Dbfetch

ID   CP001988; SV 1; circular; genomic DNA; STD; PRO; 66985 BP.
XX
AC   CP001988;
XX
PR   Project:PRJNA30165;
XX
DT   21-APR-2010 (Rel. 104, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Bacillus megaterium QM B1551 plasmid pBM500, complete sequence.
XX
KW   .
XX
OS   Bacillus megaterium QM B1551
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
OG   Plasmid pBM500
XX
RN   [1]
RP   1-66985
RX   DOI; 10.1128/JB.00449-11.
RX   PUBMED; 21705586.
RA   Eppinger M., Bunk B., Johns M.A., Edirisinghe J.N., Kutumbaka K.K.,
RA   Koenig S.S., Huot Creasy H., Rosovitz M.J., Riley D.R., Daugherty S.,
RA   Martin M., Elbourne L.D., Paulsen I., Biedendieck R., Braun C.,
RA   Grayburn S., Dhingra S., Lukyanchuk V., Ball B., Ul-Qamar R., Seibel J.,
RA   Bremer E., Jahn D., Ravel J., Vary P.S.;
RT   "Genome sequences of the biotechnologically important Bacillus megaterium
RT   strains QM B1551 and DSM319";
RL   J. Bacteriol. 193(16):4199-4213(2011).
XX
RN   [2]
RP   1-66985
RA   Eppinger M., Bunk B., Johns M.A., Edirisinghe J.N., Kutumbaka K.K.,
RA   Riley D.R., Huot-Creasy H., Koenig S.S.K., Galens K., Orvis J., Creasy T.,
RA   Biedendieck R., Braun C., Grayburn S., Jahn D., Vary P.S., Ravel J.;
RT   ;
RL   Submitted (05-FEB-2010) to the INSDC.
RL   Institute for Genome Sciences, University of Maryland School of Medicine,
RL   801 West Baltimore St, Baltimore, MD 21201, USA
XX
DR   MD5; 20d65e532faa372aa0f5196d635d145d.
DR   BioSample; SAMN02603354.
DR   PubMed; 11251820.
DR   PubMed; 14602653.
DR   PubMed; 15933003.
DR   PubMed; 21705586.
XX
CC   Bacteria available from the Bacillus Genetic Stock Center,
CC   (http://www.bgsc.org/), The Ohio State University, 776 Biological
CC   Sciences Building, 484 West 12th Avenue, Columbus. Ohio 43210 under
CC   inventory No. 7A116 or from Patricia S. Vary (pvary@niu.edu), Dept.
CC   of Biological Sciences, Northern Illinois University, DeKalb, IL
CC   60115.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..66985
FT                   /organism="Bacillus megaterium QM B1551"
FT                   /plasmid="pBM500"
FT                   /strain="QM B1551"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:545693"
FT   gene            177..1298
FT                   /locus_tag="BMQ_pBM50001"
FT   CDS             177..1298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50001"
FT                   /product="putative replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50001"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72340"
FT                   /db_xref="GOA:D5E3G5"
FT                   /db_xref="InterPro:IPR009428"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3G5"
FT                   /protein_id="ADE72340.1"
FT                   /translation="MEMLDYVIYNLVATGIQAIHSKTLMQKFDVSQSTVSRFVKSLKET
FT                   PFMIVARYIKEDTTGAHPDSYVFILKSHTNFNQICEEIFFAHDTTGVQTLQQEEMTTPV
FT                   TTPVTTPVTSPERAENVDTPSFEGEKTSSPFINLDLPKNHLTNHLISASQSFAYIKGVP
FT                   KKVNNVYAGKYGHQLKDFYARIQNAAKAVKRDTEIEIVKEQVHEVAYTAIVGLDKYVHE
FT                   ANHKGTPLSLDEMCRLVYQIAYNQFTNLLTGNTEEQPSESDIHTEAETAALFTPKHIIR
FT                   KEIVPAWLKVEKEQKECTQEPALSLDEQLEMIQLKQDLGQELTPEEETLLQEHSSTYSS
FT                   LEMAQLKQDLGQALTPEEQALLHQQDQLKGSVS"
FT   gene            1406..2173
FT                   /locus_tag="BMQ_pBM50002"
FT   CDS             1406..2173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50002"
FT                   /product="plasmid stability protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50002"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72341"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3G6"
FT                   /protein_id="ADE72341.1"
FT                   /translation="MPHKMTLTGSATGPLREYDRYVAFDMREKGSPSAPKGLKKSTFIS
FT                   YTVFVAKKAFNKTGLTKKSIMHEKILIQGEPTLDIPIDECPGEIGIICFQITVLPNKND
FT                   KEANESKDKKEAKLEVSKAQQEVAATRQEEKQNPVSQPVATEAKTIQPEAKEMPVQEKK
FT                   AAPQKKQLPTQPKGTQDVVNFDEIIVPEAFLKTRPNPVKTEEVIEFVKRTGHLDKPLTI
FT                   DKGSKILKDGYRRYIVAKTVKMDKVPVVYEYQK"
FT   gene            2253..3065
FT                   /locus_tag="BMQ_pBM50003"
FT   CDS             2253..3065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50003"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72342"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3G7"
FT                   /protein_id="ADE72342.1"
FT                   /translation="MSYPYDLDYLLPDDQRYNIYVATLIPKLSIDEDSVQFFENYIRFD
FT                   VMVGTGEHTSREILDISIFSDDKPEFDHRKFEFDYEKPRKAMVFTGWKKGPIELSLLHV
FT                   YREDSKYYLDTEIVYIGQAFGENGERLPAEELMSDPMLQKVEEALLREYPEKDLALLLL
FT                   EFNSQLLEEIDSEDEDLIQLQEITKNPSLELNNQILNATEAALINYFKPEYNKKLNNDF
FT                   SNVEDHGLHYHSVTVQVHPDIMGLKLFSKEKTYLSNDPIVSSPLHSNS"
FT   gene            3386..3955
FT                   /locus_tag="BMQ_pBM50004"
FT   CDS             3386..3955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50004"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72343"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3G8"
FT                   /protein_id="ADE72343.1"
FT                   /translation="MSEQLGYFAKQVCGKLKLNPNTLRKWAIELEENGYKFERNNKGPN
FT                   GQRIYYERDINIIAEFKVLLERTHSVENTAKLLMKRVEEDSNAEITHGVREEKERSNPI
FT                   TVTFTREELEQYTRGIIEETSAKVAAEVSAQTAEAVYKKMENLIEQRDHKLINQMNESM
FT                   EQRRLEIAAAREEPASSFWSRLFNRK"
FT   gene            4029..4202
FT                   /locus_tag="BMQ_pBM50005"
FT   CDS             4029..4202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50005"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72344"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3G9"
FT                   /protein_id="ADE72344.1"
FT                   /translation="MTRGEKGSNTGITHSVREEKERSNPVTVMFTREELEQYTFGLSKK
FT                   FQCKRQKQRIKK"
FT   gene            4486..4605
FT                   /locus_tag="BMQ_pBM50006"
FT   CDS             4486..4605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50006"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72345"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3H0"
FT                   /protein_id="ADE72345.1"
FT                   /translation="MLQSCSENENKKEDTIHNISSHEVKKDLLSILEIRLFSI"
FT   gene            4861..5088
FT                   /locus_tag="BMQ_pBM50007"
FT   CDS             4861..5088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50007"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72346"
FT                   /db_xref="GOA:D5E3H1"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3H1"
FT                   /protein_id="ADE72346.1"
FT                   /translation="MFWWKNPKRSKFGKWLDKNGIQQTDFAMKSNVSRRTIWTICNDKN
FT                   YIPSATIVKKVMDAVKMVDSSKQPKDFFDI"
FT   gene            complement(5572..6804)
FT                   /locus_tag="BMQ_pBM50008"
FT   CDS             complement(5572..6804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50008"
FT                   /product="cytochrome P450"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50008"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72347"
FT                   /db_xref="GOA:D5E3H2"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniProtKB/Swiss-Prot:D5E3H2"
FT                   /protein_id="ADE72347.1"
FT                   /translation="MKKVTVDDFSSPENMHDVIGFYKKLTEHQEPLIRLDDYYGLGPAW
FT                   VALRHDDVVTILKNPRFLKDVRKFTPLQDKKDSIDDSTSASKLFEWMMNMPNMLTVDPP
FT                   DHTRLRRLASKAFTPRMIENLRPRIQQITNELLDSVEGKRNMDLVADFSFPLPIIVISE
FT                   MLGIPPLDQKRFRDWTDKLIKAAMDPSQGAVVMETLKEFIDYIKKMLVEKRNHPDDDVM
FT                   SALLQAHEQEDKLSENELLSTIWLLITAGHETTAHLISNGVLALLKHPEQMRLLRDNPS
FT                   LLPSAVEELLRYAGPVMIGGRFAGEDIIMHGKMIPKGEMVLFSLVAANIDSQKFSYPEG
FT                   LDITREENEHLTFGKGIHHCLGAPLARMEAHIAFGTLLQRFPDLRLAIESEQLVYNNST
FT                   LRSLKSLPVIF"
FT   gene            complement(6957..7652)
FT                   /locus_tag="BMQ_pBM50009"
FT   CDS             complement(6957..7652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50009"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50009"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72348"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3H3"
FT                   /protein_id="ADE72348.1"
FT                   /translation="MSFRLSQRDKDIIAFINQFRAVDRDSLVDLFFKQLKSPVNACNSV
FT                   MVRLYRLGVIERTQQYSPTVYLPVDAKIKKNSQKILHFLSVLDVYKQMCAYSVPKHVIV
FT                   EDKPTGRKGGIEPDLFCIFKGSPFWIEIQRNQYSEQKMQAKINLYEEFFFSDEWKALQW
FT                   QSEDRAALFPSVMVITPVRYAVASNHIRIIQVASIHELMEKYKSSSKQQKEARSKTDPS
FT                   SGGIKINLT"
FT   gene            complement(7649..8446)
FT                   /locus_tag="BMQ_pBM50010"
FT   CDS             complement(7649..8446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50010"
FT                   /product="FtsK/SpoIIIE family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50010"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72349"
FT                   /db_xref="GOA:D5E3H4"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3H4"
FT                   /protein_id="ADE72349.1"
FT                   /translation="MELPVCIGQDIYGNLVSWDFADLETLLISGEIGAGKSSLMRVILT
FT                   TWVKYTSPDDLRLVLVDLKRADLGLFHGIEHVDALCFEAKDMRKPFSLLRAEMYRRGDL
FT                   LLEHGVTHISRLPFKLPRIVVVVDEMSIIKRETELVEIIQQFASQGRALGVHTIIAMQR
FT                   PDSDLLNSALKANLRVRISGRQADATNAKVAGVIGAEEIDAAARGRMKIKIDEVKEFQA
FT                   FFLDEGDCKEILSPYKALVHDPEPDIEVASQSIFGLLEKEEQR"
FT   gene            complement(9786..10028)
FT                   /locus_tag="BMQ_pBM50011"
FT   CDS             complement(9786..10028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50011"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72350"
FT                   /db_xref="GOA:D5E3H5"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3H5"
FT                   /protein_id="ADE72350.1"
FT                   /translation="MNKKKSNYIIFSLWFLVLFFLWIIISLSAGTNGQWWSMYRFNPEK
FT                   YGPWALEFSYIKIIMAAVISLLIAYVVAFVLTRKK"
FT   gene            complement(10191..10883)
FT                   /locus_tag="BMQ_pBM50012"
FT   CDS             complement(10191..10883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50012"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72351"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3H6"
FT                   /protein_id="ADE72351.1"
FT                   /translation="MATNYKYSKELWLNGRPQLHVIKTKISNICTETICKPLTDTSYYG
FT                   INGGFFDSRDYHKTPNASRAICVDTGESGKKITVGGKTFYKNYNYNNTSSNPISRKTAV
FT                   IYTVSGTKKMTSMYAKTRDNVAAKYPKYNQIIGGMDYSSKAWGTKAYSAPTQRTVLAWS
FT                   GSYAYLIVTEVAMSIPGLKKAVEQLGLNSANSIVLDGSGSTSMKCKEFVKKGDKRHIFN
FT                   MVRLFKTS"
FT   gene            complement(11014..11205)
FT                   /locus_tag="BMQ_pBM50013"
FT   CDS             complement(11014..11205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50013"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72352"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3H7"
FT                   /protein_id="ADE72352.1"
FT                   /translation="MLYTNEEIEEVLICLEYKLRKSLRETHPKYREDLAQNLRESIVRK
FT                   MKSDTLHKSPSFFTLINQ"
FT   gene            complement(11224..11394)
FT                   /locus_tag="BMQ_pBM50014"
FT   CDS             complement(11224..11394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50014"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72353"
FT                   /db_xref="GOA:D5E3H8"
FT                   /db_xref="InterPro:IPR024419"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3H8"
FT                   /protein_id="ADE72353.1"
FT                   /translation="MIDSTNIIQLIGNFGFPMALAIYLLLRFENRLESLKSAIDKLAET
FT                   MREFPNINKDN"
FT   gene            complement(11387..11923)
FT                   /locus_tag="BMQ_pBM50015"
FT   CDS             complement(11387..11923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50015"
FT                   /product="putative RNA polymerase sigma-70, region 4"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50015"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72354"
FT                   /db_xref="GOA:D5E3H9"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3H9"
FT                   /protein_id="ADE72354.1"
FT                   /translation="MLKIKNPLIQGFLKEEENYSLFKKYQLEPTQKNEQKLDNKFKKYY
FT                   LKIRAISYFSKVIHFESKKFDNKHRTYNKRFLSILDKPVPESDNGTLIDLLIDSSTNYC
FT                   TEEVPSKKLEDYIENPSLYLSIKKLSSKQKKILYLAYIKDLKDVEIARYLNVSQQYITR
FT                   TRNKTLLKLRGDLSD"
FT   gene            12363..12479
FT                   /locus_tag="BMQ_pBM50016"
FT   CDS             12363..12479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50016"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72355"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3I0"
FT                   /protein_id="ADE72355.1"
FT                   /translation="MRLSLPAQLQFLFVFIDYRLPKTFVKVFELQETFVIYF"
FT   gene            complement(12773..13345)
FT                   /locus_tag="BMQ_pBM50017"
FT   CDS             complement(12773..13345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50017"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50017"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72356"
FT                   /db_xref="GOA:D5E3I1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3I1"
FT                   /protein_id="ADE72356.1"
FT                   /translation="MSKQIDPRVLRTRKLIMDALIELSMKKEFKDITIKDITTVATVNR
FT                   ATFYYHFMDKYDLLEKVLSESIMREVLQEVSTHEVINEETIEAIFLSIIKFQTSLSNQC
FT                   QQNYEAFMPQIETIFKKELQAFFSEWGKKQWNNPNKMEVEAGAVMLSWTLYGAAVHWMQ
FT                   NQTTEPEDYLMSLMSFIKNWNEHINLI"
FT   gene            13380..14138
FT                   /locus_tag="BMQ_pBM50018"
FT   CDS             13380..14138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50018"
FT                   /product="NAD dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50018"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72357"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3I2"
FT                   /protein_id="ADE72357.1"
FT                   /translation="MCWIYYICVILLVEQRFLPWYINFTTSVGYTKGVETKNMKITIFG
FT                   ATGQIGQLLVTQALQAGYDVTAYSRRPNALNIKHEKLQIIVGDLTDQGKLREAILERDV
FT                   VVSALGPTMSMKRQVLDLPITQGHKAIISVMEEYGPKRFITLATPTISAKEDVKQLVTQ
FT                   LPSIMAKLLYPTGYAEMKEIEKLIENSRLDWTVVRMLNPNMKTNGNGYSVSFGDTKGKM
FT                   NVSRYNVAKCMLEATQKDEWVHKMPIVFNN"
FT   gene            14358..14981
FT                   /locus_tag="BMQ_pBM50019"
FT   CDS             14358..14981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50019"
FT                   /product="biphenyl-2,3-diol 1,2-dioxygenase III"
FT                   /EC_number="1.13.11.39"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50019"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72358"
FT                   /db_xref="GOA:D5E3I3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3I3"
FT                   /protein_id="ADE72358.1"
FT                   /translation="MSNQENKKITPILHHIGLTTGRFEEMISWYNNVLGMEPVHYSENP
FT                   AGDIGMKVKALWVTNDEANHRIAMIGIPGLTSDMNRSKHSRIQHIAFEYDTLDDLLDTY
FT                   IRLKNLGITPHVTADQGVSIAFYYNDPDGNTVELTMDTFGDWSKSKEFMKKSPTFAKKP
FT                   MGKYIDVEKILLAREQGLSANEIHERAYAGEYEPNTPMDPQKML"
FT   gene            complement(15064..15183)
FT                   /locus_tag="BMQ_pBM50020"
FT   CDS             complement(15064..15183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50020"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72359"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3I4"
FT                   /protein_id="ADE72359.1"
FT                   /translation="MHYFKCIAYLLEVCAFLLSGTCNMNTALKEINYKIASLF"
FT   gene            complement(15288..16280)
FT                   /locus_tag="BMQ_pBM50021"
FT   CDS             complement(15288..16280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50021"
FT                   /product="oxidoreductase GFO/IDH/MOCA family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50021"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72360"
FT                   /db_xref="GOA:D5E3I5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3I5"
FT                   /protein_id="ADE72360.1"
FT                   /translation="MKKANLCFIGAGFHASTNIYPSAIEAGAAIQAVSTRNIERSKATL
FT                   QRFGSKGTPYDDYKKMLQYEECDGVVVVAQPEDQPSLVMDCIRAGKNVFVDKPLGMSAD
