_pBM60011"
FT   CDS             10423..11247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60011"
FT                   /product="NAD dependent epimerase/dehydratase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60011"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72444"
FT                   /db_xref="GOA:D5E3R9"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3R9"
FT                   /protein_id="ADE72444.1"
FT                   /translation="MKLLILGGKGMAGHVITRYFMLNSNYDVSYTSRDPKDENGIYLDI
FT                   TNFKRLEETVDAIKPDIIINCIGVLNEHASNNPMRAFQINSLLPHQLAKLIERYQGKLI
FT                   HISTDCVFLGSKGDYTENDSPDGTSVYAQSKQLGEIVDNKHLTIRTSIIGPELKEDGIG
FT                   LFLWFMKQEGIIKGYKKVFWNGVTTLELAKAVEFLIENNVTGLYHLHSKQKLSKLTLLE
FT                   LFKEVFEKDDIKIIPDEEVVLDRTIISTRTDFCYMPPGYREMLNELKEWMSK"
FT   gene            complement(11481..11678)
FT                   /locus_tag="BMQ_pBM60012"
FT   CDS             complement(11481..11678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60012"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72445"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3S0"
FT                   /protein_id="ADE72445.1"
FT                   /translation="MGDNHFQEAHNSNDINFTQKQRYRVITGAFNDKVTANQIAAEIKE
FT                   RYGLTVYVIPEQVKRSSSSL"
FT   gene            complement(12090..12713)
FT                   /locus_tag="BMQ_pBM60013"
FT   CDS             complement(12090..12713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60013"
FT                   /product="putative papain-like cysteine peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60013"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72446"
FT                   /db_xref="InterPro:IPR014903"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3S1"
FT                   /protein_id="ADE72446.1"
FT                   /translation="MNLEGIKGHYDAIFSLGDLCLTSLQLKENNLRTFSGILDWVSSPS
FT                   LKNVNVLLQNRFADFLNLKNLRIIKYISQWDLLVWDEVYNIGFNHDFKTDKNTLTYLGG
FT                   YAEVKEKYDRRIQRFLEKLSTSQRILFIRTEANFEEVAELEAILSGMIANDFRILVINH
FT                   TDVDHLVEKSWSLQRVCAIELPNHDKWNANIHYWKMILADVTLL"
FT   gene            complement(12911..13828)
FT                   /locus_tag="BMQ_pBM60014"
FT   CDS             complement(12911..13828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60014"
FT                   /product="NAD dependent epimerase/dehydratase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60014"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72447"
FT                   /db_xref="GOA:D5E3S2"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3S2"
FT                   /protein_id="ADE72447.1"
FT                   /translation="MKAIVTGGAGFIGSHLVEELIIKGFEVHIIDSMISGKQENIHPLA
FT                   TLHVEDICSKQARQIILQEKPNIVFHLAAQADVSTSINDPQYDADVNVKGTINILEACR
FT                   DASVDKIIFASTSAVYGELQKDLITEMDPTAPISYYGLSKLTAESYIRLFSRLYGLSYT
FT                   ILRYGNVYGPRQTPKGEGGVVAVFLDRLDKGTMLNIHGDGEQTRDFIYVKDIVQANIAA
FT                   IDKGHQEIIHASTTQRTSVNRLLKELEKIHGSKINISHTEGRPGDIKHSCLDSKKAHKL
FT                   LEWRSQVSIFNGLTETYTFLKNNK"
FT   gene            complement(13960..15198)
FT                   /locus_tag="BMQ_pBM60015"
FT   CDS             complement(13960..15198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60015"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60015"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72448"
FT                   /db_xref="GOA:D5E3S3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3S3"
FT                   /protein_id="ADE72448.1"
FT                   /translation="MKRGAKFMKILLATFWEVPHVGGVWNYMQQLKEELEALGHEVDLL
FT                   GHGAGNESVHIVNKNQEFIKDEFSLIAKLAQKEENHPLLYKDEVVKFYEKQRLGYIEGV
FT                   TYLGIDQYDIIHTQDVVSTACISPLKPEKTALVATIHGCVAHELNHYVKNTLKSSTADI
FT                   ACKYFNELEHTGAMSADCTVVANNWLKNILLKEFQVQEEKLTVFHYGYDINSFLQRMQT
FT                   PSTLRARVGQQVIIYTGRLVEIKGIHHLLSALSELKKLKKGWVCWIVGDGDKKAELKAQ
FT                   SRALGLGKRVVFLGNRNDVPSLLSLANIFVLPSLIENQPLSVIEAQLAGKPVIVSDAGG
FT                   LPEMVKHGSTGIISPAGDPNSLCENIYNLLINPEYRESLGAKAQEWALNHWSQKKAVDK
FT                   VLNVYEKVLSHRS"
FT   gene            15404..16318
FT                   /locus_tag="BMQ_pBM60016"
FT   CDS             15404..16318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60016"
FT                   /product="GDP-6-deoxy-D-lyxo-4-hexulose reductase"
FT                   /EC_number="1.1.1.145"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60016"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72449"
FT                   /db_xref="GOA:D5E3S4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3S4"
FT                   /protein_id="ADE72449.1"
FT                   /translation="MNAKKKLLITGASGFTGYHACEYFSKSELDIIAITKKRNFCYKKV
FT                   KTKQCDLFNKKGIKDLIKQTKPDYVLHLAGQNAVGRSWEDPLDSLEVNAMGTAYLIEAL
FT                   RQEAPACKTVIVSSALQFNPTSISTFNHPYGLSKTIQSIFSQFWATLYNMHIVIARPSN
FT                   LIGPGFSTGVCSIFAQRIVNMEREKEEKFLNVSNLNNRLDFLDVRDAVRAYDFLLKKGK
FT                   SGDIYDVSSGKSHSLEEIINIFRKTTDIQFQTKLDNQSPIVNHVDLQPLSLIELGWQPT
FT                   VPLKTTIKDIVDFYRQQVDGLNN"
FT   gene            16677..17402
FT                   /locus_tag="BMQ_pBM60017"
FT   CDS             16677..17402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60017"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60017"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72450"
FT                   /db_xref="GOA:D5E3S5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3S5"
FT                   /protein_id="ADE72450.1"
FT                   /translation="MGPKVSIIIPFYNCPYVDQAIKSALDQTYENIEIVVIDDGSTSYT
FT                   EKIMPFKDKIIYIRKENGGTATALNTGLFVATGEYIAWLSSDDYFVPTKISKQVDFMTK
FT                   KKIDASFTNFDYINKDNQVLVPWCTKRFTNLEDVYNAFLTYNAINGCTILIKKEIFDKI
FT                   GIFSPDFRYTHDYEMWFRMLVNGYEIHYFDESLTKFRSHENSGTRKYQSEMQKEMKIIE
FT                   YHYRPLLKKYIKSLQSDHS"
FT   gene            17766..17900
FT                   /locus_tag="BMQ_pBM60018"
FT   CDS             17766..17900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60018"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72451"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3S6"
FT                   /protein_id="ADE72451.1"
FT                   /translation="MKDKTTSSFDKDLTDFLDDIKTKLHPDYKIPDPQVVNIILKYTQ"
FT   gene            17984..19225
FT                   /locus_tag="BMQ_pBM60019"
FT   CDS             17984..19225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60019"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60019"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72452"
FT                   /db_xref="GOA:D5E3S7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3S7"
FT                   /protein_id="ADE72452.1"
FT                   /translation="MKILLVSYYPLPYTGGVWTFVSLLKKSLEDLGHSVDVLSHTPDTT
FT                   KYRIIGQEPEIEIDDISPYIKEKIVTEMPSLPINSWIYNVEIFRYSLELSAAYYNLQQY
FT                   DIIHALDVTAARAISRVKPSHIPLVTSALGNLSRDIFFTLKTMHRKKTDQQLQNTFEYQ
FT                   YHKTLERLGYQSSNLIHSPTLWMRNNIIDNFSISPDKIMTFSYGLDIKNFHPDSMECPI
FT                   IGPKKGKKIILFMGRLVYLKGVHYLLDALALLKKDRDDWECWILGEGELQGELEKQSQK
FT                   LELSNRVRFLGISNDVTHFLREADIFVHPSIHDTQPYSVMEAQLTGLPVLVSNTAGLPE
FT                   MVEVGRSGLVSSVGNIHELYDQLRYLLENDILREQLAACTKEWAKERWSLGTMVNNVLS
FT                   LYKQAKGLETENPT"
FT   gene            complement(19274..20344)
FT                   /locus_tag="BMQ_pBM60020"
FT   CDS             complement(19274..20344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60020"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60020"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72453"
FT                   /db_xref="GOA:D5E3S8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3S8"
FT                   /protein_id="ADE72453.1"
FT                   /translation="MNILFVFYVPSGGVETLNRQRCKALKKHNINAHCLYYENRKKTIN
FT                   DHGTQTFVTNEDREIKKILDGGNYSLIVIVSDFQALPRFKSLGYKGKMIIEIQGYGPKS
FT                   TARAALTNAVPLVTKYASGFLNPKTPHIMQLLDELYPSFPVFSFNNCFDTNQFSYRSVP
FT                   VSHTPHIAWIGRIEDNKNWREFLKIGSELVHNYNSGIQLHMFEDPTISEPKERAEFKNL
FT                   IKELNLEANLLLHANVPNNEMANYFSMIGESGGFLCSTSKVEGAPYSLLEAMSCKCPVL
FT                   TTDSDGVKSSIIHNQTGKYYTLGNVDEAVKEAKELIMDSQLREYIRVNALQHVKINFSP
FT                   ELYCANFIAMIRSLGI"
FT   gene            20663..21385
FT                   /locus_tag="BMQ_pBM60021"
FT   CDS             20663..21385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60021"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60021"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72454"
FT                   /db_xref="GOA:D5E3S9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3S9"
FT                   /protein_id="ADE72454.1"
FT                   /translation="MLKVSVIVPFFNCPFISHALDSLLNQNYNNIEIIVINDGSTQYKE
FT                   KIIPYLDKIIYTEKENGGTASALNVGIQLATGDYICWLSSDDIYYPQKIALQLEFMTIN
FT                   NALFSHTNYYAINTRGRIITPPLGFHPSNKIEILKQISKGNIINGCSTMINKNVFTRVG
FT                   LFDETLLYTHDYDLWVRIIQKFDLHYLSEPLLLSRIHENMGTKKYASFIKEENKMVINR
FT                   HKDTLTQLIIECIAKENL"
FT   gene            21462..21617
FT                   /locus_tag="BMQ_pBM60022"
FT   CDS             21462..21617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60022"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72455"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3T0"
FT                   /protein_id="ADE72455.1"
FT                   /translation="MVKFILDTKKFKYKHETSVIRLSFACTPQLPIKDYSTLAKIIKML
FT                   STEKIG"
FT   gene            complement(21586..21714)
FT                   /locus_tag="BMQ_pBM60023"
FT   CDS             complement(21586..21714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60023"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72456"
FT                   /db_xref="GOA:D5E3T1"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3T1"
FT                   /protein_id="ADE72456.1"
FT                   /translation="MSNFALASLDSANIIILSQLHFFALLSMFYNMLIRFFRCSAF"
FT   gene            21677..22228
FT                   /locus_tag="BMQ_pBM60024"
FT   CDS             21677..22228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60024"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72457"
FT                   /db_xref="InterPro:IPR020139"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3T2"
FT                   /protein_id="ADE72457.1"
FT                   /translation="MALSSEAKAKLLNLLGTLQSLPTTADSTTTTTTNNLLNTANSSTN
FT                   VTDLLSTLNTNGLVDTSLITNLLNSTTTNVTDLLNTTTASATDLLNTTTATATGLINTT
FT                   TTATTNLLIDLLRLRLLPSLNALRNDLTNRLNQTVQLSTEYETLTGVLLAVQSDYVVLV
FT                   ESDGTMHFVNLSKIETVASL"
FT   gene            22245..22463
FT                   /locus_tag="BMQ_pBM60025"
FT   CDS             22245..22463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60025"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72458"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3T3"
FT                   /protein_id="ADE72458.1"
FT                   /translation="MFESFLAAELTKHIGTPVEVAMSDGLVEGIITSVTGNLLTILQTV
FT                   GYGYGTTTTPLTISIPAINFVTFSPVA"
FT   gene            complement(22460..23746)
FT                   /locus_tag="BMQ_pBM60026"
FT   CDS             complement(22460..23746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60026"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60026"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72459"
FT                   /db_xref="GOA:D5E3T4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3T4"
FT                   /protein_id="ADE72459.1"
FT                   /translation="MKDIQVILLSYSNSSALQQALTSLNLIINRVKGVIVIDIPDFLLK
FT                   VADSFTPQAKTEYVKLNNNHLGKVLNNYIKELSCEYVLFLYDQDYLNSNITEIQLELNN
FT                   EKQVMTYQCTIKNITIQRPFFIKTYFLKQNIFFQENEVPFKEAILPSWLSLVNHYHLIL
FT                   EDRGVISQLSKDASTSNVEKIKFIEKYQSKVPNQIAQPSVAVMVSNYNMANYVGTAINS
FT                   CFLQNSPPEQVLVVDDGSTDESYKVLEKWIYHPQFKLLTKKNGGKARALNELLPYIETD
FT                   FIVELDADDWLDPDAIFVIRDYLRSLADDVAVLYGNLRAWKQVSPGKIKYKGIRKGSQV
FT                   LNKTELLSYTFPLGPRIYRTLSLKENKGFPIIDFEDGRMYEDVSILNYLLRENRLLYKD
FT                   FTIYNVREHAFSITKKNPSSWSDFLKLLN"
FT   gene            24128..24562
FT                   /locus_tag="BMQ_pBM60027"
FT   CDS             24128..24562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60027"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72460"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3T5"
FT                   /protein_id="ADE72460.1"
FT                   /translation="MTRLLDARTSQNASIANSISIPITILSQPGLFGQIGLNVSGATGP
FT                   VRTQLSGTVACQLPLLPAATTITLTIVRVTALTDPVVYSSSESLNINLLGPQLFTFTAS
FT                   DFNIPAPASGLLVYTAFIGSNLLGTVRVGPESFNGIAYSD"
FT   gene            complement(24945..25373)
FT                   /locus_tag="BMQ_pBM60028"
FT   CDS             complement(24945..25373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60028"
FT                   /product="spore coat protein X"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60028"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72461"
FT                   /db_xref="GOA:D5E3T6"
FT                   /db_xref="InterPro:IPR011428"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3T6"
FT                   /protein_id="ADE72461.1"
FT                   /translation="MGEQKWRALDHCKTGTHNGAVIDQDADAASSIEQQSFEWIIVKDS
FT                   EGVEVNTTDAQVAIQLQVAIQVAIAAVVAILTSNVNQGEIVAEEMTALLGTRQRNSQKT
FT                   VIEGSINVKVNTTDADVALNIQVAIQVLIAIFVSLLSS"
FT   gene            complement(25411..25944)
FT                   /locus_tag="BMQ_pBM60029"
FT   CDS             complement(25411..25944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60029"
FT                   /product="spore coat protein X"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60029"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72462"
FT                   /db_xref="GOA:D5E3T7"
FT                   /db_xref="InterPro:IPR011428"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3T7"
FT                   /protein_id="ADE72462.1"
FT                   /translation="MPTHKRYESREVKKRSKKKYSDHDHKSRFELEEDDHFSHLFESDN
FT                   HFEDESKEDAVIEQEPDAFSFVDQESTELIWIKDSCDIEVTTTDTQVAVQLQVAIQVAL
FT                   GVVISILSSNVANSEVIAQDLLAHANLEQTNKQKIVIVNSKDVKITTTDADVAVNIQVA
FT                   VQALIAVFVSVLSS"
FT   gene            complement(26080..26355)
FT                   /locus_tag="BMQ_pBM60030"
FT   CDS             complement(26080..26355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60030"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60030"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72463"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3T8"
FT                   /protein_id="ADE72463.1"
FT                   /translation="MIDTYSIMTFIMKGAGNLNNSNQKPGETPNKLMELMMLNILQKHG
FT                   ITKENVKGQVTDEQKQLIFDLLEELKQQSNALADRAKATSPKTKPK"
FT   gene            complement(26532..27005)
FT                   /pseudo
FT                   /locus_tag="BMQ_pBM60031"
FT   CDS             complement(26532..27005)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60031"
FT                   /note="putative transposase, point mutation"
FT   gene            complement(27289..27570)
FT                   /locus_tag="BMQ_pBM60032"
FT   CDS             complement(27289..27570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60032"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72464"
FT                   /db_xref="GOA:D5E3T9"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3T9"
FT                   /protein_id="ADE72464.1"
FT                   /translation="MLLTSKLAAFLGYENLIVLDIIRGIHEMVLMSGRYTKSLENFILL
FT                   FFMIGMETLSNRLWLLINGQTIRLKRLSFIFLKKGVTTTKIAHLMEHI"
FT   gene            27906..28724
FT                   /locus_tag="BMQ_pBM60033"
FT   CDS             27906..28724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60033"
FT                   /product="YVTN family beta-propeller repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60033"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72465"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3U0"
FT                   /protein_id="ADE72465.1"
FT                   /translation="MAKKAKKINVNFSDSGASNDQLYVIDENNNVISVVNATTNNVVST
FT                   IPVGHQPVSLNGNPNNNRIYVTNGGSQTVSVIDGATNTVIAIIPVGIQPAGVGINPYIN
FT                   RIYISNRGSNTVSVIDGLTNTVISTISVETYPTDINVHPYINRIYVTNEFRNTVSVIDG
FT                   LTNTVISTISVESQPSGIGINSATNRIYISNRGSNTVSVIDAITNTVMAIIPVGNQPTS
FT                   IEVNSSNNQIYVTHEVENTISVIDGLTNIVVATVPVTSPMANIDEDLSLE"
FT   gene            29276..29998
FT                   /locus_tag="BMQ_pBM60034"
FT   CDS             29276..29998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60034"
FT                   /product="GlcNAc-PI de-N-acetylase family protein"
FT                   /EC_number="3.5.1.89"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60034"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72466"
FT                   /db_xref="GOA:D5E3U1"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3U1"
FT                   /protein_id="ADE72466.1"
FT                   /translation="MTVSKGTSTSYIKYNTEPGGKKMRECILVIGAHPDDELLGTAGTL
FT                   KKFIDEGHQVISIVVALGRKEEAHHIQEFGKLANKELGIDEVIFLGHPNLELESIPLHL
FT                   LTKEIEKLIQKYKPSKIFTHHYGDLNIDHQITFKAVLTATRPLPNKEPIELITFETVSS
FT                   SEWNASTSDNLFKPNYFVDITSNIDAKINALKYYDVEMRKFPHPRSYEGVKHLGRVRGM
FT                   TIGVPYAEAFEVIRRVWK"
FT   gene            29995..31281
FT                   /locus_tag="BMQ_pBM60035"
FT   CDS             29995..31281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60035"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60035"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72467"
FT                   /db_xref="GOA:D5E3U2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3U2"
FT                   /protein_id="ADE72467.1"
FT                   /translation="MIRDLIFPYPYIIEKMDEYYKPNFPPVKVREEYRTKISPQKRPSK
FT                   KKLTILIATFWDYPHIGGLSNYITELSKGLKKQGHKVDVISPNLFPSATVKDLREDITP
FT                   KLKGFFLRRYGSYDKKILSNSRLLYVYEQMLQKMDLEKYDIFHAQDIFTANILGRFNAN
FT                   YNKPLFFTPHGMFTFKRLKFNLMEKGSIEETYYKELERKAIEFASQLIILSDSFRDSLT
FT                   DLGAKQEKMTTVITGINYPEKYYKKNLEHQEKLIITCVARLGPRKGHNYLLNALSRIRQ
FT                   YTNNVEVLIVGDGEMRETLEKQVHSLDLPMVNFLGSRDDVPYILSKTDIFVLPTINDSL
FT                   PIAIIEAMHSGTAIISTNCGGIPEIVKHGKTGIIVEPGDTEELAQALRFFIVNKQARDK
FT                   ATTNAFNFAKTHLTTDGMIRKIESIYNKF"
FT   gene            31297..32472
FT                   /locus_tag="BMQ_pBM60036"
FT   CDS             31297..32472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60036"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72468"
FT                   /db_xref="GOA:D5E3U3"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3U3"
FT                   /protein_id="ADE72468.1"
FT                   /translation="MKHEHCAVVLDLSANGVGIIRSLSKKGIKIYAFDTERAYKIGKSR
FT                   LATCNICPNPLTEENELLTFLINLSQSIGKKPVLYAGSDDYIVFISKNRKELSKYFLFL
FT                   LPDHSLIEEVLDKEKAYELALKHNIASPKTYIVENEDHFEEAIANLDFPCILKPVLGHE
FT                   FRKNINKKAILINDLDQLKADYQTYREYGKLLIQEIIPGDDNCFYKVATFYDDNMKLMA
FT                   LFSLQKNHQFPAEFGTGAHIMSKRVPELFDICLPFFEEIGLKGIGMAEFKKDPRDGVYK
FT                   FIEINPRFWLTHSLTEPSGINFVYMYYLYLTKQNPEPIFYQIDGVKWIYLVRYYLTFLQ
FT                   KRKRKEMSFIDFYKGFQGKKEFALFAWNDPMPFIRSTCSHLVNAWKQQRKE"
FT   gene            32478..33536
FT                   /locus_tag="BMQ_pBM60037"
FT   CDS             32478..33536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60037"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72469"
FT                   /db_xref="InterPro:IPR004119"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3U4"
FT                   /protein_id="ADE72469.1"
FT                   /translation="MYEPKLLYKLFTKLKISEKLSYSMDEKVIIDPTKIECLKSTKRSS
FT                   IYKLLLRKKSGYYPIIFKVYSSTTQKNEVEINIYKKLHPLLKEFLPQIYLIERNPNEDW
FT                   VFMEFVNQIRGQLKFTPKHLDYIIPTVAKLHARTFEDKFKKYNDAWSSWLPTYDSASAR
FT                   KEREKYIEKTVVFLDEAVSDDRTKDLIKPYYKPLIKLYSKGPDFFPEILESGSSLTHGD
FT                   LHMQNICSKDVTKDYPWNIQFIDWESARYAPTWFDMVVLVEILLGFRADWQKHAEEIRN
FT                   HCVVTYVNEMKKHGIKFKTDPRDLYKMAYLQRTLEKGLHTQLRRIFDNRGGELLGYHLE
FT                   KVAIWGRELGID"
FT   gene            33708..34025
FT                   /locus_tag="BMQ_pBM60038"
FT   CDS             33708..34025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60038"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72470"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3U5"
FT                   /protein_id="ADE72470.1"
FT                   /translation="MSKSYKNKKEGQHYDLKVIHDASKDKHDCKCKKDKYEEKDEYKHK
FT                   KDKYESKDKKNKYKEKDEYKHKKDKCESKDKKDKYKEKDEYKHKKDKCKYKSTDYDTMY
FT                   P"
FT   gene            complement(34725..34856)
FT                   /locus_tag="BMQ_pBM60039"
FT   CDS             complement(34725..34856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60039"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72471"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3U6"
FT                   /protein_id="ADE72471.1"
FT                   /translation="MGYKEYWDDEKHSEESSSKKKKKKSEHKDSGATVRIISLWKKG"
FT   gene            35373..35942
FT                   /locus_tag="BMQ_pBM60040"
FT   CDS             35373..35942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60040"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72472"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3U7"
FT                   /protein_id="ADE72472.1"
FT                   /translation="MKDFSPASNHKHNKVIRKEDLKEYEIIGDGADGIVYQLTSDRCIK
FT                   FFFKEETQQRELEALRIGQSSPVMPRLYQYGANFIVMEYIKGFSLARYLKKHGQLTKPL
FT                   VEKILNMLDELKKLGFTRYDAEIRHVLINELGDLKVIDHKRAFTSDQPVPVKLLKGFKK
FT                   LGLTDEFLRFVREIRPSVYDEWKKYK"
FT   gene            complement(36037..36534)
FT                   /locus_tag="BMQ_pBM60041"
FT   CDS             complement(36037..36534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60041"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72473"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3U8"
FT                   /protein_id="ADE72473.1"
FT                   /translation="MVSAILRDEDIKSINLWITKMKQYKTQDTEWMTKAAVRTLKLDYK
FT                   IIGYGYERVTYDLQNGYVLKVATSELGLKSNKNEFIIYKYCHAKLKEHLCPIKEVGYGW
FT                   IIMKKMTIPVPRTEDYDNQLKYLKKRFRQYGVRPKDLVRPNLALTKKGKIVFIDYGDFT
FT                   LK"
FT   gene            complement(36885..37370)
FT                   /locus_tag="BMQ_pBM60042"
FT   CDS             complement(36885..37370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60042"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60042"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72474"
FT                   /db_xref="InterPro:IPR001073"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3U9"
FT                   /protein_id="ADE72474.1"
FT                   /translation="MKNYYIPYNYEGIYRPYVNDIRAGASAFRALNNVNTPLEANNANK
FT                   VRFQTEQYDLANEYDLNTSTFVPRENGVYTLTSSVKFRPFNSGPYNLDIVFLITNKGET
FT                   EGRDNEAFAGKRPGIITTSETLWLNAGDQVVVGMRSSINGMIQGDGSTTFSAVKVFP"
FT   gene            complement(37815..38291)
FT                   /locus_tag="BMQ_pBM60043"
FT   CDS             complement(37815..38291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60043"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72475"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3V0"
FT                   /protein_id="ADE72475.1"
FT                   /translation="MGKLDKYARQSRSKEASKVLPIRLPEGIYEQFRERCDELGLSMSE
FT                   AGYLLIREELEENLYTTTTSEVAATTGRIQKSIQDENTPYTKKTTNSSSSFSSRWTSAH
FT                   YEVENELPCPLCHQWYSKTNFARHAKNHNTTPKELLENNKEFIFQMINERKHNV"
FT   gene            complement(38483..39298)
FT                   /locus_tag="BMQ_pBM60044"
FT   CDS             complement(38483..39298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60044"
FT                   /product="Integrase core domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60044"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72476"
FT                   /db_xref="GOA:D5E3V1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3V1"
FT                   /protein_id="ADE72476.1"
FT                   /translation="MCEVLTIPRSSYYHSFKKTVSNREQENQKLTKEIQRIHVKSKARY
FT                   GAPKIHQTLVNNGCYLSLKRVQRLMKKARIRSITKKKYRPYPSKEKVIQLDNLLKRDFS
FT                   TRTINEKWVADITYIPTLRDGWCYLASVLDLHSKKIVGYSFSRSMTSELVIEALRNAYT
FT                   AQKPGKDLLLHTDLGSQYTSSEFTQHVHEYEMKQSFSQKGCPYDNACIESFHAILKKEE
FT                   VYHTQYTDYSAAKLAIFQFIEGWYNRNRIHSSLGYQTPQAIEDQMRKTA"
FT   gene            complement(39358..39633)
FT                   /locus_tag="BMQ_pBM60045"
FT   CDS             complement(39358..39633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60045"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60045"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72477"