FT                   EAAEIADAADEAGVTVMVGFMKRYAPCYTKLKEIIENGSLGNARSFQAKFAVDSTPFCK
FT                   DDEQFIKFAAIHIVDLIRYLFGEVLYVSGFKNSDNGFISHSITLKFKNGVVGSLYFTGM
FT                   TAWSRESENILVTFDNGFAFADEVNSLTIHKSQTFSDLPWKSLEEADTVFTPSASPMSG
FT                   TYRDLYLRGFVGEMTHFIDCCKNKRKPTSNGRDNVHTMSLCDRILSELI"
FT   gene            complement(16520..16651)
FT                   /locus_tag="BMQ_pBM50022"
FT   CDS             complement(16520..16651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50022"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72361"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3I6"
FT                   /protein_id="ADE72361.1"
FT                   /translation="MTEIFIFYYLRKKHSPFNQMNANENHFPIALEKFTHDYKEQFL"
FT   gene            16714..17244
FT                   /locus_tag="BMQ_pBM50023"
FT   CDS             16714..17244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50023"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50023"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72362"
FT                   /db_xref="GOA:D5E3I7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3I7"
FT                   /protein_id="ADE72362.1"
FT                   /translation="MSTIKKEERPVSDVTFEDLFKQYYVYVVKQIVWIVKNQMIAEELA
FT                   QEVFLQLYRNDWKSIENVPGWLLKSSTYVAYNYLRSEKRHQARINKTIQYHEAQHISSL
FT                   DDDWIRKEEITKVQNVLSNMNERERTILLLKFSSFQYKEIAEVLQINISSIGTLLVRAK
FT                   QKFRKIYKQLEEA"
FT   gene            17248..18225
FT                   /locus_tag="BMQ_pBM50024"
FT   CDS             17248..18225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50024"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72363"
FT                   /db_xref="GOA:D5E3I8"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3I8"
FT                   /protein_id="ADE72363.1"
FT                   /translation="MNCYDKGFIQAYIDGELSHDTRKEFTKHLDTCEICQDVLIEISKL
FT                   NRWEDVVLEEETRHLSQEINIDVDQAWKTFESRTKLENVSYINQKTEQKRGLFTNMNKK
FT                   SKRFMYTAVAAAGLFTTAMIPQVQVAATNVASYFSNEISNDKVVNEGIHDENGVTQDMM
FT                   KDGQFIPIDKKITDQGVTVHFKELYVADSRISIHYKIEKADGSLVPFEFDTTGLDLKND
FT                   GKTNEQQEENPEYQEKDGSFSQLPFIQGASGLPFKLMAAGEELEYVGIRDKDRPEGIIT
FT                   FVEGPEGKDSFKQPLTLNVDINKIGKVAGSWKGQIQIDPAKLKK"
FT   gene            complement(18233..18394)
FT                   /locus_tag="BMQ_pBM50025"
FT   CDS             complement(18233..18394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50025"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72364"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3I9"
FT                   /protein_id="ADE72364.1"
FT                   /translation="MSGPKNKESLPCPYWDVFMVIRLKKIKYDINVTNIRKNISMVLDT
FT                   HRSILFFI"
FT   gene            18531..18659
FT                   /locus_tag="BMQ_pBM50026"
FT   CDS             18531..18659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50026"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72365"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3J0"
FT                   /protein_id="ADE72365.1"
FT                   /translation="MNAFFSYIIKKVFCHKTWISGFSIIRESNKSEVLTGMLTKKD"
FT   gene            18794..19243
FT                   /locus_tag="BMQ_pBM50027"
FT   CDS             18794..19243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50027"
FT                   /product="helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50027"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72366"
FT                   /db_xref="GOA:D5E3J1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3J1"
FT                   /protein_id="ADE72366.1"
FT                   /translation="MNRGEKIAKARREMNLTQDQLAEMLEVTRQTISKWESNLAYPESV
FT                   KLGKLAEVLNVTCDYLLRENQATSTSTSIEVTMNNSGNYTLDWSKLYPILNEYQNMIDC
FT                   PHYFEKIYGMVKEIMVKYKYSSEDTFLILKDLLYQIYLQMEKKVQ"
FT   gene            19366..19503
FT                   /locus_tag="BMQ_pBM50028"
FT   CDS             19366..19503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50028"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72367"
FT                   /db_xref="GOA:D5E3J2"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3J2"
FT                   /protein_id="ADE72367.1"
FT                   /translation="MVKNKNRALVYQCSVFILVPRLLIMLTTFVYRIQLKNRKNYLRIR
FT                   "
FT   gene            19549..19689
FT                   /locus_tag="BMQ_pBM50029"
FT   CDS             19549..19689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50029"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72368"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3J3"
FT                   /protein_id="ADE72368.1"
FT                   /translation="MGSLLKEVKNMYIHKNEVYFKFYLNVCFETYKKGKSILILFQINL
FT                   K"
FT   gene            19743..19889
FT                   /locus_tag="BMQ_pBM50030"
FT   CDS             19743..19889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50030"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72369"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3J4"
FT                   /protein_id="ADE72369.1"
FT                   /translation="MSINKEVFYRGKRFKIIHIYSSGYCELRKVNDPFKVELALLNDIL
FT                   LTG"
FT   gene            complement(20095..20304)
FT                   /gene="gsiB"
FT                   /locus_tag="BMQ_pBM50031"
FT   CDS             complement(20095..20304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsiB"
FT                   /locus_tag="BMQ_pBM50031"
FT                   /product="glucose starvation-inducible protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50031"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72370"
FT                   /db_xref="InterPro:IPR019626"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3J5"
FT                   /protein_id="ADE72370.1"
FT                   /translation="MTTNKNNDKMSREEAGRMGGKATSKNHDKEFYQEIGEKGGEATSK
FT                   NHDKEFYQEIGEKGGKANNKRNND"
FT   gene            complement(20385..20498)
FT                   /locus_tag="BMQ_pBM50032"
FT   CDS             complement(20385..20498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50032"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72371"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3J6"
FT                   /protein_id="ADE72371.1"
FT                   /translation="MYFIDTLILKKSISTNISKIFQKEELQNKKRKMILNY"
FT   gene            20728..20886
FT                   /locus_tag="BMQ_pBM50033"
FT   CDS             20728..20886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50033"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72372"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3J7"
FT                   /protein_id="ADE72372.1"
FT                   /translation="MDNKHNLLLCPGEVNCLREGYKNCEKELIKSEIHKDIILLSDEIK
FT                   VDYKVNR"
FT   gene            21038..21211
FT                   /locus_tag="BMQ_pBM50034"
FT   CDS             21038..21211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50034"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72373"
FT                   /db_xref="InterPro:IPR025072"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3J8"
FT                   /protein_id="ADE72373.1"
FT                   /translation="MGEQTYSDIQRKKTSIIDSLIHLGIYKKGNKQLYELTLHELETEY
FT                   HIVNPEIQDISF"
FT   gene            21256..21438
FT                   /locus_tag="BMQ_pBM50035"
FT   CDS             21256..21438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50035"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72374"
FT                   /db_xref="InterPro:IPR014962"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3J9"
FT                   /protein_id="ADE72374.1"
FT                   /translation="MFLKKLIKNGLITVKYYENGSLQTYKGRVYNLNLHEQTLSLKDEK
FT                   QNIFFIRLSGIEDIY"
FT   gene            21574..21711
FT                   /locus_tag="BMQ_pBM50036"
FT   CDS             21574..21711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50036"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72375"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3K0"
FT                   /protein_id="ADE72375.1"
FT                   /translation="MRENKQIWSDFIEEDRFELHSYLTYLFKQCHDENLRQLEDENIEE
FT                   "
FT   gene            21927..22190
FT                   /locus_tag="BMQ_pBM50037"
FT   CDS             21927..22190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50037"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72376"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3K1"
FT                   /protein_id="ADE72376.1"
FT                   /translation="MNTTVNELYDFGTVLRRKLLNNNLYAHYLSDAMRRENHFDFLYYF
FT                   LTATVDSQTPIPEHVSAVFLKVLSDKEKLSDLTPFIMGLIGK"
FT   gene            22680..22886
FT                   /locus_tag="BMQ_pBM50038"
FT   CDS             22680..22886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50038"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50038"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72377"
FT                   /db_xref="GOA:D5E3K2"
FT                   /db_xref="InterPro:IPR018540"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3K2"
FT                   /protein_id="ADE72377.1"
FT                   /translation="MLTKVSELSQRIYLSECIINKRRELVDLGMDYGLLNKKTIQCSQD
FT                   LDQLINLYMQGSKKTEYKFYYIL"
FT   gene            23082..23273
FT                   /locus_tag="BMQ_pBM50039"
FT   CDS             23082..23273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50039"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72378"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3K3"
FT                   /protein_id="ADE72378.1"
FT                   /translation="MSKQAEAIKEVKLLNAEIDLCNRIKNLLNQGKLRDLQLKKEYTEY
FT                   EILQIALNRLMNELTFRY"
FT   gene            complement(23463..23816)
FT                   /locus_tag="BMQ_pBM50040"
FT   CDS             complement(23463..23816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50040"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72379"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3K4"
FT                   /protein_id="ADE72379.1"
FT                   /translation="MVTEGLTPTTLVKNLSALPTPCNDVVYYPTHLTVLGIQGEYSVFQ
FT                   AFSRKSGLAYIAITHPDTTKFIFAGSRNSMYELYQVIPWPEYKISNGELTFYYKTAPSL
FT                   QTLEDYFNNIKKQ"
FT   gene            complement(24194..24313)
FT                   /locus_tag="BMQ_pBM50041"
FT   CDS             complement(24194..24313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50041"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72380"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3K5"
FT                   /protein_id="ADE72380.1"
FT                   /translation="MSRKSIIFIVRLSLKFNYERSLKNTPFYERFGKKIRFLP"
FT   gene            24294..24422
FT                   /locus_tag="BMQ_pBM50042"
FT   CDS             24294..24422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50042"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72381"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3K6"
FT                   /protein_id="ADE72381.1"
FT                   /translation="MIDFLLKRKVRKCILLRKLNLILFQIVKGIKLRIFLELLKLF"
FT   gene            complement(24658..24846)
FT                   /locus_tag="BMQ_pBM50043"
FT   CDS             complement(24658..24846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50043"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72382"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3K7"
FT                   /protein_id="ADE72382.1"
FT                   /translation="MINKIKVKFLRERFSANSINIFDVFLPENRELSFNEQIMLLRVLL
FT                   NQACYFFYYIQVISRRN"
FT   gene            complement(24966..25439)
FT                   /locus_tag="BMQ_pBM50044"
FT   CDS             complement(24966..25439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50044"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50044"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72383"
FT                   /db_xref="GOA:D5E3K8"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3K8"
FT                   /protein_id="ADE72383.1"
FT                   /translation="MFRIILFIHILVGVICLVTGFAAMIAPKKKGFHTNLGEIYHFSFI
FT                   IVFLTTIVMAVMHWSSSSYLLYIGIFSYSLALLGYLAGKFKWKNWVAIHIGSILGSYIA
FT                   ILTAVLVVNVNRIPILNNYNPLIFWLLPTVIGSPIIYLIRKKYEIDLNQEKSV"
FT   gene            complement(25870..27621)
FT                   /locus_tag="BMQ_pBM50045"
FT   CDS             complement(25870..27621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50045"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50045"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72384"
FT                   /db_xref="GOA:D5E3K9"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3K9"
FT                   /protein_id="ADE72384.1"
FT                   /translation="MDHKLQSNLNSFPILLLMCLGIFICLLDTTIMNIALPAIQNDLNT
FT                   TLETSSWMLNTYTMTIAVLSIPMGRLAEIYGKMKFFILGLIIFACGSAFCGLSDNGEML
FT                   IFARFCQSLGASILVPVATIIGVESLPLKKRHISLSLLGATQGLSTALGPSIGGLIAQN
FT                   LGWNWVFFVNIPICIVALVIAFIILPFKLEKRVKAKIDWAGLILAAIGIFNLNLVLIKG
FT                   NTWGWTSFTSLCCFFIFIVSLIMFIIVERKIKDPMVDLNLFKDRLYVGATLAVSSAYLF
FT                   LVGVMVLLPQFLTSFQDKTEIQAALLITPISATIFIVVNFVGFLVKKIGYVIPIMIGYI
FT                   IVAASYFQLEHLNTASTVSEIIIIGVTLGIGFSFIISPATMASVSSFEGEMLTSSQSVF
FT                   TMLRQIGVVLAVAIFVSSITHEVDSKKQNVISYAKEQTSNIDVSPEKRLEILKSTEKKI
FT                   DTDSTFSNVIEAPTVSASERQDLIDKNVKDTLSQYPAAEQEKIKEQITNQVTNQVNQDI
FT                   LKVNKEIKIYTENVTSYTRKEFSSVFSIVFGHALPFIFIGLLISILYRKSKKSKVIKNK
FT                   EVTALGE"
FT   gene            27600..27731
FT                   /locus_tag="BMQ_pBM50046"
FT   CDS             27600..27731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50046"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72385"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3L0"
FT                   /protein_id="ADE72385.1"
FT                   /translation="MIVIYDPFLHLLSSFLQNTEYKFTKSTIVNSNCFSIKLQYQKS"
FT   gene            complement(27703..28110)
FT                   /locus_tag="BMQ_pBM50047"
FT   CDS             complement(27703..28110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50047"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72386"
FT                   /db_xref="GOA:D5E3L1"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3L1"
FT                   /protein_id="ADE72386.1"
FT                   /translation="MKAEIQDLWDNLVFHYEHQEEFQLIILDNKKVKYMWDNYNASLLK
FT                   ILHKKDLHYATSNGRFIERIGARLAVKLAYGKRYPKENLKNIFIASDTWGAPSLWYQTH
FT                   EIKRVVVSLTHIPNYSGACLHNINSFDIVTL"
FT   gene            complement(28100..30529)
FT                   /locus_tag="BMQ_pBM50048"
FT   CDS             complement(28100..30529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50048"
FT                   /product="Beta-ketoacyl synthase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50048"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72387"
FT                   /db_xref="GOA:D5E3L2"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3L2"
FT                   /protein_id="ADE72387.1"
FT                   /translation="MKIAVTGIGILSALGNNQYEFWDNIQSGKTGIREMVQLDSSELLT
FT                   NYAGEVRNLSPEKMMTQEEIEETERCTQLSFLAASEALKQADIPAGFYNTFKQGVILGT
FT                   SLGGIPNGEKFHKQWIREGYEHTDPNLLLSYPLHTAADFLSVRFNLKGPKVAISTACSA
FT                   GSNAIGYGIELIKSGKADMLIVGGADPLSMLSLAGFNSLKALSDEPCSPYSQSKGITLA
FT                   EGAGVLILERLDRVKERGGKILSLVTGFGLTSDAYHPTAPNPGGAGAFKSMQMALERSN
FT                   ITSQDIDYVNGHGTGTRANDSAETTALKNLFSNTDKNVPVSSTKSMIGHTLGAAGAVEG
FT                   ITCVLSLMKQTAPPTISFTNNPYNMDFIPNVSRPMAINTVLSNSFAFGGNNASLIFKKY
FT                   EEEKQQTEVLSGIKQKVLITGIGCVQPLGIGKDELWESIEKGNSAINPIDFEKEKYIGK
FT                   LGASVSEKKYLKYINPSLIRRLDLLGKLSLASSKMALNDSGIKINRDNSDKIAVIYGTS
FT                   SGPLQTVEDIHRTIVVDGVKKVNPSQFPNTVMNAAAGHICSTFQIKGPSTTICTGNVAG
FT                   SQSITYAYHMINEGLIDAALVVVADEYTETIHAGYDRLGVLGNAPYPFERDSDGMALSC
FT                   GSTALFLESEKHAKERKASVYGQIKGYGITSDAYKLAGNNPNGKAYSYAMSDALKESEL
FT                   SVDDIDAIFSDARGLRSMDLTEVNAIRHLGGAKIPVTTLSNKNGYNLSGMTPLHIVAAL
FT                   QTFNNHKIPGLKVKNPIYNLNFAKENQKLHSANNFLFNSANFGGTYTSVVVGRYES"
FT   gene            complement(30541..31623)
FT                   /locus_tag="BMQ_pBM50049"
FT   CDS             complement(30541..31623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50049"
FT                   /product="aminomethyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50049"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72388"
FT                   /db_xref="GOA:D5E3L3"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3L3"
FT                   /protein_id="ADE72388.1"
FT                   /translation="MTYRKSPANESINVITKVVGNQNVPSVFSSLEEEYKAIREEVAVL
FT                   DFSFNTFLKVSGDSASSFLQELITKDLDYLTEEQTVTCLMLDEDGHLVTELIVYVMENE
FT                   YLLEIEPSLSEKAEDYLQSHIKDGVLIENLAGKLQMIQLEGPKSWEVVQTLLPFPIEIL
FT                   PYKNFAPFHFEGHNLYIARLGYTAEYGYKVFGDEAGIDLFWKALFAYDLSEINVQQIGL
FT                   DAHDVCRLEVRFPDLSKEATSNKLIVESGVNWMLDFNKDFIGKDKNLEGLTSGLCQELV
FT                   CFTSESAVAKNQDILVDGNKVGYIQHTLYSPGINGSIGVAYLDEKYVASGLTFTLDNDM
FT                   TINTVSSPMIYPKSLSIRIG"
FT   gene            complement(31651..32151)
FT                   /locus_tag="BMQ_pBM50050"
FT   CDS             complement(31651..32151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50050"
FT                   /product="FabA-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50050"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72389"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3L4"
FT                   /protein_id="ADE72389.1"
FT                   /translation="MTNLLEKKSLKLPLELDQIKNMIPHRYPFLLIDRVNELNPGVSGV
FT                   AIKNVTANEPFFQGHFPGEAIMPGVLIIEAMAQLIAVIYVSKALVEVESQETSNDINYA
FT                   DRVGYLAAVKNIKFKNKVVPGDQLVLRAKVVGKMGVLSQVQVWAEVNGKTVVEGSISVS
FT                   EKM"
FT   gene            complement(32148..32447)
FT                   /locus_tag="BMQ_pBM50051"
FT   CDS             complement(32148..32447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50051"
FT                   /product="acyl carrier domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50051"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72390"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3L5"
FT                   /protein_id="ADE72390.1"
FT                   /translation="MSTITQNDLLEQVNERKQLCQQIKTEIVERLSLNIEPAWIADNQP
FT                   LFGRGLELDSIDTLEISIALQEVFDVMLTDDNMDVLGSVNKIADFITSQRNENL"
FT   gene            complement(32471..33211)
FT                   /locus_tag="BMQ_pBM50052"
FT   CDS             complement(32471..33211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50052"
FT                   /product="3-ketoacyl-acyl carrier protein reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50052"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72391"
FT                   /db_xref="GOA:D5E3L6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3L6"
FT                   /protein_id="ADE72391.1"
FT                   /translation="MFKDKVVLVTGASKGIGRATALYFLNEGAKVIINYSKEGNHIKEL
FT                   KEMVSNKEDQTLFFCADVSNVSSVREMFKAIKNKWGQLDILVSNAGITRDSWLMMMGDK
FT                   NWDDVLNINLKGTFFCIREASKMMAAKKQGVIINVSSTSGLKGQPGQANYSASKGGIIA
FT                   MTKTLSRELASYNIRVNCIAPGFIHTGMTNNMPQNTLDSYIQHIPLGRIGEANEVAETI
FT                   GFLASPKASYITGQCIVVDGGLTT"
FT   gene            complement(33204..34163)
FT                   /locus_tag="BMQ_pBM50053"
FT   CDS             complement(33204..34163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50053"
FT                   /product="acyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50053"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72392"
FT                   /db_xref="GOA:D5E3L7"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3L7"
FT                   /protein_id="ADE72392.1"
FT                   /translation="MNKKVAVIFPGQGSQVMGMGKDLISLPLFAQRLEKVAELANLTLD
FT                   EFFQPKNMKIIEKTEIVQPYIFVISVTLHELISKEYSLKPILFGGHSLGEFSALVASGM
FT                   LSFEAGFELVKVRGSLMGEACNKTKGGMLAVLSPEKELFSLLHDEVKEQHNTIKIANYN
FT                   SANQLVISGADESIKEFKNVIENKLKARAIPLKVSGAFHSVLMNEANKDFSHYLDFTKF
FT                   QAPLAPIVMNVSGEAELNKSNIFSLIKEQMISSVLWKKSMETIESFQPDLVLEIGPGRV
FT                   LSSLIKSSHRNLNVSNIGNRSDLLRFKKQLEREVEIVV"
FT   gene            complement(34185..34532)
FT                   /locus_tag="BMQ_pBM50054"
FT   CDS             complement(34185..34532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50054"
FT                   /product="phosphopantetheinyl transferase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50054"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72393"
FT                   /db_xref="GOA:D5E3L8"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3L8"
FT                   /protein_id="ADE72393.1"
FT                   /translation="MISVGIDLVDIERFKLALSRSGELFVSRILNNYEIAKYDSYQWAI
FT                   LFSAKECAIKMIKQIPKDFRLRDIQVDILSKDELLVTFDESLYKQVDLPTNSIKGTYKV
FT                   FKDCIVTHLIA"
FT   gene            complement(34529..34966)
FT                   /locus_tag="BMQ_pBM50055"
FT   CDS             complement(34529..34966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50055"
FT                   /product="thioesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50055"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72394"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3L9"
FT                   /protein_id="ADE72394.1"
FT                   /translation="MKWLETKARVRWSEVDSQSIVYYGNYFLYFDLGREYVAEKVELEY
FT                   LTEEFDVITLDTTAKYRQPARYGDELIIRTRMIHPSPAEMASPMGFTFQFEYQILKSQG
FT                   KLLLAEGTSRHALKDKITHKLYVKVPKEKKEKFLSVFEIYK"
FT   gene            complement(34993..35730)
FT                   /locus_tag="BMQ_pBM50056"
FT   CDS             complement(34993..35730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50056"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50056"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72395"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3M0"
FT                   /protein_id="ADE72395.1"
FT                   /translation="MEVAIVTGAGSGIGRATAIQLSSQDYRVYALDKDEKSIKDFEKTK
FT                   NITPIVCDVLKENDINSFFSRFSSKEKHLDLLFNGVGAMKLGGLLDTSEDDWDFGFHIN
FT                   LKSALVFSKRAYNYLLESKNPSIINISSVLGETYEEKAAIYTVMKSALVTLTKCLAKEL
FT                   APKKIRVNAISPGPIQTSFVRSFSQETKKIQGASKLVMKLSHTPIGRTGKPEEVAKLVS
FT                   YLASPQASFITGSCISIDGGWSI"
FT   gene            36663..36797
FT                   /locus_tag="BMQ_pBM50057"
FT   CDS             36663..36797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50057"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72396"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3M1"
FT                   /protein_id="ADE72396.1"
FT                   /translation="MSCVPERDIMLTTNVYLIQHKKRKNPCRWSGVFSVTYQGIKNDT"
FT   gene            complement(36837..37235)
FT                   /locus_tag="BMQ_pBM50058"
FT   CDS             complement(36837..37235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50058"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50058"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72397"
FT                   /db_xref="GOA:D5E3M2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3M2"
FT                   /protein_id="ADE72397.1"
FT                   /translation="MVIEYKVNASISAKEVADIFKSSGIKRPVNELERIERMIKNSDIN
FT                   LTAWNNQQLIGIARAITDYSYCCYLSDLAIHKDYQNKGIGKELVQRLQDIIGEEVALIL
FT                   LASSVAMDYYPHIGFEKSENAFRIPRKK"
FT   gene            complement(37417..38643)
FT                   /locus_tag="BMQ_pBM50059"
FT   CDS             complement(37417..38643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50059"
FT                   /product="transporter, major facilitator family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50059"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72398"
FT                   /db_xref="GOA:D5E3M3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3M3"
FT                   /protein_id="ADE72398.1"
FT                   /translation="MIPITKEAKVRTGIWKGKFIYLWVASIFSSLSISMYLTIEQWYVV
FT                   NYLNLKSSLGIILMATTIPRVLLMVIGGVVSDKYRRSKVIFFSLLTRCFMLLLMALFYT
FT                   NNLLSLSVLFIFALLFGASDAFFWSARDSIVPGIVHKEQLVRANSVIQTTNQLSVMFGP
FT                   VLGATLLSLFSYSTIFLIIAFTLLISIILLQFIKEKKTLRPKKTSILRDLAEGINYVKD
FT                   SSFLLTVMVTFIIVNLFFIGPLMLSIPILAEDRFKGNAFYLSIFQSSFASGMLLGAIVM
FT                   GWLNIKRNRGKLAISFIFLEGLLLMIFSQGINLWLAAAILLAIGCCVSSINILIVSLIQ
FT                   EKTPSTIVGRVMSVNTMVSMGLIPVSYGLVSTLLSINVDIKFILLCAGIVIVLFSVLLL
FT                   LKASDLKNT"
FT   gene            complement(38736..39317)
FT                   /locus_tag="BMQ_pBM50060"
FT   CDS             complement(38736..39317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50060"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50060"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72399"
FT                   /db_xref="GOA:D5E3M4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018656"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3M4"
FT                   /protein_id="ADE72399.1"
FT                   /translation="MQLDKLVNYYKAVGDPTRIRIISLLKKGHLHGQAIAYKLGLQPST
FT                   ITHHISKLRDVGLVYQRRQGNIIYFYLDTERLEYNSKAILNIGEESMENQDSKINDKDK
FT                   LSIIKSFINSDGTLKQIPSQRKKKNVILAYLIRDLHQGKMYKEKDLNEYIKNYHEDYAT
FT                   IRRELIMQHFMYRQNGEYELNPKEMWPVTF"
FT   gene            39500..40165
FT                   /locus_tag="BMQ_pBM50061"
FT   CDS             39500..40165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50061"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72400"
FT                   /db_xref="InterPro:IPR024250"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3M5"
FT                   /protein_id="ADE72400.1"
FT                   /translation="MLDYIWIDGDLPILSQLPNDFNSAAILFHPFIQMPSGWEKSKREN
FT                   PYQHIYPSDEEMLKLGEPISWKEVMVKSNLKSYKELFRVLQYLTGAPSDEYKKLASYVK
FT                   SNPDFYYPEEDRTSLFILNSLVKILCSKGANTLYFSEPIHDTNGSFKVNDMSSLEIANL
FT                   SPNESIITDENMDFAFMGIYDSFITLLLAKDTNIEDTIKSLNLEAFICDKETYFNSFI"
FT   gene            40299..40595
FT                   /locus_tag="BMQ_pBM50062"
FT   CDS             40299..40595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50062"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72401"
FT                   /db_xref="GOA:D5E3M6"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3M6"
FT                   /protein_id="ADE72401.1"
FT                   /translation="MLGETFTLFRPIYYLITIFLVCNFVYVVFLSNKIKANSYILFNSL
FT                   FFVIIGAMLLFQQGIIVDETNQSGDPVIFDLTILFGVLFIASFIFRNIKKRKV"
FT   gene            40799..41128
FT                   /gene="csaA"
FT                   /locus_tag="BMQ_pBM50063"
FT   CDS             40799..41128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csaA"
FT                   /locus_tag="BMQ_pBM50063"
FT                   /product="export-related chaperone CsaA"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50063"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72402"
FT                   /db_xref="GOA:D5E3M7"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR008231"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3M7"
FT                   /protein_id="ADE72402.1"
FT                   /translation="MATIDDFFKLDIRIGTVVKAEPFPEARKPAIKLEIDFGELGVKCS
FT                   SAQITRRYKPEQLIGSQVVAVVNFPPMRIAGFKSEVLVMGGIPEEGDVVLLKPSEFVKN
FT                   GTPIA"
FT   gene            41429..42307
FT                   /locus_tag="BMQ_pBM50064"
FT   CDS             41429..42307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50064"
FT                   /product="integral membrane protein (DUF6)"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50064"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72403"
FT                   /db_xref="GOA:D5E3M8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3M8"
FT                   /protein_id="ADE72403.1"
FT                   /translation="MKNTLLGSIYLALAASIWGGMYVVVKVVVAVIPPLELVWIRYVIA
FT                   ILALFIIGLIKRQSWRINKRHIPLIVAIGVIGNAISIVTQEYGTMLSSAQMGAIITSST
FT                   PAFMVIFARLILKERLNMKKGISVGLATIGVLLIVGNGHINMSSQLGGLSLLMAALTWA
FT                   LMSILIKRVPSSYSPVVITTYSILVAILVLTPFVYKGLGEIHISKLIDPTIGGGLLYLG
FT                   IVSTALAFILWNRGLQLLNASSGGLFFFFQPLVGTLLGWLLLGESIGGTFWIGSFLILS
FT                   GVLLVIKEKTN"
FT   gene            42441..42584
FT                   /locus_tag="BMQ_pBM50065"
FT   CDS             42441..42584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50065"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72404"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3M9"
FT                   /protein_id="ADE72404.1"
FT                   /translation="MTTNRQFYFLWYTNISSPCLLRNCYIKGNQTEKFQTFNIIIFLTT
FT                   YI"
FT   gene            42602..42724
FT                   /locus_tag="BMQ_pBM50066"
FT   CDS             42602..42724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50066"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72405"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3N0"
FT                   /protein_id="ADE72405.1"
FT                   /translation="MSFIQKSKYINKLIKIKVLLFTLPDDKYGLFLHTIQILMY"
FT   gene            43331..43639
FT                   /locus_tag="BMQ_pBM50067"
FT   CDS             43331..43639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50067"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72406"
FT                   /db_xref="InterPro:IPR025889"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3N1"
FT                   /protein_id="ADE72406.1"
FT                   /translation="MPNIQVVEKSSHAKIAIDEFLRAGFNTDEIHLLTCNSANTINSYE
FT                   NELCSTNFVNPDTNILQVDEDVFFSKMQSFGISKRDAERYKESMDKGSIMVIVSKAV"
FT   gene            43649..43795
FT                   /locus_tag="BMQ_pBM50068"
FT   CDS             43649..43795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50068"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72407"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3N2"
FT                   /protein_id="ADE72407.1"
FT                   /translation="MQNIKTILRIFETKIGIKKVQKRFFLIPSELLTLFNKTLLFICLY
FT                   KEF"
FT   gene            complement(43957..45414)
FT                   /locus_tag="BMQ_pBM50069"
FT   CDS             complement(43957..45414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50069"
FT                   /product="intracellular serine protease"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50069"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72408"
FT                   /db_xref="GOA:D5E3N3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3N3"
FT                   /protein_id="ADE72408.1"
FT                   /translation="MKKKILHTVLSITVGVGILSVGGVPTQAKSKNQEMNNTYAIAFKS
FT                   RLPENYQEVIQKAGGKVTKVLPEVGGIEAQSDQPSFLKNLKGNSSIEAANREIPLSLDK
FT                   TAVSPYNYESSIISQQNSESYWDSQWDIQRVTNNGKSYDLETGGYKNKDGSITHKAVVG
FT                   VIDTGIDESHPDLKNNIIGGRNLVPAGMDESETGDPTDIKDRNGHGTHVAGIIGANGKV
FT                   KGVGPELGIRSYRVFYSEQALGLPAWIIDGIIAATNDKVDVINMSLRFYNNTKMTIEGE
FT                   SYKSVAETLLWKRAIQYAVKNGVTVVAGSGNESLNLDDKKEVNEFLNKMYEPYGMSVKG
FT                   PATVVPAQMPGVINVSASTKWSTQQLAFYSNYGNSAIDVAAPGGDYGQKYAETNDPAAA
FT                   DPSNLILSTWPTYLGTSYELNAGTSMATPQVAGIAGVIKAAHPEYKPAQITARIKQTAF
FT                   DYGKKGQDALFGSGEANAYRALENIKK"
FT   gene            45625..45867
FT                   /locus_tag="BMQ_pBM50070"
FT   CDS             45625..45867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50070"
FT                   /product="helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50070"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72409"
FT                   /db_xref="GOA:D5E3N4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3N4"
FT                   /protein_id="ADE72409.1"
FT                   /translation="MLQLNYGRNWCILKNNVKTFRVQADLTQHQLAEKVGVTRQTISLI
FT                   EKGKYNPTLKLCLEICYVVNRTLDEIFWIDQEENK"
FT   gene            45864..46295
FT                   /locus_tag="BMQ_pBM50071"
FT   CDS             45864..46295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50071"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72410"
FT                   /db_xref="GOA:D5E3N5"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3N5"
FT                   /protein_id="ADE72410.1"
FT                   /translation="MKVIRDERLVIKNLKNIRIAFAFQTLAMAGILIYDGITRGFNNVT
FT                   DNPLWLVLILTSVILGYLNLGISVDSYESEKQLRKTPYYLIVIGCLTIGIIFGLLTKIT
FT                   SNSSVQDSTIIGLVIFLCFLGTFSFWHFLIKKRSKDEDE"
FT   gene            46481..46804