FT                   /db_xref="GOA:D5E3V2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3V2"
FT                   /protein_id="ADE72477.1"
FT                   /translation="MERKRAGKTYNDEFKKTIVDLYHAGNSVKDLSSEYGVSEVTIYKW
FT                   VKAFTPISSEEGSLTPKELADIQKENLRLKQELDILKKAMVIFAKK"
FT   gene            complement(40243..40491)
FT                   /locus_tag="BMQ_pBM60046"
FT   CDS             complement(40243..40491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60046"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72478"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3V3"
FT                   /protein_id="ADE72478.1"
FT                   /translation="MFSLLYVYIFKICTRNERVHFEIRKLPKVFLSIIRQLHFNERKKP
FT                   LIRFSDFFLFFMEGCPFSLGFRASNPLSQIPQKYAHL"
FT   gene            40521..40664
FT                   /locus_tag="BMQ_pBM60047"
FT   CDS             40521..40664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60047"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72479"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3V4"
FT                   /protein_id="ADE72479.1"
FT                   /translation="MVTVVEIMVAKMITVMLINEKKSMVGPTENIVYSHDNVIKRKKET
FT                   NH"
FT   gene            40827..41312
FT                   /locus_tag="BMQ_pBM60048"
FT   CDS             40827..41312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60048"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72480"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3V5"
FT                   /protein_id="ADE72480.1"
FT                   /translation="MSSCRKKHCYGCSNCTLNSCYCTGPSILSAFGSLRKESGQVIDVD
FT                   GTKVDYDFVGPSANVTLNIVNDTITINESGVYEISMSLTLGINPTDLARGFLFVNDVPL
FT                   NFSAVSLTVTSSTLALATVSKTIQLDLLANDVIDVRIHKVGDAVIVGSSSLTINRIG"
FT   gene            complement(42032..42955)
FT                   /locus_tag="BMQ_pBM60049"
FT   CDS             complement(42032..42955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60049"
FT                   /product="YVTN family beta-propeller repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60049"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72481"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3V6"
FT                   /protein_id="ADE72481.1"
FT                   /translation="MITTPPIIYSILAYVANPGNDTVSIIDTETNIMIYNILVRGIPYR
FT                   LAITPDGMRVYVTNYGDLTISVIDTMANTVTATIFTGDNPAGLAITPDGTRVYVTNEGN
FT                   NTISVIDITTNRVISTISVGTNPSEIAITPDGRYTYVTNSGSDNVSVINTAINTVISTI
FT                   SVGYKPSGVAITPDGTHAYVTNKFSDNVSVINTAINTVISTIFVGYKPSGLAITPDGMY
FT                   AYVTNAGSNNISVINTATNTVKATIFVEDAPSGIAITPNGTHAYVTNEFSDNVSVINIA
FT                   TNTVISTIDIKSNSYPIGILIMNSLY"
FT   gene            43124..44305
FT                   /locus_tag="BMQ_pBM60050"
FT   CDS             43124..44305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60050"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60050"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72482"
FT                   /db_xref="GOA:Q848Z6"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q848Z6"
FT                   /protein_id="ADE72482.1"
FT                   /translation="MNQFTTDLVQALVQKENVTEIFRSHLENAVNTLLASELTAFLDYE
FT                   KYDRIGFNTGNSRNGSYERTLHTEFGELHLVIPRDRNGDFKQQTVAPYKRSNDTLEAFV
FT                   IHMFQKGVTTAEIAHLMERMYGHHYTPQTISNMTKVMSEQVEAFRDRTLCARYACVYLD
FT                   ATYIALKRDTVSKEAVYIAVGIREDGSKEVLGYTIAPNESAFVWKELLEDIKSRGVEEI
FT                   LLFISDGLKGISDSVFSIYPASSYQTCCVHLSRTIAHKVRVSDRAEICEDFKSVYRAES
FT                   LEMGQQALHSFIEKWKSKYPKVTKPLLNNSYLFTFYSFPKSIWRSIYSTNLIESFNKQI
FT                   KKYSKRKEQFPNEESLERFLVSQFDQYNQRFATRCHIGFDQARAELQMMFKTN"
FT   gene            45451..46014
FT                   /locus_tag="BMQ_pBM60051"
FT   CDS             45451..46014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60051"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72483"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3V8"
FT                   /protein_id="ADE72483.1"
FT                   /translation="MKEKLHLGCGKTILKEWINLDIMKGQGVDIVADLEMCSEIPLPFE
FT                   DNSIDEFYASHLIEYIHFTLPLMQELHRIAKNDSKAVFRLQYGLSDDAYVMRPYFIDSF
FT                   ACFSQPYYWRADYGYKGDWKTEKISLFVSQAVYKKKSFHEIYEDVMRKRNVVSEMVVEL
FT                   RAIKPIRATKKELQTRPFIEFLMV"
FT   gene            46559..47902
FT                   /locus_tag="BMQ_pBM60052"
FT   CDS             46559..47902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60052"
FT                   /product="FAD binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60052"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72484"
FT                   /db_xref="GOA:D5E3V9"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3V9"
FT                   /protein_id="ADE72484.1"
FT                   /translation="MGSTHLTGRVIFKGDPGYEEAIKNWNPYVDVCPLVFVFAQDSQDV
FT                   SNAIKWARENKVPLRVRSGRHALDKNLSVVKGGVVIDVSDMQKVSLDRKNAIATVQTGI
FT                   HVGPLVKGLAREGFMAPFGDSPTVGIGGITMGGGFGVLSRSIGLISDNLLALETVDAKG
FT                   KIIQADQSSNEDLLWASRGGGGGNFGYNTEYTFKVHRAPKTATVFNIIWPWEQLETVFK
FT                   AWQQWAPFVDERLGCLLEIYSKVNGLCHAEGIFLGTETELIRLLKPLLNAGTPTETTIE
FT                   TLSYPDAIDFLDPDEPIPGRSDQSVKFSSAWALDLWSEEPISIMKQFLEEATGTESNFF
FT                   FINWGGALSRVPSNETAFFWRSPLFYTEWTASWENKSQKDSSIASVERVRQQLKSYVTG
FT                   SYVNVPDQNIKKYGKAYYGSNYERLRKIKAKYDPENVFRFPQSIRPKF"
FT   gene            48368..49039
FT                   /locus_tag="BMQ_pBM60053"
FT   CDS             48368..49039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60053"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72485"
FT                   /db_xref="GOA:D5E3W0"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3W0"
FT                   /protein_id="ADE72485.1"
FT                   /translation="MEKKLIIFIHIPKTGGTTLNDIFKKLYAENEIYDHVPVEAMNKHF
FT                   SQLKEEEKKTLKAISGHHFYGIHDLFSKSYTYFTMMRNPIERVISLYYFLKTYPGYYQE
FT                   NMRNMSFEDYLDWDPQAKNGQTQQICGIHSQISLEKAKENLKTFEVVGITEMFNESLLL
FT                   LKNKLGWNDIAYKRKNITKSRPLLQEVPTEIIKKIEKNNELDIELFEYIKSNFIRQLKD
FT                   F"
FT   gene            complement(49127..49633)
FT                   /locus_tag="BMQ_pBM60054"
FT   CDS             complement(49127..49633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60054"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72486"
FT                   /db_xref="GOA:D5E3W1"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3W1"
FT                   /protein_id="ADE72486.1"
FT                   /translation="MLPIQRKCPFFVYFSFLIFFTCFSEIAFTHFVTLVSFSTATKRNF
FT                   LCSSTGISQVRRRFPSLTLLIRSSFQTTYLICNVAYNLILEDIITIVNDKNRHIYFRQY
FT                   NPHFRKQKSHVLKKRTWLRKMKRSYNTLYRLYKYVVLDNNLILINKIRFLEKTTQAAAK
FT                   HQPMW"
FT   gene            49544..49657
FT                   /locus_tag="BMQ_pBM60055"
FT   CDS             49544..49657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60055"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72487"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3W2"
FT                   /protein_id="ADE72487.1"
FT                   /translation="MSKSNFRKTCKENKKRKVNKERALPLDRKHPMSKLKY"
FT   gene            49881..50054
FT                   /locus_tag="BMQ_pBM60056"
FT   CDS             49881..50054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60056"
FT                   /product="LuxR-type HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60056"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72488"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3W3"
FT                   /protein_id="ADE72488.1"
FT                   /translation="MDGYSGQEMQLLLSKGETTINSKRQNIVCKLDVSSMKEAVEKFQH
FT                   LEYESPRKLLQS"
FT   gene            50336..50485
FT                   /locus_tag="BMQ_pBM60057"
FT   CDS             50336..50485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60057"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72489"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3W4"
FT                   /protein_id="ADE72489.1"
FT                   /translation="MCLIVVKNLDDLAKRKGPSRQAFLKEQLETLSIVEEEAKREQAID
FT                   DLYD"
FT   gene            complement(50820..51482)
FT                   /locus_tag="BMQ_pBM60058"
FT   CDS             complement(50820..51482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60058"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72490"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3W5"
FT                   /protein_id="ADE72490.1"
FT                   /translation="MDIKQDAINAEEMAKRLNTTSSNIRKWCIELEKHGYKFVKDNRKK
FT                   RYYSVTDQTLLSNLKYAIQEKKLPLEIASMAVIKGFDRNHSSSSTQEEHLFNEENNREL
FT                   NVPQEHENYTKDVVLDTLKQQQSANNKLLEMLDHYKNALKISERRRQTEQEQTSKQLKE
FT                   LEERLAERISQQINNRDKEMMDYIRQSQRQNQQQLLEIVATKEKEQQKSFFARLFGK"
FT   gene            complement(52463..53218)
FT                   /locus_tag="BMQ_pBM60059"
FT   CDS             complement(52463..53218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60059"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72491"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3W6"
FT                   /protein_id="ADE72491.1"
FT                   /translation="MVSWSNQILKIRPDQQYQNNLQVNVYGIFTAGSKPSDFNGRQKRF
FT                   NRDINLANQIWNGGGMCNINFIPQPVFEMKTIIDVTNLGFQAAMEGPVKGLIKKVKHKI
FT                   GNPIGIYVVYTSGNDFAFSSGSTSPIGAGGVIIEDFRIKDGIPKFTLFGSIALSNRALN
FT                   APFTFAHEAGHVLLTELDKQPFNNIFKFNAIDPTGPFINPVTGKSDIAHSNLVGNLMAP
FT                   VLPNIIPTINPLQLQKARMSRIFQNAIIK"
FT   gene            53778..54029
FT                   /locus_tag="BMQ_pBM60060"
FT   CDS             53778..54029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60060"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72492"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3W7"
FT                   /protein_id="ADE72492.1"
FT                   /translation="MGDKTKDVLSIEIKIIDGRNYTIKDKQSIYDIEEQLIGNKELHLG
FT                   RFLSVAPDKPSLDKQRKFEHMYFNINHILSIKYLKKFD"
FT   gene            complement(54623..55999)
FT                   /locus_tag="BMQ_pBM60061"
FT   CDS             complement(54623..55999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60061"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60061"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72493"
FT                   /db_xref="GOA:D5E3W8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3W8"
FT                   /protein_id="ADE72493.1"
FT                   /translation="MIKIDFYGHYYNPHNGKYYKKGKYYRKKGENNQNKLRENKSEINQ
FT                   VHNLDNSLYKMSIKNNHNHPIKVSIIMPTYNKYNQISLSLYGLSKQTFPDSDYEVILVD
FT                   DASSDKTRDILKEIDVPFKFKYIRMKKNKGRSFVRNIGIKHSEGDVLIFLDGEMLVTPH
FT                   FIQNHYKHHLQETNLVVTGAMHYEGVYTFIMPDYNEDQLAHLKDLVRKDPKYMEIYESY
FT                   ERTRHKSKKPYPLVTIEDIDTERFQSLSFSNRYFLNSGLKHFGERLKGFTLPYIAFLSG
FT                   NVSVRKEELNKSGYFDETFVGYGAEDWEIGYRLYKNGAQFVLDPSTVAYHQEHPISKKK
FT                   LKEQWGNHYRFVKKHPNIDVLILSLEWKELSFMHMHQTLVEYNALDERFPNEYNELKKA
FT                   FRVMLFRIIECLNNEQPVTELYKLPEGSEERLKIHQQFETLRPRGFDYLASSFEQIYHL
FT                   "
FT   gene            57004..57222
FT                   /locus_tag="BMQ_pBM60062"
FT   CDS             57004..57222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60062"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72494"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3W9"
FT                   /protein_id="ADE72494.1"
FT                   /translation="MWDKDTTANGPAMGGLRQFILKGTHTFLRRGRGSDVPNLPDLINM
FT                   YAIYSLRIEKLMGLISGFSAYRKVVSK"
FT   gene            complement(57459..58190)
FT                   /locus_tag="BMQ_pBM60063"
FT   CDS             complement(57459..58190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60063"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72495"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3X0"
FT                   /protein_id="ADE72495.1"
FT                   /translation="MPINIQPILISMELILQDVLKTNFVPPRYPTAFKEIAIPVPTPPG
FT                   ITNLPAFIYFDLDNQFTLTQEQDIKDAISLVLFNWFHHLSQKWNDGANNGISDLAACNK
FT                   VYAIRNLQPAWYIGPRIPNGLVATNVAMDQFTRLIRDNGLRLAPKAKIFAGSLDNDSLA
FT                   LALTALNRTKVPLSFIVDLSKISNIGINTGSIMHAWLHRAGFYAPNTTSYFITECSMCV
FT                   MRDYELKNLFLPDSAFYRFFS"
FT   gene            complement(58855..59190)
FT                   /locus_tag="BMQ_pBM60064"
FT   CDS             complement(58855..59190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60064"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60064"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72496"
FT                   /db_xref="GOA:D5E3X1"
FT                   /db_xref="InterPro:IPR005530"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3X1"
FT                   /protein_id="ADE72496.1"
FT                   /translation="MKIRGNLNALIGVWFIIAPWAIGFSDQSGALWSSTIFGIIQVIVS
FT                   LWGYDKPGWNSWQNWISTITGVWFAIFPFIYSLTNGELWSSVILGLITIIFSLWSLGSN
FT                   SGSKAVD"
FT   gene            59529..59873
FT                   /locus_tag="BMQ_pBM60065"
FT   CDS             59529..59873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60065"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72497"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3X2"
FT                   /protein_id="ADE72497.1"
FT                   /translation="MEAEINSLCTPIPGQKRRSSRNFSLFHLPANKKVKVVVERKYQGI
FT                   SFTFDVMSDDLNSTDHVIWHNVGNGSILKMPDLIRQSKGLYIANPSISSTVGFTDLVRE
FT                   TFKVKFYTLE"
FT   gene            complement(60534..61715)
FT                   /locus_tag="BMQ_pBM60066"
FT   CDS             complement(60534..61715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60066"
FT                   /product="transposase, mutator family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60066"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72498"
FT                   /db_xref="GOA:D5E3X3"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3X3"
FT                   /protein_id="ADE72498.1"
FT                   /translation="MNQFTTDLVQALVQKEDVTEIFRSHLENAVNTLLASELTAFLDYE
FT                   KYDRIGFNTGNSRNGSYERTLHTEFGELHLVIPRDRNGDFKQQTVAPYKRANDTLEAFV
FT                   IHMFQKGVTTAEIAHLMERMYGHHYTPQTISNMTKVMSEQVEAFRDRTLCARYACVYLD
FT                   ATYIALKRDTVSKEAVYIAVGIREDGSKEVLGYTIAPNESAFVWKELLEDIKSRGVEEI
FT                   LLFISDGLKGISDSVFSIYPASSYQTCCVHLSWTIAHKVRVSDRAEICEDFKSVYRAES
FT                   LEMGQQALHSFIEKWKSKYPKVTKPLLNNSYLFTFYSFPKSIWRSIYSTNLIESFNKQI
FT                   KKYSKRKEQFPNEESLERFLVSQFDQYNQRFATRCHIGFDQARAELQMMFKTN"
FT   gene            62177..62395
FT                   /locus_tag="BMQ_pBM60067"
FT   CDS             62177..62395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60067"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72499"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3X4"
FT                   /protein_id="ADE72499.1"
FT                   /translation="MSRDHKCVCDQLERLQPGTQVDVFLNGNLLEDLIFTNFNLDTFCA
FT                   TFVEVGEETGGNIIVLDCRDIQALRIE"
FT   gene            62514..62819
FT                   /locus_tag="BMQ_pBM60068"
FT   CDS             62514..62819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60068"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60068"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72500"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3X5"
FT                   /protein_id="ADE72500.1"
FT                   /translation="MSIFVNRFTDPKVFNSNSIADDHNQKVYHIDLNSKYNSKSVCSLL
FT                   ETFYQGKKVKNLLVNGTQIRVQNFVGFNPKTGLATFWGKNDGILLVDCERIDAITL"
FT   gene            62855..63082
FT                   /locus_tag="BMQ_pBM60069"
FT   CDS             62855..63082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60069"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72501"
FT                   /db_xref="GOA:D5E3X6"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3X6"
FT                   /protein_id="ADE72501.1"
FT                   /translation="MLISEDNPYFNIVYRGLITAIFISPYHLYKYKVTLQTSIEFTILL
FT                   CIFFSATKRLHKNRSLFKIVNRRIIKIKKV"
FT   gene            63431..63643
FT                   /locus_tag="BMQ_pBM60070"
FT   CDS             63431..63643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60070"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72502"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3X7"
FT                   /protein_id="ADE72502.1"
FT                   /translation="MITDLLRILDPGTPVPTLVVGGATLTNLVFSSFNATTNLASFATR
FT                   TGTGTNASTNIVTVNANQILAITTA"
FT   gene            63902..64225
FT                   /locus_tag="BMQ_pBM60071"
FT   CDS             63902..64225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60071"
FT                   /product="transposase, orfA, IS3 family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60071"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72503"
FT                   /db_xref="GOA:D5E3X8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3X8"
FT                   /protein_id="ADE72503.1"
FT                   /translation="MGKRVSYPVEVKLKAIEMRLAGVPVKEVMETLQIRNHTQLKTWMR
FT                   WHRNGESYRLAQPVGQTYTHRKGPHSQDTPSKLQAENRYLKQQIEVLKKYKELEREWYQ
FT                   KLY"
FT   gene            64204..65058
FT                   /locus_tag="BMQ_pBM60072"
FT   CDS             64204..65058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60072"
FT                   /product="transposase, orfB, IS3 family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60072"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72504"
FT                   /db_xref="GOA:D5E3X9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3X9"
FT                   /protein_id="ADE72504.1"
FT                   /translation="MVPEVVLKLVEELKEKLPISQICQCLGIPRSTYYRWQKNEQGEET
FT                   KRKKWIERKVGEQCRKHKFRYGYRKITALLNQTMHINHKVVQRIMQKYGWQCRVKRKKR
FT                   KQTGQPYQVAENVLNRNFRAERPLQKLVTDITYLPFGPKQLYLSSIQDLFNGEIIAYSV
FT                   SDCQNVEFVLDTLSQLPPLPEGCTLHSDQGSVYTSYAYQRKVKERGIIMSMSRKGTPAD
FT                   NASIESFHSSLKSETFYLDELTCTTTAIVEQTVESYITYYNHIRIQTKLNNQSPVQYRQ
FT                   LAV"
FT   gene            65856..66899
FT                   /locus_tag="BMQ_pBM60073"
FT   CDS             65856..66899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60073"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60073"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72505"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Y0"
FT                   /protein_id="ADE72505.1"
FT                   /translation="MNYYVYVPYYPLMHLYQPADHKYRNPYPVDIYYTHPNYFDYRFYA
FT                   GPTYYESEYQIDKRIVRKEKDGPDLETSSYHETDFETSSYREADLEASSCHEVDLETSS
FT                   YREADLETSSYREADLETSSYRETDFETSSYREADLEASSYHDPDLETSSYREVDLETS
FT                   SYREADLEASSYHDPDLETSSYREADLEASSCHEVDLETSSYREADLEASSYRETDLET
FT                   SSYRETDFETSSYREADLETSSYRETDLETSSYHEADLETSSYRETDLETSSYHEADLE
FT                   TSSYHEADLETSSYRETDLETSSYRETDLETSSYHESLLDNLHKDGPYGDITVAYSFKN
FT                   DITNGTK"
FT   gene            complement(67018..67164)
FT                   /locus_tag="BMQ_pBM60074"
FT   CDS             complement(67018..67164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60074"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72506"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Y1"
FT                   /protein_id="ADE72506.1"
FT                   /translation="MLTKHVYHIQLKNRKDIGKFLVNAFSIYEWNYLKTLSNDNMLFKT
FT                   YDK"
FT   gene            complement(67215..68090)
FT                   /locus_tag="BMQ_pBM60075"
FT   CDS             complement(67215..68090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60075"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60075"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72507"
FT                   /db_xref="InterPro:IPR011094"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Y2"
FT                   /protein_id="ADE72507.1"
FT                   /translation="MRNMDNQPSKLCREFARILDSTPSVINSVCTATKSRTNLHPVVLG
FT                   RSAESFMFVPQAFSFEDVDRNGRALCLGETVILQEEINPFMSKLREHGIIVTAVHNHWL
FT                   FDEPRLMYMHFESIDQPLSFARKVRDALCVLTTRNVYPDCRSITSDFSNSSNLCDRFNN
FT                   ILGGSMHTFENGICTVMKSRTNIHPEVLGRRGRSFLLIPQMFTFESMTGDGQALCSGET
FT                   VILQTEINPFITKLREQGIIITAVHNHWLFDEPRLMYMHFESVDQPLSFARKVKDALSV
FT                   LTTRQVYPKE"
FT   gene            68379..69116
FT                   /locus_tag="BMQ_pBM60076"
FT   CDS             68379..69116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60076"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72508"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Y3"
FT                   /protein_id="ADE72508.1"
FT                   /translation="MPFNFKKTLIVMELIFQDMLKTNFVIPLYPTTFRETIIPVPTPSG
FT                   VTDLPPNIYFDLDNRFNAEQEQRIRDAISETMLVWATHMNEKWNGGTNNGISQMAACTN
FT                   IYATKNLRPAWYSESPIQNGLTATNIAMDQFTQLIRDNGFRRSPRAKIFAAPLNNNTIV
FT                   FALTAFTQNFVPLSFIVDPTLIDIATLNFITGSMMHSWLHCAGFFDPNTTSYFNTECSM
FT                   CVMRGFRPKNPDMPDNLYYQFFD"
FT   gene            complement(69263..69430)
FT                   /locus_tag="BMQ_pBM60077"
FT   CDS             complement(69263..69430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60077"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72509"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Y4"
FT                   /protein_id="ADE72509.1"
FT                   /translation="MYRKRKNLLFPTNSFFFNPVAIKCPLIEEWEANYMMRNNEKNIMQ
FT                   AIKKYHNWWR"
FT   gene            70206..70598
FT                   /locus_tag="BMQ_pBM60078"
FT   CDS             70206..70598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60078"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72510"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Y5"
FT                   /protein_id="ADE72510.1"
FT                   /translation="MKTEKGDKYTENEELKLKFENVIAIGVWIKTIGQIIETIGVSNLF
FT                   LINEDPSSGDEKVVSAVWIETVGQFLQTIGVSQQVSAINEQVTFKAQELEIIGVSLKSF
FT                   AHALEAIGGIEILQEEKQTDIMDFIP"
FT   gene            complement(70664..71371)
FT                   /locus_tag="BMQ_pBM60079"
FT   CDS             complement(70664..71371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60079"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72511"
FT                   /db_xref="GOA:D5E3Y6"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Y6"
FT                   /protein_id="ADE72511.1"
FT                   /translation="MDFFYSQESLTAIQWILRAVISFFFLLIVTKIMGQRSLSQLRLLD
FT                   FIMALSIGNIIAHPLSDQHLGMKGSMITIGVLVILYLIMVFLSLKWLKFTKFVDPSPFP
FT                   LIKNGEIFYKGLTKARIPIDVLLTELRKKQIHDIQQVALALWESDGTISFFLESQYQTL
FT                   TPKDMKLMTKSFSFPITIIKDGKIDFEELKQTGKDEDWLKNQIRTVHSLDMKNILLATM
FT                   DDNNDKINVFLYK"
FT   gene            complement(71784..71990)
FT                   /locus_tag="BMQ_pBM60080"
FT   CDS             complement(71784..71990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60080"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72512"
FT                   /db_xref="GOA:D5E3Y7"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Y7"
FT                   /protein_id="ADE72512.1"
FT                   /translation="MQPNSIESEPYWKSRRMLTSIVYSMQSNEKSLNSPSLYLMFLLSF
FT                   YFLSIKPILKIEKITVARTVIFL"
FT   gene            72083..72763
FT                   /locus_tag="BMQ_pBM60081"
FT   CDS             72083..72763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60081"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72513"
FT                   /db_xref="InterPro:IPR014903"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Y8"
FT                   /protein_id="ADE72513.1"
FT                   /translation="MNLQDTKGSYDAVFSLGSACNPAIQFQRLNLKRFTSSPLDWNYSP
FT                   FLSDVNRLLKNKFNGFMELKNMRVINDKGVSMYAEEGVFVFPHKGLHKPIKSYLVLDTI
FT                   YNIFSAHDFPIIPNRNWFVTYPSFKKTLNYRIDRFLDKVKNSPSILFVRWVANYQEAVE
FT                   LESTLSQITKGNFKVLILNPVEGLQGVSEVNWGLSRTCVVNVPNDPNSNVTWDYVLNGV
FT                   TLTN"
FT   gene            complement(73016..73186)
FT                   /locus_tag="BMQ_pBM60082"
FT   CDS             complement(73016..73186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60082"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72514"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Y9"
FT                   /protein_id="ADE72514.1"
FT                   /translation="MHLLDLYRKTEKTTVAQTVVFFESDRGSKTLIEDRMMKLKCSIYN
FT                   MKKDYRCADEC"
FT   gene            complement(73526..74398)
FT                   /locus_tag="BMQ_pBM60083"
FT   CDS             complement(73526..74398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60083"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60083"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72515"
FT                   /db_xref="GOA:D5E3Z0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Z0"
FT                   /protein_id="ADE72515.1"