FT                   /locus_tag="BMQ_pBM50072"
FT   CDS             46481..46804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50072"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72411"
FT                   /db_xref="GOA:D5E3N6"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3N6"
FT                   /protein_id="ADE72411.1"
FT                   /translation="MYIWSNSEGAISLLYSRPVFIFFIVVLAALFIIILMQNKKQLVTG
FT                   LHVITIIIISLFISGLILFLEGIIVDDLNLSEDTISSYMFLIIVALCVINSVTYSFKNK
FT                   KLQ"
FT   gene            47060..47221
FT                   /locus_tag="BMQ_pBM50073"
FT   CDS             47060..47221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50073"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72412"
FT                   /db_xref="GOA:D5E3N7"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3N7"
FT                   /protein_id="ADE72412.1"
FT                   /translation="MIPAILTVIAAIVLFYIGYVEVRGFEGAAYLFLSVFLILFAIISF
FT                   VMAKKPLR"
FT   gene            47357..47626
FT                   /locus_tag="BMQ_pBM50074"
FT   CDS             47357..47626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50074"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72413"
FT                   /db_xref="GOA:D5E3N8"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3N8"
FT                   /protein_id="ADE72413.1"
FT                   /translation="MQNRFSKYSLWLSIAGIIIAIGQYFTPLYNLNILYIGIVIYLIGF
FT                   VCGVIAVGKHEKGLMKYFSLYSFVLIPVFIFFGFLFLAFQIGEK"
FT   gene            complement(47841..49391)
FT                   /locus_tag="BMQ_pBM50075"
FT   CDS             complement(47841..49391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50075"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50075"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72414"
FT                   /db_xref="GOA:D5E3N9"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3N9"
FT                   /protein_id="ADE72414.1"
FT                   /translation="MKHKKRILVASPIHQKPEILTLFLESLKHLKKEEMIVDFYFIDDN
FT                   ENVDSSRLLIQFQECIQSVIVEKSDYQDVYSRDGQTHHWNEHLVWKVAGFKNSIIQYAK
FT                   EKNYDYLFLVDSDLLLFPETIVHLVQQEKDIISEVFWTRWQPDSMEQPQVWLYDEYTQY
FT                   HKQPGEDLSTEQIKVRYQEFIAKVRTPGVYEVGGLGACTLISQNALQKGVNFNKIPNLT
FT                   FWGEDRHFCIRAAAMGLSLYVDTRYPAYHIYRDTNIKEGQEFIKKITARQKTIQSNIYV
FT                   PTTKKTKLTLSMVIKNEENRFLKEVLRSYVPYIDDVVIIDDGSTDNSVEVCKEVLKTVP
FT                   YKIIRNEVSKFSNEVELRKQQWEETVNTEPNWILNMDADEIFEDKFDRDIQQLLTQRDY
FT                   DLYSFRLYDFWNDTHYREDDYWQSHFYYRPFLVRYRNDFSYTWQETPQHCGRFPNNIFQ
FT                   LPNSISDLRVKHYGWSKLEYRLEKYKRYLTLDPHAQYGTKEQYESILDENPNLIKWEE"
FT   gene            complement(49381..50481)
FT                   /locus_tag="BMQ_pBM50076"
FT   CDS             complement(49381..50481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50076"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50076"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72415"
FT                   /db_xref="GOA:D5E3P0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3P0"
FT                   /protein_id="ADE72415.1"
FT                   /translation="MVSISLCMIVKNEEDSIGRCLESIYQLVDEINIIDTGSNDQTKKI
FT                   ASKYTNRIYDFEWVHDFSKARNYAFEKATKDYILWLDADDVFLEEDQQKLLALKLNLES
FT                   SVDSVTMKYILATDEYGNVTSSLRRNRLVKRRNGFRWIGAVHEYLEVWGNIMNSEVAVT
FT                   HKSIHHDSDRNLKIYEKKLLTGEDFSPRDLYYFANELKDHRQFKRAIEFYEKFLSTEKG
FT                   WIEDNIAACRNLADCYLEIFDKERMIKSLLRSFTYTAPRPEICCRLAHYFIEKNDYQSA
FT                   VFWYGSATKTGVTSDNLGIQNQAYSTWIPHIQLCVCYDALGDYEKANHHNELAGTYRPN
FT                   DPKYLHNKGYLETKIPIEKVGVGNET"
FT   gene            50892..53756
FT                   /locus_tag="BMQ_pBM50077"
FT   CDS             50892..53756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50077"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50077"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72416"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3P1"
FT                   /protein_id="ADE72416.1"
FT                   /translation="MSIQNLIVNGGFETGTLSSWLIANTVITSEYSHSGFYSARLQGGA
FT                   TFSYISQFVPIEPGERLEILASLATVGQAPAIFITIQVFYYDNQSNLLENGLLVTVPGN
FT                   QIPNVENHTWLENYHTTTAAPPGSTQAFIVINTLPQVETSDVLVDDVAVLVVNNNGAIG
FT                   ATGATGATGATGATGITGATGVTGATGITGITGVTGATGATGATGVTGATGATGITGIT
FT                   GITGITGITGVTGATGITGITGITGVTGATGATGATGVTGATGITGATGVTGVTGVTGI
FT                   TGVTGVTGVTGVTGATGITGVTGETGVTGETGATGVTGITGATGITGVTGITGATGVTG
FT                   VTGVTGVTGATGITGVTGETGVTGETGATGVTGITGATGITGVTGITGATGVTGATGVT
FT                   GITGVTGITGVTGVTGVTGITGVTGATGATGITGATGATGITGVTGITGVTGVTGVTGI
FT                   TGVTGATGATGITGATGATGITGVTGATGITGATGITGATGVTGVTGVTGVTGATGATG
FT                   ITGATGITGATGVTGATGVTGVTGATGATGVTGITGVTGVTGATGVTGVTGVTGVTGAT
FT                   GVTGVTGITGITGVTGVTGITGVTGATGATGVTGATGVTGVTGATGATGVTGITGVTGA
FT                   TGVTGATGITGATGITGATGATGITGVTGATGVTGATGITGATGVTGATGATGITGVTG
FT                   ATGATGVTGVTGITGVTGVTGITGVTGVTGVTGITGVTGATGATGVTGVTGITGVTGVT
FT                   GITGVTGVTGVTGITGVTGATGATGITGATGATGATGITGVTGATGITGVTGVTGATGA
FT                   TGATGPTASSPTLAFSEAPGTIAIFPPLNTEVTVASVTQNVLINQQLKIDYALAVEIIT
FT                   TANWSIVFEMRLYRDTTLIDTRIFNRSATQAGTQRFPLASTQVNIAPTTTTSTYSVRII
FT                   VTAATSITSATAINRDLNIITFTP"
FT   gene            53811..53978
FT                   /locus_tag="BMQ_pBM50078"
FT   CDS             53811..53978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50078"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3P2"
FT                   /protein_id="ADE72417.1"
FT                   /translation="MYIRDSYHVDVLEKNSEKLVYDQELYSKYYSVIEKLYKIKFQNWI
FT                   QDQKRTCYCR"
FT   gene            54305..54919
FT                   /locus_tag="BMQ_pBM50079"
FT   CDS             54305..54919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50079"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72418"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3P3"
FT                   /protein_id="ADE72418.1"
FT                   /translation="MGDISEGKFSYVDYWEENYSNGGTSGKGSYGVLAQFKGDVINQFI
FT                   KGKRIHKVIEFGCGDGNQLKYMNYPSYLGMDISPTSIDICSKMFGKDKTKSFLLYNPKY
FT                   FINNGYFKSDLVVCLDVLYHITNEDDFWKTLDDIFSCKPFYIILYTRVTKPEEFVYGIP
FT                   TIQDRDILSCLSRYQDYKLIQIIEQKYKELSGASFIILEKV"
FT   gene            54955..55602
FT                   /locus_tag="BMQ_pBM50080"
FT   CDS             54955..55602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50080"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72419"
FT                   /db_xref="GOA:D5E3P4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3P4"
FT                   /protein_id="ADE72419.1"
FT                   /translation="MSIFTSRFILKTDPYSKHFVFNLPKTWETRPHEYEWAKNFAETED
FT                   IVLDAACGLSHPLKFYLAGKCKEVYACDIDARILSKSSILKDIRDTYGTIIENSFLNHY
FT                   FHHIHFCHSSLSKLPYQDKSFDKIFCISVLEHLSKVDIEQTFKEFRRTLKDEGLLIVTF
FT                   DYPTINLEALKILLDKVKFKFYGDYSLDKPDNLLVSTIWGELNCFRAVLIKN"
FT   gene            55742..57058
FT                   /locus_tag="BMQ_pBM50081"
FT   CDS             55742..57058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50081"
FT                   /product="collagen triple helix repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50081"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72420"
FT                   /db_xref="GOA:D5E3P5"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3P5"
FT                   /protein_id="ADE72420.1"
FT                   /translation="MAYKRATKVRYFSSNHDNNYLKKGNCKEKDCIDITGSQIRRLLTI
FT                   LDSLKDIIPLMLRNPNTGNINTLSNLMNRLITLLNELKPNSSAVTYLITTAQSLLSSLT
FT                   TTLLPPMRLVSLLQKLINRLILLITLLCLNSETYILLLKNLNQLEAILAQYTSIGITGA
FT                   TGPTGATGIRGTPGPPGGPGVTGITGVTGPTGATGVTGDPGITGATGSTGATGITGAAG
FT                   VTGVTGITGTTGVTGDPGIAGATGITGVTGVTGDPGIAGATGSTGATGITGATGVTGAT
FT                   GITGATGVTGATGITGATGTSLTTNSMFAGNTVGSTILVVLGGTSVPLPSNQNLDSFTV
FT                   NGTNTTFTVPATGRYYITYQINTTAALLAGSRLILNGTTPIPGSTISPAVAASSYNNDV
FT                   IVSLTVGDTITLQLFGLLATVVLTGGGSTGAALTIIRLS"
FT   gene            57329..57976
FT                   /locus_tag="BMQ_pBM50082"
FT   CDS             57329..57976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50082"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72421"
FT                   /db_xref="GOA:D5E3P6"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3P6"
FT                   /protein_id="ADE72421.1"
FT                   /translation="MKNIEVSQKYLLLVLNDKGGVAPIGSLRIRAFMVASGILELVLDD
FT                   IVSLSDNQVTVKQELPSDKEYLRSIYNKISTEKSIHLKKLGRELISKRELFKELFNSVG
FT                   DSLVELDVVTKTNGGILGQSSHYIGSENSKKQIVEQMRAELLEEGPVTTDTVVLSSLLI
FT                   GSRTLKNYFSKFEDKDLNDKLTMLRKDTRNKEIFALIDSISHTITTIIASVG"
FT   gene            57991..58254
FT                   /locus_tag="BMQ_pBM50083"
FT   CDS             57991..58254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50083"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50083"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72422"
FT                   /db_xref="GOA:D5E3P7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3P7"
FT                   /protein_id="ADE72422.1"
FT                   /translation="MSRRRSLEDILQSEYVSIGELSRLTDSRYSTLKYYTEAGLIPFEQ
FT                   SDENLTRRYPREASVQRIETIKQLKKSGLSISEISDWVVNND"
FT   gene            complement(58498..58680)
FT                   /locus_tag="BMQ_pBM50084"
FT   CDS             complement(58498..58680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50084"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72423"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3P8"
FT                   /protein_id="ADE72423.1"
FT                   /translation="MNQRDQKRLAITRELMENAKKRLDLSYELEQDLENLGLQRRMKQL
FT                   DLENKLLKEQNNELA"
FT   gene            complement(59316..59693)
FT                   /locus_tag="BMQ_pBM50085"
FT   CDS             complement(59316..59693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50085"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50085"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72424"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3P9"
FT                   /protein_id="ADE72424.1"
FT                   /translation="MSERQNAFTIKTNRLSDEVYNRLATYAKSRKLGEYISSLILRDLD
FT                   DSSTGRKAIEDKKTYEMLEHIKNELADLKTLAKTTGFVGNDSFKEEEPSKVPQLKEGKI
FT                   ADLENISGSLDDDDLEEYNDF"
FT   gene            complement(59711..60895)
FT                   /locus_tag="BMQ_pBM50086"
FT   CDS             complement(59711..60895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50086"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50086"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72425"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Q0"
FT                   /protein_id="ADE72425.1"
FT                   /translation="MKISRFNKDCGNSVDMNIMDGYLFDFPTNVVELQKEAADSFFTDA
FT                   VTAPEEFKKRILLSTTIKGEEKERYFLVGDIAASQLLANNHINKLHNKITSHIPYITFL
FT                   AAIAYYHALHAKNKKDNTIEIDYFSTMLPIWLLKKESTFGAAQKAMANRFLGDHTFTVH
FT                   TPGFENTLKVLVEESACLKEGESARFALKKDLTLQDREDANEYVECETVMVDIGGGSID
FT                   VVILPEGLKAANSRESFQSIEGIPYLAHIDKLRKEKFLELFTDLRAFDQFILDNYSKQK
FT                   FVLKNENTGESIDLTSTIKSSLREYVEILLAKLNDVAPPPANKLRKYVYCGGVAPTLEV
FT                   AIMNSMREKIGEERTEKYHKVPQDSRHLNLFGLEIRSIGYVQKKQAAEKKAVKS"
FT   gene            61345..61470
FT                   /locus_tag="BMQ_pBM50087"
FT   CDS             61345..61470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50087"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72426"
FT                   /db_xref="GOA:D5E3Q1"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Q1"
FT                   /protein_id="ADE72426.1"
FT                   /translation="MILILYYMCTTSFTIKTYRILFYFLWLYFYNENALFFIIGI"
FT   gene            complement(61493..62743)
FT                   /locus_tag="BMQ_pBM50088"
FT   CDS             complement(61493..62743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50088"
FT                   /product="transporter, major facilitator family"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50088"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72427"
FT                   /db_xref="GOA:D5E3Q2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Q2"
FT                   /protein_id="ADE72427.1"
FT                   /translation="MEEKLPVNHSTNLFGNRVFQAIIISGLFLQIGIWVRNFAVLLFIM
FT                   EKTNGDPFAVSLISVAEFAPIFIFSFIGGTFADRWRPKRTMVWCDILSAISVFAVLVTL
FT                   ILGSWHIVFFATLISAILSQFSQPSGMKLFKMHLPEEQMQVGMSVYQTVFAIFMVLGPI
FT                   LGTFAFQAFGISLSIAITGTAFLLSAAALTFLPSDRKMEEENGTTSLLSEMKSGIKYVL
FT                   GKKELSLLGLCFLAAGLGIGFIQPLSIFLVTEQLGLAKENLQWLLTANGIGMILGGAVV
FT                   MIFAKTVAPQRLLAFGMVGNAIGFAIMGLSVNLWLTLGAQFLNGLMLPCIQIGINTMIL
FT                   QRTEAAFIGRVNGILSPLFTGAMVLTMSVAGILKEQFSLVAIFEAAAVLFIIGLLFILP
FT                   LYNLKEETKQEGIELGE"
FT   gene            complement(63134..63403)
FT                   /locus_tag="BMQ_pBM50089"
FT   CDS             complement(63134..63403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50089"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72428"
FT                   /db_xref="InterPro:IPR015053"
FT                   /db_xref="InterPro:IPR023162"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Q3"
FT                   /protein_id="ADE72428.1"
FT                   /translation="MKGQQWSTRFNDVKETIQSIIYTWNPLSLHASEEYEYEATWILPM
FT                   VYKVENVESLAIEITDILNQSFNSTLIKEECIGIAQQIWEQIRE"
FT   gene            complement(63542..64204)
FT                   /gene="sigH"
FT                   /locus_tag="BMQ_pBM50090"
FT   CDS             complement(63542..64204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="BMQ_pBM50090"
FT                   /product="RNA polymerase sigma-H factor"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50090"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72429"
FT                   /db_xref="GOA:D5E3Q4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Q4"
FT                   /protein_id="ADE72429.1"
FT                   /translation="MNMIAGVEIREKKMTLNDEEIVQAFQKGDEDVFNVLVKKYEYLVW
FT                   SKVKRYFLLGGDREDLLQEARLGLYKAVRDFKTEGMSSFRGFADLCITRQLITAIKASA
FT                   RQKHSPLNNALSLNIPKNSKRLEDDLILMEMLPHPRAVSPEQATVEKENKREREQMLQE
FT                   ILSPIEQDVFTLYLKGQTYMQISQNLNLPQKSVDNALYRIKKKMKHQMQYLYLQQSS"
FT   gene            64272..64526
FT                   /locus_tag="BMQ_pBM50091"
FT   CDS             64272..64526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50091"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72430"
FT                   /db_xref="GOA:D5E3Q5"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Q5"
FT                   /protein_id="ADE72430.1"
FT                   /translation="MSKKQRVERIFREEEVSHYIKPYIMYMTCIIWTIFNLVYDFKKAN
FT                   RRFLACFTRCYWINDSDTAIVKISKFVLVLIDIGQILIR"
FT   gene            64532..64720
FT                   /locus_tag="BMQ_pBM50092"
FT   CDS             64532..64720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50092"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72431"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Q6"
FT                   /protein_id="ADE72431.1"
FT                   /translation="MLLLSSFYLPSMKKEDSFAFKLLLFFTFHFLCCIPFSVECAPMFR
FT                   AKNFVSSFYNFSFLLLS"
FT   gene            complement(65363..65548)
FT                   /locus_tag="BMQ_pBM50093"
FT   CDS             complement(65363..65548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50093"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72432"
FT                   /db_xref="GOA:D5E3Q7"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Q7"
FT                   /protein_id="ADE72432.1"
FT                   /translation="MINVPSRVTSFKVFFEKNKTEVSDLFLFSSHVHNQKSHLFLLTIQ
FT                   VIYACFFIIYESIFIL"
FT   gene            66551..66673
FT                   /locus_tag="BMQ_pBM50094"
FT   CDS             66551..66673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM50094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM50094"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72433"
FT                   /db_xref="UniProtKB/TrEMBL:D5E3Q8"
FT                   /protein_id="ADE72433.1"
FT                   /translation="MRRGKKIPLPYSKKLIYDKGDSYSNIGSLVAKYTCFDIFC"
XX
SQ   Sequence 66985 BP; 22108 A; 11406 C; 11309 G; 22162 T; 0 other;
     tgaacaagat attaacttgc tatttaccag atgtaaatac cttcaatgga cgattcacat        60
     ggttatggaa agaaaaaccg acccttcgta aaaagaaaga agcgttttta gaaacccttc       120
     gtactcattt taaacaacaa caagtagccc tacataaagt attccctaaa aaacggatgg       180
     aaatgttaga ttacgtgatt tataacctgg ttgctacagg cattcaagcc attcactcca       240
     aaacacttat gcagaaattt gatgtatctc aaagtaccgt ttctcgcttt gtaaaatcat       300
     taaaggaaac accatttatg atcgtggcac gttatatcaa agaagataca acaggtgctc       360
     atcctgatag ctatgtgttt atccttaaaa gccatacgaa ttttaatcaa atttgtgagg       420
     aaatcttttt tgcacacgat acaacaggtg tacaaacact tcaacaagaa gaaatgacaa       480
     ctcctgtgac aactcctgtg acaactcctg tgacaagtcc agaacgtgct gaaaacgttg       540
     atacaccaag ttttgagggc gaaaaaacat cgtccccctt tattaacctt gatttaccta       600
     aaaatcattt aactaatcat ttaatatctg cttcacagtc atttgcttat atcaaaggtg       660
     tgcctaagaa agtaaataat gtgtatgcag gcaaatatgg tcatcaacta aaagattttt       720
     atgctcgtat tcaaaatgct gcaaaagctg taaaacgaga tacagagatt gagattgtca       780
     aagagcaagt tcatgaagtc gcttatacag ccattgtagg cttagataaa tatgtccatg       840
     aggcgaatca taagggtact cccctatcac tggatgaaat gtgccgtctt gtttatcaaa       900
     ttgcctacaa tcaatttacc aatctactaa cagggaatac agaagaacaa ccatctgagt       960
     cagacataca tactgaagct gaaacagcag cattatttac gcctaaacat atcatccgta      1020
     aggaaatagt tcctgcttgg ttaaaagttg aaaaggagca aaaagagtgt acacaagaac      1080
     cagctctttc tctagatgag cagcttgaaa tgattcaatt aaaacaagat ttagggcaag      1140
     aactaacgcc agaagaagaa actttgctcc aagagcacag ttctacatac agttcgttag      1200
     aaatggctca gctgaaacaa gatcttggac aagccttaac accagaggaa caagctttat      1260
     tgcaccaaca ggaccagtta aaaggctcag tttcttaatc aacaagtgaa gaaatccctt      1320
     agaagctgat gtttaattag ggtattatta tttagaaata tgttctaaat aattaatata      1380
     taaatctatg taggaggaga tcacaatgcc acataaaatg acactaacag gatctgcgac      1440
     aggaccatta cgagaatacg atcgctatgt tgcctttgat atgcgtgaaa aaggctctcc      1500
     atctgcgcct aaaggtctga agaagagtac gtttatttcg tataccgtgt ttgttgcgaa      1560
     gaaagccttt aataaaaccg gactaacaaa aaagagtatt atgcatgaaa aaatcttaat      1620
     tcaaggggaa ccaacgttag atattcccat tgacgagtgc cctggggaaa ttggtatcat      1680
     ctgcttccaa attaccgttc tcccgaataa aaacgataaa gaagccaatg agtcaaaaga      1740
     taaaaaagaa gcgaaactag aggtttctaa ggctcaacaa gaggttgcag ctaccaggca      1800
     ggaagaaaaa caaaatcctg tttctcagcc tgtagcaaca gaagctaaaa ctatacagcc      1860
     agaagcgaaa gaaatgcctg tacaagagaa aaaggctgcg ccccaaaaga agcagctacc      1920
     tactcaacca aaagggacac aggacgttgt aaacttcgac gagatcatcg ttcctgaagc      1980
     cttcttaaag acacgtccaa accctgtgaa aacagaagaa gtcattgaat ttgtgaagcg      2040
     tacaggacac cttgacaaac cgttaacaat tgataaagga tcgaagattt taaaagatgg      2100
     atatcgtcgt tacatcgtag ctaaaaccgt gaaaatggac aaagttccgg ttgtctatga      2160
     gtatcaaaaa taaagcaata tctaaggagg cagctatgaa tactaaatat atgccagact      2220
     atgggctgta accatgggct tatcatctaa gcttgagtta cccttatgat ttagactatt      2280
     tattgccaga cgatcaaaga tataatattt acgtggctac tctaatccca aaattaagta      2340
     tagatgaaga ttctgtccaa ttctttgaaa attatatacg ttttgacgta atggttggga      2400
     caggagaaca tacttcaagg gagatactgg acatttctat tttttcagat gataagccag      2460
     aatttgatca cagaaaattt gaatttgact atgagaagcc acgtaaagcg atggtattca      2520
     caggttggaa aaaaggccct atcgagttaa gtcttcttca tgtctaccgt gaggattcaa      2580
     agtattacct agatacagag attgtttata tcgggcaggc atttggagaa aatggagaac      2640
     gccttcctgc ggaagagctg atgtctgatc ctatgttgca gaaggtagaa gaagctcttt      2700
     tacgtgagta tccagaaaaa gacctagccc tcctattatt ggagttcaac tcacaattat      2760
     tagaggaaat agatagtgag gacgaagatt taattcaact acaagagata acaaaaaatc      2820
     cttctctgga attaaataat caaatcctaa atgcaacgga agcagctcta atcaattatt      2880
     tcaaacctga gtacaataag aagctcaaca atgatttttc taatgtagaa gatcacggat      2940
     tacattatca ttccgttact gtacaagttc atcccgatat tatgggatta aagctatttt      3000
     caaaggaaaa gacataccta tcaaatgatc ccattgtctc ctctccttta cattcgaata      3060
     gctaaaagaa atttggttta atgctgcaat taaaaaggat caaattataa atatataata      3120
     atcctaaaat gcctctgtat gttattctat acagaggcat tttttgaaca aatcaatcag      3180
     taagatttaa ataattgtaa gttcaacctt agtttaactt gaaagagagg aaacttaagg      3240
     agattgcaat cttaccgact ctagtctaac ttaagtttaa cttaaaaaat attataacgt      3300
     aaaattacta taatatgaac gttagaagaa caggataata tcattaaagg aacgaataaa      3360
     taacaaggaa aggaagtgga tactgttgag cgaacaatta ggttattttg ctaaacaggt      3420
     gtgcggaaaa ttaaagctga atcccaacac tttacgtaag tgggcgattg aattagaaga      3480
     aaacggttat aaatttgaac gtaataacaa ggggccgaac ggtcaacgaa tctactacga      3540
     acgcgatatt aacattatag cagaattcaa agtgttattg gagcgtacac acagtgtcga      3600
     gaacactgca aagctattaa tgaaaagggt tgaagaggat tcgaacgcag aaataacaca      3660
     tggtgttcgt gaagaaaaag agcgttcaaa tcctattaca gttacgttca ctagagagga      3720
     attggagcag tatactcgtg ggattatcga agaaacttca gcgaaagttg cagctgaagt      3780
     ttcggcgcaa acggcagaag cagtgtacaa aaaaatggaa aatcttatag aacaacgaga      3840
     ccacaaatta ataaatcaaa tgaacgagag tatggaacaa cgtcgattag aaattgctgc      3900
     ggcacgggaa gaacctgctt ctagcttttg gagtcgtctc tttaatcgta aataagaaat      3960
     tcatacgcat ctataacaca agggtctatt actttgaata cagtgtcgag aacgctgtaa      4020
     agttagtaat gacaaggggc gaaaagggtt cgaacacagg aataacacat agcgttcgtg      4080
     aagaaaaaga gcgttcaaat cctgttacag ttatgttcac tagagaggaa ttggagcaat      4140
     atacttttgg gttatcgaag aaatttcagt gcaaacggca gaaacagcgt ataaaaaaat      4200
     agaaaatctt atagaacaac gaactacaaa ttaataaatc aaatgaacga gagcatggaa      4260
     caacgtcgct tagaaattgc tgcggcacga gaagaacctg cctctagctt ttggagccgc      4320
     ctctttaatc gtaaataaga aattgatgcg catctaaaac aaaaatcatc tattacttta      4380
     aatacagtgt cgagaacgct gtgaagctag taatgacaag gaaaaaagag ggttcgaaca      4440
     cagaaataac atatagcgtt cgcgaaggag aagaacgttc aaatcttgtt acagtcatgt      4500
     tcggagaatg aaaataaaaa agaagatact atacacaata tttcaagcca tgaagtaaaa      4560
     aaggaccttc tttctatttt agaaattagg ctcttttcta tttaaatacg aatatctata      4620
     acaaagaccg cccattatct attagtgtat aaggcggtct taactatatt catgctatat      4680
     gattatgaca aaaatatcga cagtattctt atttataata aacttattta aatcccgtag      4740
     ctgtatttgt ttaattaagt atatgcacta cagcttgtat ttcatgagca aatttgagca      4800
     aatctatgta tatatttttt tataccggaa atgatgttaa catcaaggag gttttcataa      4860
     atgttctggt ggaaaaatcc caaaagatct aaattcggaa aatggttaga taaaaacggt      4920
     atacagcaaa ctgacttcgc aatgaaaagt aatgtttcta gaagaacaat atggacaatt      4980
     tgtaacgata aaaactacat acctagtgct accattgtga aaaaagtgat ggatgctgta      5040
     aaaatggtag acagtagtaa acaaccaaaa gatttttttg acatataaaa gggcacatcg      5100
     aatgtatctt tatctatttc attggacatt taaatagaat gaccctctac tttgacaaaa      5160
     taaaaggtca ttgattcgta cctgcctgtc aatagtcaac cttcggaagg tgacatcttt      5220
     attcatatcc aacataatta taatcaaaac ttttcccata aagatctggt tagcataagt      5280
     agcgttatcg tatataaaag tcgttggaac aaaagattct aaccactttt catttatgca      5340
     aatatgtcca aaatcttttc atttatctac atattttgca agtgcaagca ctgtatttgc      5400
     gatgcaaata cccgtttcgt tctgcttcac ttgctttaaa atcaaagcat cgcgtcaatt      5460
     ttaaaaaaca taaaaaagaa gaacaaagct aacgcaatgt tcctcctttt cgttccattc      5520
     atttcatgaa ttcgacgtac caaccttcag ttggttttcc gtatgcacag gttagaaaat      5580
     aactggcaag cttttaagag aacgcaatgt gctgttgtta taaaccagtt gctccgattc      5640
     gattgccaat cgtaaatcag gaaaccgttg aagcaatgtg ccgaaagcga tatgtgcttc      5700
     catgcgcgcc aaaggcgctc ccaaacaatg atggatacct tttccgaaag tgagatgctc      5760
     attctcctcg cgtgtaatat ccaatccctc aggataagag aatttctgtg aatcaatatt      5820
     ggcggcaacc agcgagaaca gcaccatttc acctttggga atcatttttc catgcatgat      5880
     gatatcttca cccgcaaaac gcccaccaat catgaccggt ccggcatagc gtagcagctc      5940
     ttcaacggca gaggggagta aagaaggatt atcccgaagc aggcgcattt gttcgggatg      6000
     cttcaatagc gccagtacgc cgttgctgat tagatgggcc gtcgtctcat gtccggctgt      6060
     aatgagtagc caaatcgtgg aaagaagctc gttctcgctc aacttatctt cttgctcatg      6120
     tgcttgcaac aaagcactca tcacatcatc gtctggatgg ttgcgctttt cgaccagcat      6180
     ttttttgatg taatcaataa actccttgag tgtttccata actacagccc cttggctagg      6240
     atccatagct gctttgatga gtttatctgt ccagtcgcga aatcgtttct gatctaaagg      6300
     tggaatccct agcatctctg aaatgacaat aatgggcaga ggaaaagaaa aatccgcaac      6360
     aagatccata ttcctttttc cttctactga atccaatagc tcattggtaa tctgctgtat      6420
     acgaggtcga agattctcga tcatacgtgg cgtaaaggct ttagaggcca acctgcgcaa      6480
     acgagtgtga tcgggtggat cgaccgtaag catattcggc atattcatca tccattcaaa      6540
     cagtttgctc gcagatgtgc tatcatctat agaatccttt ttatcttgca atggtgtgaa      6600
     cttccgtaca tctttgagaa aacgggggtt ctttagtatc gtaacaacat cgtcatgacg      6660
     taatgcgacc catgccggtc ccaacccgta ataatcatcc aaacgaataa gaggttcttg      6720
     atgttcagtg agttttttat aaaatccgat gacatcgtgc atattttctg gagagctaaa      6780
     atcatcaact gtaacctttt tcatttgatt tactcctttc aaaatgcccc ttttagtaaa      6840
     ataactacat atacaaacag gtatatctct ttacgacagt cgaagtataa tatccttctt      6900
     tgctattaat cctatatttg cgaatatcat tttcaactct ctctgctaaa catggcttat      6960
     gttaagttga ttttaattcc tccagaagaa gggtctgttt ttgaccttgc ctctttttgt      7020
     tgtttagaag agcttttata tttctccatt agttcatgga tgcttgccac ttgtataatt      7080
     cggatatgat tggaagcaac agcataacga acaggtgtaa tcaccatgac ggaagggaag      7140
     agggctgctc gatcctctga ctgccattgt aacgctttcc actcatccga aaagaaaaac      7200
     tcctcgtata agttaatctt cgcttgcatt ttctgttccg aatactggtt tctttgaatt      7260
     tcaatccaaa acggagatcc tttaaagata caaaacagat ccggttcaat tcctcctttt      7320
     cttcccgtgg gcttatcttc tacaataacg tgtttaggta cactataggc acacatttgc      7380
     ttatagacat ctagaaccga aaggaaatga agtatttttt gagagttctt tttgattttt      7440
     gcatctacag gtaaatagac ggtcggagaa tactgctgtg tgcgttcaat tacccctaat      7500
     cgatataaac gtaccattac actattacat gcatttacgg gagatttcag ttgtttaaag      7560
     aatagatcca ctaatgagtc tcgatccacg gctctaaatt gattaataaa cgctatgata      7620
     tctttatcac gttgagataa tcgaaagctc atcgctgttc ctccttctcc aataacccaa      7680
     agatggattg tgatgcaact tctatatctg gctcaggatc atgtaccaac gccttataag      7740
     gagagagtat ttccttacaa tctccttcat ctaagaaaaa ggcttgaaac tctttgacct      7800
     catcaatttt aattttcatg cgccccctgg ctgcggcatc aatttcttct gcgccgatta      7860
     ctccggcaac tttcgcattt gtggcatcgg cctgccttcc agagatccga acccgtaagt      7920
     ttgcctttag tgctgaattc aacaaatcgg aatctggacg ctgcatggca ataatcgtat      7980
     gaacacctaa cgcacgacct tggctggcaa actgttggat tatctctaca agctccgttt      8040
     ctcgcttaat aatgctcatc tcatctacaa ccacgacaat ccgaggcagc ttaaaaggaa      8100
     gcctgctgat atgagttaca ccatgctcta acaataaatc gcctcgtcga tacatttcag      8160
     ctcgtaataa tgaaaaaggt tttctcatat cctttgcctc aaaacaaagc gcatccacat      8220
     gctcaattcc atgaaacaag cctaaatcag ctcgtttgag atcgactaat actaatcgca      8280
     gatcatcagg cgatgtatat ttcacccatg tggtgaggat cacccgcatg agactgcttt      8340
     ttccagcgcc gatttcgcca gaaatcagta acgtttctaa atctgcaaag tcccatgaaa      8400
     caaggtttcc atagatatct tgaccaatgc atacgggaag ctccattttc tcaatatgag      8460
     catgaatggc ttcataacta taagtaagca tcttaggtaa gcttttgtga tgaacggtaa      8520
     tactaaagtt ctttaagctg ccattcactt caatattgct gcctaatact tgtcgtaatg      8580
     cccatctttt tttatttaaa agttcaggat caatgccatt cagtaaggaa aaagcatacc      8640
     gagtgtaggt atgctgatga tcgatccgat ggatcttcgg aaattgataa gaggtacgat      8700
     ccccacgctt tatgacccga taaatctctg ctgtacgaaa cgctttaata agctttccac      8760
     gcaattttag tttctcaaac atctaaaccc tcctcaaaac ataaatgtcg caaagaagta      8820
     aaataaggcc ccataaaagg tgacaggcag gataaaccgc attacttttt caaactggtc      8880
     ggcaagatcc atgacacccc atcgatttaa tatctgttca atgaaggcaa ttcctaaaac      8940
     aatgcctcct ttagtaagaa tggtggggtc aagcaaggcg agtggactaa acggaacaaa      9000
     ggaatacgct ttgaagggac gaggtctctt gagagatgat ttgggagatg gggaaaagat      9060
     ttttcgaaaa ggaaaccttt gtgtttttct catgctgata cctactttcg ctctttttat      9120
     tttttcacct ttgatttatg cgttatttca gctcaccgca ttcggtcgcc cccttcgcct      9180
     cctcggctca gctcccttac aggttccaca aagggcttca cgaggcgtat atagcttgtg      9240
     ttaacgcagt aaccttactg aactagatac taattaggta acggagtcat aattctttag      9300
     atactatgta actacttcag taagcttgcc tgtccaatcg aaaaataaaa aagaaccctt      9360
     actgcagtag gtaaggggta gctgattatg taagaagtaa tgggtgttta tatgctaagg      9420
     gttggcctag ccgcttatat ctttatcaag tggacgagag gtcaaaagat gttcaagtgc      9480
     ctaaagtgga acgtattgat aatcaatgga agcatagtaa accagattcc gcgtgtttta      9540
     aaaaaagtta aaacacgtta aaaaagaaga aagtatcttt tggtttcttc ttctaatatg      9600
     tatggtatgt gtaattaaga taaaaggaaa aatagggacc aaattgttcg attagaaatg      9660
     tatgcaataa aatccatctt tgaatttttg ctcagatggc tcacaaaaac tttaattaac      9720
     agggcgaata aataaagaag gcttttgtaa agccttcttt atttatcaac atataactaa      9780
     gggttttatt tttttcttgt taaaacaaaa gctacaacat aagctattaa taatgagata      9840
     acagcagcca tgataatttt tatgtacgaa aattctaaag cccacggtcc atatttttct      9900
     ggattgaagc gatacataga ccaccattgt ccattggttc ctgccgatag cgatataata      9960
     atccataaga aaaataaaac cagaaaccat agtgaaaaaa taatatagtt tgattttttt     10020
     ttattcacct gtaagtcctc cataaatatt attaaaatta acttattgtt aaaggatgaa     10080
     acatgggtta ttaatatttt aacttctaca ggttaacctt accatatcaa tataattatg     10140
     taatattaaa aaagggatag aattgaactt ctatcccttt tgctttttat ttaactggtt     10200
     ttaaaaagtc taaccatgtt aaagatatgt ctcttatcac cttttttcac aaattcttta     10260
     cacttcatag aagtagatcc cgatccatcc aatacaatag agttagcaga attcaaccct     10320
     aactgttcaa cggctttttt tagtcccgga atactcatcg ctacctcagt aacaatcaaa     10380
     taagcatatg aaccagacca tgctaaaaca gtacgttgag taggagcaga atacgcttta     10440
     gttccccatg cttttgaaga ataatccata ccaccaatga tttgattgta tttagggtat     10500
     ttagcagcaa cattatcacg agttttagca tacatagaag tcatcttttt cgtaccactt     10560
     actgtataaa taacagctgt ttttcgggaa attgggttag atgaagtatt attatagttg     10620
     tagtttttat aaaaagtttt tcctcctact gtaattttct ttccactttc cccagtgtct     10680
     acacaaatag cacgagaagc atttggagtt ttatgataat ctctgctgtc aaagaacccg     10740
     ccattaattc catagtaaga agtgtccgtt agtggcttac agatagtctc agtgcaaata     10800
     ttagagattt ttgttttaat tacatgaagc tgtggacgtc cgtttaacca taattcttta     10860
     gagtatttgt aatttgttgc catgaagaat tcctcctaat ttaaagtgct tttgttattt     10920
     acaccttata aagggtgttt aggaagaaat aaaacaacct tcttacaaaa aaattgttgt     10980
     taattcaata aaaaaaagcc tagaatggct tttttattgg tttattaatg tgaaaaaact     11040
     aggcgacttg tgtaaagtat cgctcttcat ctttcttaca attgattcgc gtaaattttg     11100
     tgcaagatct tctcgatatt ttggatgagt ttctcttaag gatttcctta atttatattc     11160
     taaacaaata agaacttcct caatttcttc atttgtataa agcataattt atctcctttt     11220
     aacctaatta tctttattta tgtttggaaa ctctctcata gtttctgcta atttatctat     11280
     ggcgctcttt aaactctcta accgattttc aaacctaagc aacaagtaga ttgctagggc     11340
     cataggaaac ccaaagttac cgataagctg aattatattt gtagaatcaa tcacttaaat     11400
     cccccctaag ttttaacaaa gttttatttc gagttcttgt aatatattgt tgacttacat     11460
     tcaaataacg ggctatttca acatctttta aatccttaat ataagcaagg tataaaatct     11520
     ttttttgttt tgaagataac tttttaatgg ataaatatag cgatgggttt tcgatgtagt     11580
     cttccaattt tttagaaggt acttcttcag tgcaataatt cgtggaacta tctatcaaca     11640
     aatcaattaa tgttccattg tcgctttcag gaactggttt atctaatatg cttaagaatc     11700
     gtttgttgta agttctgtgt ttattatcaa actttttaga ctcaaaatgt ataactttag     11760
     agaaataaga gattgctcgt atctttagat aatatttctt aaatttatta tccaatttct     11820
     gttcattctt ttgtgtaggc tcaagttgat attttttaaa taaactgtaa ttctcttctt     11880
     cttttaaaaa accttgaatt agtggatttt ttatcttaag caaacaaata acctcccgtt     11940
     aagaacgtat gttctgtatt ttagcaaaaa aatttagaac atcttaaagt gttctagtta     12000
     ataaagtctt tttaaacaac aaaaaaacaa cctatatcta aaatttctgc tttttaaata     12060
     gccttaatta ctaattcaga ctattaatta tatcataatt atggttattt tccaataaaa     12120
     aggaacttat gacaactcta atagaaaaaa ctttttaccg gcgcaaaagg cacatgatcg     12180
     taagaaacat gcttatttga ggaagcaggg atatacagtc atgagggtga gtggcaggag     12240