FT                   /translation="MDLLRNMNRALHYIEENLTKDIDFREVAKLALCSEYHFKRMFSFL
FT                   AGITLSEYIRRRRLTLAAFELKDNKMKIIEIAIKYGYNSPDSFTRAFQNLHGLTPSEAK
FT                   KNGYSLKAYPQMTFQLSIKGGNEMNYRIEEKEAFHIVGIKERVPIIFHGVNPKIAAMWE
FT                   SLSDETINKLKKLSNVNPLGLLSASVNFSEGRMEEKGELDHYICVATTKECPNNLIQLE
FT                   VPALTWAVFEAVGPFPDTLQDVWGRIYSEWFPSSNYEQVEGPEILWNEHKDVTSPTFKS
FT                   EIWIPVLKK"
FT   gene            74808..75017
FT                   /locus_tag="BMQ_pBM60084"
FT   CDS             74808..75017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60084"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72516"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Z1"
FT                   /protein_id="ADE72516.1"
FT                   /translation="MYNHYQPEVNPNDLQHFYQYDSFYRQQQPQYYQQPYHHPRPPRCR
FT                   WVQECRWVRRCYPRDGFYTDGYDY"
FT   gene            complement(75386..75526)
FT                   /locus_tag="BMQ_pBM60085"
FT   CDS             complement(75386..75526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60085"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72517"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Z2"
FT                   /protein_id="ADE72517.1"
FT                   /translation="MELGKPYVICISSRMTAKSNDVAEGKGYERKQMPLSRKGTGKQET
FT                   V"
FT   gene            complement(75829..76218)
FT                   /locus_tag="BMQ_pBM60086"
FT   CDS             complement(75829..76218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60086"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60086"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72518"
FT                   /db_xref="GOA:D5E3Z3"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Z3"
FT                   /protein_id="ADE72518.1"
FT                   /translation="MNLIEVYIHEVTRRLPEKNREDIALELHSTIEDMLPDDYSEEDVK
FT                   ECLKKMGNPAILASGYRDQPMHLIGPLYYDVYVTLLKMILPIAAIISLISMIAEYFIGY
FT                   HGEEAVINVVLDIVGFGIWRIIQCS"
FT   gene            complement(76205..76552)
FT                   /locus_tag="BMQ_pBM60087"
FT   CDS             complement(76205..76552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60087"
FT                   /product="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60087"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72519"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Z4"
FT                   /protein_id="ADE72519.1"
FT                   /translation="MSTLLNSLTTELRRGTLTLAVLSQLRTPQYGYSLVQLLEKSGIVI
FT                   DQSTLYPLLRRLEKQELVTSSWDKSESRPRKYYVLSEYGLEVFLHLKKEWIDNSKELYR
FT                   LLKEEEENEPN"
FT   gene            77803..78549
FT                   /locus_tag="BMQ_pBM60088"
FT   CDS             77803..78549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60088"
FT                   /product="YqcI/YcgG family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60088"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72520"
FT                   /db_xref="InterPro:IPR014988"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Z5"
FT                   /protein_id="ADE72520.1"
FT                   /translation="MRLFKDIEKVNQIDFLPWQNDALKAFSAKMKDREYLFPCIPAIQS
FT                   FSLGHLRYGFIGHPESNQTSIELASLLKEFTINCNEYGKYTTLIIFFETPQNLITNRTV
FT                   EDFELLFWKQLSNLNKLDEKGWPIHIPRNPSEHEWEYCFHGEQYFMYCATPKHEKRKSR
FT                   YFPYMMMAITPRWVLQEFNKNKRYAKKIKEQVRERIKKYDNISTHSALNSYGNIDNHEW
FT                   KQYFLRDDNTELPKCPFLRSLVDKED"
FT   gene            complement(78794..79132)
FT                   /locus_tag="BMQ_pBM60089"
FT   CDS             complement(78794..79132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60089"
FT                   /product="antibiotic biosynthesis monooxygenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60089"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72521"
FT                   /db_xref="GOA:D5E3Z6"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Z6"
FT                   /protein_id="ADE72521.1"
FT                   /translation="MPKIEENQLFTVIIEWEVNPKYQQELINGLSNQIETYFKGYDGFI
FT                   SSSFHASEDGKRVINYAQWISREAWSNSFQALGRDEVQTTNDEIISSCEAETLKLNCYR
FT                   VARVIENI"
FT   gene            79238..79798
FT                   /locus_tag="BMQ_pBM60090"
FT   CDS             79238..79798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60090"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72522"
FT                   /db_xref="GOA:D5E3Z7"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Z7"
FT                   /protein_id="ADE72522.1"
FT                   /translation="MYRFLYFEQTTHDVTKHRPNNKCSRKTTFPTSEVVFLFLRCIWYT
FT                   CLVKSGKLRASLPLSPLRPVQVPFKTHRLKPPIVGPFAVVSSSHTISVSKTYADAPTGG
FT                   IHNSTFLSSEDSHNLMFLRETNEKSAPFQAYHGFVRKGDSIHPVIQFPAFLFSFEIMVF
FT                   AFSRILYPLPHRLTLQSSYCLHR"
FT   gene            complement(79977..80123)
FT                   /locus_tag="BMQ_pBM60091"
FT   CDS             complement(79977..80123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60091"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72523"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Z8"
FT                   /protein_id="ADE72523.1"
FT                   /translation="MAYATGLAAKTIPVQNCGPGNGLVGFMRKQRVSARLGTLLGEDEY
FT                   GEH"
FT   gene            80292..80588
FT                   /locus_tag="BMQ_pBM60092"
FT   CDS             80292..80588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60092"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72524"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Z9"
FT                   /protein_id="ADE72524.1"
FT                   /translation="MITIKKYDCDHKKESKCQPKNKKQKREKTCIHINIYNHAETGGQI
FT                   SGNGGQNANQGGQIAHTGGQNANQDSVVIKECGKKNKNTKVKKINFEDEMKEE"
FT   gene            complement(80930..81058)
FT                   /locus_tag="BMQ_pBM60093"
FT   CDS             complement(80930..81058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60093"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72525"
FT                   /db_xref="GOA:D5E400"
FT                   /db_xref="InterPro:IPR010070"
FT                   /db_xref="UniProtKB/TrEMBL:D5E400"
FT                   /protein_id="ADE72525.1"
FT                   /translation="MSKDATCGFGSSFALIVVLFILLIIIGCCSYGHGHGGRHGYC"
FT   gene            81651..82085
FT                   /locus_tag="BMQ_pBM60094"
FT   CDS             81651..82085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60094"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72526"
FT                   /db_xref="UniProtKB/TrEMBL:D5E401"
FT                   /protein_id="ADE72526.1"
FT                   /translation="MTRLLDARTSQNASIANSISIPITILSAPGLFGQVGLNVAGATGP
FT                   IRTQLSGTVACQLPLLPLATTITLTIVRGRLLTDPVIYSSSESLNINLLGPQLFTFTAS
FT                   DFNVPPPASGLLIYTAFIGSNILGTVRVGPESFNAIAYSD"
FT   gene            83432..84914
FT                   /pseudo
FT                   /locus_tag="BMQ_pBM60095"
FT   CDS             83432..84914
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60095"
FT                   /note="putative transposase, frameshift"
FT   gene            complement(86045..86236)
FT                   /locus_tag="BMQ_pBM60096"
FT   CDS             complement(86045..86236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60096"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72527"
FT                   /db_xref="UniProtKB/TrEMBL:D5E402"
FT                   /protein_id="ADE72527.1"
FT                   /translation="MLAFVPAPVLVAKEAKLVVALKLENVILVSVALPMIKVGTGIPGS
FT                   KILNKALIPLCIPLTAVN"
FT   gene            86440..87189
FT                   /locus_tag="BMQ_pBM60097"
FT   CDS             86440..87189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60097"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72528"
FT                   /db_xref="UniProtKB/TrEMBL:D5E403"
FT                   /protein_id="ADE72528.1"
FT                   /translation="MFHNIKRTLIIMKLILQDVLQINSLAPPYSSTFTKIAFPVPEPPG
FT                   VSNLPLFIYFDIDNRFTLAQQQWIRDAINGVLFQWFQHLTEKWNGGSNNGISQLATCTN
FT                   LYATRNSRPTWYLSLPISNGLAATNIAMDQFTRLIRDNGFGLAPQAKIFSNILFPANSS
FT                   TIFALTTLAQSQVPLSFIVNPAQLDSPGLNIKFLTGSMFHAWLHRAGFYHPKKSSHFIV
FT                   ECPMCIMRGFQIKRTITPDSFYIQFLD"
FT   gene            87357..87500
FT                   /locus_tag="BMQ_pBM60098"
FT   CDS             87357..87500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60098"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72529"
FT                   /db_xref="UniProtKB/TrEMBL:D5E404"
FT                   /protein_id="ADE72529.1"
FT                   /translation="MSEYHEKKHEHKNNCQSILQKAFEKLLKDIFEDDHKKTHHCGCHN
FT                   KD"
FT   gene            87756..88079
FT                   /locus_tag="BMQ_pBM60099"
FT   CDS             87756..88079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60099"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72530"
FT                   /db_xref="UniProtKB/TrEMBL:D5E405"
FT                   /protein_id="ADE72530.1"
FT                   /translation="MNDEEFNFNTRTQFKFITNNHTLGYILSGIAQKGININDYSQTKI
FT                   NVNENLIRLVVGGTGAETIDVLRCVRNIFRMLDIKFSEKDIIQIESIASNATRQINTLF
FT                   GSL"
FT   gene            complement(88275..88400)
FT                   /locus_tag="BMQ_pBM60100"
FT   CDS             complement(88275..88400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60100"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72531"
FT                   /db_xref="UniProtKB/TrEMBL:D5E406"
FT                   /protein_id="ADE72531.1"
FT                   /translation="MFYKQNEKPIDNSENFSFSHQTSVNEKRNPEYEPTFLNPSL"
FT   gene            88846..89169
FT                   /locus_tag="BMQ_pBM60101"
FT   CDS             88846..89169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60101"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60101"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72532"
FT                   /db_xref="GOA:D5E407"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5E407"
FT                   /protein_id="ADE72532.1"
FT                   /translation="MGRRVSYPVEVKLKAIEMRLAGVPIKEVMETLQIRNYTQLKTWMR
FT                   WHRNGESYRLAQPVGQTYTPRKGAHSQDTPSKLEAENRYLKQQIEVLKKDKELEREWYQ
FT                   KLY"
FT   gene            89148..90002
FT                   /locus_tag="BMQ_pBM60102"
FT   CDS             89148..90002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60102"
FT                   /product="Integrase core domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60102"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72533"
FT                   /db_xref="GOA:D5E408"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5E408"
FT                   /protein_id="ADE72533.1"
FT                   /translation="MVPEVVLNLVEELKEKLPISQICQCLGIPRSTYYRWQKNEQGEET
FT                   KRKKWIEGKVGEQCLKHKFRYGYRKITALLNQTMHINHKTVQRVMQKYGWQCRVKRKKR
FT                   KQTGQPYQVAENVLNRNFRAERPLQKLVTDITYLPFGPKQLYLSSIQDLFNGEIIAYSV
FT                   SDCQNVEFVLDTLSQLPSLPQGCTLHSDQGSVYTSYAYQRKVKERGIIMSMSRKGTPAD
FT                   NASIESFHSSLKSETFYLDELTCTTTAIVEQTVESYITYYNHIRIQTKLNNQSPVQYRQ
FT                   LAV"
FT   gene            complement(90199..91428)
FT                   /locus_tag="BMQ_pBM60103"
FT   CDS             complement(90199..91428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60103"
FT                   /product="ATP-grasp domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60103"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72534"
FT                   /db_xref="GOA:D5E409"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:D5E409"
FT                   /protein_id="ADE72534.1"
FT                   /translation="MDTIVFIETNKSGSSREAIKAANNLNFFTVLLTCRKKFLKDRNEF
FT                   PDVHEMIFTDINDYDNLITIIEKFKKTGKNIKGIFSFIDPFVYVAARLSEKFCKSDISA
FT                   DAIYHMEDKILTRNVLKKLPISLNYLIYKPTELLSSFLKTKEINFPLIVKSPKSTGSKD
FT                   VLLAKDESELISSMHTLLKKLPNEEILLEEYVDGPQYLVEVLVHNEKVHIIAVIEQEIT
FT                   LFERFIVTGYSLLGNLNNSLFHSLFNAVSSIIQAFGMKNGACHLELRRATEGWKLIEIN
FT                   PRISGGAMNRMIEIGHGINLVQETMQLMMGNEPSLTKKDYKYVYAHYLTVESKGKLIQV
FT                   TGKERSSNYRGIEEVYIKPKKGAILQPPTSMGHRYGYILASSYYKETAKRRALEAAEEI
FT                   SFKIATTDLT"
FT   gene            91519..92604
FT                   /locus_tag="BMQ_pBM60104"
FT   CDS             91519..92604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60104"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72535"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:D5E410"
FT                   /protein_id="ADE72535.1"
FT                   /translation="MNLVNIPKQVRVEERMIAMASIGMLHHRKDPINVRKAYAFAAVAK
FT                   AEGIDFFYFTPGKVHLEKRTILGKTYEKGKWIEKRYPYPDVIYNASPPISDKASEIVDE
FT                   LRKVIPFTSHSVGDKLTVYNKVNKAKKFDQYLIPTSELTNYKVLLNMAERYTKIIVKPL
FT                   SGHKGAGIFYIEKLGDSYKVSKDEQDSIFSENQLIKFIDNHIKQDTYLVQKFITCRTKL
FT                   GNVYDFRLHVQKGGNGNWLITAIYPRIGKIGSIASNLGNGGYTCFPDIFLKQEFGDNYY
FT                   NVQKYLEQFALNFSNHFESLYQDVLFDELGIDVGLDEKSRLWLFEVNWRPGPPIIVNVE
FT                   LDVVRNTLQYAQYLANKNKKY"
FT   gene            93733..94425
FT                   /locus_tag="BMQ_pBM60105"
FT   CDS             93733..94425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60105"
FT                   /product="putative papain-like cysteine peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60105"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72536"
FT                   /db_xref="InterPro:IPR014903"
FT                   /db_xref="UniProtKB/TrEMBL:D5E411"
FT                   /protein_id="ADE72536.1"
FT                   /translation="MNLQTLRGSYNLIAGLGSWCGPALYSERHNLRRHSFPLDWVQTPF
FT                   LSDVNRLLKNKFQGFMELGNMIEKDILANYIDDNGYPIFKFGTHESVRAHYITDTQYNI
FT                   DSVHDFPIIPDQEWVLQYPSYKIRLNHRIQTFLNQIAQSQRTLFIRHEWMPTSYEDIVI
FT                   LKSILAEMTNGNFNILLIETVDDDLQGVKDMNFGTPQDGICWVQISRKNCTNPSIWNVL
FT                   LEGITLID"
FT   gene            complement(94785..94898)
FT                   /locus_tag="BMQ_pBM60106"
FT   CDS             complement(94785..94898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60106"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72537"
FT                   /db_xref="UniProtKB/TrEMBL:D5E412"
FT                   /protein_id="ADE72537.1"
FT                   /translation="MTGDRAAFSRSQTVTSSKASCSCFTNKGSERLGFALY"
FT   gene            complement(95153..95395)
FT                   /locus_tag="BMQ_pBM60107"
FT   CDS             complement(95153..95395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60107"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72538"
FT                   /db_xref="UniProtKB/TrEMBL:D5E413"
FT                   /protein_id="ADE72538.1"
FT                   /translation="MQHIYKGQTFYTSSFHLDPEKNPLYQGCMKNCLVKKSILPENPCL
FT                   GEQGFFFVGDYKRGCNKKTTLVCQNELKLKIRYFI"
FT   gene            95536..96069
FT                   /locus_tag="BMQ_pBM60108"
FT   CDS             95536..96069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60108"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72539"
FT                   /db_xref="UniProtKB/TrEMBL:D5E414"
FT                   /protein_id="ADE72539.1"
FT                   /translation="MSSCKKRKVCCPTSCSSPEPLPKSCPAYGNFFNNTNLVTVLTGTA
FT                   FPFNIQGPISGGVSLLNPTTIFIENGGDYKVNFVITDNTVVFGPNPAAFPHLPTVGLFL
FT                   NNVQVSLEQANFGLEVTQAEGQGCKLIVGDTILSIPDNSILELRNITTQGPITTIITCD
FT                   SVGNNVQLSLFKLS"
FT   gene            96240..96362
FT                   /locus_tag="BMQ_pBM60109"
FT   CDS             96240..96362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60109"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72540"
FT                   /db_xref="UniProtKB/TrEMBL:D5E415"
FT                   /protein_id="ADE72540.1"
FT                   /translation="MDIKQNTINAEEMTKRLNTTSSNIRKWGIELEKHGYKFDQ"
FT   gene            complement(96655..97512)
FT                   /locus_tag="BMQ_pBM60110"
FT   CDS             complement(96655..97512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60110"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72541"
FT                   /db_xref="UniProtKB/TrEMBL:D5E416"
FT                   /protein_id="ADE72541.1"
FT                   /translation="MIKIVKKIKGNKDNYCFNPPTQPGLPPATTINLAVVGDSHVGFQN
FT                   SQNMFNTLLQRVVSNGNKRYIIFGGDDVHALGASSSQEAERYYQQFSHILNNVLGSNIF
FT                   HRTSIGNWEDIDRNNSRALFQQYLNPFLTGYVGIPGTRGLVRHVWLDNGRGGIFSQDSL
FT                   NLLRNLDPNYYYIIDFHWPLRVPGITTAILEDHVMSQAETDMFFNAIPPNVRNRILAIF
FT                   THHAHKFYSNSNNIHPGFPNTPFFVTGCSGDYACSSASRGYYDVDITIQNNMATLQATP
FT                   VRVQ"
FT   gene            complement(97825..98721)
FT                   /locus_tag="BMQ_pBM60111"
FT   CDS             complement(97825..98721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM60111"
FT                   /product="conserved phage domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM60111"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72542"
FT                   /db_xref="UniProtKB/TrEMBL:D5E417"
FT                   /protein_id="ADE72542.1"
FT                   /translation="MPITRMLTAEEFNYMKNYQSYTEDHSQHQSMKRKLLKEIISLYGD
FT                   KFYRLHDGTRKALDRLCWFGAEKGFCFPGSTYLGKTYEKSKGTIDRHLSELRKQGLIVT
FT                   VYRRCPRNNGKGNPVHLFVNHPYFKYWVNYLQLNLAKNVETDVEAEKDVIPCESKEEVS
FT                   KNSSTYNLSLKDLNKYIRKEDISVKLSPDYVPSFIPTPFKQAVAPFFRNADDIYNLWGK
FT                   VLLTYKISGLEKPIEDLVPIAVQGFRETLFAYKRKRIKTVFEAYFFGTLRGLFSAERRR
FT                   EVQQGSVNPLFYNFLEA"
XX
SQ   Sequence 99694 BP; 34155 A; 16756 C; 16115 G; 32668 T; 0 other;
     atgaagaaat caaatgtagt tcaaccatat gatctggaaa gcataaacat aaaaaactgg        60
     gtaacaaaat caaacatctt aattgagagt acatataagt tgtctttaca ggaacaaaga       120
     atccttttaa ttatggcgtc taaagttcag cctaatgacg aaacgttaaa gacatataga       180
     tttcgagcta aagattttat agaaattgta ggaaataaaa aaggtacagg tttttactca       240
     tacttaaagg aaattgtgaa tggtcttcaa acaaaaattc tcaccataaa agaaaaaggc       300
     aggcaaagaa attataactg ggttattacc tcgatctacg aagaaaatga aggatacata       360
     acattacaat ttcatcccag tctaaaatac ttatttttag agcttaagga aaaatttact       420
     tcgtaccagt tggaaaatgt tgtgaggctt aattctgtat attccattcg tatttatgaa       480
     ctgcttaagc aatacgaacg tttgagaaaa agagaactaa cccttgagga attacgtcat       540
     tttttagcta ttgaacctac taaatacaaa cagtatggcc attttaaaag caaagtatta       600
     gcagtagctc aaaaagaaat aaataataaa acagatatta actttgaatt tgttgaaata       660
     aaaacaggca gaaaagtaac ctctatagag tttatcatta ctagttcttc tgctttgaat       720
     ggtactagtt cttccaaaga gacgaaactt aaatcaaccc aatcttcatt agatttatta       780
     gataacgaaa aagaaaatgg attataccat gacctagtga gcttaggagt taagcctcaa       840
     aaaatcaagt gggttttatc agaatttgca aaagaacaag ttgaaagaaa tgtaaaatac       900
     acgcagggtc gtttagttat tggggatatt actcatccgc attcgtatgt aataaaagcc       960
     attcaaaaag actacgcgaa agtatcacaa gaatcaaaga ttgctacacc taaaaagtct      1020
     actagaaaag agttagttcc agattttatg atagaagctg aagataaaga aaaggctttt      1080
     gagaccctta cattaaagga aaaacaagaa ttgttttatg aagaaaatgg aaatcaaata      1140
     gaatttgaaa aaaggctttt acaatttcaa gaattaagaa aaatgttagt tttaaattcc      1200
     gaggagccca accaggaaga attaaaaaaa gcccaagaag cagcagtacg agaagtacta      1260
     cgaaatatga acgaggactt aagaaaacgt gaagaagtag gccttaagcc aaggctgata      1320
     aatgacttcg aaaataaaga actaagggaa atatatcgaa ccttcttgca taaacaagtt      1380
     taataaaaaa tagtgttatt agcacgcctt tatgggcgtg ttttaatgtt tttaaacgga      1440
     atttttttgt gcgaaaggta aatttaatat acaatataca ttatttaatc tagttagcgt      1500
     tttttaattt ttatatttat ctatagtata ttaaatttac caataatgga ggtgttttat      1560
     atggatattc ctcttcttgt tcaacatttc cttattcatt tacatgaaac agggaaaaaa      1620
     cattctacag tttccatgta taaacatgat ttgatggcgt tcttcaaatg gttaaatcaa      1680
     cactcccctg atataacgcc aggaatctta ccagaagaga aaagttgtta cgaagaatac      1740
     cttacctacc tgaaagaaaa aaacttatca gaggccaatt taaggcgtgt ggcttcccat      1800
     ctgaacagat tgttagaata tcataatttg acggatcaat ttggagcgct taaagctaca      1860
     acaaaaaagc agagggattt agttgatagt gactttataa ctgaaaagga taccttttcg      1920
     cttttaaact ctgttgtcag taaaaaaaat ctgacagaaa ctcaattgca aatacataaa      1980
     tatatagctc ctcgtaatta ttcaattttg attctaatgc ttcattacgg ccttacactt      2040
     aatgaagtgg tatctttaaa tataaacgat attaacttta gccaaaatga attaactatt      2100
     ataactaaca aaggaaagcg tgttttagag ctttctaaag atgataaaaa aataatatat      2160
     aattactttt cagacatacc ctccctattt aaacctaaag attatacaga cgacccttta      2220
     tttctttctt ttcaccctca aaaaaaggtt tattggtacg attataattt aaacaaacct      2280
     aaaagaatta gtctaattgg tgtaaagcgt atgattgaaa aggaagttga acgctcaggt      2340
     atacaagcca aggtaagatc tacacagttc cgaaacagtt gtatactaaa taaaatcagt      2400
     gaaggctatt caaatgaaag tcttatctac tactttggtt tatctagccg ccatgctttg      2460
     tatcgatata aaagatacct agaaacacaa taagtaaagt tcttattttt tcagaattat      2520
     atttattatt tccgttaagt tcaactaacc attgttataa aagtacgtaa taacaatggt      2580
     tagttgaact tatatctttt ttttatttgt tctaattata cagaaagcta acaagattaa      2640
     cttaagttta acttgttagc ttagaataaa ggcatctccc tccactaaat atattaataa      2700
     tgagaggtta ctcaaagatg ttttagcaat atcctatatc aactgcttaa tataaaaggt      2760
     tattatccta gaatttaaat agaatctcta tacttgattt aaatctaggc aaagtacatt      2820
     ctagaaatga ctttacgccc tgaccaacag ggtgctaatc agttcgagat ttcgttattt      2880
     aaaaccagaa acctcgaaaa gatctaatta cagaaacaga aaggttttga agctgctaag      2940
     cttaaccgta cagataaaaa tagatttaac gtagaaacac taattatcta cagacaaaat      3000
     ttgagaatgt gagctttttt agctatttaa tttgcatgaa ggagtaaaaa cgtttaattt      3060
     ccacagggga atatatgggt tttaatatct ttcagcaact atcaatctgg aataaaaact      3120
     agtacaagta cattctagaa tcattaagat gccttttata gcaaggttgg taaggactct      3180
     agatttctat ggtatgagag agatcactaa aaaaaactct cctgtatata aagatcttca      3240
     ataacatcta taccttatta atttttttat ataaaattaa atagattaca gaattactta      3300
     ataaggttga acttctatct cctaaactta taaaaatcgt ttaaaagaga ttttgagttg      3360
     aataattgat attttattaa tatataaaat atcaattatt caacccttga aaagtttata      3420
     tttttatcta gaattaaaag taggaaggta taagctgtat tccaacgaat tagactgtta      3480
     ataaataaaa aaaaagactc ttttgctttt atctagaatt aaaccaggaa tgtaaatctt      3540
     gattaatatc ttgtacatct acgttctaga tttacgaata atccttttat aacaatgtta      3600
     tataccatct agatttttta tttagaaagg agaagtctag aaaaatgtct aaaaacttag      3660
     atgaagaagt tgtttacacc ctaaaagata ctgtgaaatt aactggatta agtattgatt      3720
     tagttaggtt atatgaaaaa gaatttaatc tccagattca acggacagag gggggccacc      3780
     gaagatataa taagtccaat attgatttac ttattgaaat taagaaaaga atacaagagc      3840
     aaaattggag ttataaaatg attaaccaat ggcttcaggg agagatcata ccagaatcta      3900
     tcgaggttca atcaaacctc gaaaagaagg taggatctct tgaggataaa gttcaagaat      3960
     tacttgatcg ctctgaaaaa ggtgagcagt ttcaatttgc acttattcaa cgtttagatg      4020
     aacaaagcca gcttataaaa cagcttacag aaaagttatc ctctcaagat aaatatattg      4080
     aaaataatct agaaaaaagg gacgagaagt taactaatgc tattcgagaa attagtgata      4140
     caaagaaact aatcgcagct gctcaggaaa acctagaatc aaaaccaaaa agcttttggc      4200
     ataggatttt ccgtggttga aagctctatg ggtatagaat ttagccatat tcctataagc      4260
     ggccaagttg caaaaaaacg cactacaatg taatgaaata caaaaaggtt ctaggctact      4320
     aaataatagg atgtaatgga tgtagaggta actaaaaaga cccttatcct ctaaggaggt      4380
     aagggtcgtc ctttttatgt ttactctgta tacctttagt tcatgtaaac ttacgggaaa      4440
     gaagaacaag caaataaata cgttttctat aaagaagcga gcttttcaaa tacaacttgg      4500
     ttatgtattc cataatacct cttagcatcc ttacaaggga gagctgtaag aaatccttta      4560
     ttctcaaaag ttaatggtgt ttgtactgag taaaaatttc ttgaattaaa aaataaatct      4620
     ttttacaaac accttaattt gttatgtata aaataatgca gacatacaaa attctaattc      4680
     aactaaccag atagtagact actatatcct aagatccttt tttgggtaaa agaaaaaaac      4740
     taccggctta atacagtagt ttttttagtt ttctaatttt attacaaatt tgtacacagc      4800
     ccgtcccaat tacattgttc caggtactct actgatgcta atagtatcta agctagttga      4860
     agtaatatta ccatcttcat tcacccagac taaaaatcca tcgcgtatac ggataaatgt      4920
     accaactccg ttaagttgat ttccagcaga aaaaacttca attctatcac cttgtcttaa      4980
     accatccaaa cgaaaaccat ttgaagatgt accacggtta cttgaagaag tacggcggcc      5040
     atcagaagta cggcgtgagc tgcggcgctc gtcagaagta cgatgttttg gcatgcaatc      5100
     acctcctaaa agagataata tataatatga aaaaagaaaa aatctgtata agcaaaatgc      5160
     tcaattacta attatttcaa taaaaatagt taaataatct agttttaact ctacttattt      5220
     agtcttataa atcattctaa ttaaatggaa attttttaga gtattaacac ttgttcaaac      5280
     acttgtattt atcttacata tcataaagtg tataatccca aaagactcaa aacccttaaa      5340
     atgggacaaa agagatgaaa atacgtatat actataccga atataaccct caagacaata      5400
     agtactgtct aagaatatta tctaattatg agaaaaagtg agaaccaaaa ttaaagtaat      5460
     tttctaatga cgttacaata aacaaggtag ttgaattgaa ttttctccct aaactaaaat      5520