     tattgtaaaa cgtatgcctc aagttctaaa gaaagtaaaa acaaggttga attaaaaaaa     12300
     gagaaggcta aaacccttct ctttttcata acctatttat aaagttgtaa tcttttctac     12360
     atttgcgtct gtcattgcct gcgcagctac aatttctttt cgttttcatc gattataggc     12420
     ttccaaaaac gttcgtaaag gtattcgaat tacaagagac gttcgtaatt tatttttaaa     12480
     cttaaacgaa cgattaaaat gatagatttt atatacaaaa gaaaagtccg taaacgtata     12540
     cttttacgaa cgtatttttt tgcaaactat ctgtttgtat gcgtttttta tagactcaaa     12600
     aggtaattaa aagtaaggga tggatatgac cattatgttc gttcgtcata gaaaaaagcg     12660
     ccaactcgtt attattaaac aggtttgcac ttttttacta cctatcacat gtgttatgtc     12720
     aaaatgttga gtaaccttat atttttgaat aaatatatac tgagggagct aactaaatta     12780
     gattaatatg ttcattccaa ttctttatga aagacattaa tgacattaaa taatcttctg     12840
     gttctgtggt ttgattttgc atccaatgca ccgcagctcc ataaagtgtc cagcttaaca     12900
     tcactgcacc agcctctacc tccattttgt ttggattatt ccattgcttt ttcccccact     12960
     ctgaaaaaaa tgcttgaagt tcctttttaa aaatcgtttc tatttggggc ataaatgcct     13020
     cgtaattttg ctgacattga ttactgagag atgtttgaaa cttaattatg gataaaaaaa     13080
     tagcttcgat ggtctcttcg ttaattacct catgtgtact tacttcttga aggacctctc     13140
     tcataatact ttcacttaat actttttcaa gcaagtcata tttgtccatg aaatgataat     13200
     aaaaggttgc acgattaacg gttgcaacag ttgtaatatc tttaattgtt atgtctttaa     13260
     actctttttt cattgataac tcgattaatg catccatgat gagcttacga gttcgaagta     13320
     cacgaggatc gatttgttta ctcataaaac tttctcctat cttttagtca cttttatcaa     13380
     tgtgttggat atactacata tgcgttattt tgttggttga gcaaaggttt ctaccttggt     13440
     atattaattt tacaacaagt gttgggtata caaaaggagt cgaaacaaag aacatgaaaa     13500
     taacgatttt tggagcaacg ggtcaaattg gtcagcttct tgtaacacaa gcacttcaag     13560
     ctggttatga tgtaacagcc tattcaagaa gacctaatgc tttgaatata aaacacgaaa     13620
     aactgcaaat tatagtggga gatttaacag accaaggaaa attaagagaa gcaattttag     13680
     aaagagatgt tgtagtaagt gcccttggac ccacaatgtc aatgaaacga caagttctgg     13740
     atctccctat tacacaagga cataaagcta ttatctctgt tatggaggag tatggaccga     13800
     aaaggtttat tacgcttgca acacctacta tctctgcaaa ggaagacgtt aagcaacttg     13860
     ttactcagtt accgagtatc atggcaaaac tattataccc cactggatac gcggagatga     13920
     aagaaataga gaaattaatt gaaaactcta ggctggattg gactgttgta cgaatgctta     13980
     atcctaatat gaaaacaaat ggtaatggat attctgtatc gtttggagat acaaaaggta     14040
     agatgaatgt ttctcgttat aatgtagcga aatgtatgtt ggaagctacg caaaaagatg     14100
     aatgggttca taaaatgcca atcgtattta acaactaaga ggaatttgaa tttggagtgt     14160
     attcgtcagg tgaacgcatt cctgatagac aaagatattt tgaagccgtg aaagagcgtg     14220
     tctaagatat tctacaaata gcaaagtgga cagatgaagc tggacttgat gtgtttggtt     14280
     tgagagagca tcaccgaatg gatttgtaac aagcgtttat tagtacttat attattaata     14340
     cgcaggaggt attaaaaatg agtaatcaag aaaataaaaa aatcactccg atacttcatc     14400
     atattggttt aactacagga cgttttgaag aaatgataag ttggtataat aatgtactag     14460
     gaatggaacc agttcattat tcagaaaatc cagctggcga tattggtatg aaagtaaagg     14520
     ctctttgggt aacgaatgat gaagctaatc accgtatagc aatgattgga attccaggat     14580
     taacatcgga catgaacaga agtaagcatt ctagaattca acatattgcc tttgagtatg     14640
     atacattaga tgatttatta gatacgtata tacgtttaaa gaatcttggt attacaccac     14700
     atgtcacagc agatcaaggt gttagtattg ctttttacta taatgaccct gatggtaaca     14760
     cggttgaatt aaccatggac actttcggag actggagcaa atcaaaagaa tttatgaaaa     14820
     aatcaccaac ttttgcgaaa aagcctatgg ggaaatatat tgatgttgag aagattttac     14880
     tagcacgtga acaaggtttg tctgccaatg aaattcatga acgtgcatat gccggcgaat     14940
     atgaaccaaa cactccaatg gatccccaaa aaatgcttta atattataag taactagaaa     15000
     aataatgaca tttatatagt ttgaataaag gagaagcaat acacatgtag gcacaaataa     15060
     tgtttaaaac agggaagcga ttttataatt gatttctttt agagcagtat tcatattaca     15120
     tgttccagat agtaaaaaag cgcaaacctc taaaagataa gcaatgcatt taaaatagtg     15180
     cattgcttat ttttgtgccg ataaaaaaca ttatgtaaat aagaaacgaa tataatatac     15240
     ataaaaaaac aagaaactac cctttgaaag gtagttcttc agaatgctta tattaactca     15300
     gacaaaatac ggtcacacag agacattgta tgaacgttgt cacgtccatt ggacgttggt     15360
     tttcttttat ttttgcaaca gtctataaaa tgagtcattt ctccaacaaa gccacgtaaa     15420
     taaagatctc tgtaagttcc ggacataggt gatgcagatg gagtaaatac agtgtcagcc     15480
     tcttcaagag atttccatgg caaatcactg aatgtttgtg atttatggat agtaagtgaa     15540
     ttaacttcat ctgcaaaagc aaatccatta tcaaatgtaa caagaatgtt ttcactttca     15600
     cgagaccaag ctgtcattcc tgtaaagtaa aggctaccaa caacaccatt tttaaacttt     15660
     agtgtgatgc tgtgagaaat aaacccatta tcactattct taaaacctga tacgtataaa     15720
     acttctccaa ataggtagcg tattaaatca acgatatgta tcgcagcaaa cttgataaac     15780
     tgctcatcat ctttacaaaa tggcgtgctg tctactgcaa attttgcttg aaacgaacgg     15840
     gcattcccaa gactaccatt ttcaataatt tcttttaact tagtataaca aggagcataa     15900
     cgtttcataa atccaaccat taccgtcact ccagcttcat cagctgcatc tgcaatttca     15960
     gcagcttcat cagcactcat tccaagaggc ttatccacaa atacattctt tccagccctg     16020
     atacaatcca tcacgagaga tggttgatct tcaggctgag cgactacaac aacaccatcg     16080
     cactcttcat actgtaacat ttttttatag tcgtcatagg gcgtcccttt gcttccaaaa     16140
     cgctgaaggg tagctttaga acgctcaata ttccttgtag aaacagcctg tattgctgca     16200
     cctgcttcaa tagcagaagg ataaatatta gtagatgcat gaaatccagc acctataaaa     16260
     cagagattag cttttttcat tttcatcgct cctattttct ctaaagacac tttcaattag     16320
     aactctaaca attttatcat aatgttaact ctttaataag taggcaaagt atatctcaaa     16380
     gagacggcaa tcgctcggct ttcagtcctt ccacggcctt ctaagaggtt tcttagtact     16440
     tctcctttta tttttaatta ggtgagatga ttatttgcgt ttaacctaca attttattgt     16500
     tttcgtaagg tgattcttat tacaggaatt gttctttata atcatgcgtg aacttttcta     16560
     aagcgatagg aaaatgattt tcatttgcat tcatctgatt gaaaggtgaa tgcttttttc     16620
     gtaaataata aaaaataaaa atttctgtca caaaatctgt ttttctggtt tctctataat     16680
     acaggcatca aatgagagtg agggtttatt aatatgtcaa cgataaaaaa ggaagaacgg     16740
     cctgtctcgg atgtgacatt tgaagattta tttaaacaat actacgttta cgttgtgaaa     16800
     cagatcgtat ggatagtcaa aaatcaaatg attgctgaag aattagcaca agaagtattt     16860
     ttacaattat atcgcaacga ttggaaatcc attgaaaatg tacctgggtg gctcttaaaa     16920
     tcttctactt atgtagcgta taactatctt cgatctgaaa aacgacatca ggcgagaata     16980
     aataaaacta tacaatatca tgaagcacaa catatttcat ctctagatga tgactggata     17040
     cgaaaagaag aaattacaaa ggtacaaaac gtactcagta acatgaatga gcgagaacga     17100
     accattttat tactgaaatt ttctagtttt caatataaag aaattgcaga agtgcttcaa     17160
     attaacatat cttctattgg aacattatta gtccgggcca aacaaaaatt tcgtaaaata     17220
     tataaacaat tagaggaggc ataacaaatg aattgttatg ataagggatt tattcaagca     17280
     tatattgatg gggagctttc tcatgacaca agaaaagaat tcacaaaaca tctagataca     17340
     tgtgaaatat gtcaagatgt attaatagaa atcagtaaat taaatagatg ggaagacgtg     17400
     gtcttagagg aagaaactag acatttatca caagaaatca atattgatgt ggatcaagcg     17460
     tggaaaacat ttgaaagtcg cacaaaacta gagaatgttt cttatataaa tcaaaaaact     17520
     gaacaaaaga gaggattatt tacaaatatg aataaaaaat caaaacgttt catgtataca     17580
     gcggtagctg cagcaggact ttttacaact gccatgattc cacaagtaca agtggcagct     17640
     acaaatgttg cttcctattt ttcgaatgaa atttcaaatg ataaggttgt aaatgaagga     17700
     atacatgatg aaaatggcgt tacacaagac atgatgaaag atggtcaatt cattccgatt     17760
     gataaaaaaa ttacagatca aggtgttact gtacacttta aagaattata tgttgcggat     17820
     tcacgtatat ccattcatta caaaattgaa aaagccgatg gaagtttagt accatttgaa     17880
     tttgatacaa caggattaga tctaaaaaac gatggcaaga caaatgaaca acaagaagaa     17940
     aacccggagt atcaagagaa agatggtagc ttctcacaat taccatttat tcaaggagca     18000
     agtggtttac cattcaaact aatggcagcg ggtgaagaat tagagtatgt aggtattcgt     18060
     gataaagata gaccagaggg cattattaca tttgttgaag gtcctgaagg caaagactcc     18120
     tttaaacaac cacttacatt aaatgtggat ataaacaaga ttggaaaagt agctggatct     18180
     tggaaaggtc aaattcaaat tgatcctgcc aaattgaaaa aataaagcaa agtcaaataa     18240
     aaaaaagaat agaacgatgt gtatctaata ccatacttat attcttcctt atgttagtta     18300
     catttatatc gtacttgatt ttttttaatc ggataaccat aaaaacatcc cagtaggggc     18360
     acggcaacga ttccttattt ttggggccac tcataaaaac cagaagatgt cttatgcttt     18420
     ttatgaaaaa gtatattata ctatttgtta ttttataatg atgtatcttt tccaggggat     18480
     aggaaaagat acaaaaataa attaaatttt tgcattcatc taattaaaag atgaatgctt     18540
     ttttttcgta cataataaaa aaagtttttt gtcacaaaac ttggatttct ggtttctcta     18600
     taatacggga atcaaataag agtgaggttt taactggcat gttaactaaa aaagattagg     18660
     agaatcatat caataagctt atatgttagc agtttctaaa agcaacttaa agttgctttt     18720
     agaaacgtca ggttggttta accatttatg agtacgatat aaaattaatt ttaacttgaa     18780
     aggagagaaa tgaatgaata gaggagaaaa gatagctaaa gcacgaagag aaatgaattt     18840
     aacccaagat caactagccg aaatgttgga agtaacgagg caaactattt caaaatggga     18900
     atctaattta gcatatcctg aatcggttaa attagggaag ttagctgaag tattaaatgt     18960
     tacttgcgat tatttattgc gtgagaacca ggcaacgtct acatctacat ctatagaagt     19020
     aactatgaat aattcaggta attacacact tgattggtct aaactatatc caatacttaa     19080
     tgagtatcaa aatatgattg attgccctca ctattttgaa aaaatttatg gaatggtcaa     19140
     ggaaataatg gtcaaataca aatattcttc agaggataca tttttaatcc ttaaagattt     19200
     actatatcaa atatatttac aaatggaaaa gaaagttcaa taagaactcc ttttttaaga     19260
     taaatgatta agacaacttg aagcagtaat tagttttttc tatcctcgtt ggttctaaaa     19320
     ttaattccaa acgttatcgg gatacaatta aaaatgagtt ttataatggt taaaaataaa     19380
     aacagagctc ttgtgtatca atgctctgtt tttattttgg ttccgagatt attgattatg     19440
     ttaactacct ttgtatatcg tatacagctt aaaaacagaa aaaactacct gcgcataagg     19500
     tagttttttt ctctaattgg cattttagag atgatgcctt gcggcgtctt gggtagtttg     19560
     ctcaaagaag taaaaaatat gtatatacat aaaaatgaag tatattttaa attttatttg     19620
     aatgtatgtt ttgaaacata taaaaaaggg aaaagtatct taattttatt ccagataaat     19680
     ttaaaataag aaaaatggtt aatatgttga acaaactgta ataatgaatc tggagggaag     19740
     gtatgtcaat taataaagaa gttttctatc gcggtaaacg ctttaagatt attcatattt     19800
     atagttctgg ctattgtgag cttagaaaag ttaatgaccc ttttaaagta gaactagctt     19860
     tattaaatga tatcctacta acaggataat gattactgca tactcgtatt taactaacca     19920
     aactaaatta atttgatttt tgttattaaa aaaacatatt aatcattttt tgataaaaat     19980
     agaagccaaa ttctttatat ataaagaatt tggcttctat taatgttgaa gatgctaact     20040
     aaaaatgtat atcatataca gtgtaaaaat agcaaaagtc aattttacaa acaattagtc     20100
     attattacgt ttgttgttgg ctttgccacc cttttcaccg atttcctggt agaattcttt     20160
     atcatggttt ttagatgtag cttctccgcc tttttcgcca atctcttgat aaaattcctt     20220
     atcatgattt ttagatgtgg ctttgccacc cattcttcca gcttcttcac ggctcatttt     20280
     gtcattattt ttattagttg tcattttaca ttcctcctaa taatttttaa tatgtttttt     20340
     atcttccacg tttaaaagga gctaaactat ttatctttat tttcctaata attgagaatc     20400
     attttccttt ttttattttg tagctcctct ttttgaaaaa tcttacttat atttgttgat     20460
     atgctttttt ttaatatgag ggtatctata aagtacatta tggtaactag gaatgaatat     20520
     tttatatcac acaaactggt ctctatttaa aatcaataaa agattttgtg gggatttatg     20580
     tttactttta tttgaaacaa gtaaaatcat ttagtataat ttagaatttt ttgtaaatta     20640
     aagggaagtt ttgtagaaag tatttcatat gcgaaaaaaa acgaacataa tatatttaat     20700
     gttagtcttt ataaggagtt tattaaaatg gataataaac acaacctttt attatgtcca     20760
     ggagaagtga attgcttgag agaaggatac aagaattgtg aaaaggaact gattaaaagt     20820
     gaaattcata aggatattat attattgagc gatgagataa aagttgatta taaagtaaat     20880
     aggtaggaaa tgtacgttca cttatgtaat cgaatttact tatttattac ataggtttaa     20940
     cttcattttc atttccttgt aactgccaag ttttataatg aattagagta gttggacagt     21000
     catacgaaag accattctga atttaggcgg tgagataatg ggcgaacaga cctattctga     21060
     catacagcgt aaaaaaacct cgattataga ttctttaatc catttaggaa tctataaaaa     21120
     aggaaacaaa caactctatg aattaacctt acatgagtta gaaacagagt atcatatagt     21180
     taatccggaa atccaagaca tatcttttta agtttttact catcataatt catttgttaa     21240
     gaggagggtt aatctatgtt tttgaaaaaa ctaatcaaaa atggtttaat tacggttaag     21300
     tattatgaaa atgggtcatt acaaacgtat aaaggccgtg tttataatct taatctccat     21360
     gaacagaccc tgtctttaaa agatgaaaaa caaaatattt tctttattcg tttatccggt     21420
     attgaagata tttattagtt ttctttagtt ggtttaaaat tagtgaagaa ttttctctgt     21480
     tttttatgat aaatggtcac ttggtatcta taagagattt ctagttagga ggccataaag     21540
     atataaaagt gaaataaaaa agggggagga atgatgagag aaaacaaaca aatatggtct     21600
     gattttattg aggaggaccg atttgaacta cattcgtacc ttacctattt atttaaacaa     21660
     tgtcacgatg aaaacctaag acagttagaa gatgaaaata tagaagaata aacctataaa     21720
     taaagcaaac tggaaggata aaaaatgaaa atgaaaataa tgtagacgac cttatgattc     21780
     taatcggatg aataggtcgt ttattgctgt tatgaccctc ttttgatata tatttcatgc     21840
     atccaactat gtccataaat ttatacaagt acacttatgt gaaattcgtt ttttaactgt     21900
     ataaagatta gaaggaggaa tagtttgtga atacaactgt taatgagttg tatgattttg     21960
     gtacagtctt aaggagaaag ctattaaata ataatctcta tgctcattat ttgagtgatg     22020
     caatgagaag agaaaaccat tttgattttt tatattattt tttgacagca actgtagata     22080
     gtcaaacacc tatacctgaa catgtctctg ctgttttttt gaaggttctt agcgataaag     22140
     aaaagttaag tgatcttact ccatttatca tgggtctgat cggaaaataa acaaaagtaa     22200
     agatatataa acttcctcag atgtctaact ccctttatta aatgcagtca ttgttctttt     22260
     tgccttgtac ataaatattg gttctagtgc aaaataagtc agcttattaa ttaaatacga     22320
     gtattatcta ttttacgaat gattttcact cggaatggat ttatatattt ttgttcacga     22380
     tttgataaaa tttgagttct acaccagaac tctttgaatt gaaacatcca ctgaaaatcc     22440
     tttcaagcta tctataaaag agatttataa agatattcca cttttaaata cagctattta     22500
     tggtgataga gataatattc attagaaaaa gaatcgtctt attttgtaat gttttgatat     22560
     gttttgtaga aactattttc attttatctt ttcttattca tactagttct gttgtctcta     22620
     tttcataatc tacacgatac tttagagatt aacaaatact aatgaggtga gaagagacaa     22680
     tgttaacgaa agtcagcgaa ttaagtcaaa ggatttatct atcagagtgt attattaaca     22740
     agagaagaga attagtggat ttaggtatgg attacggact tttaaataaa aaaacaatcc     22800
     aatgtagcca agatctcgat caacttatca atttgtatat gcaaggttct aaaaaaacag     22860
     aatataagtt ttattatatt ttataatgtt cgtaaaaatg tatatgaagg aaagaaaatc     22920
     cggaccttat ttttaactta agatcatttt atataaataa ctgtttagaa agtctatctt     22980
     tactagagta gaaccacgaa caaatcttat ccaaccccca aaggactttt cctttttaga     23040
     atagaagaat atttttgtaa attcaaaagg gagctgtttt gatgtctaaa caagcagaag     23100
     ccataaaaga agtaaaactc ttaaatgctg aaattgattt gtgcaatcgg attaaaaact     23160
     tgttgaatca aggaaagcta agagatttac aactaaaaaa agaatataca gagtatgaaa     23220
     ttttacaaat tgctctgaat agattgatga atgagttaac ttttaggtat taaaaacaga     23280
     gagactttaa tatctaaaat aagttaacta ttatctatat tcacggcaat tttgtctttt     23340
     catcataatc atatagcata aatacagtta agaccgcctt atacactata gataagaggc     23400
     ggtctttgtt agtgatattc atctgaaata agattttcct acgctatttt ccctataata     23460
     aattattgtt tcttaatgtt attaaaataa tcttccaacg tttgtaatga gggagctgtt     23520
     ttgtagtaaa acgtaagttc tccattcgat attttatatt caggccaagg aataacttga     23580
     tataattcat acattgaatt tctagatcca gcaaatataa atttagttgt atcaggatga     23640
     gtaatagcta tataagctag tccactttta cgactgaaag cttggaaaac agagtattcc     23700
     ccttgaattc ctaggacagt taagtgagta gggtagtaga caacatcatt acaaggtgtt     23760
     ggtaatgcac ttaagttttt aactaaggta gttggagtta aaccttctgt taccattttt     23820
     atcacctctt atatagtaga taaactaatt attaatcaaa gaagagaatt ttacaaacta     23880
     aatattctat ttgtaataat tttcgaaaaa aagtttcatg aaataaattt tattgctaga     23940
     acagaggaat tacggtatga agatgaaatg taatgtattt ccatataaaa atgattagat     24000
     aaaataaagg taagttctct taaagtaatt aataattaaa cgtaagaagg aaacaaagaa     24060
     aaaatccttt gcttatatca gcaaaggatt ttcaagtatg acgaaggaat atgagaatac     24120
     ataatcagtc tgaccagatt tgaagattaa tatgcaaata aaaaatcaga gatacattct     24180
     gtaagttccc atactagggt agaaacctta tttttttacc aaaacgttcg taaaaggggg     24240
     tgttttttag cgatcgttcg taattaaatt ttaaacttaa acgaacaata aaaatgatag     24300
     atttcctact caaaagaaaa gttcgtaaat gtatactttt acggaaactg aatttgattt     24360
     tgtttcaaat tgttaaagga ataaagttaa ggattttctt ggaattgtta aaattatttt     24420
     aatgcgacta aaacaaaaaa ggaaactaac cctttagatg gattaattta ccttaaattc     24480
     gtttttaacc atattataac gtttcgttat aattattgga ttgtaatgga attgaaaaaa     24540
     ctatcttctt tcttttaact tacttttcac ttaaagcaag tcttttgtgt ttaccttact     24600
     aagatttagg aaagtcatat aggtacactg tatcaatcca ttccgtcctt atttattcta     24660
     atttctacgt gatattactt gaatgtaata aaaaaagtaa caagcttgat taagtagaac     24720
     tcttagaagc ataatttgtt cattaaatga aagttctcta ttttcaggga gaaaaacatc     24780
     aaatatattt atcgaatttg cagagaaacg ctctctaagg aatttaactt tgattttatt     24840
     aatcactaat cacttaatcc aaaattcagc actttaaaaa ctttcgtttt cctgctgtta     24900
     ttggttttta atgaaaatgg acaacttatt taacaaggat ggtgttctca gatgtctcat     24960
     ttttattaaa ctgatttttc ttgatttaaa tcaatttcat atttctttct aatcaaataa     25020
     atgattggag aacctataac tgttggaagt aaccagaaga ttaatggatt ataattattc     25080
     aaaataggta ttctatttac gtttactaca agaacagctg ttagaatagc aatataagag     25140
     ccaagtatgc tcccaatatg tatagcaacc cagtttttcc acttaaattt cccagctaaa     25200
     taacctaata aagctaagga ataagagaat attccaatat aaagcaaata tgaactactt     25260
     gaccaatgca ttactgccat gactattgta gttaaaaaaa caataataaa actaaagtga     25320
     tatatttccc ctaaatttgt atgaaatcct tttttctttg gagcaatcat ggctgcaaat     25380
     ccagttacga gacaaataac tcctactaga atatgtataa aaagaattat tctaaacata     25440
     gaacgtattt cctttccttt ttattagatt aaattatcta atcaacactt atgaatagct     25500
     attaaaaatc tgtataggtt tttacctata cagattttta tactattata tgaaatcccc     25560
     ctaagtacta aaagaacctg tttatactta gaaattaggg ttaactaatc tttgttcata     25620
     tagtgcttaa tctttttctc ttcccaattt tgaatattaa agaagttaaa aaatactagg     25680
     attaacatgt gcactaatac gcctataccc cacccaaaaa ttgacttagt tgcccataaa     25740
     tcgttgggtg attgaatcaa gtttacaatt aataaaaaaa cgttcaccaa tatgtaaaca     25800
     cataaatgga tataaaatcc ttttaaacgt ttcattttcc gaatagcatt ttgatatttt     25860
     acactatgat cattctccaa gagcagtaac ctccttattt ttaataactt ttgatttctt     25920
     actttttcta taaagtattg aaattaataa gcctataaaa ataaacggaa gagcatgacc     25980
     aaaaactata gaaaatacgc tagaaaattc ttttcttgta taagaggtca cattttctgt     26040
     ataaatttta atttctttat taactttgag aatatcttga ttaacttgat tggtcacttg     26100
     attagtgatt tgttctttta tcttttcttg ttcagctgca ggatattggg atagagtatc     26160
     tttaacgttc ttatcaatta aatcttgtcg ctctgatgca gaaactgtag gtgcttcaat     26220
     cacattagaa aaagttgaat cagtatcaat ctttttttca gtacttttta gaatttctaa     26280
     gcgtttctct ggggaaacgt caatattact agtttgttct ttagcgtaag aaattacatt     26340
     ttgttttttc gagtcaactt catgtgtaat tgaagaaaca aatatagcta ctgctaaaac     26400
     aacaccaatt tgacgtaaca ttgtaaacac actttgtgaa gaggtcaaca tctctccttc     26460
     aaaagaagaa acacttgcca tagtcgcagg agagataatg aaactaaacc caatccccaa     26520
     tgtcacacca attattatta tttctgatac tgtactggca gtgttaagat gctctaactg     26580
     gaaataagaa gctgcaacga ttatgtagcc aatcataatg gggattacat aaccaatttt     26640
     tttcactaag aatcccacaa aatttacaac aatgaaaata gtcgctgaaa taggggttat     26700
     caaaagtgct gcttgtattt ccgttttatc ttgaaaactt gttagaaatt gaggtagtaa     26760
     taccattaca ccaactaaaa ataagtatgc cgaggatact gctagagtag caccaacata     26820
     taatcgatct ttaaaaagat taaggtccac cattggatcc ttaatttttc tttctacgat     26880
     tatgaacatt attaaagaaa caataaatat gaagaaacaa cataatgatg tgaaacttgt     26940
     ccatccccat gtgttcccct taattaatac taaatttaag ttaaaaattc caatagcagc     27000
     taaaataaga cctgcccaat ctatttttgc tttaacacgc ttctccaatt tgaatgggag     27060
     aattataaaa gcaatgacta aagctactat acaaataggg atatttacaa agaagaccca     27120
     attccatcca agattttgag cgattaatcc acctatacta ggacctaaag ctgttgaaag     27180
     gccttgtgta gctcctaata aacttaagga aatatgtctt ttcttaagtg gtagagattc     27240
     tacaccaatg atagtagcta caggcactaa aatagaagct cctagacttt gacaaaatcg     27300
     tgcaaaaatt agcatttcac cattatcaga caagccacaa aaagctgatc cacatgcaaa     27360
     gataatgagg cctagaataa aaaatttcat tttcccataa atttcagcta atctacccat     27420
     aggaattgat agaacagcaa ttgtcatagt atatgtattt aacatccaag agctagtttc     27480
     taatgttgta tttaaatcgt tctgtatagc tggcaatgct atgttcatta tagtggtatc     27540
     taataaacaa atgaaaatac ctaaacacat tagtaagaga atgggaaaac tatttaagtt     27600
     tgattgtaat ttatgatcca tttcttcacc tactttcctc ttttttacaa aacacggaat     27660
     ataaatttac taaatcaacc atagtaaatt ctaactgttt ttctataaag ttacaatatc     27720
     aaaagagtta atattatgta ggcaagctcc agaataattt gggatgtgag ttaaactgac     27780
     aactacacgt ttaatttcat gagtctgata ccagagagag ggggcccccc aggtatcaga     27840
     cgcgataaaa atatttttca aattttcttt tggataacgt ttgccgtaag ctagttttac     27900
     tgcaagtctt gccccaatac gttcaatgaa tcttccattg gatgttgcat aatgtaaatc     27960
     ttttttgtga agaattttta ataaagaggc gttgtaatta tcccacatgt acttaacttt     28020
     tttattatct aaaataatta gttgaaattc ttcttgatgt tcataatgaa aaactaaatt     28080
     gtcccataaa tcttgtatct cagctttcat atcttcctac cacaacgcta gtataagtac     28140
     caccaaagtt tgcagaatta aaaagaaaat tattagcaga atgtagtttt tgattttctt     28200
     ttgcaaaatt caaattgtag ataggatttt tcacctttaa ccctggaatt ttatgattat     28260
     taaaagtttg cagagcagct acaatatgaa ggggcgtcat cccacttaag ttatatccgt     28320
     ttttattact caaagtagtt actggtatct ttgctcctcc taagtgacga atagcgttca     28380
     cttcggtaag atccatagat ctcaatcctc gagcatctga aaatattgca tcaatgtcat     28440
     caacagaaag ttcactttcc ttcaatgcgt cactcattgc ataagaatag gctttaccat     28500
     ttgggttatt tcctgcaagc ttgtaagcat cagacgtaat accatatcct ttaatttgac     28560
     cataaacact tgcttttcgt tctttagcat gtttttcaga ttcaaggaat aaagctgtac     28620
     ttccacaaga taaggccatt ccatcgctat ctctttcaaa tggataagga gcatttccta     28680
     aaacgccaag tctatcgtag ccagcatgta ttgtttcagt atattcgtct gcaacgacta     28740
     ctaaggcggc atcgattaat ccttcgttaa tcatatgata tgcatatgta attgattgac     28800
     ttcctgcaac atttcccgtg caaatagttg tagatggccc tttaatttgg aatgttgagc     28860
     agatatgccc tgctgctgca ttcattactg tgttaggaaa ttgactagga ttaactttct     28920
     ttactccgtc tactacaatt gttcggtgta tatcttcaac tgtttgaagt ggacctgaag     28980
     atgtgccata aattactgca atcttatcac tattatcgcg gtttatttta attcctgaat     29040
     cattaagtgc cattttagag ctagctaagg atagtttacc taataagtct aaacgtctaa     29100
     taagagatgg attaatatat tttaaatatt ttttttctga aactgatgct cctagctttc     29160
     caatatattt ctctttctca aaatcaatag ggtttattgc actattacct ttttcaattg     29220
     attcccaaag ctcatctttt cctataccaa ggggttgtac gcaaccaata ccagtgatta     29280
     aaactttctg ttttatccct gataacactt cagtctgttg tttctcttcc tcgtattttt     29340
     taaaaattag cgatgcatta tttcccccaa aagcgaatga attagaaagt acggtattaa     29400
     tagccattgg tctacttaca ttagggataa agtccatatt atatggatta ttagtaaagc     29460
     taattgttgg aggagcagtt tgtttcatta aggaaagtac acatgtgatt ccttctactg     29520
     cacctgcagc gcccaaagta tgtcctatca ttgatttagt actacttaca ggcacatttt     29580
     tatcagtatt tgaaaaaagg ttttttagtg ctgttgtttc tgctgagtca ttcgccctag     29640
     tacccgttcc atgcccattt acataatcta tatcttgaga ggttatatta gaacgttcca     29700
     aagccatttg catagattta aatgccccag ccccaccggg atttggtgca gtaggatgat     29760
     atgcatcact tgttaagcca aatccggtta ctaatgaaag tatttttccg cctctttctt     29820
     taacacgatc aagcctttca agaattaaaa ctccagctcc ttcggcgaga gtaattcctt     29880
     tgctctgtga ataaggggag caaggttcgt cagatagagc ttttaaacta ttaaatccag     29940
     ctagtgatag cattgataag gggtctgctc ctcctacaat tagcatatca gccttaccac     30000
     ttttgataag ttcaattcca tatcctattg cgttacttcc tgcagaacaa gctgtagaaa     30060
     tagcgacttt aggacccttt agattaaacc gcacacttag aaaatctgcc gcggtgtgaa     30120
     gagggtatga caataaaaga ttgggatctg tatgttcata gccttctcgt atccactgtt     30180
     tatgaaactt ttcaccgtta ggaattccac ctagagatgt tcccaagatg actccttgtt     30240
     taaaagtgtt ataaaagcct gctggaatat cggcttgctt cagggcttct gatgcagcta     30300
     aaaaagatag ctgtgtacat ctttctgtct cttcaatttc ttcctgagtc atcatcttct     30360
     cgggagagag gtttcttacc tctccagcat aattagttaa tagttcacta gaatctagct     30420
     gaaccatttc acgaatacca gttttccccg attgtatatt atcccaaaat tcatattggt     30480
     tgttccctaa tgcagataaa atacctattc ctgttactgc aattttcata gtaatcctcc     30540
     ttaaccaata cgaatcgata gactctttgg ataaatcatt gggcttgaaa ctgtatttat     30600
     agtcatatcg ttatctaatg tgaaagttaa accagaagct acatattttt catctaagta     30660
     agctactccg atacttccat taattcccgg tgagtacaag gtatgttgaa tataccctac     30720
     tttatttcca tcaactaata tatcttgatt tttagctact gctgattctg aagtaaaaca     30780
     aactagttcc tgacataaac ctgaagttaa accttctaag tttttatctt tcccaataaa     30840
     gtccttatta aaatcaagca tccaatttac accagattct actattaatt tattggaagt     30900
     agcctctttg gaaaggtccg gaaaacgaac ttctaatcta cagacatcat gagcatctaa     30960
     accaatttgt tggacattaa tttcagagag atcatatgca aataacgctt tccaaaaaag     31020
     gtctatccct gcttcatctc caaaaacctt atatccatat tctgctgtat atcctaatcg     31080
     agcaatgtat aggttgtgtc cttcaaaatg aaatggagca aagtttttat aaggaagaat     31140
     ttcgatagga aaaggcaata aagtttgcac tacttcccac gactttggtc cttctagctg     31200
     aatcatttga agctttccag ctaaattttc tatcaataca ccgtctttta tatgtgactg     31260
     taaataatct tcagcttttt ctgataaact tggttctatt tctagtaaat attcattttc     31320
     cattacataa acaattaatt ctgttactaa atgtccatct tcatctaaca ttaaacaagt     31380
     gacagtttgt tcctcagtta aataatctaa gtccttagta ataagctctt gtaaaaaaga     31440
     agaggcagaa tcaccactta cttttaggaa tgtgttaaag gaaaagtcta aaacggcaac     31500
     ttcctctcgg atagctttat attcttcctc caggctacta aaaacactag gaacattttg     31560
     attaccaact actttagtta tcacatttat agattcattt gcaggagatt ttctataagt     31620
     catttttatt catcctcttt tttaaaaatt ttacatcttt tcagatacac taattgaacc     31680
     ttctactaca gtttttccat ttacttcagc ccagacttgt acttgactta aaacacccat     31740
     tttcccaacc acctttgcac gtaagactag ctggtctcct ggtacgactt tatttttaaa     31800
     ttttatattt ttaacagctg ctaaatatcc tactcgatca gcatagttaa tatcgtttga     31860
     agtttcttgt gattctactt ctactaaagc ttttgaaaca taaattactg caatcaattg     31920
     cgccattgct tcaattataa gaacacctgg cataattgct tctcctggaa aatgaccttg     31980
     aaagaaaggt tcgtttgcgg tgacattttt aattgctaca ccactaactc ctggattcag     32040
     ttcattaact cgatctatta ataaaaatgg ataacgatga ggaatcatat tttttatctg     32100
     atcaagctct aaaggtaatt ttaatgattt cttttctaat aaattagtca tagattttca     32160
     ttcctttgag aggtaataaa atcagcaatt ttatttactg aaccaagaac atccatatta     32220
     tcgtctgtta gcataacatc aaagacttct tgaagagcaa ttgagatttc aagtgtatcg     32280
     atagaatcca actctaatcc tctaccaaat aaaggttgat tatcggcaat ccatgcaggt     32340
     tcgatattta gagaaagtct ttctacaatt tctgttttta tttgttggca aagttgcttg     32400
     cgttcattaa cttgttctaa taaatcattt tgagttattg ttgacataat attttcccct     32460
     ttaatatttt ttaagtagtt aatccaccat caaccactat gcattgaccc gttatgtagc     32520
     ttgctttagg tgaagctaaa aacccaattg tttcggctac ttcatttgct tcacctattc     32580
     gacctaacgg aatatgttga atataagaat ctaaagtatt ctgtggcata ttgtttgtca     32640
     taccagtatg tataaatcca ggtgctatgc agttaacacg gatattatag gaagctaatt     32700
     ctcgagataa tgtttttgtc atagcaatga ttccgccttt agaggcgcta taattagctt     32760
     gcccaggttg accttttaat ccactggttg aagaaacatt aataataacg ccttgttttt     32820
     ttgcagccat catcttggaa gcttctctta tacaaaagaa agtacctttt aaattaatat     32880
     ttagtacatc atcccagttt ttatctccca tcatcattaa ccaactatct cttgtaatcc     32940
     ctgcattact tactaaaatg tctagttgcc cccatttgtt ctttatagcc ttaaacattt     33000
     ctcttacaga actcacgttc gatacatcgg cacaaaaaaa gagtgtttga tcttctttgt     33060
     tagagaccat ttctttaagt tctttaatgt gatttccttc tttagaataa ttgataatga     33120
     cttttgcacc ttcatttaaa aaataaagtg cagttgctct tcctattcct ttactagcac     33180
     ctgtaactag gacgactttg tctttaaaca acaatttcta cctccctttc tagttgtttt     33240
     ttaaatctca gtaagtcact tctattccca atgtttgaga cattcaaatt tctgtgggat     33300
     gattttatta aactagataa aacacgtccc gggcctatct caaggactaa gtctggttgg     33360
     aaagactcaa ttgtctccat tgattttttc cataaaacag aagatatcat ttgctcttta     33420
     attaatgaaa aaatgttact tttattcaat tccgcctctc cacttacatt cattactatg     33480
     ggtgctaacg gtgcttgaaa tttcgtgaaa tctaaatagt gggaaaaatc tttatttgcc     33540
     tcgttcatta atacactatg aaaagctcca ctgactttta aagggatagc gcgagccttt     33600
     agcttattct caataacatt cttgaactct ttaatagatt catcagcacc actaataact     33660
     aattgattag cagaattgta attagcaatt tttatagtat tatgttgctc tttcacctca     33720
     tcgtgcaata atgaaaataa ttctttctca gggctcagta cggctaacat tccaccctta     33780
     gtcttattac aagcttcacc cattagggat cccctaactt taactagctc gaaacctgct     33840
     tcaaagctca gcatgccaga ggcaaccaga gcagaaaact ctcctaaact atgtcctcca     33900
     aataatatag gttttagaga atattctttt gaaataagtt catgtaaagt aacacttata     33960
     acaaaaatgt aaggttgaac tatttcagtt ttttcaatta ttttcatatt ttttggttgg     34020
     aaaaattcat ctagagttaa gttagctaat tctgctactt tctctaagcg ttgtgcgaac     34080
     aatggcagag aaataaggtc ttttcccata cccataactt gactaccttg acctgggaaa     34140
     atgactgcaa cctttttatt caatgttttc aactcctctc taatctaagc aattaaatgg     34200
     gtaacaatac aatctttaaa tactttatag gtccctttaa tagaattagt aggtagatct     34260
     acttgtttat atagagattc atcaaatgta actaacagtt catctttaga caagatatca     34320
     acctgaatgt cccttaaacg gaaatcttta ggtatttgtt ttatcatttt gatagcgcat     34380
     tctttagccg aaaataaaat ggcccactga tatgaatcat attttgctat ctcataatta     34440
     tttaagatac gtgaaacgaa aagttctcca cttcttgaga gggctaactt aaacctttca     34500
     atgtccacta agtcaatccc cacgctaatc atttataaat ctcaaaaaca cttaggaatt     34560
     tttctttttt ttcttttgga actttaacat ataatttatg agttatttta tcttttaaag     34620
     catgacggct tgttccctca gctagtaata gttttccctg tgattttaag atttggtatt     34680
     caaattgaaa cgtaaagccc attggagaag ccatttcagc tggagaagga tgtatcatac     34740
     gagttcgaat gattagttca tccccatatc gagctggttg acgatacttt gcggtggtgt     34800
     ccagggtgat tacatcaaat tcctctgtta agtattccaa ttcaaccttt tcagcaacgt     34860
     attctcttcc tagatcaaag taaagaaagt aatttccgta atatacaata ctttgagaat     34920
     ctacttctga ccatcttact cttgcctttg tttcaagcca tttcataatc ctttatcctt     34980
     tccaattctt tcttagatag accaaccacc atctattgaa atacaggaac ccgtaatgaa     35040
     ggaagcttgt ggcgatgcta aataagagac taacttagcc acttcttctg gctttccagt     35100
     tcttccaata ggagtgtgag ataatttcat tactaatttt gaagcccctt gaattttctt     35160
     tgtttcttga ctaaaggaac gaacaaaaga agtttgaata ggtcctggag agattgcatt     35220
     aactctaatt ttttttggtg ccaattcctt tgctagacat ttagttaatg tgacaagagc     35280
     cgatttcatt accgtataaa tcgctgcctt ctcctcatag gtttctccta gtacagagga     35340
     gatattgatt atacttggat ttttcgattc tagtaggtaa ttatatgctc tcttactgaa     35400
     tactaacgct gatttaagat ttatatgaaa tccaaaatcc caatcgtctt ctgaagtatc     35460
     taagagacct cctaacttca tagcacctac cccattaaac aaaaggtcta aatgtttttc     35520
     cttggaagag aatcgagaaa aaaaactatt aatatcgttc tcttttaaaa catcacatac     35580
     aataggtgtg atgttttttg ttttttcaaa atcttttatt gatttttcat ctttatctag     35640
     tgcatatact cggtaatcct gagaactcaa ttgaatagct gtagccctcc cgattccgga     35700
     tcctgcacca gtcactatag caacttccat aatacttaaa aacctccaaa ataaacgggt     35760
     aaaatctaat gggtaaaaaa ggcatagtta ctttttacca tctattttgg aaaaattcaa     35820
     ctgtttttcc ctttttttaa taaaaaaata ctttattttg gattttttac tattttacca     35880
     acacaaaatc tttacccttt agttcttatt cattataaac aaagtatttt ttagattaat     35940
     cccaaaacat gagggtaatt tatcacaaat aggtacaaat cacaggtcga aatggaaata     36000
     ggttcttcac aattaaatac aaaaaaatca aatttatttc atttctaaaa caacaactct     36060
     ataccgaaaa aagtatagaa agtggctact tataactaaa tgaggtacct aaatatgctg     36120
     ttttaggatg attattaaaa gttagatgga gagttttaaa atctatagtc aaccgtaatt     36180
     tgtatagttg ataattattt tatttgtata gtaattattc atagtaagtt aaagctaaat     36240
     ttaaaaggat attgtataga atcttgggat gttcttcata tataattgtt gtaattatac     36300
     tattaagtag ataagtagac ttaattaaga taaattttat aaattactaa catttttgat     36360
     tataaaaaga tattctatga atataaaatt aaaaaaagat actttaaaat aatgaaatag     36420
     gtagctttat ctttgacttt ataatcattt aaatataaat atcatagtaa acaagttata     36480
     aaatattttt tataaaagga gcatatttga ccttataagt agatgtataa aaggtgtact     36540
     ttttatacat cttttgcaag tcaactttga gggaaaagct tgataaatca acgatgtata     36600
     aaaagctgca tacattagaa atctatccta tgtgaaaccc cttgtgacat aaggggttct     36660
     ttttgagttg tgtaccggaa agagacatta tgttaactac aaatgtatat cttatacagc     36720
     ataaaaagag aaaaaacccc tgtcgttggt caggagtttt ttcagtaacg tatcaaggta     36780
     ttaaaaatga tacgtaacgt atcttgagta gtttgctctg gttacgattt tttaattcat     36840
     ttttttcgag gaatgcgaaa tgcattctct gatttttcaa atccaatatg aggataataa     36900