     cttttttaat taacataatg tattttatat gtattttata tgtctttcct aacaaatcat      5580
     aaaaatgtat ttttcttata tgtttttact ttaggattta atttttatac actaatttaa      5640
     aaggggcaca atcctaattc actaaaaata gcccaggcaa actcgataat tttttctata      5700
     atagtcaatg tagcatcatt ataaatataa agagggggat taagccatga aaaaagcaag      5760
     aaaatctgtg ggtaataaaa caaaaatttt cttaacatta acatcaaata attcaggcaa      5820
     aattgccaag aagcgttgag acatttatcc attaactaaa ttttataagt aaaaaacagc      5880
     tgtcttcgtt tgaggatagt tgtttttatt ttattgattt atctactcct taaggctcat      5940
     taccttcaca aaccgaggtc tgcagaacta taatcaaaga attcagtaat acattgctta      6000
     caaacatatt tttatacata tttcacctaa actcacaatc caattaatgt ttacataagt      6060
     aatacgtttg tccaatcctt tctaacggaa catgaatatt ctataagtac ccagttcttt      6120
     agaagggaaa tagatactta attggcttgt tattgtctca tctatattcg ttattatact      6180
     gtgaaatata tagtgccact cttacactta gattcttcag aatttactaa gaatactcaa      6240
     ataattgtca agtttaaaga agatgtatgt gaagaaacac agctagaaat tcatcataag      6300
     aataaatgta cgattttaga tcacaacaat gaacttaatt ttcaagtttt acattctaaa      6360
     aaggatatta atacacttat taaagtttat aataaattag aagaagtaga atacgcggaa      6420
     ccaaattata tgttgaaagc cttctataca acacccaatg accctctttt cgcctatcag      6480
     tatggacctc aaaaagtaca agctcctgat gcttgggatg ttatgaccag taatggaaat      6540
     ataaaaatcg ctattataga tacaggagtt cagttaaacc atcctgagtt agctgttaag      6600
     ctttggcctg gttataattt tgtagagggg gatttaaatc ctaacgatgg taacggccat      6660
     ggaactcatg tagctggtat tgctggagct cttacggaaa atagtttagg tattgctgga      6720
     atggctcctt cagcatctat aatacctgtg cgtgcccttg ataacatctg aaatggcact      6780
     ttgagtaaca ttgcaaatgc aattacttac tcgacaaatg caggagctaa agtaattaat      6840
     ttaagtttag gatcttctca aggatcagtt actgacccta gcagtatatc aacttgggat      6900
     tatgtcttaa atagcatgca taacattgat tcactgactc tctcttttac tttttataaa      6960
     taaaatcaac cattgtatag accgcataat atgttcagtt tcattgctta gagcttaaac      7020
     tatgaaacga gttattcact agtattttaa taattaacaa acataattcc ctaactttta      7080
     aaaataagta agctaatgat tatgttacaa atttagtccc ttttcttaat tacttaagag      7140
     ccattaggat taagtttctc taaacctata gttactttgt ccaagcaaag atacatcatt      7200
     tagcatttac tataatagaa ccgttaaaag taaagggatg attatattga atttacaaga      7260
     tattagagga tcttatgatt taatgttagg gttaggcagc tggtgtggtc cctcccttaa      7320
     tctaagaaga cataattgga ggagattttc gttcccttta gattggatga tatctaattc      7380
     aatttctgat gtaagtagat tgttaagaaa taggttcact ggatttatgg agtttcaaaa      7440
     cttacagcga actgacggtt atgctcattt tcttgatgac ggcgtagcaa tctttcctga      7500
     agaaggagga gctgaaccag ttaatgctca cttcattcat gatacttact acaatatcat      7560
     ttctgtccat gatttcccta tcattccaaa cgtagattgg acggtaatgt atccttccta      7620
     taaagagaaa cttaatcagc gaatagctag atttttggag aaagtcgaaa atagttcctc      7680
     cattttattt attaggtggg gagcagctag tccagaagaa gctatagaat taaaatctgt      7740
     attatcggag ctgacaaagg ggtcgtttaa tatattactt cttcagccgg cagagggact      7800
     taaaaacgtt attgatatgc attggacgat tgatggagtc tgctctgttc aagtacctat      7860
     ggatgaacca aataatgaac tagtatggga ttatgtacta aacggggtaa gcttgagtaa      7920
     ttattggaat tagcgtttaa gatagaatat atctttttta tcgccatgat aataaagata      7980
     aatagaaaga gtcattataa agaaagacaa tagaacttcc taaaaagctc ctgttgtctt      8040
     tctttataat ggtcaaataa ctaaatatcc tttttgaatt tattcataag ccccatacat      8100
     aactcttttt tatgctattt ctaaaatttt aagaaaggat aataatgtct aagaagagcc      8160
     ctatatttat accgccttcc ttccactcac ttaaaaaatt ttataagttg ggtaggtaag      8220
     tttttattgg aaagattaat agattagcct atagcaagaa acaatggtga gcatatttta      8280
     ataaataagg gggcgaatac gaaatagagc aggtatttat gctcgaataa catgaatagg      8340
     gtgtgtatac aatgaaagtt atgactattt tgggtacaag acccgaaatt atacgtttaa      8400
     gcctcattat cggaaaactg gatgattacg ctacagaaca cattttagtg catacagggc      8460
     aaaattttac cgcttcatta agcgaagtat ttttccaaga attaaatgtt cgccagccag      8520
     attatatatt ggctaaccaa caacttaccc taggggaaca gttatcaaaa atgtacaaag      8580
     agctagaagg tatattttta aaagaaaaac cggacaaaat tttagtatta ggtgatacta      8640
     atagtggtct aagtacgatt ttagctgaaa gaatgggtat accagttgtt catatggaag      8700
     ctggaaatcg ttgctttgac ttagaagtac ctgaagaaaa gaatcgacga attattgatt      8760
     ctatttcaag tttcaatctt ccttatactc cccaaagtaa agaaaactta cttagagaag      8820
     gtatcccctc taatcgaatt attgtttctg gaaacccaat taatgaagtt ttaacatatt      8880
     acgaatctag aatagaagat agtaagattc ttaacaaatt gtccttaaaa gaaggagact      8940
     actttttagt tacagctcat cgtgctgaaa atgttgatca cgaagatcga ttactggaaa      9000
     ttattaaagg gattaatatg gtggccgaat attatcaaaa aagagtcata tgtagcatac      9060
     atcctcgtac gaagtctcga atagaacata gttcacttgt taacattcat ccattagtag      9120
     aactccataa tccatttggt ttttttgatt ttgtaaaact tgaaaagaac gcttactgtg      9180
     tcttaacaga tagcggtaca gtacaagaag aatgctgttt atttcacgtt cctactgtga      9240
     ctattcgtaa aacaaccgaa agaccagaaa caattgaatg tggaagtaat atgctttcgg      9300
     gaataagtgc tgatcaaatt ttaaactgtg ttcatgtaat ggtcaatcaa ttaaaaaact      9360
     ggtcctatcc cgaaggatac ggtcatttaa acgtttcaga taaagtgatt aaagtagtat      9420
     taggaggaat aaaaggtgtt tgataataaa actattttag tgacaggcgg tacaggttca      9480
     tgggggtatg aattagttaa acagctatta acacataacc ctaaagaaat ccgtgttttt      9540
     tcaagaaatg agtccaacca attcacgatg aagcaagagt ttgacaacca tcctaaattg      9600
     agcttcataa ttggtgatat taaagaaaga gaagcattaa tggaatcctg tcaagatgtg      9660
     aattatgttt ttcacctagc tgctttaaag catgttccag tatgtgaaga tcagccaatt      9720
     gaggcactga aaacaaatgt acatggaaca caaaatgtaa tagacgcagc tataagttgc      9780
     aatgtagata gagttgtcta tatttctact gataaagcct caaaccccgc caatttctat      9840
     ggtttatcaa aggcgatggg agaaagacta attattcacg ctaacacatt aaatactaat      9900
     actaaatttg tttgtatacg tggtggtaat gtgttaggca caaacggaag tgttattcat      9960
     gtattcaaaa agcaaattca ggagaagggg aaaattggca ttacgcatcc gaatatgacc     10020
     cgcttctttc taactttgga agatgcaata aaacttgttt ttaaggcaac atttgaaagt     10080
     ctgggcggag aaatttttgt tatgaaaatg cctacttgta aaattattga cctagctaat     10140
     gtattgatag aggcttctgg aaaagaaacg attgaaattg aaacattagg tatacgacct     10200
     ggagagaaaa tacatgaatt acttttatct gaatatgaga gcacgaccac tgtcacctat     10260
     gatgatgaat atttcgttat tttacctcca attcatattg aaggcctaaa agaatattac     10320
     gcaccataca cccttgtaaa cctagaaaaa tatgattcaa gtaaagaaac gattagcaaa     10380
     gaggcaatta gagaaatgtt gctgaaaggc ggttttattt aaatgaaatt attgattctt     10440
     ggtggaaaag gaatggcagg gcatgtaatc acaaggtatt tcatgctaaa ttcaaattat     10500
     gatgtatcct atacatcaag ggatccgaag gatgaaaatg gaatttattt ggatataaca     10560
     aattttaaaa ggctcgagga aaccgtcgac gccataaagc ctgatattat tattaattgt     10620
     attggagtct taaatgaaca cgcaagtaat aatcctatgc gtgcttttca aataaatagc     10680
     ttactaccgc atcaattagc taaattaatc gaacgttatc aaggtaagtt aattcatatt     10740
     agcacagatt gcgtcttctt aggatcaaaa ggagattaca cagaaaacga ttctccagat     10800
     ggtacatcgg tatatgctca atctaaacaa cttggtgaaa ttgttgataa taagcaccta     10860
     acaatccgta cgtcaataat aggtcctgaa ttgaaagaag atggaattgg cttatttcta     10920
     tggtttatga aacaggaggg aataataaaa ggttataaaa aagtattttg gaacggagta     10980
     acaaccttag agttagctaa agccgttgaa ttcctcatag aaaataatgt tacgggatta     11040
     tatcatctac attcaaagca aaagttatca aaattaacat tattagaatt gtttaaagaa     11100
     gtttttgaga aggatgatat taaaataatt cccgacgagg aagtagtact agatcgaaca     11160
     atcattagca cccgcacaga cttttgctac atgcccccag gttacagaga gatgttaaat     11220
     gaattaaaag aatggatgtc taaataattc ttcctgaata atagaaatga tgaaagaagc     11280
     cacactaaaa atgatgtctt ttttatcccg acatattgtt tgaagttttt ttatttaaac     11340
     attcatttta aaaaaattaa attaaagggt taatagacag ccaattattt caaaaagaag     11400
     caaattagct gtctcttttt ataataactt atttgttgtc taactattat aattataaaa     11460
     gctaacttag cgtaaccaat tcaaagagaa gagctagatc ttttaacttg ttcgggaatt     11520
     acatagactg ttaaaccata tcgctctttt atttcagctg caatctgatt tgctgttact     11580
     ttatcgttaa atgctcctgt tattacgcgg taacgttgtt tttgagtgaa attaatatca     11640
     ttgctattat gcgcctcttg aaagtgatta tcacccataa tacacccctc cttattcgct     11700
     ttttatgtta taactaagaa taagttaatt taaatattta gttacaacca gatttataag     11760
     ttgctctttg ccttagtaag ggcaccccta acaagcaccc tgatattcct ggaagagata     11820
     tcttaaatga aattaaataa ataaagattc gtttcaactt gtccaataat cttcatgtta     11880
     attatattta tagaaaacaa tttataggat ataactaact tagggaaaaa taaaggacaa     11940
     aataaagaat aatttctatg tatttatacc gatacttcag tacatacccc ccctttaaat     12000
     ttaataattg atcttaataa cagcaacact ccataacttt ataaaaatat cccctttata     12060
     attagataag agaaggcgcc ctcatgtaat tataaaaggg taacatcagc cagtatcatt     12120
     ttccaataat gaatgtttgc attccattta tcatggttag gcagttcaat agcacagact     12180
     ctttgcagag accagctttt ttcaactaaa tggtccacat ccgtatgatt aataacaagg     12240
     attctaaaat cattggcaat cattccagat aagatagctt ccagctcagc aacttcttca     12300
     aaatttgctt cagttcttat aaacagaatc cgttgactcg tagacagctt ctctaaaaag     12360
     cgctgaattc ttctatcata tttttctttg acctcagcat agccacctaa ataggtaagt     12420
     gtatttttat ctgttttaaa atcatgatta aatcctatat tgtaaacttc atcccacact     12480
     aataagtccc attgtgatat atattttata attctaaggt tctttagatt caaaaaatca     12540
     gcaaaccggt tctgtaagag aacattaaca ttctttaaag aaggagacga gacccaatct     12600
     aagattccag aaaatgttct taagttgttt tctttaagct gaagtgaagt caaacacaaa     12660
     tctcctaaac tgaaaatagc gtcatagtgc ccttttatac cttctaaatt catactattt     12720
     tccccttaaa ataaaatttg tacaagttta tatattatat taaatgcaca aatctaaaaa     12780
     agggaagggc tagtaactac taatttaata aaataagcat tcacacaaag gattatgtga     12840
     agggggcata gcgaggcttt aaatcaaatg aataaatcga taaactatta aacaatcata     12900
     cttataaatg ttatttatta ttttttagaa atgtgtatgt ttctgttaag ccattaaaga     12960
     tagaaacttg agaacgccac tctaatagct tatgcgcctt tttactatcg agacaactat     13020
     gtttaatatc tccaggacgt ccttccgtat ggcttatatt aattttagac ccatgaattt     13080
     tctcaagttc ctttaataaa cgattcacag aggttctctg cgtagtactg gcatgaatga     13140
     tctcctgatg acctttatca atagcagcta tatttgcctg aacaatatct tttacgtaaa     13200
     taaaatcacg tgtttgttcg ccgtcaccat gaatatttag catagttcct ttatctagtc     13260
     tatctaaaaa tactgcaact actcctcctt cgccctttgg agtctgcctg ggtccgtata     13320
     catttccgta acgaagaatt gtataagata gtccatataa acgggaaaat agacgtatat     13380
     atgactcggc tgtcagctta gataaaccgt aataagagat gggtgctgta ggatccatct     13440
     cggtaattaa atctttttgt aactctccat aaacagctga agtggatgca aatataattt     13500
     tatccacgga agcatctcga caagcctcaa ggatattgat agtccccttt acatttacat     13560
     cagcatcata ctgaggatca ttgatcgatg ttgaaacatc cgcctgagca gccagatgaa     13620
     atactatatt gggcttttct tggagaataa tttgtctagc ctgcttacta catatatctt     13680
     caacatgaag agtagcaaga ggatgtatat tctcttgctt tcccgagatc atgctatcaa     13740
     ttatatgaac ttcaaatcct tttataataa gttcttccac aagatgggaa ccaataaaac     13800
     ctgcccctcc agttactata gccttcatat gctattctct ccctctttaa gtttcaatag     13860
     tatatgtcat cgaaaaggtc actgtgtaag ctccctaccc aatacttcat taaaaagaag     13920
     aattaattta cctttgccat actactaaaa gttataagtt taactccgat gtgagagaac     13980
     cttttcgtaa acgtttaata ccttatcaac tgcttttttt tgtgaccaat gatttagggc     14040
     ccattcctgg gctttagccc ctaagctctc cctgtattct ggatttatta ataagttata     14100
     aatattttca cataatgagt tcgggtctcc cgcaggcgaa attattcctg ttgaaccgtg     14160
     tttaaccatt tcgggtagtc cccctgcatc gcttactatt acgggttttc cagcaagctg     14220
     cgcttcaatt actgatagag gttgattttc tataaggctg gggagtacaa agatattagc     14280
     aagagatagt aaagaaggga catcatttct gttgcctaaa aagacaactc tttttcctaa     14340
     tcctaatgct ctgctctgag cctttagctc agctttttta tctccatccc cgactatcca     14400
     acatacccat ccctttttta acttttttag ttcactgagg gcagataata aatgatgaat     14460
     tcccttaatc tcaaccaacc ttcccgtata aataattact tgttgaccaa cgcgtgcacg     14520
     aagagttgat ggggtctgca tccgctgaag aaaagagtta atatcatatc cataatgaaa     14580
     tactgtaagt ttttcctctt gaacctgaaa ttcctttagt aaaatattct taagccagtt     14640
     atttgcgacc actgtacagt cagcggacat agcacctgta tgttcaagct cattaaaata     14700
     cttacaagct atatcagcag tagaggattt caaagtattt ttaacatagt gatttaactc     14760
     gtgagctaca caaccatgta tagtggctac taatgccgtc ttttcaggtt ttagtggact     14820
     aatacaggca gttgacacta catcttgtgt atgaattata tcgtattgat ctatgcctag     14880
     ataagtaact ccttctatat aaccaagacg ctgcttttca taaaatttaa ctacttcgtc     14940
     tttatataga agaggatgat tttcttcttt ttgagctaac tttgcgatca atgagaattc     15000
     atctttaatg aattcttggt ttttattaac aatatgaact gattcattcc ctgcaccatg     15060
     accaagcaag tctacttcat gtcccaatgc ttcaagttct tcttttaact gttgcatata     15120
     attccaaacg ccacctacat gtgggacttc ccaaaatgta gcaagtaata ttttcataaa     15180
     tttcgctcct cttttcacaa catcaacgct ctcaaattcc ccttatatat aggtattcat     15240
     gtagctaatt aatgttataa actaccactt ttattttaaa aacaacattt tgacacagta     15300
     gcataaaggc tctaaatgaa agatttgttt tttttagcat acatctaata ttaagcttag     15360
     tttaatggga aagattaaat acatttggtg ggatgtggaa ctgatgaacg caaaaaaaaa     15420
     attattaatt accggagcga gcggctttac tggataccat gcgtgtgagt atttttcaaa     15480
     atcagaattg gatattatag ccataactaa aaagagaaac ttttgttata aaaaagttaa     15540
     aacaaaacaa tgcgatttat ttaataaaaa gggaataaaa gaccttatta aacaaacaaa     15600
     gcctgattat gtcctccatt tagcagggca aaatgcggta ggtcgttcat gggaagaccc     15660
     tcttgactcc cttgaagtga atgcaatggg tacagcatat cttattgagg ctctccgaca     15720
     agaagcccca gcttgtaaga cagttattgt gagttcagct ctccaattta atccaacatc     15780
     tatctccact tttaaccatc cctatggcct gagcaaaaca atacaatcta ttttttctca     15840
     attttgggct actttgtata atatgcatat tgtcattgct agaccatcaa acttaatagg     15900
     accaggattc tctacaggag tgtgttcaat ttttgctcag agaattgtaa acatggaaag     15960
     agagaaagaa gaaaaattct taaacgttag taatttaaat aatcgtctag attttttaga     16020
     tgtacgagat gcagtgagag cttatgattt tcttctcaag aagggaaagt ctggtgacat     16080
     atatgacgtt tcttctggta agagccattc cttagaagag attataaaca tatttaggaa     16140
     aacaacggat attcaatttc aaacaaaatt agataatcaa agccctatag ttaatcatgt     16200
     tgatctgcag cctttatctt taattgaatt gggatggcaa ccaacagtcc ctctgaaaac     16260
     taccataaaa gacattgttg atttttatcg tcaacaagta gatggtctta ataactagag     16320
     aaagaaaaat ggctacttta ttaattaatc ctttgctgat tcgtataaaa tctcttgttt     16380
     gaaattaatt aagatttact ttaatcgaac tttttcctta tttccattag aggttggcat     16440
     atgaaaggtg ttttttagag ggttttcata tcatttaaca agttctttgc atattctaat     16500
     taaggaatta aataaggtaa ttttagaata atggattgct tgatattccg taaagtatat     16560
     aacttataaa ttccattgct taaattaaag ctatcatttt ataaagtttt ggattaagta     16620
     tggataataa gcaagtcata taccctgaac acaatttatt tcttggaggg taaataatgg     16680
     gtccaaaagt atcaataatc atcccttttt ataactgtcc ttacgtagat caggcaatta     16740
     aaagtgcctt agatcagaca tatgaaaata tagagatagt ggtaatagac gatggttcta     16800
     caagctatac ggaaaaaatt atgccattta aagacaagat tatttatata aggaaagaaa     16860
     atgggggaac tgctactgct cttaacactg gcttatttgt tgctacaggg gagtatattg     16920
     cttggttaag ttcagatgat tattttgttc ccacaaaaat ttctaaacag gtagacttta     16980
     tgactaaaaa gaaaatagac gccagtttta caaattttga ttatattaac aaagataatc     17040
     aagttttagt tccttggtgt actaaacgct ttaccaacct tgaagatgta tataatgctt     17100
     ttctaactta taatgctatt aatggctgta cgatccttat aaaaaaggaa attttcgata     17160
     aaatagggat tttttctccg gattttcgtt atacacacga ttatgaaatg tggttccgca     17220
     tgcttgtaaa tggctatgaa attcattact ttgatgaatc ccttacaaaa tttcgctcac     17280
     atgagaattc aggaacacgt aaatatcaat ccgaaatgca aaaagagatg aaaattattg     17340
     aatatcatta ccgtcctctt ttaaaaaaat atataaaatc ccttcagtca gaccactcat     17400
     aaagtgtgta taagtttata attctctatg cctatcaata cctatctcaa ccttatttca     17460
     caagctactt cactacttgt ttgaattatg aatcccacct aaatgattaa aattctcctt     17520
     tacaagtagt gttacccctt attcttagtc tctttacacc tatacacatt taaatcttgt     17580
     tacatacatc cctgatcgaa atattaaaag aataagcccc tcccatacca attaaaaatt     17640
     tctcacatat tatacattaa tggaagtcat tataactaag ataaaattat tttatcttat     17700
     ataaatgtac taaatcggat attatttttg acctagtttt taagaaagaa gggaagcaat     17760
     aataaatgaa agataaaact acttcatcat ttgataaaga ccttactgat ttcttagatg     17820
     atataaaaac caaattgcac ccagactata aaattcctga ccctcaagtt gtaaatataa     17880
     tcttaaaata tactcagtaa gctagtcagc tttctacaat gttgttataa ggttacacac     17940
     ccaacaccaa aatatatgca aaacaattaa gggatgatta taaatgaaga ttttattggt     18000
     ttcctattat ccactcccct ataccggggg agtttggacg tttgtatcat tactcaaaaa     18060
     atctcttgaa gacttggggc attctgtcga tgtactcagc catactcctg atacaaccaa     18120
     atatcgaatt atagggcaag aaccagaaat agaaattgat gatatttctc cttatattaa     18180
     agaaaagatc gtaacagaga tgccttcatt acctataaac agctggatat ataatgttga     18240
     aatatttcgt tatagcttag aactatcagc agcatattac aatctccaac aatacgatat     18300
     tattcatgca ttggatgtaa cagcagcaag agctataagt agagttaaac cttcacatat     18360
     tccccttgtt acgagtgcac taggtaacct atcaagggat attttcttta ctcttaagac     18420
     catgcatcgt aaaaaaactg atcaacaact gcaaaataca tttgaatatc aatatcataa     18480
     aacccttgaa cgtctaggat atcaatctag taatttaatt catagtccta cgctttggat     18540
     gcgtaataat attatagata acttttctat ttctccggat aaaataatga ctttttcata     18600
     cggattagat attaaaaact ttcacccaga ttctatggaa tgccctatta ttggaccaaa     18660
     aaaaggaaag aaaattatcc tgtttatggg aaggcttgtt tatttaaagg gtgttcatta     18720
     tctacttgat gcacttgcgc ttttaaaaaa ggatagagat gattgggaat gctggatact     18780
     tggagaagga gaattacaag gagaattgga aaaacaatcc caaaaattag agcttagtaa     18840
     tcgcgttaga tttttaggaa tttctaatga tgtaactcat tttctgagag aggcagatat     18900
     ttttgttcat ccaagtatac atgataccca accttattct gtcatggaag ctcaactcac     18960
     aggtttaccg gtacttgtaa gcaacacggc aggtttacct gaaatggttg aagtcggcag     19020
     aagcgggtta gtttcctctg ttggaaacat ccatgaacta tatgaccagt taagatattt     19080
     acttgaaaat gatattcttc gcgagcaact ggctgcctgt accaaagaat gggcaaaaga     19140
     gcggtggtct cttggtacca tggttaataa tgttttgtca ctatacaaac aggctaaagg     19200
     tttggaaaca gaaaatccaa cttaaataaa acaccggagc atgtgaaggc tctggtgttt     19260
     tatttactta ttatcatatt ccaagggatc taatcatagc gataaaattt gcacagtata     19320
     attccgggct aaagtttatc tttacatgtt gtagagcatt tacacgtatg tactctctta     19380
     attgagaatc cattatcaac tcttttgctt ctttaacagc ttcatcaaca ttacctaacg     19440
     tataatattt tcctgtttga ttatgaataa ttgaactttt tacaccatca gaatctgtcg     19500
     tcaagacggg acacttacag ctcattgctt caagaagcga ataaggtgct ccctcaactt     19560
     ttgaggtaga gcataaaaag ccaccagatt caccgatcat tgaaaagtaa tttgccattt     19620
     cattgttagg gacatttgcg tgaagcagaa gatttgcttc taagtttaat tctttaatta     19680
     aatttttaaa ttcagctctt tcttttggtt cacttatagt aggatcttca aacatatgga     19740
     gttgtatgcc tgagttataa ttatgaacta attcactgcc tatttttaaa aattctctcc     19800
     aattcttatt atcttcaatt cgtccaatcc atgcaatatg tggagtatga cttacaggca     19860
     cggatcggta tgaaaactga ttagtatcaa aacagttgtt aaaactaaaa acagggaatg     19920
     aaggataaag ttcatctaac agctgcataa tatgaggggt tttagggtta aggaaaccag     19980
     aagcatattt agttacgaga ggcacagcat ttgtaagggc ggctcttgct gtgctttttg     20040
     gaccgtatcc ttgtatttct ataatcatct ttcccttata acctaatgat ttaaatctag     20100
     gtaaagcttg gaaatctgaa acgatcacaa tgagactgta atttccacca tctaatattt     20160
     tttttatctc cctatcttca tttgttacaa acgtttgagt accatgatca tttattgtct     20220
     tttttctatt ttcataatag agacagtggg cattaatatt atgtttctta agagccttac     20280
     atctttgacg atttaaagtc tctacaccac cacttgggac atagaataca aacaatatat     20340
     tcatttctta cccccattta gtaaattaat ttaaaaacaa aaattataga ttggatatta     20400
     aaccttaaga taataaagac cactccaata aataatatgc ataaattgaa ctgctctttt     20460
     acttaacctg ctaatattat taaatttaaa tttttatcca ctttaaatag ttagttaaat     20520
     taatctaacg aatatccatt tcatatttaa aatatgtttc atatcttaat aaatgtaatg     20580
     ttatttaata agatattgga gctaaaagaa taatcaaata ggatagtaat aagcttaatg     20640
     ttatctgaaa ggagaattaa atatgttaaa agtatctgtt attgtacctt tcttcaactg     20700
     tccatttatt agtcatgcat tggatagttt actaaatcaa aactataata atattgaaat     20760
     tatcgtgata aatgacggat ccactcaata taaagaaaaa atcattcctt atttagataa     20820
     aattatatat acggaaaaag aaaatggagg aacagcaagt gctttaaatg tgggtatcca     20880
     gttggctaca ggagattata tatgctggct tagttcagat gatatttatt atccccaaaa     20940
     gattgctctc cagttagaat tcatgactat aaacaatgct ctttttagcc atacaaatta     21000
     ctacgctatt aatacaaggg gacgaattat aactcctccg ttagggttcc atccttcaaa     21060
     caagatagaa atactgaaac aaataagcaa agggaatatt attaacggct gttctacaat     21120
     gataaataaa aatgtattta ctcgtgtagg cctttttgac gaaacactcc tttatactca     21180
     tgattatgat ttatgggtgc gaatcattca aaaatttgat cttcattatc tttccgaacc     21240
     gctcttatta tctagaattc atgaaaatat gggaactaaa aaatatgctt cctttattaa     21300
     ggaagaaaat aaaatggtca ttaaccgtca caaagatact ctgactcaac taatcataga     21360
     atgtatagca aaagaaaatc tataaacaac aataccttgg aactgtcaat gtctgaaata     21420
     ctaaagacct ataagttact ttggctactt tgccaaagca aatggttaaa tttattcttg     21480
     atactaaaaa attcaaatat aaacatgaaa catctgtaat acgcctctct tttgcatgta     21540
     ctcctcaact acccataaaa gattattcaa ccctagctaa aataattaaa atgctgagca     21600
     ccgaaaaaat cggataagca tattataaaa catagacaat aatgcaaaaa aatgcaattg     21660
     agaaaggatg attatattgg cactatcaag tgaagctaaa gcaaagttac tcaatctact     21720
     tgggacatta caaagcttac ccaccacagc ggattctaca accacgacta ccactaataa     21780
     tctattaaac actgctaatt catcaactaa tgtaactgat ctccttagca ctttaaatac     21840
     taatggcctc gtagatactt ctttaatcac taatctgtta aactctacta ccactaatgt     21900
     aactgacctg ttaaacacta ctaccgccag tgctactgac ctgttaaaca ctactactgc     21960
     tactgctact ggcctaataa acactacaac tacagcgact actaaccttt tgattgatct     22020
     tctaagacta agacttctac ctagtttaaa cgctctacgt aatgatttaa caaatcgcct     22080
     taaccaaaca gtacaattgt caacagagta tgagacactt acaggagttt tacttgctgt     22140
     tcaatctgat tatgttgttt tagtggaaag tgatggaacg atgcactttg taaatctaag     22200
     caaaattgaa acagtagcat cactttaaga aggaggttta ttatatgttt gaaagctttt     22260
     tagcggcaga actaacaaaa catattggga caccagtgga agttgctatg tctgatggtc     22320
     ttgtggaggg aattatcact tcagttacag gtaatcttct tactatcctt cagacggttg     22380
     gatatggtta tggtactact actactccac taactatatc tatccctgca attaactttg     22440
     ttactttttc cccagttgct taattaagca attttaaaaa atcgctccaa ctggagggat     22500
     ttttttttgt gatgctaaat gcatgctctc tcacattata aatcgtaaaa tctttatata     22560
     gtaaacgatt ttctcttaat aaataattta atatactaac gtcttcatac atacgcccat     22620
     cctcaaagtc tataattgga aatcccttat tctcctttaa agacaatgtc cgatagatgc     22680
     gaggacctaa aggaaacgta tatgaaagca attccgtttt attgaggact tggcttcctt     22740
     ttctaatacc tttatatttt attttcccgg gactcacctg tttccaagct cttaaattac     22800
     cgtagagaac agcaacatcg tctgctaagc tccttaaata atctctgata acaaaaattg     22860
     catcaggatc tagccaatca tcagcgtcta attcaactat aaaatctgtc tcaatgtatg     22920
     ggagtaattc attcaaggcc ctggcctttc caccattctt tttagttaaa agtttaaatt     22980
     gaggatggta aatccatttt tctaaaacct tataagactc atcagtcgag ccatcatcaa     23040
     ctactaatac ctgttctggt ggactgtttt gtaggaaaca tgaattaata gcagttccta     23100
     catagttagc catattataa tttgatacca ttactgctac ggagggctgt gctatttggt     23160
     taggaacttt tgactgatac ttttctataa attttatttt ttccacatta cttgtagaag     23220
     catctttaga taactgacta ataacgcctc tatcctctag tataaggtga taatgattaa     23280
     ccagagatag ccatgaaggt aatatggctt ccttaaaagg aacttcgttt tcttgaaaaa     23340
     atatattttg ctttaagaaa tacgtcttta taaaaaaagg ccgttgaatt gttatatttt     23400
     tgattgtgca ttgataagtc atcacttgtt tttcattgtt taactctaat tgtatctctg     23460
     ttatgtttga atttaaataa tcctggtcgt agagaaataa aacatattca caagatagct     23520
     ctttaatata attatttaat acctttccca aatgattgtt gtttagcttc acatattcgg     23580
     tttttgcttg cggagtaaaa gaatcagcta cctttaacaa aaagtcaggt atatctataa     23640
     ctatgacccc ttttactcga ttgataataa gattcaaaga cgttagggcc tgctgtaatg     23700
     cacttgagtt agaataactc agtaaaatga cttgaatatc tttcatgata taaattaacc     23760
     tccattatac aaggtactga ttataaatat tccaataatg agattattga tacttttata     23820
     agcttattgt gactaataag acgacactct aatttaattt ttgtatagaa aatatcttat     23880
     cttattaaat ttcgttataa tatttgcaac tcaactaaaa agtaattatt tacaaggtta     23940
     ctaatacgta ctttaacttc tttatgatat taaataatgt atgtaaattt tactctagag     24000
     aaatataact gattaaattc tattccatcg gttaaggttt gaacttgtac ctaaactaat     24060
     tagtttgtcc aagcataaaa acttacttgt tatataataa taaataatat agaaaggagg     24120
     tcattatatg actagattat tagatgctag aacatctcaa aatgctagca ttgctaactc     24180
     tatttctatt cctattacta ttctctcgca accaggatta tttggacaaa ttgggcttaa     24240
     tgtttcagga gctacaggtc ctgttcgtac tcaattaagc gggacagttg cttgccaatt     24300
     acctcttcta cctgcagcaa caactattac tcttacaata gtcagagtaa ctgcccttac     24360
     tgaccctgtc gtttattcct cttcagaatc cttaaatata aatctattag gtccccaact     24420
     ttttaccttc acagcttctg attttaacat ccctgcaccg gcttctggcc ttttagtcta     24480
     tacagcattt atcggctcaa atctactagg aaccgtgaga gtaggaccag agagttttaa     24540
     tggtattgct tactcagact aatactaaat aaaaatcttg tcacttttcc cctcaaaagt     24600
     gaacctaaat aatagaattg tttaattccc ttatccattt aattacgtta atttcatcta     24660
     taaaatataa aaagcacttt cctcaagaaa agtgcttttt tcctattttc aggaaagtaa     24720
     ataacgaata aatttagcta aatatatcca tgagtttaaa tatgacgtaa taatctttag     24780
     aactctatat aattcgagtg tactctaaaa ctattaactg agggaacggt tttttagact     24840
     atccctctct cttcctgcta gtaacctctt agtagataaa aaaatccaag attattacga     24900
     ttatctcttt ttttagtttg tagcgttaaa aaaataactc ataattatga gctaagtaga     24960
     gaaacaaata ttgcgattaa cacttgaatt gctacttgaa tatttaaagc aacatctgca     25020
     tctgttgtat taacttttac atttattgat ccttcgataa ctgttttttg actattccgt     25080
     tgtctagtcc ccaatagtgc tgtcatttct tcagccacaa tttcaccctg attgacatta     25140
     cttgtgagaa tggctacaac ggctgcaata gctacctgaa tagcaacttg tagttgtatc     25200
     gctacttgtg catctgttgt gtttacttca acaccttcag aatccttaac aataatccat     25260
     tcaaaggatt gttgttcaat tgaacttgct gcatctgcat cctgatcgat aactgctcca     25320
     ttatgtgttc cagttttaca atggtctagt gctctccatt tttgttcacc catactattt     25380
     cacctcttta aatttttaat taaataagaa ttaagaacta aggacagaaa caaatactgc     25440
     aattagtgct tgaactgcta cctgaatgtt tacagcgaca tctgcgtcag ttgttgtaat     25500
     tttgacatct tttgaattta caatgacaat tttttgtttg ttagtttgct caagattagc     25560
     gtgtgctagt aagtcctgag ctataacttc agaattcgca acattactgg aaagaatgga     25620
     aattactact ccaagagcta cttggatagc aacttgaagc tgcacagcta cctgagtatc     25680
     tgttgtagta acttcaatat cgcatgaatc tttaatccaa attaattcag tagattcttg     25740
     atctacaaat gaaaatgcat ctggttcttg ctcaataact gcatcctctt tactctcgtc     25800
     ctcaaaatga ttatcgcttt caaataaatg cgaaaaatga tcatcctctt ctaattcgaa     25860
     acgacttttg tgatcatgat cagaatattt ctttttactt cttttcttta cttcacgaga     25920
     ctcataacgt ttatgagttg gcatgattaa cactcctttc cttatatgaa ataatatatg     25980
     attttgaaat gaataggatt gggctaaccc ctaagagttt aggtccaatt ttaaaataga     26040
     aaaaacgcct aaaaaaggcg cttttaagag gaatcagaat tactttggtt ttgtttttgg     26100
     agaagtggcc ttggctctat cagcaagtgc attggattgc tgttttaatt cttctaacaa     26160
     atcgaaaatt agttgttttt gttcatcggt tacttgccct ttaacattct cttttgtaat     26220
     accgtgtttt tgaagaatgt ttagcatcat taattccata agtttgttag gggtttcccc     26280
     aggcttttgg tttgaattat tcaagttacc tgctcctttc atgataaatg tcataatact     26340
     atatgtatct atcatgaaaa aagaaacccc taagttcgat ctctattctt aaatattata     26400
     atttttaaaa tgaaaccaag gataaaaatg tacatgagac cgtcaataat tttatgtaaa     26460
     tggaaatttc cttttcttat agacattatc cactagtttg ttttaaacac catttgtagc     26520
     tctgcacgag cttaatctaa accaatatga catcttgtcg caaagcgctg gttatactga     26580
     ttaaactgag aaacgaagaa tcgttcaaga gactcttcgt tagggaattg ttccttacgc     26640
     ttactatatt tcttaattgg tttattaaat gactcaatga gattggtaga ataaatacta     26700
     tgccaaatag acttaggaaa gctataaaaa gtaaacaaat aagggttatt gagcaatgat     26760
     tttgtcattt ttggatatgt agacttccac ttttcaacga acgaatgcag ggcctactgg     26820
     cccatttcta ggctttctgc acggtacaca gatttgaagt ctccacagat ttcagctcgg     26880
     tcggatacac gaactttatg agcaatcgtc catgaaagat ggacgcagca tgtttgataa     26940
     gaagaatctg gatagataga aaaaacacgg tttgagattt cttttaaccc gtcgaaaata     27000
     aacaacagaa tctcctctac gccacgaaat ttaatgtctt ctaaaagttc tttccctata     27060
     aaggcggatt cgttagatgc aatcgtataa ctaagtactt ctttttaatc atctttgcga     27120
     atgctaacgg caatatacac agcttctttt gatactttat ctcatctcaa ggcaatatct     27180
     aaataaatgc atgcataacg tgtacatgcg gttcaatctc ggaagagctt ctacttatga     27240
     cttcaccttt gttatagtta aaatcgtttg aggcgtgtaa tggtcacatt atatgtgctc     27300
     cattaaatga gcaattttag tagtcgttac accctttttt aaaaatatga atgacaatcg     27360
     cttcaagcgt atcgtttgcc cgtttataag gagccacaat ctgttgctta aagtctccat     27420
     tccgatcatg aagaacaaca agatgaagtt ttccaaactc tttgtgtagc gtccgctcat     27480
     aagaaccatt tcgtgaattc cccgtattat atccaatacg attagatttt cataacctaa     27540
     gaaagctgcc aatttgctcg ttaagagcat attcacctca tgttctaagt gagaacggaa     27600
     aattcccatc acatcttctt tttagactag agcttgaaca agatctattg taaactgatt     27660
     catagaaaga ccttctttgg attggttgtg gtgacttaat tctacaaaaa aaggtcttcc     27720
     tttttgtatt aattcattta cataagttat tttacgctct cacgtacatg taaaagttca     27780
     tcttataatg aagtcaattt tttttgaata ataaaaaaat aataatatca tatatttata     27840
     cataagatat ttcccttatg ttttcaacaa ttttcttata gtaattatga aaagagttgg     27900
     tgaaaatggc gaagaaagca aaaaaaataa atgttaattt tagcgatagt ggagcttcta     27960
     acgatcaact atatgtaata gatgagaata ataacgtaat ttccgtcgtt aatgcaacaa     28020
     caaataatgt agtttctact attcctgtag gccatcagcc agttagccta aatgggaatc     28080
     caaataacaa tcggatttat gtaacaaatg gggggagcca gacggtttct gtaattgacg     28140
     gggcaacaaa tactgtaatt gctatcattc cagtaggaat tcaaccggcc ggtgtaggga     28200
     tcaatccata tatcaatcga atttatatat cgaatagggg aagtaatact gtttctgtaa     28260
     ttgatgggtt aactaatact gtaatctcca cgatttcggt agaaacttac ccaactgata     28320
     taaatgtcca tccatatatc aatcgaattt atgtaacaaa tgaatttagg aatacagttt     28380
     ctgtaattga tgggttaact aatactgtaa tttccacgat ctcagtagaa tctcaaccgt     28440
     ctggtatagg tataaattcg gccactaatc gaatttatat atcaaatagg gggagtaata     28500
     ctgtttctgt aattgatgca ataacaaaca ctgtaatggc tattattcct gtaggaaatc     28560
     aacctaccag tatagaggtt aattcatcca ataatcagat ctatgtgaca cacgaagtag     28620
     aaaatacaat ttctgtaatt gacggactaa ccaatattgt agtagctact gttccggtaa     28680
     catctcctat ggctaacatt gatgaagacc tttctttaga ataatctaac cttataaaat     28740
     ttataaggag taacaattta atgattagat aaaaatatat aaaattgagc atgttattat     28800
     aagtatattg ataatatttg tattaaaata ccatttaatt agatatccca aaattccttt     28860
     tgaagcaacg tatctctgga tatagtaagt aaataagagt taattactac actgtaaaat     28920
     ccttaccaaa attaaattta attcgaattt cctttgtcac attcaattaa atttaatttt     28980
     tatgtaagtg gtttaaaaag ccataggttt gaagagacct ggcttttttt gtttgctcct     29040
     agactaatta ggggataacc aagaaaaatt acatattctt cgtgttaatt tcgtgcttat     29100
     aacaagcacc tatatatatc actcaaacca ttgtttatga atgaacgttt ttcaattttc     29160
     ctttttttcc actggtaagt aattatttgt tatatgaaaa tttcaaaata gaaaatcatt     29220
     ctcagttact gttatcgaag aaatttctaa atttataact atgagttctc cgccaatgac     29280
     agtttctaaa ggtacaagta cttcatatat taaatataat acggaaccag gaggaaagaa     29340
     aatgagagaa tgtatattag taattggagc tcatcctgat gatgaactat taggaacagc     29400
     aggaacttta aaaaaattta tagatgaagg ccatcaagta atttcaattg ttgtggcttt     29460
     aggaagaaaa gaagaagcac accatattca agagtttgga aaacttgcca acaaggaact     29520
     gggtattgat gaagtaatat tccttgggca ccctaatcta gagttagaat caattcctct     29580
     tcatttattg acgaaagaaa ttgaaaaatt gatccaaaaa tataaaccta gtaaaatatt     29640
     tacccaccat tacggagatt taaatattga tcatcaaatt acatttaaag ccgtgttaac     29700
     agcaactaga cctcttccta ataaggaacc aatagagtta attacatttg aaactgtatc     29760
     ttctagcgaa tggaatgctt ccacttctga taacctattt aaaccaaatt attttgttga     29820
     tatcacaagt aatattgatg ccaagattaa tgcacttaaa tattatgacg ttgaaatgcg     29880
     aaaattccct catccccgtt cttacgaagg agttaagcat ctaggtagag ttcgaggtat     29940
     gactattggt gtaccgtatg cagaagcttt tgaagtgata agaagggttt ggaaatgata     30000
     agagatctta tttttcctta cccttatatc attgaaaaga tggatgaata ctataaacct     30060
     aatttcccac cagtaaaagt tagagaggaa tatagaacaa agataagccc tcaaaaacgg     30120
     ccctcaaaaa agaaactcac tatattaatc gctacatttt gggactaccc tcatatagga     30180
     ggattgtcca attatattac ggagcttagt aaaggtttaa aaaaacaagg ccataaagtt     30240
     gatgttatct cccctaatct atttcccagt gcaacagtaa aagatttacg agaggatatt     30300
     acccctaaat taaagggatt cttcctgaga cgatatggaa gttacgataa aaaaatctta     30360
     tctaatagtc gccttttata tgtgtatgaa caaatgcttc aaaaaatgga tttagagaaa     30420
     tacgatatct ttcatgcaca ggatatattt acagcaaata ttctagggag atttaatgca     30480
     aattacaaca agcctttatt tttcacccct cacggaatgt ttactttcaa gagattaaaa     30540
     ttcaatttaa tggaaaaggg ttctattgaa gaaacctatt ataaagagct agagagaaaa     30600
     gcaatagagt ttgctagtca gctcattatt cttagtgact cattccgtga ttcattaaca     30660
     gatttaggag caaaacaaga aaaaatgaca acagtaatta caggtattaa ttatccagaa     30720
     aaatattaca aaaaaaatct ggagcaccaa gaaaagctta taattacatg tgtcgctaga     30780
     ttagggccaa gaaaaggaca caactattta cttaatgcat tatcacgtat taggcaatat     30840
     acaaataatg ttgaagtatt aatagttggt gatggtgaaa tgcgagaaac tttagaaaaa     30900
     caagtacatt ccttagattt acctatggtg aattttttag gttcaagaga cgatgtacct     30960
     tatattttaa gcaaaacaga catttttgta cttccaacaa ttaacgatag cttaccgatt     31020
     gcgattattg aagccatgca tagtgggaca gcaataattt caacaaattg cggtggtatt     31080
     ccagaaattg ttaaacacgg taaaacagga atcattgttg aacctggaga tacagaagaa     31140
     ctagcacaag cattaagatt tttcattgtt aataaacaag ctcgagataa agctactact     31200
     aatgcattta attttgctaa gacacactta accacagatg gaatgataag aaaaatagaa     31260
     agtatatata ataaatttta aaggtggcta aaccttatga aacatgaaca ttgtgcagtt     31320
     gtacttgatt tgagcgcaaa tggggttgga ataattcgaa gtttatctaa aaaagggata     31380
     aaaatatatg cttttgatac agagagagct tataagatag gaaaatcccg tttagcgact     31440
     tgtaatatat gtcccaatcc tttaaccgaa gaaaatgaat tgcttacgtt tttaatcaat     31500
     ctttctcaaa gtataggaaa aaaacctgta ttgtatgcag gttctgatga ttatattgtt     31560
     ttcatttcaa aaaaccgcaa agaattgtct aaatactttt tgttcttact tccggatcac     31620
     tccttaattg aagaagtttt agacaaagag aaggcatatg aattggcttt aaagcataat     31680
     atcgcatccc ctaaaacata tatcgtggaa aatgaagacc actttgaaga agcgattgct     31740
     aatcttgatt ttccttgtat cctgaagcca gttcttggcc atgaattcag aaaaaatatt     31800
     aacaaaaaag ctatcttaat aaatgattta gatcagttaa aagcagatta ccagacctac     31860
     agggaatatg gaaagctact cattcaagaa attattcctg gagatgataa ttgcttttat     31920
     aaagtcgcta ctttctacga tgacaatatg aaattaatgg cattgttctc cttacaaaaa     31980
     aatcatcaat ttcctgcaga gtttggaaca ggtgcacata ttatgagtaa gcgagttcca     32040
     gagctttttg atatatgttt accctttttt gaagaaattg gacttaaagg cattggtatg     32100
     gctgaattca aaaaggatcc tcgagatggt gtttacaaat tcattgaaat aaatccacgt     32160
     ttctggctaa cacacagctt aacagaacct tctggtatta attttgtcta tatgtattat     32220
     ttatatttaa ctaaacaaaa tcccgagccc atcttctatc aaatagacgg ggttaaatgg     32280
     atatatctag taagatatta tctgactttt cttcaaaaaa gaaaaagaaa agaaatgagt     32340
     tttattgatt tttataaagg ttttcaagga aaaaaagagt tcgccctatt tgcatggaat     32400
     gacccaatgc catttattag aagtacatgt tctcacttgg ttaacgcttg gaaacaacaa     32460
     aggaaggaat gaaaattgtg tatgaaccta aattattata caaactattt acgaaattaa     32520
     agatttccga aaagctttct tattccatgg acgaaaaagt tatcattgat ccaactaaaa     32580
     tagagtgtct gaaatcaacc aaaagaagca gcatatataa attattactt cgaaaaaaaa     32640
     gtggttacta tccaattatt tttaaggtct atagttcaac aactcaaaaa aatgaagttg     32700
     aaattaatat atataagaaa ctccacccac tgctgaaaga atttttacct caaatttacc     32760
     tcatagaaag gaatccaaat gaagattggg tattcatgga atttgttaat caaatacgcg     32820
     gtcaattaaa atttacccca aaacatttag actacattat tcccacggtt gctaaacttc     32880
     atgctcgcac attcgaagac aaattcaaaa aatataatga tgcttggagt tcttggcttc     32940
     caacttatga ttccgcatca gcaagaaagg aacgagaaaa atacattgaa aaaacggtcg     33000
     tttttctcga tgaggcagtt agcgatgaca gaacaaaaga tttaataaaa ccttattata     33060
     agcccttaat aaaactatat agtaaaggtc cggatttttt ccctgaaata ctggaaagtg     33120
     gttcttctct tacacatgga gatcttcaca tgcaaaatat atgtagtaaa gatgttacca     33180
     aagattatcc ctggaatatt cagttcattg attgggagtc agcaagatat gctccaacat     33240
     ggtttgatat ggtagtttta gtagaaatat tattaggatt cagagcagat tggcaaaaac     33300
     acgccgaaga aattcgaaat cattgtgtag taacttacgt taacgaaatg aaaaagcatg     33360
     gaattaaatt taaaactgat ccaagagatc tttacaaaat ggcttattta caaagaacat     33420
     tagaaaaagg attgcacacc caattacgaa gaatatttga taatcgtgga ggcgagttac     33480
     taggttatca tctggaaaaa gtagcaattt ggggtaggga attagggata gattgatata     33540
     taaggtaagt tatcaatctc tataaataac aatctttccg gagagacatt taaaaatgtc     33600
     tctccagaaa aattaaaaaa taggctgtaa ttttgaatat ttttccgtat agtacaagca     33660
     attttactgt agaaaaatag aatataatat gaaaggagga aagcaatatg agtaaatctt     33720
     ataaaaacaa aaaagaaggc cagcattacg atttaaaagt catccatgac gctagcaaag     33780
     acaaacatga ctgtaagtgc aaaaaagata aatatgaaga aaaagacgag tacaagcaca     33840
     aaaaagacaa atacgagtct aaagacaaaa aaaataaata taaagaaaaa gacgagtaca     33900
     agcacaaaaa agacaaatgc gagtctaaag acaaaaaaga taaatataaa gaaaaagacg     33960
     agtacaagca caaaaaggat aaatgcaaat ataaaagcac agattacgat acaatgtatc     34020
     cgtaaataat ccttttttaa ttatcaaata aaattcaatt aaatttctaa ataaatatcc     34080
     ctttttaatc acaattcacg attaataaag ggatattttt cacctaagta ttatacatat     34140
     tcattctccc agatatttga ctcacctaat ttgtctcaaa aatgtaaaga agcaatcttt     34200
     ttatagcatc aataagtgag cagcaatacc acattaatat ttaaacgttt cctaaaaata     34260
     gtcttatgaa actttattaa ttcctctagt aacatagcag tttttaaaat agaccctaag     34320
     tatgtatgtc tttaattaca gtaatgtttt gtgttttggt aagttatgta ggggtcttta     34380
     ttagaaaatc agtttgtgta tagttagtat aataggatta cgcctaacct ttttatttaa     34440
     gtcgattaaa agagtgatta gttactcaca atatgtctct tggtttctaa acttttttag     34500
     tattcgtgag aattcaaacc ttaaggattt aacattttaa caatcagtag tatctctaag     34560
     ttttaaagta attcctactg ttttattact ctttgtaaat aacacccttt attatcaaat     34620
     atattccaga taaaattaca taaccattcc ttcattaggc ttgaaagaat ggctatgtag     34680
     cttctattaa tagttacata aaaaaagaca tataagtgta tatattatcc ttttttccac     34740
     aaactaataa ttcttaccgt tgcaccagaa tctttgtgct cacttttctt ttttttcttt     34800
     ttagaagaac tttcttctga atgcttttca tcgtcccagt attctttgta acccataata     34860
     atagcacctc tcttccaatt ttaataatat tatatgtaaa aacaagcaat cggaaagggt     34920
     acttgtacca tatttttaaa aaaatttctg atttaaaata acaattaaaa aataaatagg     34980
     aatttcttta ataacaccaa ataacaaatt ataagtcaac agattatcaa aacaattaac     35040
     atcagctaga attattaatt tgcactacaa aatatatttt ctaattaacg gacaagaatc     35100
     caagcatctt attaatccaa gaataagata taaaatatgg gaaaacaaca aaattcacgt     35160
     ctccctcggg gaatatatcc tgaagttcaa tagaaaaaga gtcataagat actcgtctaa     35220
     atgctaactt aagtaaatta atgaatcttt tatacattca taagtagaag gttcaagtaa     35280
     ttaaccttta agttacctaa cagtaataac aatgaagaaa tcaccagccc agattttgaa     35340
     aatatgattc ttcattttta ggaggaatag atttgaaaga tttttcacca gcaagcaatc     35400
     ataaacataa taaggttatt cgaaaggaag acttaaaaga atacgagata atcggggacg     35460
     gagcagatgg tatagtttat caactaacat ctgatcggtg tattaaattt ttttttaaag     35520
     aagaaacaca acaaagagaa ttggaagcac tgcgaatagg ccaatcatct ccagtaatgc     35580
     cacgtcttta tcaatatggt gcaaacttta tagttatgga atatataaaa ggattttcac     35640
     tcgcacgata cctaaaaaag catggacagt taacgaagcc tctagttgaa aagattttaa     35700
     acatgttaga tgaactaaaa aaattagggt tcactagata tgatgcagaa atacgccatg     35760
     tgttaatcaa cgagttaggg gatttaaaag ttattgatca taaaagagct tttacttctg     35820
     accaacctgt acctgttaaa ttattgaaag gatttaaaaa actagggtta acagacgagt     35880
     ttttaagatt tgtaagagaa attcgcccat ccgtctacga tgaatggaaa aaatataagt     35940
     aaagatatta ttatttcatt atgcaggtag tagtgaaagg ataatccata aaaacgaaaa     36000
     ctaatattaa tcttttaatt ttataggata tccttttcac tttaatgtaa agtccccata     36060
     atcaataaag acaattttcc ctttctttgt taaggctaaa ttaggtctta ctaaatcttt     36120
     aggtcttact ccatattgtc taaacctctt ttttaaatac tttaattggt tatcgtaatc     36180
     ttcagttcta ggtactggga ttgtcatttt tttcattata atccacccat atccgacttc     36240
     cttaattgga catagatgtt cttttaactt agcatgacag tacttatata ttataaattc     36300
     atttttatta cttttaagtc ctaactctga cgtggcaact tttaatacat atccattttg     36360
     aagatcataa gtgacccgct cgtatccata tccaattatt ttataatcta attttaaggt     36420
     ccttactgcc gctttagtca tccactccgt atcttgtgtt ttatactgct tcatcttcgt     36480
     tatccacaaa ttaatggact ttatatcttc atcacgcaaa atagcactta ccacttttcc     36540
     tcctcttttc tctaaaagtt tgactatatg atatatttaa aagaaatttc cctattaggc     36600
     taatgaaaat attaatacac ctttgttgag ttctacatag atcttaaaat tgagctttct     36660
     catttagtat gaattattaa gaaaaggttt aataatttac aaggcaatta tataaggggg     36720
     taaaggtaaa tttaacaaac ttgaacagtt caaagaaatg tataagtagt atagaaatta     36780
     ttctattcat cagtttaaag acgtttttat ataggggaaa gaaggtttac tcggagataa     36840
     taataggtca aatgaaatta agattaaact aacattcata ttatttaggg aaatactttg     36900
     actgctgaaa aagtcgtact gccgtcccct tgtatcatgc cattaatact acttctcatc     36960
     cctactacta cttgatctcc cgcatttaac caaagagttt cacttgttgt tataattcct     37020
     ggcctttttc ccgcaaatgc ttcattatct ctcccttcag tttcgccctt gttagttata     37080
     aggaaaacta tatctaagtt atatgggcca ctattaaaag gtctaaattt aactgatgac     37140
     gttagggtat atactccatt ttcccttgga acaaaagtag atgtatttaa atcatattca     37200
     ttcgccaaat catattgttc agtttgaaag cgaaccttgt tagcattgtt ggcctcaaga     37260
     ggagtattta cattattaag agctctaaaa gcagaagctc ctgctcttat gtcgttaaca     37320
     tacggtctat atatcccttc ataattataa ggtatataat aatttttcat tttatcaacc     37380
     ccgtttcctg tgttttctat acagtttatt cctttataga aaaagggtta gtattcctag     37440
     cctactacag gcaaaaatac tactttgata tttttttcta acattctcta caataggaaa     37500
     cccatcaagc aatgataaca gttgttgccg atatcaattg ttaaatgtaa aagataaatc     37560
     tcaattggat tccttctaat ttattatata tacaaaattc ctttcttttt gtgcttgtcc     37620
     agttatgcta aatttctgta tatttaataa ataacttact tttcaaccca ctaagtaaga     37680
     aaaaacaatt atgctctgct tttgaaatcc ttttatatct tcataaatac ttatcttgta     37740
     aggaataaat ccgttcttcc actttacttt cgagcaagag ggtgtgcata tgcaaaaacc     37800
     ctcttacatt attgttacac attgtgttta cgttcattta tcatttggaa aataaactct     37860
     ttgttatttt ctaagagctc ttttggagtt gtattatgat tcttggcatg acgagcaaag     37920
     ttagttttac tgtaccattg gtggcataaa ggacaaggta gttcattttc aacctcataa     37980
     tgagctgaag tccagcgact agaaaaagaa gaagagctat ttgtagtttt ttttgtatac     38040
     ggtgtattct catcttgtat agatttttgt attcgtcctg tagttgcagc aacttcgctt     38100
     gtagtcgttg tgtatagatt ctcttctagt tcttccctga tgagtaaata tccagcttcc     38160
     gacattgata gccctaactc atcacaacgt tctcgaaatt gctcatatat accttctggc     38220
     aatcgaatcg gtaacacttt acttgcttct tttgatcttg attgacgagc atacttatct     38280
     agctttccca ccttatcacc tcgtgtatac aatttgtata catattcagc acttggtcct     38340
     catgttcctg ccatttattc atatacattt tgtatacgtt ctgtattcgt agatgatttt     38400
     ccaataacta taaatatgat aatagaaacc aatagattat tttggatttg agtcaataat     38460
     ttggacacaa aaaagttaag tcttaagctg tttttctcat ttgatcctca attgcttgag     38520
     gggtttgata accgaggcta ctatggattc tgtttcggtt ataccatcct tctataaact     38580
     gaaatatggc taattttgca gctgaatagt ctgtgtattg cgtatgatac acttcttctt     38640
     tctttaatat ggcatgaaat gactctatgc aggcattatc ataagggcag cctttctggc     38700
     tgaaagactg cttcatctcg tattcgtgga catgctgagt aaactcacta ctcgtgtatt     38760
     gtgagccaag atccgtatga agaagtaagt cctttccggg cttttgagca gtgtaagcgt     38820
     tcctaagtgc ttctataacc agttcggatg tcatggaacg ggaaaaagaa tagccaacga     38880
     tttttttaga atgcaaatct aatacagatg ccaaatagca ccaaccatct cttaacgtag     38940
     ggatatacgt aatatctgcc acccatttct cgttaatggt ccgtgtagag aaatctcgtt     39000
     ttaacagatt atctagttgt ataacctttt cttttgacgg ataaggacgg tattttttct     39060
     ttgtgatcga acgaattctt gcctttttca ttaagcgttg aacacgcttt aggcttaggt     39120
     aacacccgtt atttactaaa gtctgatgaa ttttaggagc accgtaacgt gctttacttt     39180
     tcacatgaat tcgttggatt tctttcgtca gcttctgatt ttcctgttcg cggtttgata     39240
     ccgtcttctt gaacgagtgg tagtagctac ttcttggaat tgttaacact tcgcacattt     39300
     tttgaacgct atattgttct ttataggtgt cgataaaatg gttgagctct gcttctgtta     39360
     ctttttcgcg aatatgacca tagccttttt tagaatatcc agttcttgtt ttaaccgaag     39420
     gttttccttc tgaatgtcag ctaattcttt tggtgttaga gagccttctt ctgaactgat     39480
     aggtgtaaat gccttcaccc atttatagat tgttacttct gatacgccat attcgctgct     39540
     taaatcttta accgagtttc ctgcatgata tagatccaca atcgttttct taaactcatc     39600
     attgtatgtt ttgcctgcac gtttacgttc catttcggac acatcctctc aaaagtcatt     39660
     gtaaggactt aattaaatgg tgtccatgaa actatactaa ctccaatttt tcaagaaatc     39720
     atattaatta ttattttaat actaaatata aattaacaat taacttttat taagatatat     39780
     ttataatctt tttgttttta tgtaagagtt ctaaaaaatc attttatata aatttatttt     39840
     aattattact tcatttgtag aaaaaggcca tatttgtcgt cagtaagagt aaatagtaaa     39900
     acatttgttt tttaatagat gttttttcat ttacttatta catgttatca tttttatgat     39960
     tgtatttagt aatcgctttt agataaaaaa catttgtata ttaatataaa ataaaaaaat     40020
     cctaagatta ataagttcat ttcactttta ctgatatgtg ttatagatag gtataaagta     40080
     aattaagaaa aataaaatat aatctagaac cataattcta tcttttgtta gaaaaataaa     40140
     ctatttccta aaaatcgttt tttaacgact aataaacatc aaatgccttt aagtaataac     40200
     agacttgtta cttaatagct tttgtaataa ttaactcata cattatagat gagcatactt     40260
     ttgtgggatc tgggatagtg gatttgatgc cctaaaacct aaggaaaagg ggcatccctc     40320
     catgaagaaa agaaaaaagt cactgaacct aatcagtggc tttttccttt cattgaaatg     40380
     taattgtcta atgatgctca gaaacacttt aggaagtttt ctaatttcaa aatgaaccct     40440
     ttcattcctt gtacatattt taaagatata aacatatagg agtgaaaaca tatgtttttt     40500
     cgtagatggt ggcgctggca atggttacgg tggtggagat catggttgcg aagatgataa     40560
     cagtgatgtt aataaacgaa aagaagtcta tggtaggtcc gaccgagaat attgtttatt     40620
     cgcatgataa tgtaataaaa agaaagaaag aaacaaatca ttagtaaaca aagacatatt     40680
     cctatatgga aaaagctatt agaaataatt tcaacagctt ctctcttgat aacaaaatta     40740
     tgtaaagtag tctagacagg catacaagca aaattaatat atttttaata tagctatagt     40800
     atgagttaaa taaagggggg agttttttgt cttcatgtcg aaaaaaacac tgttatggtt     40860
     gctctaattg cactttgaac tcctgttatt gcacaggacc aagtatatta tctgcttttg     40920
     ggtctttacg taaggaatct ggacaagtta tagacgttga tgggacaaaa gttgattatg     40980
     acttcgtagg tccttcggct aatgtaacgt taaatatagt taatgataca ataacaatta     41040
     atgaatcggg ggtttacgaa atttctatga gtttaactct tggaattaat ccaacagacc     41100
     ttgctagggg gtttcttttt gttaatgatg ttccattaaa tttttctgca gtaagtttaa     41160
     ctgtaacgag cagtacactg gctttagcca ctgtaagtaa aactatacaa ttagatcttt     41220
     tagctaatga tgtaattgat gttcgtattc ataaagttgg tgatgcagtt attgtgggta     41280
     gctcttctct tactataaat cggattggtt aataaaaatt taaattaagt atattatatc     41340
     cataataacg tatttaaaaa atcagcaatt aaggtgcgat atcaagaact agttcattaa     41400
     ctagttcttt tttagataga cgactcctaa tggacgttag ttatacgttt gctttttact     41460
     aaaaaacata taactaatcg ttaaatattt gctcttttaa cacttctgtt aacaacgatt     41520
     atgtcaatta gaagcgaata gaagatgcat tactatacaa ggaaaacggc cgggattaaa     41580
     gtagcttttt ctgacttcaa tcattttcac ctccatgatt gaagtcttgc atggttatta     41640
     ttattctaaa tggagaaatc atgtttattt aaccgtttta tatggataga agaaagacac     41700
     tggcattata tcggccaatg tcttttttaa gataaaagat tcttcgtcta tatagtatgt     41760
     ttaatattat tttctgatta ttcctgataa agtttattat gtcaattaat tttcaataaa     41820
     tatagaatat ttcgcaagaa cagcgatgca aagcaagtaa taaattataa gaagcaagaa     41880
     attcttgatt taaatattgc acttcttgcg tatctatgtt gaccccgaat ggcacacatc     41940
     tgtttgttgg aatacgtaca ccatttgtgg ctaatacatt atattaaata aatgttcctt     42000
     ctccattaac ttcattgcat acaattttta attaatataa agaattcata attaatattc     42060
     caataggata agagttactt ttaatatcaa tggtagaaat cactgtattt gtagctatat     42120
     taataaccga tacattgtca ctgaactcat ttgtgacata agcatgagtc ccatttgggg     42180
     taatagctat tccagatgga gcatcttcaa cgaaaatagt agcttttacc gtgtttgtag     42240
     ctgtattaat aaccgatata ttattactac ccgcgtttgt aacgtaagca tacatcccgt     42300
     ctggtgtaat ggctaagcca gatggtttat aaccaacgaa aatagtagaa attactgtat     42360
     ttatagctgt attaatgacc gatacattgt cactgaactt atttgtaaca taagcatggg     42420
     tcccgtctgg cgtaatagct actccagatg gtttataacc aacggaaata gtagaaatta     42480
     ctgtatttat agctgtatta ataaccgata cattatcgct tcccgaattt gtaacataag     42540
     tatatctccc gtctggggta atagctatct cactagggtt tgtaccaaca gaaattgtag     42600
     agattactct atttgtagta atatcaatta ccgaaatcgt gttattaccc tcatttgtaa     42660
     cataaacacg tgttccatct ggcgtaatgg ccagtccagc tgggttgtct ccagtgaaaa     42720
     tagtagcagt cactgtatta gccatagtat caatcactga tattgtaaga tctccataat     42780
     ttgtaacata aactcgcatt ccatctggtg taatagccag tctgtatggg atgcctctaa     42840
     ctaaaatgtt ataaatcatt atattagttt ctgtatcaat tattgaaacc gtatcatttc     42900
     cgggatttgc aacataagca agaatactat aaataatcgg aggtgttgtt atcaattgaa     42960
     ttctcccttt ttcaataata aaaaatttat ataactttat atccaaattg ttgtgaaaat     43020
     cgagagcgta aaatatcttg tgtaaatgaa taaatacaaa aaggaagacc ttttcttgta     43080
     gaattaagtc accacaacca attcaaagaa agaaggtcct cctatgaatc agtttacaac     43140
     agatcttgtt caagctctag ttcaaaaaga aaatgtgacg gaaattttcc gttctcactt     43200
     agaaaatgcg gttaatacac tcttagcgag cgaattgaca gcttttttgg actacgaaaa     43260
     atatgatcgt attggattta atacagggaa ttcacgaaat ggttcgtacg aacggacgct     43320
     gcacacagag tttggagaac ttcatctcgt tattcctcgt gatcggaatg gcgactttaa     43380
     gcaacagacg gtggctcctt ataaaagatc caatgatacg cttgaagcgt ttgtcattca     43440
     tatgtttcaa aagggtgtaa cgacagctga aattgcccat ttaatggagc gcatgtatgg     43500
     tcatcactac acgcctcaaa ccatttcaaa catgacaaag gtgatgtctg aacaggtaga     43560
     agccttccgt gatcgaacct tgtgcgcacg ctatgcgtgc gtttatttag acgctacata     43620
     tattgcttta aaacgggata cagtgtctaa agaagctgtc tatattgccg ttggcattcg     43680
     cgaagacggt tcaaaagaag tgcttggcta tacaatcgct cctaacgaat ctgcctttgt     43740
     ctggaaagaa cttttagaag acatcaaatc tcgtggcgta gaggagattc tgttgtttat     43800
     ttccgacggg ttaaaaggaa tctcagacag tgttttttct atctatccag cttcttctta     43860
     tcaaacatgc tgcgtccatc tttcacgtac gattgctcat aaagttcgtg tatccgatcg     43920
     agctgaaatc tgtgaagact ttaaatctgt gtaccgtgca gaaagccttg aaatgggcca     43980
     acaggccctg cattcgttta ttgaaaagtg gaagtcaaag tacccaaaag ttacaaagcc     44040
     attgctcaat aactcttatt tgttcacgtt ttatagcttt cctaagtcta tttggcgcag     44100
     tatttattcg accaatctca ttgaatcttt taataaacaa atcaagaaat atagtaagcg     44160
     taaggaacaa ttcccaaacg aagagtcact tgaacgcttc ctcgtttccc aatttgacca     44220
     gtataatcag cgctttgcca caagatgtca cattggtttt gatcaagctc gcgcagagct     44280
     acaaatgatg tttaaaacaa actagtgaat aacgtctata agaaaaggaa attcgtattt     44340
     acacaaaatt attgacggtc cctgaaaatc ttttatatta taaattaaag ttaattatga     44400
     aatagtccat atattattat tttttttgat atttcgagac tgacttttac tgttttaagt     44460
     tcatatactt tttcaaaatc tttttgtttt tcaaaatcat ctattgcttt gttaatgtga     44520
     ataagggcct tgttaacata acctaatact tcatgtaaat tttcgttatc agggtgtatg     44580
     atagttattc cctccctttt ttgcggcttt actatataaa atgattaatt aattaaaagt     44640
     gattggacaa cttagaaaga taattagttt tcatgtaata aatttactaa attaagtcta     44700
     gaggaatatt attactttca tgaaacgagc attgggtttc tttttttatg cctcccatag     44760
     agcccagata actaaaaatg aataaactat acagcctaaa acaaaaaaat actgctcctg     44820
     aacggtggtt atttctgttt agacgcaggt gtatacagag taataatgtg aaccatctcg     44880
     agtaattttc tccaataata gaaaatattc agcttaggca agttacctga ttgagaatga     44940
     aaacatatag tgtattaaga atagtttatt taggtaatgg gattattaac ttttaacctt     45000
     catatttttg catcattctg acctttataa attaaaaagt ccctagaaca aacatttcta     45060
     agggcttttt ttaataattg tgattataca aaaagaaaaa ctatcttata ggagaattaa     45120
     ggtagttttt tcttgagcgg acagacattc aaaccctctg ttagaaaatt aggaggatac     45180
     tgaaatagaa tttcttaatt tatagtatgt aaagtagcga gaagggtgtg gacgagtgct     45240
     aattctatat aagatgtcta tttcctgaag aatccattat gtagtgttac aataaaagat     45300
     tttaatttta ttaattaatt tatttttatt acttttaagt gacattctat taaactgaga     45360
     ctagctcctg atgtaacttc cacaagagaa acatttataa agcaaaatag acaattctta     45420
     agaaggcgct taaaaaagga ggaaatatta atgaaggaaa aacttcatct gggttgtgga     45480
     aaaacaattc taaaagagtg gataaatcta gatatcatga aaggacaagg agtggacatt     45540
     gtagctgact tagaaatgtg ttcagaaatc cctcttcctt ttgaagacaa tagcatagat     45600
     gaattttatg caagtcatct aatagaatat atccacttta cactccctct aatgcaggaa     45660
     cttcacagaa tagcaaaaaa tgattcaaaa gcagtttttc gccttcaata tggattgagt     45720
     gatgatgcat atgtgatgag accatacttt atagattctt ttgcttgttt ttcacaaccc     45780
     tattattgga gagccgatta tggatacaag ggtgattgga aaacggaaaa aatctcttta     45840
     tttgttagtc aagcagtata taagaaaaaa tcatttcacg aaatatacga ggacgtgatg     45900
     agaaagcgaa atgttgtaag tgaaatggtt gtagaattac gggctattaa acctataaga     45960
     gcaacaaaaa aagaattaca aacacgtcct tttattgaat ttttaatggt gtaaaagtaa     46020
     tagctttctc tctgttcatt aaaaagtaag tttaagttga ttctaattgg ggtcactcta     46080
     gaatgaggtg gctttttata aggtttcaca cgtataacaa gtaacgaaaa aataacttcg     46140
     aattaatgag atcatatttt taccacaaag actacatttt accttagctg catatgtata     46200
     aaaggtacac tttttataca tcttattttc attcacttgt agggagatta ttgttatatc     46260
     aaggatgtgt aaaaagctgc atattggaga aaaagtgaca cgtggagaac ctttggtata     46320
     ctagggttct ctttttcgtg aagttccgtg ttaactaagt ttatatatca tatacagctt     46380
     aaaaacagaa aaaactatgt ttttattgat aatcctaatc atcttgagta gtttgctcaa     46440
     aacattggct tttattaatg tatctcccat tattatcaag ttagattgca tattttatta     46500
     tttatataac ataaaattta tagttgcatt tttaatatta aaattaggag ttgagtagat     46560
     gggatcaaca cacttaacgg gacgagtaat cttcaaaggg gaccctggtt atgaagaagc     46620
     aattaagaat tggaaccctt atgttgatgt ctgtcctctt gtctttgttt ttgcacaaga     46680
     ttctcaagat gtaagcaatg ctattaaatg ggctcgtgag aataaagtgc ccttgcgtgt     46740
     aagaagtggg cggcatgctc tagataagaa tctttcagta gtaaagggcg gcgttgttat     46800
     tgatgtaagt gatatgcaaa aagtttcctt agataggaaa aatgcgattg caacggttca     46860
     aacaggaatt cacgtcggtc cacttgtaaa aggattagct cgagaaggtt ttatggctcc     46920
     gtttggagat agcccaaccg ttggaatcgg aggaattacg atgggcggtg gatttggggt     46980
     actctcacga tcgattggtc ttataagtga taaccttctc gcactggaaa ccgtagatgc     47040
     aaaaggaaaa attattcaag cagatcaatc tagtaatgag gatttactat gggcttctag     47100
     aggtggtggt ggcggtaatt ttggatataa tacagaatac acctttaaag ttcatcgtgc     47160
     ccctaaaact gcaaccgtct tcaatattat ctggccatgg gaacaattag aaacggtgtt     47220
     taaagcttgg caacaatggg caccgtttgt agatgaacga ttagggtgtt tactcgagat     47280
     ttacagcaaa gtaaatggtt tgtgccatgc agaaggaatt ttcttgggta cagaaactga     47340
     gctgattaga ttattaaaac ctttactaaa tgctggaacc ccaactgaaa caactataga     47400
     aacattatct tatccagatg ctatagattt cttagatcct gacgaaccaa tccctggtag     47460
     atcggatcag agtgttaaat tctcttcagc gtgggcactt gatctttggt cggaagaacc     47520
     catttcaatc atgaaacaat ttttggaaga agctactggg acagaatcca atttcttttt     47580
     tataaattgg ggtggtgctc taagcagagt gcctagcaac gaaacagcct tcttttggcg     47640
     cagtccattg ttttatacgg aatggactgc tagttgggaa aataaatcac aaaaagattc     47700
     gagtattgca tcggttgaaa gagtacgcca acagttgaaa tcatatgtaa caggctccta     47760
     tgtgaatgtt ccagatcaaa acatcaaaaa atatggaaaa gcatattatg ggtcaaacta     47820
     tgaaaggcta cgaaaaataa aggcgaaata tgatcctgaa aatgtatttc gttttccaca     47880
     aagcatacgt cctaagtttt aagtctatct tttgtattta ccagcttcta tttattgagg     47940
     taaaaggtat tcaaaattag ggattagtaa tacctgcaaa taaagaacac ctttaagtaa     48000
     aaaacgggta tgtagtccct aacaatgact tggaggagtt ttttctattg gaagaagagt     48060
     tagctataga gtaatgattc ctcgatcttg agtagtttgc tcaaggcctt aaaatttatt     48120
     ttttaagttt tcaagttcca aagagtagaa aggggaatac attaaaatta aaaaaatcat     48180
     tggcaatggt ttatgttact ttcatcactg aatcaaaaac ccttggaatc attattttca     48240
     agggtttttg attctaataa tttatgacta tgcttgtttc ataatacctt tctacacagg     48300
     atattttctc tttgcatttg gaaaataaaa attaaattga gttttaaaag aggaggtata     48360
     ttttcgaatg gagaaaaagc ttattatctt tatacacatt cctaaaactg ggggaaccac     48420
     gttaaatgac attttcaaga aattatatgc tgagaatgag atatatgatc atgtccccgt     48480
     agaagcaatg aataagcatt ttagtcagtt aaaggaggaa gagaaaaaaa cactcaaagc     48540
     aatatctggt catcatttct atggcataca tgatcttttt tctaaatctt atacttactt     48600
     tactatgatg cgcaatccta ttgagcgtgt gatatcatta tattattttt taaaaactta     48660
     tcctggttat tatcaagaga atatgagaaa tatgtctttt gaagactatc ttgattggga     48720
     tccccaagct aaaaacggtc aaactcaaca aatttgtggt atacattctc aaatcagttt     48780
     agaaaaagca aaagaaaatc taaaaacatt tgaagttgta ggaataacag aaatgtttaa     48840
     tgaatccctt cttttactaa aaaataaact tggttggaat gatatcgcat acaaaagaaa     48900
     aaatattacc aaatcacgtc ctctacttca ggaagtgcca actgagataa taaaaaaaat     48960
     agaaaaaaat aatgagttag atatagagct atttgaatat ataaaatcta attttattag     49020
     gcaattgaaa gatttttaaa aataaattca catatttatt tggatctgca ggaataaaaa     49080
     gcagaaaaac tccctatttc cgtagggagt ttttctgcta caagaattac cacataggtt     49140
     gatgctttgc tgcagcttga gtagttttct ctagaaatct aattttattt attaaaatta     49200
     gattattgtc taatacaaca tatttataaa gtctatataa tgtattatac gaccttttca     49260
     tcttccttag ccatgttctt tttttaagaa catggctttt ttgtttccta aaatgaggat     49320
     tatattgtct aaaataaata tgtctatttt tatcattaac tatggtaatt atatcctcca     49380
     aaatcaaatt ataagcaacg ttgcaaatta aatatgttgt ctgaaaggaa gagcgtatga     49440
     gtagggttag agaaggaaat cgtcgtctta cttgtgatat tccagtagag ctgcataaga     49500
     aattacgttt tgtagctgtt gaaaatgaca caagcgttac gaaatgagta aaagcaattt     49560
     cagaaaaaca tgtaaagaaa ataagaaaag aaaagtaaac aaagaaaggg cacttcctct     49620
     ggataggaag caccccatgt cgaaattaaa gtattagtag actctattat aacatgggtt     49680
     tccctcaaaa aataggagga gctcatcatg gatcaaacta aaaaactgtt aatagggatt     49740
     gacacaattt gagtgttgct tctgatttaa ttgatgaagt ttcttgatta aaaaatgtag     49800
     aagaggaatg taaaattctt aaagaaacag tatttctaaa tcaatttaca atcgtctaac     49860
     aacaaatttt tgagcttgct gtggatggtt attctggaca agaaatgcag ttgcttctct     49920
     ctaaaggaga aaccacaatt aattcaaaaa gacaaaatat tgtatgcaaa ttagatgtat     49980
     cctccatgaa ggaagccgtt gaaaaatttc aacatttaga gtacgaatca ccaagaaaac     50040
     ttcttcaatc ttgataaact gacgtgacct tcggagggac ttaacatcaa cagaatatac     50100
     actataaatc acctgtaaag gggacgttat atccacacta tataatcagc agggaacctt     50160
     aaggtgttca cctaagcaaa tttcgtggta tcacggtgaa gctaggctct gcctagcccc     50220
     acacaccctg tgggggcaaa aaccccttat gctcttcaag atgtttttta cttttttata     50280
     ttgaagtaga aaaacactga aaaggaaaac aaagatagag attaaagtga gaaatatgtg     50340
     tctgattgtt gtgaagaatt tagatgattt agcaaaaagg aaaggtcctt ctagacaagc     50400
     ttttttgaaa gaacaacttg aaacactgtc aattgttgaa gaagaagcaa agagagaaca     50460
     agctattgat gatttatatg attgaactat aaaggcaatg gaaaagtgtt caggtccgat     50520
     aacaaatgtg aattgtattt ttcataaaat cacaggcaag gatgaagaat actgacagca     50580
     ggcaaacaca gaagaatgat ttccttaatt gaagaagttg acgaatatct tcaagaacat     50640
     atgcgaaaaa gaagctatct ttttcctaga aataccatta cgtatatcat ttgaagatat     50700
     aaaaaattaa aatagctata aagactaagt ggccgcctta aggcagccaa aatcttacta     50760
     ttaggagtag ctcctcttgt gtgcttaacg aggaacactt aatttttaca atcaaaatat     50820
     tacttgccaa ataaacgagc aaaaaagctt ttttgctgtt ctttttcttt tgtagctaca     50880
     atttctaata attgttgttg gttttgtctt tgtgactggc gtatgtagtc catcatttct     50940
     ttatctctat tattaatttg ttgacttatt ctttccgcca agcgttcttc taattctttt     51000
     aactgtttgc ttgtctgttc ttgttctgtt tgtcttctcc tttctgatat ttttaaagca     51060
     tttttataat gatctagcat ttctagtaac ttattattag cagattgttg ttgttttaat     51120
     gtatctaaca caacatcttt tgtgtaattt tcatgttctt ggggaacatt tagctcccgg     51180
     ttattctcct cattaaacaa gtgttcttct tgtgtgcttg acgaggaatg gtttctatcg     51240
     aaccctttta taacagccat tgaagctatt tctaaaggaa gttttttttc ttgaatagca     51300
     tactttaagt ttgacagtaa agtttgatca gtaacagaat agtaacgctt ctttctgtta     51360
     tcttttacaa acttatagcc atgcttttct aattcgatac accattttct aatattgctg     51420
     gaagttgtat ttaagcgctt agccatttct tcagcattta ttgcatcctg cttgatatcc     51480
     atggttggcc tccgatccta atatgttatc tttgtgcttt ccatataata aaattttatc     51540
     tacacaaatt cgatagaact tgtgtatttc ctttatttag tataatttga aagcataaga     51600
     atctggtttt tatacaaaaa atccaagctt gatcgtcgct aaaatgtgtt gaatcaataa     51660
     tatataaaca ataaatctga aaataattat ttgcatttta gcgatgtcta aagtttataa     51720
     tttccccgtg ttatttctga taattgttgt tatgtaaacc aactttgtat taattaagga     51780
     atgaaccttt aggttttaag aaactaaaaa gccatttcag aatctaatag ttaaggtttt     51840
     tatttgaatg ttttatgaat aaaaagatga tgtaatcata taaagtaaaa gtagaagtaa     51900
     atcaaattat tatcgtttta cccctgtgaa tatagagagg aagttgaaga attgattaat     51960
     gtaaccatta atttaatgaa agttattttg catagcacta tgagaaacaa cttggttttt     52020
     atgaattgtt actttaattc aagagccatt ttgttatcca attctaagaa gctataaatt     52080
     attttgttta tcttgatggt tttaattact atcaatacag atcatggcac gaactaacta     52140
     tacagccggc ctgcagctaa aaaatagaaa aaactactgg tgccgcctaa tcagtagttt     52200
     tttctattat acaaaatcat ctaataggag cgagccttta tggtgtctga agtaacttgt     52260
     tcaaactctt ggataatata tgatgaagaa ttcatttgaa gacgagctgt taaatccact     52320
     atctattgct tttcctattc tcttttaaga ttaaaagcta tcttattaat agcattccgg     52380
     gattttgtga atcattttaa tatccccatt ggctttaata ccattaccca atggaatttt     52440
     caaatgaatg ataatctatt tatcatttta ttattgcatt ttgaaatatc ctactcattc     52500
     tagctttttg cagttgtaag ggattaatag ttgggataat gttaggaagt acaggagcca     52560
     tgagattacc tacaagatta ctgtgagcta tatcactctt acccgttaca gggttaataa     52620
     aaggacccgt aggatctata gcattaaatt taaatatatt attaaaaggt tgtttatcaa     52680
     gttcagtcaa aagaacatgt cctgcttcat gtgcaaatgt aaaaggtgca tttaaagctc     52740
     tgttgctcaa tgcaatagag ccaaagagcg taaatttagg tataccatct ttaattctaa     52800
     aatcctcaat tatgactcct cctgcaccta tagggctagt actacccgaa gaaaatgcaa     52860
     aatcattccc actcgtataa acaacgtata tcccaattgg attgccaatc ttatgtttaa     52920
     ctttcttaat taaaccttta acaggacctt ccattgctgc ttgaaaacct aaattggtca     52980
     catctattat tgttttcatt tcaaatacag gttgtggaat aaaatttata ttacacattc     53040
     ctccgccatt ccatatctga tttgccaaat taatgtctcg attaaatctt ttttgccttc     53100
     cattgaaatc actaggctta gagcctgcgg taaagatacc ataaacatta acttgaaggt     53160
     tattttggta ttgttgatcg ggtctaattt ttaatatttg attagaccag gaaaccatat     53220
     ttgttttttt ttagactttc tattattcaa ttgatgcact tccttttata tcgttaatat     53280
     aagctatgaa actacggcta atttgcttgt atgcttatcc actaacagtg ataaaataaa     53340
     aattttcaaa gctaaaatcc agtgatataa cttatacaat aaaaaaacta ctgaactcca     53400
     atcagtaatt ttttcaatca tgatagatag aagtttaatt tactatgttt ttcgaaacct     53460
     catatataca ttcaacaaag ggccccatta caagatgatc ataaatacgt ttacaataaa     53520
     gatatctata ttagctaaaa gaggttagtt aaaaacgcaa tatccaaagt tgctgtcacg     53580
     cactctaaat aaatgtagtt attccgatca ccttttttca aagtttgggc tatagccttg     53640
     ctttacgatg aatagtaaaa ttgttaaata cttaaatagt tcattagtaa aaataggttt     53700
     ttatacccca tcttaccgtt aattaggatt aatgattata aaatatgatg ttccctaggt     53760
     taaaggagag ataaaaaatg ggagacaaaa caaaagatgt actttccatt gaaattaaaa     53820
     taatagacgg gagaaattac acaattaaag ataaacaatc tatatatgac atagaggagc     53880
     aattaatcgg taacaaggag ttacatttag gtagattcct ttcagttgca cccgacaaac     53940
     catccttaga taaacagaga aaatttgagc atatgtattt taatattaac catattctaa     54000
     gtattaaata tctaaaaaag tttgattgaa agaggtaaag acttttttgt agttatacct     54060
     ttcatgctat ttttcacaga tcataacaca tatataaaag gtacgtgttt tattgattac     54120
     ttccaatttc acctactgaa ggaacattga aattccattg ataacgatgt atcaaaacgt     54180
     acatattctg gaaaaacaat ccttattgga cgtctacttc cccaagagtt cttttgagtg     54240
     ggattctaaa actaacttta tataccgtat acactctaaa ctgaaaaaac tcccttaaac     54300
     ggtagggagt ttttctttta actaacgaga ctcaagatgt agtccacttt attgattgga     54360
     caattcactt gaagtgagtt aacgaataga gtttatttac tagttaatac aaccttacct     54420
     tcattccttt ggaaatacat tttcctcaca tcaaaagcct cttcagttaa tcatcgaata     54480
     agccttcaat gtctgtaaaa ttcagtatgg taactaaaat tttatgttct atacatttta     54540
     aatacagaaa aacctactgt ttgaaagtag tttctttctg tcatatcgtt tgtttttaat     54600
     tttaatcctg gctttataaa gactacaagt gatatatttg ttcgaaagaa cttgcaagat     54660
     aatcaaatcc tcgaggacgt aatgtttcaa attgttgatg gatttttagt ctttcctctg     54720
     atccttcagg aagtttgtaa agttcagtaa caggctgttc gttatttaaa cattcaataa     54780
     ttctaaaaag cattactcga aaagcttttt ttagttcatt atattcattt ggaaaacgct     54840
     cgtccagtgc attatattca actaatgtct gatgcatatg cataaatgat agttctttcc     54900
     attcaagaga taagataaga acatctatat ttggatgttt tttaacgaaa cgataatgat     54960
     taccccattg ttctttaagt tttttcttag atattggatg ctcttgatga taagcaactg     55020
     tagagggatc taaaacaaat tgcgctccgt ttttatataa acgatatcca atttcccaat     55080
     cttctgcccc ataaccaaca aaggtttcat cgaaatatcc agatttgttt aattcttctt     55140
     tccttactga tacatttcca cttaaaaatg cgatataagg aagtgtaaac cccttgagcc     55200
     tctccccgaa atgttttaat ccactattaa gaaaatatcg gttagaaaat gataaacttt     55260
     gaaagcgttc tgtatcaata tcttctattg ttacaagcgg ataaggtttc tttgatttat     55320
     gtctagtgcg ttcgtaactt tcatatattt ccatatactt aggatctttt ctcactagat     55380
     cttttaggtg tgccaattga tcttcattat aatccggcat aataaaagta tagactcctt     55440
     cataatgcat ggctcccgtg actacaaggt ttgtttcttg caaatgatgt ttatagtggt     55500
     tttgaataaa atgaggagtc actaacattt ccccatccaa aaagattaaa acatctcctt     55560
     cggaatgctt aattcctata ttgcgtacaa aggaacgtcc tttatttttt ttcatacgta     55620
     tatatttaaa tttgaatggg acgtcaattt cttttaaaat atcacgagtt ttatcagaag     55680
     aagcatcatc tactaagata acctcataat cagagtcggg aaacgtttgt tttgagaggc     55740
     cgtaaaggga aagggagatt tgattatatt tattataggt aggcataatt atactaactt     55800
     taattggatg gttatgatta ttttttatac tcatcttata taagctgttg tccaaattat     55860
     ggacttgatt aatttcactt ttgttttctc ttaatttgtt ttgattattt tctccctttt     55920
     ttctataata ttttcccttt ttataatatt ttccattgtg agggttgtaa taatgaccat     55980
     aaaaatctat tttaatcatc ctttcctttt ttttataata ttcaattggc ggaaaaatgc     56040
     ctgtacaatg aaaaaaatga gttatgaatg ctgaggaatg ggtaaagaat aaagtattat     56100
     taattgaagt aataatactt tcatgaacct catctaaaaa attattgttc cagattaaaa     56160
     tgttaaaaaa ttcaaattaa ccttttgtat ttaacaattt ctatgtaatt tgggaaaagg     56220
     tactcagata taagaattaa caatatctat tatccgaaag atctacctct gtaagtgagc     56280
     ccttcaattc aatactgacg ggcttaccta tattgttata tatccagtga ttaccgataa     56340
     gcttcattat ggtgcgacaa gaaatcccta ttatatagtg tagctctgcc actagtttag     56400
     acgtaaaaac tatccttgtc caaaactgca ggcctaataa tgaacttgtg ggttgtatgc     56460
     ggaaatacgg aaacagagag tcagtgcgcg actcgaaaca ttgctaggag aagaaaatta     56520
     tggtgaacat caggggatgt ttgtaatctt cgtaagggtt agctcaggag cgtgcccaga     56580
     tttgcttggg tattggcaag aggaaaagca gattcataat gctgctgtga ggcgttccac     56640
     atcttgctcg aagtaaaaaa accacctaac ctcgtcgtat ctataagatg cagaacttgg     56700
     taagtccttt gccatctgtg taaatagtaa gggggtcgta agatcaaaca atgtgacaga     56760
     gggtaaagga taggagagaa agcgaatgcc gttatctcga aagagaaaag gaaagcagga     56820
     aactatataa ctggatggat actatcgtcc ttacatacaa acccatgata ggtccgaaaa     56880
     ggagctgact tctcgttgat ctctcgtagg catataaggt tatggctatc ttttggtgaa     56940
     agaaacgtac tgttatatat atctccatct gaagcgtcgg cgtacgtttt acttaccaac     57000
     acggtgtggg ataaggatac aacagcaaat ggacctgcaa tgggaggttt gagacaattt     57060
     attttgaaag ggactcacac gtttcttagg agaggaaggg gcagtgatgt ccctaactta     57120
     cccgacttaa ttaacatgta tgcgatatac agcttaagaa tagaaaaact aatgggtcta     57180
     attagtggtt tttctgccta tcgaaaggta gtctcaaagt gatgttcaat ccatcttgag     57240
     taatttactc taattattct cgttttattc atatggacaa tttgcttagt aatgggcagc     57300
     aacatatatt atgtattgta aatgacagat ttcttactct atcttcatta tcatcctttg     57360
     taaggctgat aaacagcccc tgaattaatt cacgggctac ttttagttca tttagaaact     57420
     aactttgtat atgacttaca cttttaactt cttcatcatt agctaaaaaa tctatagaaa     57480
     gcactatcgg gtagaaagag gtttttaagt tcataatctc gcataacaca catcgaacac     57540
     tccgtaataa aataactagt tgtattagga gcataaaatc ctgcccgatg taaccaagca     57600
     tgcataatgg atcctgtatt tatgccaata ttgcttatct tcgataaatc aacaataaat     57660
     gataaaggta ctttggttcg atttaaagct gttaaagcca aagcaaggga atcattatca     57720
     agggaaccag caaaaatttt cgctttggga gcaagacgca aaccgttatc acgtataagt     57780
     cgagtgaatt gatccatagc tacattcgta gccactaacc cattgggaat acgtggtcca     57840
     atataccaag caggttgtaa attccgtatt gcatacacct tattgcaagc agctaaatca     57900
     gaaataccat tattagctcc atcattccat ttttgactta ggtgatggaa ccaattaaat     57960
     agtacaagtg aaatggcatc tttaatatct tgttcttgtg ttagagtaaa ctgattatca     58020
     aggtcaaaat aaataaaagc gggtaaattg gtaattcccg gaggtgtagg gacaggtatt     58080
     gctatttctt taaatgcggt ggggtaccgt ggcggaacga aatttgtttt taaaacatcc     58140
     tgtagaataa gttccatact gatgagtatc ggttgaatat tgattggcaa agtgatgtcc     58200
     tcctttcata aaagatattt gtactagtag aatattcact tgaatgaaaa aagtttggac     58260
     atgggcagat agatgaaaag ccattaaaat taggggttcc aatggctcga taataatgat     58320
     tatattaact agagaatttt acatattgta tacattaaaa atagaaaaaa aacactgaac     58380
     ttctagactg cacccttaaa gcagatgtcg aaaaaatcac atttaggcaa ccttgaatga     58440
     aaaggagggt caagcttttt ttagataata ggggcatgta aaaaagaatg cactgatcaa     58500
     gaaggttaca tcaggagatt ggaaatggtg aaatgctgtt ttaagaattt tcatgaaacc     58560
     ttaatgaggg agggaaaagg caaggtttta tgtagtagaa gtattaagag attaatatat     58620
     ttatataagg agacaaaaat gattaaatcg acagtcccca gtaaattatc gtaacgagca     58680
     actcgttgca taaggaaatg gggatcttaa acatgtacaa tcaaatctac aaataggaag     58740
     ctattcccta aagggaatag ctccgttttt ttaaatttcc acctgttggg gctttaacca     58800
     cttcatcgtt gttaagtagt tggctcaaat agttggctcc tatcggtttt atctttaatc     58860
     cacagccttt gaacccgaat tagatcccaa gctccataaa ctaaatataa tcgtgattaa     58920
     accaagaatt acacttgacc aaagctcccc atttgttaat gaatagataa atgggaaaat     58980
     tgcaaaccag acaccagtaa tggttgaaat ccagttttgc caagaattcc aaccaggctt     59040
     gtcatagccc cacaatgata caataacttg aatgattcca aaaatagtac ttgaccataa     59100
     agctcctgat tgatctgaaa aaccaatagc ccaaggtgcg ataataaacc agacaccaat     59160
     taatgcattt aaattacccc ttattttcac ggttacacct cccaaaggtt tacgaaatcc     59220
     ctaaagattt cattactgaa ttatatgctt agaaattatt aacattaact aaaatcagga     59280
     tacatagtga tttataaaaa aagcaaaaac aatccgtagg aggcggattg tttttgctta     59340
     aagaaagatc aggactgcag ttcttaactg tattttatat ttctcatttc actttataat     59400
     cacctgtaaa attactatct ttgtatatta atattttttt aataggggaa aaattgtcaa     59460
     aataatcata tatttttact ttcttctata ttatttcctt atgttccata tagaagggaa     59520
     ggctgaaaat ggaggcagag ataaactctt tatgtacacc aatccctggt caaaaaagaa     59580
     gatcgagtcg taacttttca ctttttcatt tacctgcgaa taaaaaagtt aaggttgtag     59640
     ttgaaaggaa gtatcagggt atatcattta cttttgatgt tatgagtgat gatctaaaca     59700
     gtacagatca tgtcatttgg cataatgtag gaaatggttc aattcttaaa atgccggatc     59760
     tgattagaca aagtaaggga ttgtacatcg caaacccttc tataagttct acggtagggt     59820
     tcacagatct ggttcgagaa acatttaaag tgaagtttta tacattagaa taagcatata     59880
     agctaaccaa agttggtttg tgaaattcat gaaatgaggg gaacaaaaag gaggaacact     59940
     gtgtcagctt ttttcctttt ttattttcaa gctagtgaag cagagcgaaa caggtatatg     60000
     tatcgtaaat acggtgctgt tagatgtttt tcacatagag aaatcaccta aaacaggtct     60060
     atgatcataa tgtaatttat attcttagag tcatatgtct ttctaaaaat acaccccgct     60120
     aactgaagga aaacttaact atagaaaaaa aattctgaaa cgaatattta cattaatgaa     60180
     aaatatacat gttcagatac aaataaaaat gattagaatc attagttcta acttgctcta     60240
     tccctaatcg tgatgattat ataaaagaac ctgctactta gttgtactag tagcaggtta     60300
     ggtaagaggt ttgattgcat aattctatat taatcattga ttaatgaatt gtttgtatga     60360
     ttgtcctaag acataaaaaa gtttatagat atctttatat agggaaagtc actgacatta     60420
     ttagtgtcaa cggctatgcc tcagctaact tcattattta ttctcacctc cgtaaaggga     60480
     ccgtcaataa ttttgtgtaa atacgaattt ccttttctta tagacgttat tcactagttt     60540
     gttttaaaca tcatttgtag ctctgcgcga gcttggtcaa aaccaatgtg acatcttgta     60600
     gcaaagcgct gattatactg gtcaaattgg gaaacgagga agcgttcaag tgactcttcg     60660
     tttgggaatt gttccttacg cttactatat ttcttgattt gtttattaaa tgattcaatg     60720
     agattggtcg aataaatact gcgccaaata gacttaggaa agctataaaa cgtgaacaaa     60780
     taagagttat tgagcaatgg ctttgtaact tttgggtact ttgacttcca cttttcaata     60840
     aacgaatgta gggcctgttg gcccatttca aggctttctg cacggtacac agatttgaag     60900
     tcttcacaga tttcagctcg gtcggataca cgaactttat gagcaatcgt ccatgaaaga     60960
     tggacgcagc atgtttgata agaagaagct ggatatatag aaaaaacact gtctgagatt     61020
     ccttttaacc cgtcggaaat aaacaacaga atctcctcta cgccacgaga tttgatgtct     61080
     tctaaaagtt ctttccagac aaaggcagat tcgttaggag cgattgtata gccaagcact     61140
     tcttttgaac cgtcttcgcg aatgccaacg gcaatataga cagcttcttt agacactgta     61200
     tcccgtttta aagcaatata tgtagcgtct aaataaacgc acgcatagcg tgcacacaac     61260
     gttcgatctc ggaatgcttc tacctgttca gacatcacct ttgtcatatt tgaaatggtt     61320
     tgaggtgtgt aatggtgacc atacatgcgc tccatcaaat gggcaatttc agcagtcgtt     61380
     acgccctttt ggaacatatg aataacaaac gcttcaagcg tatcattggc tcttttataa     61440
     ggagccaccg tctgttgctt aaagtcgcca ttccgatcac gaggaataac gagatgaagt     61500
     tctccaaact ctgtgtgcag tgtgcgttca tacgaaccat ttcgtgaatt ccctgtatta     61560
     aatccaatac gatcatattt ttcgtagtcc aaaaaagctg tcaattcgct cgctaagagt     61620
     gtattaaccg cattttctaa gtgagaacgg aaaatttccg tcacatcttc tttttggact     61680
     agagcttgaa caagatctgt tgtaaactga ttcataggaa gaccttcttt ctttgaattg     61740
     gttgtggtga cttaattcta caagaaaagg tcttcctttt tgtatttatt catttacaca     61800
     agatatttta cgctctctcc gtaaatttac tataatggag atttattatt atatagaata     61860
     tatacataat attgtttgat aggaaatact tttactttct aaccatcata aaattctgat     61920
     atctaccaag gcatggacaa gttttcttat taattctata tttcatgtaa tgaataaaat     61980
     ttctcttttt ctacgctttt tatagactcc agctaatttt ccatctacat gttctgattt     62040
     attgtataaa agttggtatt aatctttata tacagctaaa aataggtatt tcccctctat     62100
     actttgtcca ttcattgcct gatatttttc atataatata tagcaatgtg aaatgctttt     62160
     taaggaggga ttctatatga gcagagacca taagtgtgta tgtgatcagt tagaaagatt     62220
     acaaccaggg acacaagtcg atgtatttct aaatggaaat ttactggaag atcttatttt     62280
     tactaatttt aacttagata ctttctgtgc aactttcgtc gaagtaggag aggaaacagg     62340
     aggaaatatt attgttttag attgtagaga tatacaagca cttcgaattg aatagcatta     62400
     taaaataata gtgtaacagt gtaactgcag aagagcttgt aaaagggctc ttctgttaat     62460
     ttaaaaagac gctctattca aatattatct aaactaagaa agggaaacct aaaatgtcaa     62520
     tttttgttaa tcgtttcacc gatcccaaag tatttaattc taattctata gccgatgatc     62580
     ataatcagaa ggtatatcat attgatctga attcaaaata caattctaaa agtgtatgca     62640
     gccttttaga aactttttac caaggaaaaa aggtaaaaaa ccttttagta aatggtacac     62700
     aaataagagt tcagaatttt gtaggattta accctaagac tggtctcgct acattttggg     62760
     gaaagaatga tggcattctt ttagttgatt gtgagcgtat tgacgctatt acactttgaa     62820
     aaaattttca cactataatg ccctgttctg tgtcttgtta atcagtgaag ataaccctta     62880
     ctttaatatt gtttataggg gattaataac agccattttt atatctccat atcatttata     62940
     taaatataag gttactttac aaacgtctat agaatttaca atactcttat gcatattttt     63000
     ttctgcaaca aaaaggcttc ataaaaatag aagccttttt aaaattgtta accgtagaat     63060
     aataaaaatc aagaaagttt agtcctgtta agatattcaa aacaggttag tttatgaggc     63120
     tctatataat ttgatatcag agattgtcca tatgaataaa acagaaataa ttagagcaaa     63180
     ctgatgcgat gaaacatcca ttcgaaaacc ttgctacaaa tagaaaaact actgtactgg     63240
     agcagtagtt tttctgtttc taagctgtat acactataca tttttagtta acataatcat     63300
     tgttctcgat atttatttat ataataaata attaaatagt acaagctctt gcttgaaatt     63360
     tacatataat aaaacaaatg tagatttaca atttatattt aatttattgc agcaaggggg     63420
     gatacaaagg atgattacag acttattaag aatcttagat cctggaacac cagttccaac     63480
     cttagtcgta ggcggtgcta cacttactaa tcttgtattt tcaagcttta atgctacaac     63540
     taatttagct tcttttgcta ctagaacagg tactgggaca aatgctagca caaatattgt     63600
     cacagtaaat gctaatcaga ttctagctat aacaacagcc taaatatata tcttatttag     63660
     aattggacat gcttcatttg actgcatatt ttattagata tatcttaaaa tctccatatt     63720
     tgtccaaaca cttataacta atttgaatgt gataaattat aaaacggtcc ttaatattcc     63780
     tataattaca aaaaaactac tggtggatgg agtgacccca tagagtgaga caaataaaaa     63840
     acacctttaa gttaaaaaac gggtatgtag tacctaacaa taacttggag gtgttttttc     63900
     tatgggaaaa agagtgagct atccagtaga agtgaaatta aaagcaattg aaatgagatt     63960
     ggcaggagta ccggtcaaag aagttatgga aactttacag atccgcaacc atacacaact     64020
     caaaacatgg atgaggtggc atagaaatgg agaatcctat cgcctggcac agcccgttgg     64080
     gcaaacatac acccatcgaa aagggcctca ttctcaagat actccatcaa agttacaagc     64140
     tgaaaatcga tatttaaaac aacagattga agtcttaaaa aagtacaaag agttggaaag     64200
     ggagtggtac cagaagttgt attgaagtta gtagaggaat taaaagagaa actgcctatc     64260
     tctcaaatct gtcagtgcct gggtattcct cgatccactt attatcgttg gcagaaaaat     64320
     gagcaaggag aagaaacaaa gagaaagaaa tggatagaac gaaaagttgg tgaacaatgc     64380
     cgtaaacata aatttcgata tggctatcga aaaattacag cgttactcaa tcaaaccatg     64440
     catatcaacc ataaagtagt gcagcgtatc atgcagaagt acggttggca atgtcgtgtg     64500
     aaaaggaaaa aacggaaaca aacaggacaa ccttatcagg ttgcagaaaa cgtgttaaac     64560
     cgtaatttcc gagcagagcg ccctcttcaa aagctggtta ccgatattac ctacttgcct     64620
     tttggaccta aacagttgta tctttcaagt attcaagatt tatttaatgg cgaaatcatt     64680
     gcgtattcag tgagtgattg tcaaaacgtg gagtttgttt tagatacatt aagccaactc     64740
     cctcctttac ctgagggatg tacgttgcat agcgaccaag gttcggttta cacatcatat     64800
     gcgtatcaac gaaaagtcaa agaaagaggc atcatcatga gtatgtcccg caaagggaca     64860
     cctgcagata atgcctccat tgaatcgttt cattccagcc taaagtctga aacgttttac     64920
     ctcgacgagt taacatgtac tacgactgcc atcgtagaac aaactgtcga aagctacatt     64980
     acttattata accatatccg tattcaaacg aaactaaaca accagtcacc ggtacaatac     65040
     cgacaactgg ctgtttaaaa ggtgttttga tccctgtctc gaaatcaggg gtcagtcccc     65100
     cggattcagt agttttttct gtttttatgc tgtatacgac atataaagac aatttacata     65160
     atgagtttaa taagagtgga atagtctatc cttagaccat tccattctta tagagttgca     65220
     tttagtattt agaacggccc caaggattgc aattacagtg acgatggcat ctacaattag     65280
     aatggtgacc atgatgatta ttacattcat ggtggtgttt acagccagaa ccatggtgat     65340
     gatcacattc atggtggtgt ttacagctag aaccatggtg atgatcacat tcatggtggt     65400
     gtttacagct agaaccatgg tgatgatcac attcatgacg acgtctacat ctacaacaaa     65460
     atacaagacg attccaacaa ttcatatata atacccccct atatatagaa taggatatta     65520
     tattcacaat aaaaaaactg gcttgtatta gtgtcaccta gtctaaaaaa taggctctac     65580
     aatatagaat ggctattctt aaagcaaaag tcttgatgat tataagtaga aaacaatatt     65640
     tttaaatgga ttttataaga agtgaaaatc ttagatattg cttaaacata atgattaaat     65700
     attcctcata acttctcgta aaaatgacga gttgatccct tataattgtc acggttaata     65760
     ctcttaatat ttgtttatat gaaaaatttt ttagtaacac agaccaagca attgggtcat     65820
     atgctgatga atgaaaaatg aaaggttgtg aataaatgaa ctattatgtt tatgttccat     65880
     attatcctct gatgcatctc tatcaaccag ctgatcataa atacagaaat ccatatcctg     65940
     tagacatata ttatacccac cctaattatt ttgattatcg tttctatgct ggtccgactt     66000
     attatgaatc agaataccaa atcgacaaaa gaatagttag aaaagaaaaa gatggtcctg     66060
     atcttgagac ttcatcctat catgagaccg atttcgagac ttcatcctat cgtgaggccg     66120
     atcttgaggc ttcatcctgt catgaggtcg atctcgagac ttcatcctat cgtgaggccg     66180
     atctcgagac ttcatcctat cgtgaggccg atctcgagac ttcatcctat cgtgagaccg     66240
     atttcgagac ttcatcctat cgtgaggccg atcttgaggc ttcatcctat catgatcccg     66300
     atctcgagac ttcatcctat cgtgaggtcg atctcgagac ttcatcctat cgtgaggccg     66360
     atcttgaggc ttcatcctat catgatcccg atctcgagac ttcatcctat cgtgaggccg     66420
     atcttgaggc ttcatcctgt catgaggtcg atctcgagac ttcatcctat cgtgaggccg     66480
     atcttgaggc ttcatcctat cgtgagaccg atctcgagac ttcatcctat cgtgagaccg     66540
     atttcgagac ttcatcctat cgtgaggccg atcttgagac ttcatcctat cgtgagaccg     66600
     atctcgagac ttcatcctat catgaggccg atcttgagac ttcatcctat cgtgagaccg     66660
     atctcgagac ttcatcctat catgaggccg atcttgagac ttcatcctat catgaggccg     66720
     atcttgagac ttcatcctat cgtgagaccg atctcgagac ttcatcctat cgtgagaccg     66780
     atctcgagac ttcatcctat catgagtcac tcctagataa tttacacaaa gatggtccat     66840
     atggtgatat aactgtcgcc tattccttca aaaacgatat aaccaatgga actaaataaa     66900
     aaacgcaaac gaaaaagtaa ttgctgaaaa gagggataag ttatataaaa gaccacacat     66960
     ccttttctat gtcattagtt tagacaaaac ttatgataat aataaaaaac taatttctta     67020
     tttatcataa gttttaaata acatattatc attagataaa gtttttaaat agttccactc     67080
     atatatagaa aaggcattga caaggaattt accaatgtct tttctgtttt taagctgtat     67140
     atgatataca tgtttagtta acataattta aattctataa attggtaagt ctattttaga     67200
     taaaaagatg cattttactc ttttgggtat acttgcctag ttgtaagtac actcagagca     67260
     tccttaactt ttcttgcaaa ggagagtggc tgatcaacag actcgaaatg catatacatg     67320
     agacgtggtt catcaaatag ccaatgatta tgaacagctg ttataatgat accctgttcg     67380
     cgaagcttag tgataaatgg attgatctca gtctgcaaaa taacggtttc tccactgcaa     67440
     agagcctgac catctcctgt catagattcg aatgtaaaca tttgagggat tagtaaaaat     67500
     gatcttcctc ttcttccaag aacctcagga tggatgtttg tacgggattt cattactgta     67560
     caaattccgt tctcaaatgt atgcatggat ccccccagaa tgttattaaa tctgtcacag     67620
     agattagatg agttactaaa atcagaagtt atggatctac aatcaggata aacattacgt     67680
     gtagtcaata cacacaatgc atctctaact tttcgcgcaa aagaaagtgg ttgatcaata     67740
     gattcaaagt gcatatacat tagacgtggt tcatcaaata accagtggtt atgaacagca     67800
     gttactatga taccatgctc tctaagttta ctcatgaatg gattaatttc ctcttggaga     67860
     attactgtct ccccaagaca taaagctctc ccatttcgat caacgtcttc aaaagaaaaa     67920
     gcttgtggta caaacatgaa agattctgcg cttctcccta acactacagg atggagattg     67980
     gtacgagatt tagttgcagt acatacgcta ttaataacac ttggcgttga gtcaagtatt     68040
     cttgcaaact ctcgacagag tttagagggt tgattgtcca tattcctcat gaaaatgcct     68100
     cctataaata acatataatc tcgttataat atgtacttac ataaattaag aaatgggcaa     68160
     tagtctacta ccgttctctt tagataactt tttctgtttt caggctatat aagatataaa     68220
     aatctagtta acataatgag tgtcacccga attaaaagcc atccgaacta atgattccaa     68280
     cggctttttc agtatcagaa catgcccaaa ctcttttcat ttagttgcat attttactag     68340
     tacaagcact atataacttt atgaaaagag gaaaattaat gccatttaac tttaaaaaaa     68400
     ctttaatcgt tatggaactg atattccaag atatgttaaa aacaaacttt gtaattcctt     68460
     tatatccaac tacatttaga gaaaccatta tacctgttcc tacgccttca ggagtcacag     68520
     atttaccacc taacatttat tttgatcttg ataatcgatt taatgcggaa caagaacaaa     68580
     gaatcagaga tgccattagt gaaactatgt tggtatgggc tactcatatg aatgaaaaat     68640
     ggaatggtgg aacaaacaat ggaatttcac aaatggcggc ttgtacaaac atatatgcaa     68700
     caaagaattt acgccctgct tggtatagtg aatcacctat tcaaaatgga ctaacagcta     68760
     ctaatatagc tatggatcaa tttactcaac ttatacgtga taacggattt aggcgttccc     68820
     cacgagcgaa aatcttcgct gctccactta acaataatac tattgtcttt gcattaactg     68880
     cttttactca gaattttgta cctttatcat ttattgttga cccaacctta attgacatcg     68940
     ctactctaaa ttttataact ggttctatga tgcactcttg gctacattgc gcaggattct     69000
     tcgatcctaa tacaactagt tacttcaaca cagaatgctc aatgtgtgtc atgagaggat     69060
     ttcgaccaaa aaatcctgat atgcctgata acctttatta tcagtttttc gattaactaa     69120
     aagcgtaggt ataccttata cacttttagt taacataata ctaattataa gtatctctat     69180
     taaaagaaaa aatcgtaata ataaaaaaag tctttcctat ataagaaaga cttttttgtt     69240
     attaatagca actgctataa tttcatctcc accaattatg atattttttt atagcttgca     69300
     taatgttctt ttcattattt cgcatcatat aattggcttc ccactcttcg atgagaggac     69360
     atttgattgc tacggggtta aagaaaaaac tatttgtggg aaaaagtaga tttttcctct     69420
     ttctatacat acattcttga taacaaagaa aactacacaa aaaatcgtga ggcatctatc     69480
     actattctta ttcgaattac gtcgatccaa gcagtaaaaa ctttctaccg cctgtggagt     69540
     tttctgcttt ttaacttgta taccatataa aatcgtagtt accataataa aattataggc     69600
     aatcgcaaaa gaaaccttta acttctactt gtatactctt actatatcaa ccgaagttaa     69660
     taaatttcct tatcatatca gcactctttc aaatacatgt aattatttta catatcataa     69720
     attatgcaaa caaactcaaa actttccttt ttagatgcat atttgatata ataatagttt     69780
     acatatgagt tttcccagca ttaaaagcct cttcagttca ttgaaaaggc ttttgatgtg     69840
     tgatgagggt acttagaaaa ggagtaaggt gaaggttaaa ttaactacca aataaattat     69900
     attcattagc ccactttaag tgaattgtcc ataggaataa aacaaaaata atttgagcaa     69960
     actactcaag atagataaat catcacctag ctaactccta taaaatagaa aaactcctga     70020
     acaccaggag tttttctgtt ttttatcaca aataatcaga aatcaatatt aaaacataat     70080
     atatagataa agaaaccttt attgtaaaag agacattggg tgatatagta ccaatgtctc     70140
     ttttgcatcc tgataaaaat ttaataataa atataataga actccaataa ccgaggtgaa     70200
     aataaatgaa gacagaaaaa ggcgacaaat atacagaaaa cgaagaactg aaattaaaat     70260
     ttgaaaatgt aattgcaatc ggcgtttgga ttaaaacgat tggccaaatt attgaaacca     70320
     ttggagtatc aaatttattt ttaataaatg aagatccatc atctggtgat gaaaaggtgg     70380
     tatctgcagt ttggattgaa acagtcggcc aatttttaca gactatagga gtatcacaac     70440
     aagtttcagc aataaatgaa caggtaacat tcaaagctca agaacttgaa ataataggcg     70500
     tttcccttaa atcctttgct catgctttag aagccatagg tggaattgaa atactacaag     70560
     aggaaaaaca aacagatata atggatttta taccttaaaa cagttatatc tgtttgttaa     70620
     ttttcttgaa agatagttta cacatataca tgatactgca tgattactta tataaaaaca     70680
     cgtttatctt gtcattatta tcatccatag ttgctaataa aatattcttc atatctaaac     70740
     tatgtaccgt tctaatctga ttttttaacc aatcttcatc tttaccagtc tgttttaatt     70800
     cctcaaaatc aatcttccca tctttaataa ttgttatagg aaaagagaag gactttgtca     70860
     ttagcttcat atctttagga gttagtgttt gatactgaga ttctaaaaaa aacgatatag     70920
     taccatctga ttcccataat gccagagcaa cttgttgaat atcatgtatt tgtttttttc     70980
     ttaattctgt tagtaaaaca tcaataggta tcctagcctt agttagacct ttataaaata     71040
     tttctccatt ttttataaga ggaaaaggcg aaggatcaac aaattttgtg aattttaacc     71100
     acttaagact taaaaatacc ataataagat ataaaataac taatacacct atcgttatca     71160
     tagaaccttt catacctaaa tgttgatctg acaaaggatg agcaataata ttccctattg     71220
     ataaagccat tataaaatca agtaacctta actgagatag tgatcgctgt cccattattt     71280
     tagtaacaat gagtaagaag aaaaaagaaa taaccgctct tagaatccat tgaattgcgg     71340
     taagtgattc ttgactataa aaaaaatcca atacattcac atcctaaata ttagttgaaa     71400
     atctcaaaat tagtatcaac tattagctat taattattga cataaaaata tctatcttat     71460
     acaaatgagt attttctaat actttaagca aactacacaa gatgctgtga ggcatctacc     71520
     actattctta cttgaattac gtcgctccaa acagaaaaaa ctccctaccg cctgtggagt     71580
     tttttctgtt ttttaagctt tatatgatat acatgtttag ttaacataat gtactttata     71640
     gaaaaagata caaaatagaa caagttttat ataaaacaaa cgcttgtcct tacccttatc     71700
     cttgctttgc atattataaa ttgaccatct ttattttaac atccttctat ttttttattg     71760
     agatctttaa acttctatcg gattcacaaa aaaattactg ttcgagctac agtaattttt     71820
     tctattttta agatgggctt tatagaaagg aaataaaaag atagtagaaa cattagataa     71880
     agtgaggggc tgttcaaact cttttcatta ctttgcatac tatatactat agaagtgagc     71940
     atcctcctgc tcttccaata aggctcggat tcaatgctat taggctgcat atgatttaca     72000
     taaaagtaat tgtccaagca aatttgctca actaagcatc ttatatagga gaacttcaaa     72060
     agaaaaggag agaatgatta atttgaattt acaagatacc aaaggatcct atgatgctgt     72120
     gtttagttta ggaagtgctt gtaatccagc tattcaattt caacgtctta atttaaaaag     72180
     atttacatca agtccacttg attggaatta ctctccattc ctttcagacg taaatagatt     72240
     gttaaaaaat aaattcaatg gattcatgga gcttaaaaac atgcgtgtga taaatgataa     72300
     gggagtttct atgtatgctg aggaaggagt ttttgttttt ccgcataaag ggcttcataa     72360
     accaataaaa tcctatctag tactagatac tatttataat attttttctg ctcatgattt     72420
     ccctattatt ccgaatcgaa attggtttgt aacttatccc tcttttaaaa aaacccttaa     72480
     ctaccgaata gataggtttc tagataaagt taaaaatagt ccatccattc tattcgttag     72540
     atgggtagct aattatcaag aagcagttga attagaatct actttatctc agataacgaa     72600
     ggggaacttt aaagtcctta tacttaatcc agtagaaggt ctgcaaggag ttagtgaagt     72660
     aaactgggga ttaagtagaa cttgtgtagt taacgttccc aacgatccaa atagtaatgt     72720
     aacatgggat tatgtcttaa acggggtaac attaactaat taaggcgttg ttttagacca     72780
     ctaaatcgtt taatttataa caaatttttt atcaagaata gaatctaata ttttgagcaa     72840
     actactcaag aagctgtaac gtttcgatcc ttcaatgaaa taaatgtagc agaaaaactc     72900
     ctgaacaggt cacaggagtt tttctgtttt taaacagtaa atgatataca accttagcca     72960
     acataatgga ttttccagga agtaaacaca aaaacaggag aaatcttgca caaaattagc     73020
     actcgtccgc acatctataa tcttttttca tattataaat tgagcatttc aatttcatca     73080
     tcctatcttc tataagagtc tttgagcctc tatcagattc aaaaaaaact actgtttgag     73140
     ccacagtagt tttttctgtt tttctatata aatcaaggag gtgcaaaaaa aacggagaat     73200
     gaaggttact gattccatca tctaaaatat tcttactaca ctatatgttt ttgttatcga     73260
     ttaggtaact tgcctatttg gaataaaatt ttatttcttg ggcaaactac tcaagataaa     73320
     tgcatcattg ttctaaagct aactcctgag gaacagaaaa aactacttct cggactcgga     73380
     agtagttttt tctattttag gctttatatc atatacaact gtagttaaca taatgaattt     73440
     acaggaagct ataaattaga agaggagatc atatttataa cctcctcttt ccctacatta     73500
     aaaatatttt attgttgaat catcgttatt ttttcaacac cggtatccat atttcacttt     73560
     taaaagtcgg tgatgttaca tctttatgtt cattccataa aatttctggt ccctctactt     73620
     gttcataatt tgaggatgga aaccattcgg aataaatccg tccccataca tcctgcaatg     73680
     tgtcaggaaa tggcccaact gcttcaaata cagcccatgt taaagcaggt acttcaagtt     73740
     gtatcaaatt attaggacat tccttagttg ttgctacaca gatatagtgg tcaagctcac     73800
     ctttttcctc cattcgtcct tcagaaaaat ttacggatgc actaagcagt cccagtgggt     73860
     taacattaga aagttttttt aatttattta tcgtttcatc acttaagctt tcccacatag     73920
     cagcaatctt tgggttaact ccgtgaaaaa ttataggcac tctttcttta atacccacta     73980
     tatgaaatgc ctctttttct tcgattcgat agttcatttc atttcctcct ttaattgata     74040
     gctgaaaggt catttgtgga taggctttaa gtgaataacc attctttttg gcttctgaag     74100
     gagttagacc atgtaagttt tgaaaagctc ttgtaaaaga atctggtgag ttatatccgt     74160
     atttgatcgc aatttcaatg atcttcatct tattatcttt aagttcgaat gctgcaagag     74220
     taaggcgtct tcggcgaatg tattctgaca aagtaatgcc tgcaagaaaa gaaaacatcc     74280
     ttttaaagtg atactcagag caaagagcta actttgctac ttctctaaaa tctatatcct     74340
     ttgttaggtt ctcttcgata tagtgtaaag ctctattcat atttctaagc aaatccattc     74400
     atatgacctc ccttatcatc agaatagcag gatttaaatg ggtctatccg acatttcatg     74460
     cacaattatg taggtttttc ttttttctct tcgtaagttc ttaagaactt gagcaaacta     74520
     cccaagatgt taccaaacat cgactcatac aactaaattc tgcaacagaa aaaacctacc     74580
     tcttttgact ggggagagat aggtttttct gttttttaag atgtatacgg tatacaactt     74640
     tagttaacat aatcagtgtt atcggtatta acctaataaa aaatacagag ctaaagctaa     74700
     atttagttta aatacctaaa aacaggctcg ttttcctagt tataagtcca tatcaaattc     74760
     ttagataaac atatagtgtg ttggagaaaa tcaaaggaga gattactttg tataaccatt     74820
     atcaacctga agtaaatcct aacgatttac aacattttta ccaatatgat tctttttaca     74880
     gacaacaaca gcctcaatac tatcaacagc cttatcacca tcctcgtcct cctcgctgtc     74940
     gttgggttca agaatgcaga tgggttcgtc gttgctaccc acgagatgga ttctacactg     75000
     atggttacga ctactaattg agacaaaact actgataagc ccagtagttt ttttcttttt     75060
     aggatgtata cactatacaa ggttagttac gtcgggtaag cgaggggcat cactgcccct     75120
     gactccccta agaaccgtac gtgagccttt caactcatac ggctcaagcc tcccattgca     75180
     gatccatttg ctgtcgtatc tttatcacac accataatgg taagtaaaac gtacgtcgac     75240
     gctccaagtg gaggtataca taacagtacg ttgctttcgt caaaagatag ccacaacctt     75300
     atgttcctac gagagaccaa cgagaagtag gctccctttc gggcctatca tgggtttgtc     75360
     cgtaaggacg atagtatcca tccagttata cagtttcctg ctttcctgtt ccctttcgag     75420
     ataatggcat ttgctttctc tcgtatcctt taccctctgc cacatcgttt gactttgcag     75480
     tcatcctact gcttatgcag atgacatagg gcttaccaag ttccactttc tacagatgca     75540
     ataggggggg caggttcttt actccgggca agatgtggga cgcatcagag cagcattatg     75600
     attctacttt tcctcttgcc aagacccaag caaagctgtg cattatcttg agctaaccct     75660
     tacgaagctt acaaaccttc acttttgttt accataccta tcttctccta gcagtattct     75720
     ggaccatgca tttgtcctct gtttccacat ttcctcatgc aaccgacaga ctcgttatca     75780
     agaatgccgt ttcggatgga gatcatctct gcgtctagat gagtaacgtt agctacactg     75840
     aatgattctc catataccga aaccaacgat atctaaaacc acatttatta ctgcttcctc     75900
     gccgtgatac cctataaagt attcagcaat catcgagatc aatgaaatga tagcagcgat     75960
     aggtaaaatc atctttaata acgtgacata tacatcataa taaagaggac caatgagatg     76020
     cattggctga tctcgataac cactcgctaa tattgctgga ttccccattt ttttcaggca     76080
     ttcttttaca tcttcttcac tgtaatcatc aggtagcata tcctcaattg ttgaatgtaa     76140
     ctcaagcgca atatcctcac gatttttttc aggcaacctc cgagtaactt catgtatata     76200
     aacctcaatt aggttcattt tcttcctcct cttttaataa tctataaagc tctttagagt     76260
     tatcgatcca ttcttttttt aaatgaagaa aaacctctaa gccatattca cttaagacat     76320
     aatacttacg gggtctactt tcagacttat cccaactact tgttaccaac tcctgttttt     76380
     ctaaacgacg aagtaatgga tataaagtac tttgatcaat gactattcct gatttctcga     76440
     gtaactgaac aagtgaatat ccatactgag gtgttcgtaa ctgacttaaa acagctaatg     76500
     tcaacgttcc tcttctaagc tctgttgtta atgaatttaa taaagtactc attcctacac     76560
     ctcattttta cttttactat atgttataca gtatacaatt tatactatgt gtcgtacagt     76620
     ataattgtta caaaaacaat tgaaataaat ttaaagtttt ttcatatttt tagttttcat     76680
     aagacccgtt atagatagta cgcaaaatga atacctctct ttattttgag caaactactc     76740
     aagatacgtg aggtatcact cttaactctt tgatacgtta cagaaaaaaa ctaccgactc     76800
     caagcagtag tttttttctg ttttcaggct gtatatgata tacaaaggta gttaacataa     76860
     tggattttct aggagtaaac acaaaaacag tagaaatcct ttataaaatt agtactcgtc     76920
     cgcaccttta taatcttttt tcatattata cattgagtat ttcaatttca tcagcgttcc     76980
     tatcttctat aagaatcttt gaatgtctat cagattcacg aaaaactact gtttaggcca     77040
     cagtagtttt ttaattttta gactgtatac gatatataaa attagttaat ataatgtgcc     77100
     tcacttatat aaaatacttg tcctacctta ggacaagcat acaaacattt tattaattga     77160
     tgaataaaat atatagaaac taataatgga ggtgataaac atgtgtaaat attattgcaa     77220
     gtcaaaagat aagaaatata aagaggacaa gcataaggaa tataaatgta aaaaaaataa     77280
     agaatataag tctaaatgta aaaaaaataa agaatataag tctaaatgta aaaacaagaa     77340
     acacaatggt tattcttatt aattaattta ttagtgtaat atctttattt cttataggaa     77400
     gtataacagg tttttaagga aacctgttat acccaccaaa agagcctgcc tcttttgatt     77460
     gaaaaggggc acgcttttct ttctagagta tctataagaa gtagacgcaa agatagtaga     77520
     aattttaaat aacaccagta cttgtccaca ccctttttat tactttgcac actataaaag     77580
     tgagcatcct cctgctcttc caatagatcg gttcttatat tactactgtt tggtgaacag     77640
     tagttttttc gtttttatgc tgtatatgtt atacatgttt agttaacata atcgatttta     77700
     tcggtatata cctaagattt aacgcccaat tagttactag gacattcacc tatacaactt     77760
     ttttgcaata gtctaataaa gcatcaagga ggctattgca taatgagatt atttaaagat     77820
     attgaaaaag ttaatcaaat agatttttta ccttggcaga atgacgcatt aaaagctttt     77880
     agtgcaaaaa tgaaagatag agaatatctc tttccttgta ttccggctat tcaatctttc     77940
     tcacttggtc atctaagata tgggtttata ggtcaccctg aaagtaatca aacatctatt     78000
     gaattagcta gtttactaaa agaattcact ataaattgta atgagtatgg aaaatacaca     78060
     acattaatta tattctttga aactcctcag aatctgatta ctaataggac tgtcgaagat     78120
     tttgaattat tgttttggaa gcaacttagt aatttaaata aattagatga aaaaggttgg     78180
     cccattcata ttcctcgaaa tccctctgaa catgaatggg aatattgttt tcatggagaa     78240
     caatatttta tgtactgtgc tacccccaag catgagaaga gaaaaagtag atatttccct     78300
     tatatgatga tggctattac tccacgttgg gttctgcaag aatttaataa gaacaaaaga     78360
     tatgctaaaa agattaaaga acaagtaagg gaaaggatta aaaaatacga taatatctct     78420
     actcattctg ctttaaacag ttatggaaat atagataatc atgagtggaa acaatacttt     78480
     ttaagagatg acaatactga gttacctaag tgtccatttt taaggagctt ggttgataaa     78540
     gaggactaaa gaaaaatgta gtaggttctt ttatgaataa ataaatttat taattaataa     78600
     atattgtata aatcagatta ggaagagcaa actacccaag atgatggata tcatcatctc     78660
     acctagcata acctctaaaa aaactcctga ataggcacag gagttttttc tctttttcgg     78720
     ctgtatattg tatacatatt tagttaacat aatggatttt ctgggcagtt attctaatta     78780
     agcaattagt acttcatatg ttttctatta ctctagcaac acgataacag ttaagcttta     78840
     atgtttcagc ctcacagcta ctaataattt catcattagt agtctggact tcatcacgac     78900
     ctaaggcctg aaacgaatta gaccaagctt ccctcgatat ccactgagca tagttaataa     78960
     ctcgtttacc atcttcacta gcatggaaac ttgatgaaat aaacccatcg taacccttaa     79020
     agtacgtttc aatttgattt gaaagaccat taattaattc ttgttgatat tttggattaa     79080
     cttcccattc aataatcacc gtaaataact gattttcttc aatttttggc atgtgacctc     79140
     tcctttatta atcccgatat ctatagttta ttacagtata gttgttttaa catacaacaa     79200
     tagtatgaat cctcctataa ctttagcatg ggtgagagtg tatagatttt tatattttga     79260
     gcaaactact catgatgtca caaaacatcg tcctaacaac aaatgtagca gaaaaactac     79320
     cttcccaact tcagaggtag tttttctgtt tttacgctgt atatggtata catgtttagt     79380
     taagtcgggt aagttaaggg catcgctgcc cctttctccc ctaagacccg tgcaagtccc     79440
     ttttaagaca catcggctca agcctcccat tgtaggtcca tttgctgtcg tatcctcatc     79500
     acacaccata tcggtaagta aaacgtacgc cgatgctcca actggaggta tacataacag     79560
     tacgtttctt tcgtcagaag atagccacaa ccttatgttc ctacgagaga ccaacgagaa     79620
     gtcagctccc tttcaggcct atcatgggtt tgtccgtaag ggcgatagta tccatccagt     79680
     tatacagttt cctgctttcc tgttctcttt cgagataatg gtatttgctt tctcccgtat     79740
     cctttaccct ctaccacatc gtttgacttt gcagtcatcc tactgtttac acagatgaca     79800
     aagggcttac caagttccgc atcttataga tacgacgagg ttaggtgggt tctttactcc     79860
     gggcaagata tgggacgcgt cacagcagca ttatgaatct gcttttcctc ttgccaatac     79920
     ccaagcaaat ctgtgcacta tcctgagcta atcctgacga agcttacaaa ccttcactaa     79980
     tgttcaccat actcatcttc ccctagcagt gttccgagtc gtgcactgac tctctgtttc     80040
     cgcatgaaac ccacgagccc gttaccaggc ccgcagtttt ggacggggat agtttttgcg     80100
     gctaaaccag tggcgtaagc catactatat aaaagcgact tcttgtcgca ccataatcaa     80160
     aattctaggt accaaaaaag actattaaaa tacttcccta tctagccaaa aatgttactt     80220
     aatacatagg acaagcatac aatcaccctt tctatggatg aataaattat atagataaat     80280
     aaaaaaagaa ggtgattaca ataaaaaaat atgattgtga ccataaaaaa gaatcaaaat     80340
     gtcaaccaaa aaacaaaaag cagaaaagag aaaaaacttg tattcacatc aacatttata     80400
     accatgctga aactggagga caaattagtg gtaatggtgg acaaaatgct aatcagggtg     80460
     gacagattgc ccacacaggc ggacaaaatg ctaatcaaga cagcgtggtt attaaagaat     80520
     gtggaaaaaa aaataaaaat actaaagtga aaaaaattaa ttttgaagat gaaatgaaag     80580
     aagaataata ccaattttta aactgtatag agtatacatt cttagttaac ataatcccca     80640
     ttctaggtag taatataatt taaatattat tgcattaaaa gtacagtttc gttcttattt     80700
     gcatatgcta tcaccaccag ttacttgcaa taccttcctc ttcactaaaa ggctaatctc     80760
     tgaaagaata gataagcctt tttatttgta taaagaatac aatcctactt tatacaaata     80820
     aaattattag caataaaata agaaaagtcc tattttaata aataaggact tttcctttta     80880
     actgttttta ttagaaatca ccatcaaagc acgaagcacc aacgatttac taacagtagc     80940
     catgacgacc accatggccg tgaccataag aacaacatcc aataataatt aaaagtataa     81000
     acaatacaac gattaaagca aaactagatc caaatccaca tgtagcatcc ttagacatat     81060
     aaacactccc ttttacgcta attttttata actttatatt gaggaaaatt tgaatgaata     81120
     gataaagcct ttagagatac taaccaaagg ctttatctgt tggcataaaa accatatttt     81180
     atattttgta ataaaattag acttttataa tgaatgaaga atttcaagaa agaggtatat     81240
     aaaggcgaca tttatcctga ttacactata ttcatcaact catttatagg taaattgtcc     81300
     atcatgaata acatcttgga tattttgagc aaactacaca agaagccacg aggcatcatc     81360
     tcataaaacc taattacgtc acagaaaaac ctcctgaaca tggccaggag gtttttctct     81420
     ttttaggctg tatatggtat acatatgtag ttaacgtaat gagtgttatc ggaaaaaagc     81480
     cattgaaatc aatgattcca atggcttttt tctgtatcta aacatatcca aatcctttta     81540
     taccattgca tattttatta agtcatatgt tttagattat ccacgcttgt ccaatcgcaa     81600
     aggtgtagag attcatataa taataaataa aatagaaagg aggttattat atgactagat     81660
     tattagatgc tagaacatct cagaatgcta gtattgctaa ttctatctcc attcccatta     81720
     ctatcctctc tgcaccagga ttatttggac aagttggcct taatgttgcg ggtgctactg     81780
     gccctatccg tacccaatta agtggaactg tagcttgcca attaccactt cttcctttag     81840
     cgacaactat tacattgaca attgttagag gcagactcct tactgaccca gtcatctatt     81900
     cttcatcaga atctctaaat ataaatctct taggacccca actttttacc tttactgctt     81960
     ccgattttaa tgttccaccc ccagcatctg gacttttaat ttatactgca tttattggca     82020
     gcaatatatt aggaacagtg agagtaggac cagaaagttt taatgctata gcttattcag     82080
     attaatgtta aaaattaatg taacgataat gaattttatc cgcgttaaaa tcctcttcaa     82140
     tgattaactg aagaggactt tgatgtgtga ttagtgtatt tcgaagggta ttaagaggat     82200
     gattatatta actaccaaat aaattatatt cattagctta ttttaagtga attgtccata     82260
     tggataaaac aaaaataatt agagcaaact gttcaaggtc caacaaagcg tcaaaacaac     82320
     atttcaatca ctgtatagaa aaagactgtc tcttactagt caaaagaggc agtcttttct     82380
     gttttccgac tgtatagagt cttcattttt agttaccata atggatttta ccggaaacaa     82440
     aataaaaaat gtcatgtgct taaaataaga acatgactat aaaagaagat gctttaagtc     82500
     gctacatact acatcctatg tactttaaga ataacttgtc ctagacaata acctattttt     82560
     tatataaatg aataaattta tttaccaaga gcaaactacc caagacgccg caaggcatca     82620
     tctctaaaat gccaattaga gaaaaaaact accttatgcg caggtagttt tttctgtttc     82680
     taacctgtat atggtataca aagttagttt ctatagagtt tgcttaacag ttatcaaaaa     82740
     atagaaacac tacatactat acgcgtaagt ttatggtata gataaaataa ttatattatt     82800
     actgcttttc cttacgggct aacattataa tgaaaacgta gtgaggacct agattaaaaa     82860
     ggttttaatg ctaaatgtgg cgtatataaa tagacaatgt atcctttatg ttaacgtggg     82920
     tgcactcgtg gagtagcaac ttttaagtta gtgtggggac attaatgatt ggaaataaag     82980
     aagggctctt accaaaatgg ttagagtcct tttcgtatag caaagataag gcgtgcagag     83040
     ccccaatttt ttattagagt tctaagatac cttacggtat ctagtcccat tccagttatg     83100
     gtcggaaaca ccgttcaaag gtcactgcac atatttatta tagcaaaagt attaagaaag     83160
     attgataaga tctttttacg agaaggaatt agtaaatacc atgccgaaca ttaatttctg     83220
     tgaagagcta taaaaaagtt ttacaattct ttttatagct tttagtggtt gaaactctta     83280
     ataggaatgg ggctagtttt ttcactagac ctcttagatt aatgtgagac ttttcatctg     83340
     acgctgtaat cctgacatac tacattgggc ttaaagctct tatagaaact tggatagtca     83400
     gatgtattat accaccggga ggatttacat cgtgaaagag gaaacgactt taccttttag     83460
     ctttttatca aatcaagcga ccatacaaga aagaaaaatg tatcaatttt ttataggaat     83520
     cgatattgga gccagctttc acgtggcctc ttgtatccac tttcaagctt ttcttgatcc     83580
     aaaaggccag gaatggaagc gttctaagac aatgaaattc aatgcagata gtgccggcat     83640
     cacaagcatt ttaaatgcgt ttaaacaagt agaaagacaa tttggtgtac aaagagatga     83700
     cttttttatc ctgttagaac caaccaacag gagggcatta ttctttcttg atacaacaag     83760
     ttttattata tgagggatac acgttattcc aagtggaaaa caaagcagtt aagaacttcc     83820
     gtgaaagtca tttaggtata acagagaaat ctgatgcgat ggatgcaaaa gtcatgtctt     83880
     atatgggatg gcacaaaacc cttcatcctc atatgcatgg ggttcgtctg ataaatccag     83940
     ctagtgtatc ccaatctatt tttcgaacta ttatgagaga ccgttggctc cttaatacac     84000
     aacttacacg acgaaaaaat caaatccaac aactactaca agttactcat ccagatctaa     84060
     aggctgcatt taagaaacca agttctccat ccgttttaag gtttatatta cgctatccca     84120
     ccgggataga tctacagggt gcaacacaag atgagttaag acaggcaatg atcgaagcag     84180
     gagctaatag cgtagctaca aaagcttcta gaatccttta tgaacactca ttatatacag     84240
     tagctattcc tgttcctcac ttgattggta gagagaagtg gatgattgag gaagcacttc     84300
     gaattgaaca gagtataaag gatttagata aacatattca ggagcttctc catggtaatg     84360
     tgcagcaagg aatctcccca cacccatatg ccaaattact atattccttt ccttttatga     84420
     gtgataattg ggcatgtaca ttaattggga cgataggaga tgtagataga tttaatacat     84480
     ataaagaatt taaaaaatat atgggggtat cagcagaaaa taagcagtct ggtacttctg     84540
     taaaaggaac acgtcaaacg tttagtggtg tccgagatac ccgtcgggta ttgtttcaaa     84600
     tggccctcat catgatcgct actaaaaagc aacctacggt gtttagtatg tattataatc     84660
     gcttagtcga acgagaaatg aacaaaaaga aagctatcgt acatctatgt gggaagattg     84720
     ccaaactaat ttatacgact ctcaaaacag gacaagaata tgattcaaag aagcatgccc     84780
     aagcatgtgg aatcgcatgg gaaagtatgt acgataagaa gcttgaaaat attgatgatg     84840
     atgcttttca tgatgaagca ttaagattca taggggaaag tccaccaact gagttagagg     84900
     aactagatgt ctaaaaatct atctaagtgc ttcaaatcat tatattcagg atttttttcc     84960
     acataaaaag agtgattccc tcaaaaatgg atttccgttt ttgaggagaa acactacact     85020
     acattaacat aatgtctctt tccggtacac atcaaaaagg aaaccccttg gcgtagaagg     85080
     gtttccatga gggtaaagtt tctttattat gcagcttttt atacatcctt aatgtaacag     85140
     cattcacctg aaggattaat aggcggagaa tgtatgaaaa gtgcacattt tatacatatg     85200
     cttcaccaga aaaatatagt ctttatggaa aaatatgata taatttcttt tgattcgttt     85260
     tatgtgagcc ctgacgaaaa gctgcttcgc ttccactgcc gaggtagctt tttattttgt     85320
     taataagttt aatcaccttt acaacgattc tttttccttc agcctcatta agtttttttt     85380
     tcgcaaaaag gtatatggta cgatcttaac ggatactaat gatgtgatta gtacacattt     85440
     tgaagttgct aacttccctt ctcctccaac aagataaata agggaagtta attactaata     85500
     ggaacaatct atataaaaaa tactttagat tggttttatt tttctaaagt gttttttatt     85560
     taaaaatgag tactgtatac attttaagtt aacataatgg attttataga aaaaggatac     85620
     aaagatagta caagttttat ataaaaccag cgcttgtcca aacctttttc attattttgc     85680
     atattataaa ttgagcattg cattaacctc ctcctcttcc attagaggtc gttccattgc     85740
     tatggggttg aagaaaaaac tattttttgg gaaggagtag ttttttcttc tttctataca     85800
     tacattcctg ataacgaagc agactactca agatacctta gggcttcaat aatcattaag     85860
     tagattatgt atcaaaaaaa ctatctattc ccaagatagt tttttctatt ttgcattaca     85920
     tacgttgttc attcccagta aactaacttc taaaaaataa aaagattatt aaaataatta     85980
     aatagtacaa gcccttactt gaaatttaca tataataaaa caaatgtgga tttacaattt     86040
     atatttaatt tactgcagta agggggatac aaagggggat tagggcctta ttaagaatct     86100
     tagatcctgg aataccagtt ccaaccttaa tcataggcag tgctacactg actaatatta     86160
     cattttcaag ctttaatgct acaactaatt tagcttcttt cgctactaga acaggtgctg     86220
     gaacaaatgc tagcacaaat attgtcacag taaatgctaa tgagattcag gctataacaa     86280
     cagcttaacc atatatctta cttaaataaa tttggaaata aaatctatca aaatcaataa     86340
     ttacaacgga tttttctgta tttaaacatg tccaaatctt tttcatttgg ttacatattc     86400
     tactagtaca agtatcttct atgaaaggat aaaataataa tgtttcataa tataaaacga     86460
     accctaatca taatgaaatt gattctgcaa gacgtattac aaataaactc cttagcacct     86520
     ccctattcca gtacattcac aaaaatagcc tttcctgtac ctgaaccacc tggtgtatcc     86580
     aacttaccac tcttcattta ttttgatatt gataaccgtt ttactttagc ccaacaacaa     86640
     tggattcgtg atgctattaa cggtgtacta tttcaatggt ttcaacacct aactgaaaaa     86700
     tggaatggag gctctaataa tgggatctcc caattggcaa cttgcacaaa tctatacgcc     86760
     accagaaatt cacgaccaac ttggtatctg agcttaccta tttctaatgg attagctgct     86820
     actaatatcg ccatggatca atttactcga ctcatacgtg acaatggatt tggactggct     86880
     ccacaggcaa aaatcttttc aaatatttta ttccctgcaa attcttctac catcttcgct     86940
     ttaactactt tagcacaaag tcaagttccc ctatctttta tcgttaatcc agcgcagctt     87000
     gatagtccag gtttgaatat taaatttctc actggatcta tgtttcatgc ttggctccac     87060
     cgtgccggtt tctatcatcc taaaaaaagc agccatttta ttgttgaatg tccaatgtgt     87120
     atcatgcgag gatttcaaat aaaaagaact attactcctg atagcttcta tattcaattc     87180
     ctagattaaa tttatgctgt atatgatata caatcttagt taatataatg aacatatcga     87240
     aaataaatta ttttgaaatc ttcttcatat aaaattcaaa tgctagtgga caagtacaca     87300
     agcgctttct tgattaagga atagtatatt atgagaaaaa aaaaggagtg atccaagtga     87360
     gtgaatacca cgaaaaaaaa catgaacaca aaaacaactg tcaatccatc ctccaaaaag     87420
     cctttgaaaa actgttaaaa gatatttttg aagatgatca caaaaaaaca catcattgtg     87480
     gatgtcataa caaagattga cattattatg aaggaccttc tagattggac aagtaataaa     87540
     taattaattt acgaactcgc ttttaaatta atttttcacc ttgaatgtta acccataatt     87600
     tgagcaaact atccaaaatc tcgttaaata tcaggtcata taacccagta taaaaagagg     87660
     aaagctactg ttaggccagt agcttttttt cttctaaact ctttgcctat tccaataata     87720
     ccagcatctt ttatgaaagg agaataaaca caagaatgaa cgatgaagaa tttaacttca     87780
     acacaagaac tcagtttaaa tttataacaa ataatcatac tctaggctat attttaagtg     87840
     gtattgcgca aaaaggaatt aatattaatg actactctca aacaaaaatt aatgtaaatg     87900
     aaaatcttat tagacttgta gttggaggta ctggagcaga aacaattgat gttcttcgtt     87960
     gtgtaagaaa catattcaga atgcttgaca ttaagtttag tgagaaagat attattcaaa     88020
     ttgaaagtat tgcatccaat gctactcgtc aaattaatac tttgtttgga tccttgtaac     88080
     ataagtcaaa tgtattatat attggtaaga ataatatatt atatttagat gcgtcaaata     88140
     ttcataaagc aatactaata ttatcaaaaa gagaactaaa acaatgtcct aaaaactgtc     88200
     gagaagggtt ctgattcgag gcttaaagtt attctaacta ctttatattc attcctcttt     88260
     aggtaactta cctattacaa agagggatta agaaaagtag gttcatactc agggtttctt     88320
     ttctcattaa ctgaagtttg atgggagaat gaaaaatttt ccgaattatc aataggtttt     88380
     tcattttgtt tataaaacat tattaatact ccccctttct caatacaact tatttagtta     88440
     attattaaaa tgattttatc caaataaaaa ggacatttct tatatgtcct gttcctttat     88500
     atcagctccg cctccactaa ataatatgac agcctcttat gctatccaac ctattaacac     88560
     tataattgaa aacgattaca aaaaaatcaa ttgaatttat atatatattc accatattat     88620
     attcgttgta gctattttag gtgacttgtg catcatgaat attttcttat atattgagca     88680
     aactatggat gatgccgtga ggcttctacg aaaatcctta cagcaataga gcaaaaaaaa     88740
     ccactgatta ggggactgac cccatagagt gcgacaaata aaaaaacacc tttaagtaaa     88800
     aaacgggtat gtagtaccta acaataactt ggaggtgttt tttctatggg aagaagagtt     88860
     agctatccag tagaagtgaa attaaaagca attgaaatga gattggcagg agtaccaatc     88920
     aaagaagtta tggaaacttt acagatccgc aactatacac agctcaaaac atggatgagg     88980
     tggcatagaa atggagaatc ctatcgcctg gcacagcccg ttgggcaaac gtacacccct     89040
     cgaaaagggg ctcattctca agatactcca tcaaagttag aagctgaaaa tcgatattta     89100
     aaacaacaga ttgaagtctt aaaaaaggac aaagagttgg aaagggagtg gtaccagaag     89160
     ttgtattgaa cttagtagaa gaattaaaag agaaactgcc tatctctcaa atctgtcagt     89220
     gtctgggtat tcctcgatca acttattatc gttggcagaa aaatgagcaa ggagaagaaa     89280
     caaagagaaa gaaatggata gaaggaaaag ttggtgaaca gtgccttaaa cataaatttc     89340
     gatatggcta tcgaaaaatt acagcgttac tcaatcaaac catgcatatc aaccataaaa     89400
     cagtgcagcg tgtcatgcag aaatacggtt ggcaatgccg agttaaaagg aagaaacgga     89460
     aacaaacagg acaaccttat caggttgcag aaaacgtgtt aaaccgtaat ttccgagcag     89520
     agcgccctct tcaaaagctg gttaccgata ttacctactt gccttttgga cctaaacagt     89580
     tgtatctttc aagtattcaa gatttattta atggcgaaat cattgcgtat tcagtgagtg     89640
     attgtcaaaa cgtagagttt gttttagata cattaagtca actcccttct ttacctcagg     89700
     gatgtacgtt gcatagcgac caaggttcgg tttacacatc atatgcgtat caacgaaaag     89760
     tcaaagaaag aggcatcatc atgagtatgt cccgcaaagg gacacctgca gataatgcct     89820
     ccattgaatc gtttcattcc agcctaaagt ctgaaacgtt ttacctcgac gagttaacat     89880
     gtactacgac tgccatcgta gaacaaactg tcgaaagcta cattacttat tataaccata     89940
     tccgtattca aacgaaacta aacaaccagt caccggtaca ataccgacaa ctggctgttt     90000
     aaaaggtatt ttgatccctg tctcgaaatc aggggtcagt ccctagcccc agtggttttt     90060
     cttgttttca tactctatat catatacgat gatctatttt ttataaacac agctacagga     90120
     agccctaagt ccaatgttag acttattgtt gtttaaaggg aacactccca taatgctgca     90180
     tctactacag catcgtattt atgttaaatc tgttgttgca attttaaagg agatttcttc     90240
     tgctgcctct aaagctcttc ttttagcagt ttctttataa tatgatgacg ctaaaatgta     90300
     accataacga tgacccattg atgtaggtgg ctgtaaaatt gccccttttt taggctttat     90360
     ataaacctct tctatgcctc ggtagttaga actgcgttct tttcccgtaa cttgaattag     90420
     ttttccttta gactcaactg ttaagtaatg ggcgtacaca tatttataat cctttttagt     90480
     caaggaaggt tcgtttccca tcattaattg catagtctcc tgtaccaagt taattccatg     90540
     tccaatttca atcatacgat tcatagctcc acctgatatt cttggattta tctcaattaa     90600
     tttccaacct tcagttgctc tacgaagctc caaatgacat gctccatttt tcataccaaa     90660
     agcctgtata atagaactaa cagcattaaa aagactatga aataagctat tattcaaatt     90720
     ccctaacaaa gaataaccag tgacgataaa acgctcaaaa agggtaattt cttgttcaat     90780
     tactgcaata atatgaacct tttcattatg aactaacacc tcaactaagt actgagggcc     90840
     atctacgtat tcctcgagta agatttcctc gttaggtagt ttttttaaaa gggtatgcat     90900
     agatgatatt aactcactct catccttcgc taacaataca tcctttgacc ctgttgattt     90960
     aggggactta acaataaggg gaaaatttat ctctttagtt ttaagaaatg aagataataa     91020
     ttctgttggt ttataaatta aataattaag tgaaattggt aatttcttaa gcacattacg     91080
     agtcaatatc ttatcttcca tatgatagat tgcatcagcg gatatatcac tcttacagaa     91140
     tttctctgac agacgtgcag ccacataaac aaaaggatcg atgaaactaa aaattccttt     91200
     tatatttttt cctgtttttt taaatttttc gattatcgtg attaaattat cataatcatt     91260
     tatatcagta aagatcatct catgtacatc tggaaattca ttccgatctt taagaaattt     91320
     ttttctacaa gttaacaaaa ccgtaaagaa attaagatta tttgctgcct taattgcttc     91380
     ccgactcgat ccagatttat ttgtttcaat aaagacaata gtatccataa atattcccca     91440
     tcctatccga tcaaaaatgt tctcttactc tatgatataa aaaaagacaa ccatggttcg     91500
     tccaaatgta aataatatat gaatttggtg aatataccta aacaagtaag agtagaagaa     91560
     aggatgattg ctatggcttc aatcggcatg cttcatcatc gtaaggaccc gataaatgtt     91620
     agaaaagctt atgctttcgc tgcagtagca aaagccgaag gtatagattt tttttatttc     91680
     actccaggga aagtgcattt ggaaaaacgg actattttag ggaaaacata cgagaaagga     91740
     aaatggatag agaaaagata tccttaccct gatgttattt ataatgctag tccccctata     91800
     agtgataaag catcagaaat agtagatgaa ttaaggaagg taattccttt taccagtcac     91860
     tctgttgggg ataaattaac tgtttataac aaggtgaata aggctaaaaa atttgatcag     91920
     tatctcattc ctacttcaga attaactaat tataaagtat tgctaaatat ggcggaacgc     91980
     tacacaaaaa taattgtaaa acccttatcc gggcataaag gggctggtat tttctatata     92040
     gagaagctag gtgacagtta caaagttagt aaagatgaac aggactccat atttagtgaa     92100
     aatcaactaa taaagtttat cgataatcat ataaaacagg acacttactt agtacaaaaa     92160
     tttataacat gtaggacaaa attaggaaat gtatatgatt ttagattgca cgtacaaaaa     92220
     ggaggaaacg gtaattggtt aattaccgct atatatccga gaataggtaa gataggtagt     92280
     atagcttcaa acctgggcaa cggaggctat acttgttttc ctgatatctt tttaaaacag     92340
     gaatttggag ataactacta taatgtccaa aagtacctcg aacaatttgc tttaaatttt     92400
     tctaaccatt ttgaatctct atatcaggat gtactatttg acgagttagg aattgatgta     92460
     ggacttgatg aaaaaagcag actttggctt tttgaagtga attggagacc aggcccccct     92520
     atcattgtca atgttgaatt ggatgtagta aggaacactc ttcaatatgc ccaatatcta     92580
     gccaataaaa ataaaaaata ttagctggaa tttatataga aatataaaca ttattaatta     92640
     aattaagact tcaatccaat aaatacattt ttatgactgg aaaacacatg cctctgcagg     92700
     gagatagttt ttttattttg ctctgtagat tttatctaga tcttgctaag tcgagtaagt     92760
     taggggcatc actgcccctg cctcccatag caggtttatt tatcgtatcc tcactacata     92820
     cggtattggt aaataaaacg tacgccgacg ctccaaatgg aggtatacat aacagcacat     92880
     ttctttcatc agaagatagg cacagcctta tgtacctata aaagaccagc aagaggtcag     92940
     cttcattttg gatctatcat gggtttgtcc gtaagggcaa tagtattcat ccagttatgc     93000
     gtttttctgc tttcccgttc tctttctaga taacggcatt cgctttctct tgtattcttt     93060
     atcctccgtc acattgtttg ggcttacagt ctccctacta tttatacaga taataaaggg     93120
     tttactgagt ccagcatcct atagatacaa ccgggttaga tggattcttt acctcgggca     93180
     agatatggga cacatcacag cagcgttatg aatctacttt tcctctcgcc aatacgtaaa     93240
     caaatctgtg cactatcctg agctcacatt tacgaagctt acaaaccttg actttcattc     93300
     atcttactta tcttcccctg acagtgttct gaatcgtgta atgattctct atttcagcat     93360
     ttcctcctgt aaccctcgag tccgttacca gaccagcggt tttagacatg aatagttttt     93420
     gcgtctaaac tagtggcttt ggccacatat atagtagcaa ctgcttgtcg taccttaatt     93480
     tttgttactt gaaatttaag aaagaaggaa tattccctta tagaatgctc cttctttctt     93540
     aaatttatta taaagttctt taaaaagctt tatccaatac atttctgaaa cccttctaaa     93600
     ttaagctgtt tcagctattc tactaatact aatagcacct aaatctgaaa aaattattaa     93660
     atatattctg ccttgtccaa tcaatttaga atgcccccct atataatata aaaaagcgta     93720
     ggagtgatta gtatgaattt acaaactctg cgaggctctt ataatttaat agcgggctta     93780
     ggaagttggt gtggtccagc actttattcc gaacgtcata atttaagaag gcattcattc     93840
     ccacttgatt gggttcaaac tccttttctc tctgatgtaa ataggttact aaaaaataaa     93900
     tttcaaggtt ttatggaatt aggaaatatg attgaaaaag atatattagc caattatata     93960
     gacgataatg gatatcctat ttttaaattt ggaactcatg aatcagtaag agctcattat     94020
     attacagaca cccaatataa catcgactct gttcatgact tcccaataat tcccgatcaa     94080
     gaatgggttc tacaatatcc atcttataaa ataagattaa atcatcgcat ccaaacattc     94140
     cttaatcaaa ttgcacaaag tcaacgtacc ttatttatac gacacgaatg gatgccaaca     94200
     agctatgaag atatagtcat actaaaatct atattagctg aaatgactaa tggtaacttt     94260
     aatattctgt taatagaaac cgttgatgat gacttacaag gcgtgaagga tatgaatttt     94320
     ggaacacctc aagatggtat ttgttgggtt cagatttctc ggaaaaattg taccaatcct     94380
     tctatttgga atgttctatt agaagggata actttaatag attaaaattt tataaagtat     94440
     aataatttaa agaggaattc gtgccacaaa tcatagtgag cttaatttca tttttaaata     94500
     cctaatgtgt gtcataagag gatttcaact caagttacca taatggcctt tctaggtggt     94560
     cataaaaaac atatataatg agtaaaataa agtaaaccct atgtaagact caccgcccta     94620
     tagattctta aatctatggg gtttcacctt ataaccatat gtatttactt aaatttaata     94680
     attaaagttg ggcagatatc tttataaggt gaatagccta tatatgaact attttaagta     94740
     taaaatggat agcataattc taattattct ttcataaagg aacttcaata tagagcaaaa     94800
     cctaaccgtt cagacccttt atttgtaaaa caactgcaag aagctttaga tgaagtaacc     94860
     gtttgagacc ttgaaaaggc agccctatcc cctgtcattt gagccatcct agggggaatg     94920
     aacccacaac atgttattgt ttcctgtctt gatgctatgc cagcagatag tttagagagt     94980
     acatagatcc agattatacc gcaacaagtg gcaatccctt agcaaatgtt cctgtaaatt     95040
     taaatgcaga ttcacaagat tggcctcaga ttgtacctca tcctacctat atccatagta     95100
     ctccacctca agaatcggga aggaatcata catcgataag tccaacggct gcctaaatga     95160
     agtatctaat ttttaatttc agctcatttt gacataccaa tgtagttttt ttattgcagc     95220
     ctcttttata atccccaaca aaaaagaacc cttgttcacc aagacaaggg ttctcaggaa     95280
     gaatagattt tttgactaaa cagtttttca tacatccctg atataacgga tttttctcag     95340
     gatccaggtg gaaggaagat gtataaaaag tctgtccttt atatatatgc tgcatttcaa     95400
     tctaaagcaa tctcctttac aaaaacttat taatgtttac aatacgtaaa tatttttatt     95460
     tactagtgga caagcataca agcaaaaaaa atattcaaca ttgaatatag tatatcgggt     95520
     aaaggaggtt atgatatgtc ttcatgtaaa aaaagaaagg tttgttgtcc cacttcttgt     95580
     tcatctccgg aaccgttacc taagtcttgc cctgcttacg gtaacttttt caataatact     95640
     aatctcgtaa cagtactaac tggaactgca tttcctttta atatacaagg accgatctct     95700
     ggaggagttt ccctattaaa tcctaccact atctttattg aaaatggggg agattataaa     95760
     gttaactttg tgataaccga taacacagtt gtttttggcc caaatccagc tgcatttcct     95820
     caccttccta ctgttggatt attcttaaat aatgttcaag tttcactcga acaagctaac     95880
     tttggacttg aagttactca agcagaaggc caaggttgca aactaattgt tggggatact     95940
     attctatcta ttccagacaa ctcgatactt gaattaagaa atataactac acagggtcct     96000
     attacaacga taatcacttg tgatagtgtt ggaaacaacg ttcagttaag cctttttaaa     96060
     ctaagttaag caagacgcac tctctaattc tatctcttgg aaagcaatct cgcctagccg     96120
     aggttgcttt tttacatact taaatcacgc tagataaaag gggtttctct cgaatttatt     96180
     taagtaaaat tgtgtcgtag aggaatacaa ggtgcacaca ttaggaacgg aggccaacta     96240
     tggatatcaa gcagaataca ataaatgctg aagaaatgac caagcgatta aatacaactt     96300
     ccagcaatat tagaaaatgg ggtatcgaat tagaaaagca tggttataag tttgatcaat     96360
     aacagaaaga aacgttcctc ttctgttatt gatcaaattt aaatatgcta tttaaggaga     96420
     aaaacttccc ttagaaatag ctgcaatgac tgttataaag ggatttgata gaaaccgttc     96480
     cgcgtcagac acatgttagg aacgcctaaa agttggtccg ccttcaggcg gccatgtact     96540
     ttcaagattt aatgttctct aataaaaaaa ttaaaaaact aacatatttt ccatagaaaa     96600
     aagagcttag agtagtctac aattaagctc tttttcactt cctcactcta taagctactg     96660
     gactcttact ggcgtagcct gtagagtggc catattgttt tggattgtta tatcgacatc     96720
     gtaataacct ctactagcag aactacatgc atagtctcct gagcatcccg tcacaaaaaa     96780
     tggcgtatta ggaaagccag gatgaatatt atttgaattc gaataaaatt tatgtgcatg     96840
     gtgagtgaaa atggccaaga ttctatttct cacattggga ggtattgcat taaaaaacat     96900
     gtctgtttct gcttgggaca taacatggtc ttcaagtatt gcagtagtga ttccaggaac     96960
     tctcaaaggc caatgaaaat cgataatata ataataatta ggatccaaat ttcttaatag     97020
     gtttaagcta tcctggctga atattcctcc acgcccgtta tctagccaga catgccgtac     97080
     cagtccccgc gttcctggaa tacccacgta tccagttaaa aaagggttga gatactgttg     97140
     aaataaagct ctactgttat ttctatcgat atcttcccaa tttcctatag atgttctatg     97200
     gaagatattt gatcctaaaa cattatttaa aatatgcgag aattgttggt aatacctttc     97260
     ggcttcttgc gatgaagaag ctcccaaagc atgtacatca tctcctccaa aaataatata     97320
     ccttttgtta ccattgctca ccactctctg caaaagagta ttaaacatgt tttgactatt     97380
     ttgaaatcct acgtggctat cgcccacaac agccaaattg atggtagtag ctggtggaag     97440
     tcctggttgg gttgggggat taaagcaata attgtccttg ttacctttaa tttttttaac     97500
     tatttttatc accctttctt tatatctttc ttgatattct attcaataaa tgaaaggctg     97560
     cttgtacact tgaaaaaatg ttcttttatc attttctttt ctcttcgttt ttgagtggat     97620
     ggttggctat taatctttgt atcaacacat ttattaaaga gaggaaactt cagacagttg     97680
     ctctgacgat tcggtaagta aaattgctat aacaagcaga tcattacctt tatttttatc     97740
     ctttgctgga gggaattatg ttaactcttt acctacttac aaacttttag gattctatac     97800
     taaacaagaa gataaaaagc gaaattacgc ttctaagaaa ttgtaaaata aaggattgac     97860
     ggaaccttgc tgaacctctc gcctacgttc agcactaaat aaacctctta atgtcccaaa     97920
     aaaataggct tcaaagacag tttttattcg ttttcttttg taagcgaaga gagtttccct     97980
     aaaaccttga acagcaatag gaactaagtc ttctatgggc ttttctaagc cactaatttt     98040
     ataagttagc agaacttttc cccataagtt ataaatatca tctgcattcc taaagaatgg     98100
     agctactgct tgtttaaatg gtgttggaat aaaagatggt acataatcgg gtgaaagttt     98160
     aacacttata tcttctttac gtatgtattt atttaaatct tttaaagata aattataggt     98220
     agaagaattt ttggagacct cctccttact ctcacaaggg attacgtctt tttctgcttc     98280
     aacatctgtt tcaacattct tagccaaatt gagttgtaaa taattcaccc aatatttgaa     98340
     ataaggatga tttacaaaca gatgtacagg atttcctttt ccgttattac gaggacaacg     98400
     ccgataaact gtaacaatta gtccttgctt tcgaagctca cttaggtgac gatcaattgt     98460
     tccctttgat ttttcatagg ttttccctaa atatgtactg ccaggaaaac aaaagccttt     98520
     ttctgcaccg aaccagcaaa gtcggtctaa agcttttctc gtgccgtcat gaagacgata     98580
     aaatttatct ccgtaaaggc tgataatttc cttaagcaat tttcgtttca tagattgatg     98640
     ttgagaatga tcttctgtgt aactttggta gtttttcata taattaaatt cttctgccgt     98700
     aagcatacgt gtaataggca ttagtctatc ttctcctttt caagaacaaa aaaagacatc     98760
     gcatcccgtg aaaaggaaaa cgatgtcgga ttttttgaca gactaagctc ttgaaataaa     98820
     cctaattatc ctataaaata aaggcgtaat taaatttatg tatcgagact tcgacagatg     98880
     ttttccctag gtgtttaggg ttaacggtgt aagggtgttg gcgcaccact tgcacacgtt     98940
     ggagtctttt tatattccgt cctgttttgt tgactctatt ataacgtcta ttaatcttgt     99000
     aattcaataa aaattcacca agtcctcagt aaaattatat gacctcactt ctcttatggt     99060
     taaaaatcac ttcaattgga tacgctgtta aagtaactac cttgagatta gtattttctc     99120
     tctaataaat aataatccta aattataata catactacga ttgttttatt gtttttatat     99180
     attgttttat atatttgttt tattgtttta ttgttttaga ctctctatag accttgatat     99240
     tacagcattt ataagcataa actatcacta attttgcgcg aactatcact aattttgcgc     99300
     gaactatcac taattttgcg tgaaactatc actaattttg cgtgaaacta tcactaattt     99360
     tgcgcgaact atcactaatt ttgcgtattt atccctatat gtttataagt atcactaatt     99420
     ttgcgtgata aatgtagatg tggcttaagt atcaccaatt ttgcgtgata aatgtagaca     99480
     tgccttaact atcaccaatt ttgcgcgtta aaattaagat ttaaggtaat aaatcaagat     99540
     ggagtaatgc ttctagggtt aaaaatcctc atgaagtatc actaattttg cgtgatattt     99600
     aaattgcaag gacaggctgt tctttaacat gcaatttaca cagtatcact tttatgatat     99660
     tttagtgata gtttagaaaa atatggggga tttt                                 99694
//