     tccattgcta ctgaagaagc taataatatt aatgcaactt cttctcctat tatatcctgt     36960
     aaacgttgaa cgagttcctt accaattcct ttattttgat agtctttatg aatagctaaa     37020
     tcagataagt agcagcaata actataatca gtaatggccc tagcaattcc tatgagctgt     37080
     tggttattcc atgctgtaag attgatatct gagtttttaa tcatacgctc aattcgctct     37140
     aattcattaa caggtctttt aataccagat gatttaaaga tatctgctac ttcttttgca     37200
     cttattgaag cattaacttt atattcaatt accatatgta ttccaccttc aattctttgt     37260
     agttgttatt tttttaatct aatttgagta taaaaagaaa ctgaaactct taacagttcc     37320
     agtttttata taatttatag tgtcagtctt cgagggattg cttccgaaat ctgtgattat     37380
     ggtgactaaa taaggcctga ttttattgta gatgcctcat gtatttttaa gatctgaagc     37440
     ctttaaaaga agtagtacac taaataatac aatcacgata ccagcacata agagaataaa     37500
     tttaatatcg acattaatgc taagaagagt ggaaactaac ccataagaaa ctggaataag     37560
     tcccatggaa accattgtat ttacactcat aactcgacct actatggttg agggtgtttt     37620
     ctcctgtatt aaactaacta tgagaatatt aatacttgat acacaacatc caatagctaa     37680
     caaaatagca gcagcaagcc agagattaat tccttggcta aatatcataa gtaataaccc     37740
     ttccaagaat atgaaagaaa ttgcaagttt tcctctattc ctttttatgt tcaaccagcc     37800
     catgactata gctcctaaca acatgccact agcaaacgaa ctttggaaaa tacttaagta     37860
     aaaagcattt cctttaaaac gatcctctgc aaggataggg atgcttaaca tgagaggtcc     37920
     aataaagaat aagttgacaa taataaatgt caccatgact gtcagaagaa acgaagaatc     37980
     tttaacataa ttaattcctt cagctaaatc ccttaagata gatgttttct tgggccttaa     38040
     tgtcttcttt tctttgatga attgtaacaa gattatgctt atcaaaagtg taaaggcaat     38100
     tatcagaaag atggttgaat atgagaaaag tgaaaggaga gtagcaccta agacagggcc     38160
     aaacatgaca gaaagctgat tcgttgtttg tattactgaa ttcgctctga ctagttgctc     38220
     tttatgaaca atccctggaa caattgaatc tctagctgac caaaaaaagg catcagatgc     38280
     tccaaataat aaagcaaata taaataaaac ggaaagagat aataaattat ttgtatagaa     38340
     taaagccatc agaagtagca taaaacacct agttagtaat gaaaagaata taactttaga     38400
     tcgtctgtat ttatctgata caacgcctcc tataaccatt aataatactc taggaatcgt     38460
     agtcgccatt aaaataattc ctaaagagct cttcaagttt aggtaattga ctacatacca     38520
     ctgctcaata gttaaataca ttgaaataga aaggcttgaa aatatacttg ctacccatag     38580
     ataaataaac tttcctttcc aaatacctgt tcgtacttta gcctctttag ttattggaat     38640
     cacattttca cctcattctt attaaaaata acagcaacct aattagatga atatcgaatt     38700
     agatggattg aaaaatgaac gaagaaacgt tcattttaaa aggtaacagg ccacatctct     38760
     tttgggttta attcatattc tccgttttgc ctatacatga agtgttgcat aattaattct     38820
     ctacgaatag tcgcataatc ttcatgatag ttttttatat attcattaag atccttttct     38880
     ttatacattt ttccttgatg taaatcacgt attaaatacg ctaatataac gttctttttc     38940
     tttctttgac ttgggatttg tttcaacgtc ccgtcactat ttataaaact tttaataata     39000
     gataacttat ctttatcatt gattttacta tcttggttct ccatagactc ctccccaata     39060
     tttaagatag cttttgaatt atattctagc ctttcagtat cgagataaaa ataaataata     39120
     ttcccttgtc ttctttgata aactaaccct acatctctta attttgaaat atgatgagta     39180
     atggttgacg gttgtaaccc gagtttataa gcaattgctt gcccatgaag atgacctttt     39240
     tttaacaagg aaataattct aattcttgtg gggtccccaa ctgccttata gtaattgact     39300
     aacttatcta gttgcataat ttaatacctt cttcctctaa ttcgatatac atctaattag     39360
     ataataatcg aattagatgt gcttgtcaaa aagtacccgg ttaatgactt cttataattt     39420
     tgattatgtt gactagaaat tactgttctc tgtatataaa atgtacgtaa ctaagtatat     39480
     tcaaaggaga tgtctcgttt tgttggatta tatatggatc gatggggatt tacctatttt     39540
     gtcccaatta cctaatgact ttaattctgc tgctattcta ttccaccctt ttattcaaat     39600
     gccctctggt tgggagaaat caaagaggga aaatccttat cagcatatat atcctagtga     39660
     tgaggaaatg cttaaacttg gagaaccaat atcatggaaa gaagtaatgg tcaaaagtaa     39720
     tttaaaatcc tacaaagaac tattcagggt gttgcaatac cttactggtg cgcctagtga     39780
     tgaatataaa aagttagctt cctatgttaa gtctaatcct gatttttatt atcccgaaga     39840
     agatcgtaca tcgttgttta tactaaatag tttagtaaag atcctctgtt caaagggggc     39900
     aaatacttta tatttttctg aacctattca cgacacaaac ggttcattta aagtcaatga     39960
     tatgtcatct ttagaaatag ctaacttatc tcctaacgag tcaattatca cagatgaaaa     40020
     tatggatttt gcatttatgg ggatctatga ttcgtttata acattgcttt tagcaaaaga     40080
     tacaaatatt gaggatacaa ttaaatccct aaaccttgaa gctttcatat gtgataaaga     40140
     gacatatttt aattcattta tttaataggt accaataaaa tccattatgg taactacctt     40200
     tgtatagcgt atacaaggtg aaacaaaatc aattttttga taaaatggaa atatattgat     40260
     tcttaaaatt aaaatagcaa aaagagagga ttatataaat gcttggggaa acctttacac     40320
     tttttagacc gatttattat ttgataacta tctttttagt atgtaatttt gtgtacgtag     40380
     tttttttaag caataaaatc aaagctaata gctatatatt attcaactct ttattctttg     40440
     taataattgg agcgatgcta ttatttcaac aagggataat tgtagatgaa actaatcaat     40500
     caggagatcc agtaattttt gatttaacga tcttatttgg agttttattt atagctagct     40560
     ttatctttag gaatataaaa aagaggaaag tctaaacttt cctctttttt gcgttattgc     40620
     cgataatacg ttttatgtta agtaaattta attctctcac atcttataat tggacaatat     40680
     attcttagga taggacaaaa atgcctcttt tgcttatgtt acaatcatta aagtctaaag     40740
     ggataaattg aagtttcata caatgtatct cgaaataata aaagtatagg tgataatgat     40800
     ggcaacaatc gatgattttt tcaaattaga tattcgtatt ggtactgtag taaaagccga     40860
     accatttcca gaagcaagga aacccgcaat aaaactagaa atagactttg gagaacttgg     40920
     agttaaatgt tcttcagctc agattacacg acgttataag ccagaacaat tgattggatc     40980
     tcaagtagtt gccgtggtga attttcctcc tatgcgtatt gctggtttta aatctgaggt     41040
     actagttatg gggggtattc cagaagaggg cgatgtagtg ctattaaagc ctagtgagtt     41100
     tgttaaaaat ggtacaccca ttgcttaata atgttgtcat ttgtaagtct tttaaaatag     41160
     acattcccgt atacgtgtag gaatatacca tactggaaaa atacgtatat aaaggactct     41220
     gtcttttatt ttaaaaaggt ttaagctaaa atcaaattat atatattcat gatactagat     41280
     taaatttgag gtgaaataaa tgtttttagc tccattattt gaaaatgatg taccagtagc     41340
     gcttctccgt ccttaatgga gtaaagtgac tacttctctc cgttagggca tacattgacc     41400
     taatttttaa atacggaggg tacaaaaaat gaaaaacacc ttattaggtt ctatatattt     41460
     agctttagct gccagtattt ggggtggcat gtacgttgtc gttaaagttg ttgtagcagt     41520
     tatcccacca ttagaattgg tttggataag atatgtaatt gctattcttg cactttttat     41580
     catcggtttg ataaagagac aatcttggag aattaataaa cgccatatcc ctttgattgt     41640
     cgctattggc gtaattggta atgccatctc aattgtcacc caggaatatg gcacaatgct     41700
     atcttcagca caaatggggg caattattac atcatccaca ccagctttta tggttatttt     41760
     tgctcggtta atccttaaag agagactgaa tatgaaaaaa gggatatctg ttggcttggc     41820
     tacaataggt gtattactaa ttgtcggaaa tggacacata aatatgtcta gccagcttgg     41880
     tggtctttca ctacttatgg cggctttaac atgggctcta atgtctattc ttataaagcg     41940
     tgtgccaagc agttattctc cagtcgtcat tacaacttat tctattttag ttgctatttt     42000
     ggtactaact ccttttgtgt acaaagggtt aggggaaatt catatctcca agttgattga     42060
     cccgactatt ggaggagggc tattatattt aggtattgtt tcaacagctt tggcatttat     42120
     actttggaat cgtggattac agttattgaa tgcttcaagt ggaggtttat ttttcttttt     42180
     tcaacctcta gtaggaacgt tacttggctg gcttctccta ggagaaagta tcggtggaac     42240
     gttttggata ggttcattct taattcttag tggtgtttta ttagttatca aagaaaaaac     42300
     taactaattt ataattaaaa taaatataaa aaagcactag tcttgaacta gtgctttttt     42360
     atttatgccg ttaacttaca ttacgttaag taaacaataa agtatctcgt taaattgatt     42420
     agttttatca tttactctat atgacgacaa atagacaatt ttacttctta tggtatacca     42480
     atatatcttc tccttgcctt ttaagaaatt gttatattaa aggcaaccaa acagaaaaat     42540
     tccaaacatt taatattatt atatttttaa caacatatat ttaaataaaa atacaaaaat     42600
     aatgtctttt atacaaaaaa gtaaatatat aaacaaactt ataaaaatta aagttttact     42660
     atttacttta cctgacgaca aatatggact ttttctacat actattcaaa tattaatgta     42720
     ttaataacat aagtatttta tctttaactt caatgtgtag gtctttcatc agtttttctc     42780
     tttactcttt atataattaa taaacctttc tctttaaaga atagttttat taaacgtggc     42840
     gttttggact ataatatgac cttcatattc atctgtcatt tatttagcaa tagactcttc     42900
     gttaatggga aatgttacaa atcctttatt gtatatgtaa tagttaaaac taaacttaat     42960
     caatgcattt aattttacta ctaaaaatac aggtttatca gaactgatag agggtaaaaa     43020
     aataaaaatt ctaataaaat agggatgttt agtagaatgc agtaaaattt actttttctc     43080
     gccttgctct ttcaacaata gaggctgaag ttacttctta tctctctaaa gaacaaagcg     43140
     aattatgagg tattataaga attcattcga tttatgaagt tagctactcc atataaggca     43200
     ttgaaacaga gtataacttc attccctgtt taatatcata aggaatgaaa cttgaattat     43260
     taaactgtat gtgtattact gaaaatatta tttcgcctaa gtatcaatat aattctggag     43320
     gctgatgatc atgccaaata ttcaagtagt agaaaagagc agtcatgcca agatagcaat     43380
     tgacgaattc ttacgtgcag gctttaatac agatgaaatt catttgctta cttgcaactc     43440
     agctaataca atcaatagtt atgaaaatga attgtgtagc actaatttcg taaatccaga     43500
     tacaaatata ttacaagtgg atgaagatgt attcttttct aagatgcaat ctttcggaat     43560
     atctaagaga gatgctgaac gatataaaga aagcatggac aaagggtcta taatggtcat     43620
     tgtatctaaa gcagtttgat aggttttagt gcaaaatatt aaaacaattt tacgtatttt     43680
     tgaaacaaaa ataggaataa aaaaagttca aaagagattt tttttaatac cttctgaact     43740
     tttaacctta ttcaataaaa cacttttgtt catttgtctc tataaggaat tttaaaaagt     43800
     ttgtcgctct aaaagtattt gcttttagag cgactatttt atttcctgct atattcaatt     43860
     aataaatcgc tttttaaaat ggcctttata atttattttg aaagaacgtt ctacttctcc     43920
     ggtactttta atacttcctc ttattagaaa tataagctac ttctttatat tttctaatgc     43980
     tctataagcg tttgcttctc ccgaaccaaa taaagcatct tgtccctttt tcccataatc     44040
     aaaagccgtt tgcttaatac gtgctgttat ttgggcaggt ttatactcag gatgagcagc     44100
     cttaataact cctgcaattc cagctacttg aggagtggcc atggaagtac cggcattcaa     44160
     ctcatatgaa gtgcctaaat aagtaggcca cgtactcaga attaagttgc tcggatcagc     44220
     tgctgcagga tcattggttt cggcatattt ctggccataa tctcctcctg gagctgctac     44280
     gtcaatagca ctgtttccat aattagagta gaaagcaagc tgctgagtgg accattttgt     44340
     ggaggcagat acattaataa ctcctggcat ttgtgctggt actacagttg caggtccttt     44400
     cacgctcatt ccatatggtt catacatttt atttaaaaat tcgtttactt ccttcttgtc     44460
     atctaaattt aaactttcat taccactacc agctactaca gttactccat tctttactgc     44520
     atattgaatt gctctcttcc aaagtaacgt ttcagcgact gacttatagc tttctccctc     44580
     aattgtcatt ttggtattat tatagaaacg aagagacata ttaataacat caaccttgtc     44640
     atttgttgct gcaataattc catctataat ccaagcaggt aatccaagcg cttgctccga     44700
     gtaaaatacg cgataagatc gtattcctag ctctggtcct acacctttta ctttaccatt     44760
     tgctccaata atcccagcaa catgtgtacc gtgaccattg cgatctttta tatcagtagg     44820
     atcgcctgtt tccgattcat ccattcccgc aggaacaaga ttacgccccc ctattatatt     44880
     attctttaag tcaggatgag actcatcaat tccagtatca atcactccca ccactgcttt     44940
     atgagtaata ctaccatctt tatttttata tccgcctgtt tctaaatcat atgatttccc     45000
     gttgttggtt accctttgaa tatcccattg agagtcccaa taactttctg aattttgctg     45060
     gctgatgata ctagactcat agttgtaagg gctaactgct gttttgtcta aggatagggg     45120
     aatttctcta ttagcagctt ctattgaaga gttacctttt aggtttttaa gaaaagaagg     45180
     ctgatcagat tgagcttcta ttcctccaac ttcaggaaga actttagtta ctttaccacc     45240
     agctttctgt attacctctt gataattttc tggtaatcga cttttaaaag ctattgcgta     45300
     tgtgttattc atttcctgat ttttactctt agcttgggta ggaacaccac caacggaaag     45360
     gatccctact cctactgtaa tcgaaagcac cgtatgtaga attttctttt tcatatgtct     45420
     cctcctatat atggaatata ttaatcactc tatatcttaa tatataacaa actaaattcc     45480
     aagtttttct aattaatctc aaattattca aataagtaat aaataactag atgcttcttc     45540
     ttttttatta tgtatttcga gaaactacat tatgtcaatt tgattcacga ttatgtaaca     45600
     tatatattga aaaatgtaat atatatgtta caattaaatt atggaaggaa ttggtgtata     45660
     ttgaaaaaca atgtaaaaac atttcgtgta caggctgatt tgactcagca tcaattggct     45720
     gaaaaagttg gagttactcg tcaaacaata agtttaattg aaaagggaaa atacaatcct     45780
     accttaaaat tgtgcttaga gatttgttat gtagtcaaca gaactttaga tgaaattttt     45840
     tggatagacc aggaggagaa taaatgaagg taataagaga tgaaaggctc gttattaaaa     45900
     atttaaagaa tattcggatc gcttttgctt tccaaacctt ggctatggcg ggaattttaa     45960
     tatatgacgg aattactaga ggttttaata atgttaccga taaccctttg tggttagttt     46020
     taatactaac tagtgttata ttaggatatt tgaatttagg tatttctgtt gattcatatg     46080
     aaagtgagaa acaacttaga aaaacacctt actatttaat agttataggt tgtttgacta     46140
     taggaattat ttttggcctt ctaacaaaga taacgtctaa tagcagtgtt caagatagta     46200
     caataattgg actagttata tttttatgtt ttttaggaac tttttcattt tggcattttc     46260
     taataaaaaa acgttccaaa gatgaagacg aataagttta taaaaaattc ctagaaccag     46320
     ccttatggtg cgacaagaaa ttgtcacgtg cggttcttag gggagttagg ggcagcaacg     46380
     cccctcgctt acccgactaa actagaaaca tatatacata gtgattcaaa tcaatattat     46440
     tgataaaatg gaaaaatgaa ggtaatagtg gaggtttaat atgtatatat ggagtaatag     46500
     tgagggagcc ataagccttt tatattcgag gccagtattt atatttttta ttgttgtatt     46560
     ggctgctttg tttatcataa ttttaatgca aaataagaag caattagtta ctggcttgca     46620
     cgtaatcact ataataatca ttagtttatt catttcaggc ttaatccttt tcttagaagg     46680
     aataattgta gatgatctta atttatcaga agatactatt tcgtcttata tgtttttaat     46740
     aatagtggct ttatgtgtta ttaattcagt aacgtattct ttcaaaaata aaaaacttca     46800
     ataaaggtaa aaagaagtcg catttagagg gcttcttttt tatttgctac ctagaacatg     46860
     aattatggta actagaaacg aatatgatat acggaacttt ttaaagaata attgtgttaa     46920
     tatggtacaa aaaggaattt tgaaaggctg atagataatg atgattggtg ttcctttact     46980
     tattgcaata ataccaggtg taattgtatt attattaact tggctattta ggcgtatgaa     47040
     gtggggcata actgttagaa tgattcctgc aattttaacg gttatagctg caatcgttct     47100
     tttttatatt ggttatgtag aagtacgagg ttttgaaggt gctgcttatt tgttcttatc     47160
     agtatttcta atactctttg ctatcatatc ctttgtaatg gcgaaaaaac ctttaagata     47220
     atatattctt aaaggttttt ttgtgccgat aacgctgatt atgttaatta ataaccaata     47280
     ttgtgttact tttctccaag aatatttatg ataaaatggt ataattgtcc atgtaatcta     47340
     ttttaggagg attaatttgc agaatcgttt tagtaagtac tcattatggc tgtcaatagc     47400
     agggattatt attgccattg gtcaatattt cactccctta tataatttaa atattttata     47460
     tataggtatt gtaatctatc ttataggttt cgtatgtggg gttatagcag ttggaaagca     47520
     tgaaaaagga cttatgaagt atttcagtct atactctttt gtattaattc cagtttttat     47580
     cttctttggt ttcttatttt tagcttttca aataggtgaa aaataaccaa actttttatg     47640
     tccgataacg cacatgttat cttagaacag gggtactttt cggaatggga gagtaccctc     47700
     tttattttag gttccggaaa tactcattat gttaactaaa tgtatactag gtaaaccgtg     47760
     gtataagagt gggcggcaaa taaaaaagag aaatgaaaac ttctcttttt accctagaat     47820
     ataattaatg taaattatct ttactcttcc cactttatta ggttggggtt ttcgtccaat     47880
     atggattcgt attgctcctt cgttccatat tgggcatggg gatcaagggt taaatatctt     47940
     ttgtattttt ctaaacgata ctctagtttt gaccacccat aatgtttaac tcttaagtcg     48000
     gagatgctat tcggtaattg aaatatattg ttagggaatc tcccacagtg ctgaggagtt     48060
     tcttgccagg tataggagaa atcatttcga tatctaacaa gaaacggtcg atagtaaaaa     48120
     tgtgattgcc aatagtcatc ctcacggtaa tgggtatcat tccaaaaatc atagagtcta     48180
     aaagaataaa gatcatagtc cctttgagtg agaagctgct gtatgtctcg atcaaatttg     48240
     tcctcaaata tctcatccgc atccatattt aaaatccaat taggttctgt attgactgtt     48300
     tcctcccatt gttgtttacg aagctctact tcattagaga attttgagac ttcatttcgt     48360
     ataattttgt aaggtactgt ttttaaaact tctttacaaa cttcaaccga attgtcagta     48420
     ctaccgtcgt cgataattac aacatcgtca atataaggaa cgtagcttct caaaacttct     48480
     tttagaaaac gattttcttc atttttaatt accatagaca aggtgagttt tgttttttta     48540
     gtagtaggta cataaatatt tgattgaatt gttttctgtc tagctgttat ttttttaata     48600
     aactcttgcc cctcttttat gttcgtatca cgataaatat gataggcagg ataacgtgta     48660
     tctacatata gggaaaggcc cattgcggct gcacgtatgc aaaaatgacg gtcttctccc     48720
     caaaatgtta aattaggtat tttattaaag ttgactcctt tttgaagagc attctgtgaa     48780
     atgagggtac aggcaccaag tcctcctact tcataaactc caggagttct cactttagct     48840
     ataaattcct ggtaacgaac ttttatttgt tcagtagata aatcctcccc tggctgtttg     48900
     tgatattggg tatattcatc gtaaagccag acttggggtt gctccatcga atctggctgc     48960
     caccttgtcc aaaatacctc agagataata tctttttctt gctgaaccaa atgaacaatt     49020
     gtctcaggaa atagtaaaag gtccgagtcc accaaaaata aataatcata atttttttcc     49080
     tttgcatatt gaatgattga atttttaaaa ccagctactt tccaaacgag atgttcattc     49140
     cagtggtgtg tttgaccatc tcgtgaataa acatcttgat agtctgattt ttcgacaatt     49200
     actgattgaa tacattcttg aaattgtata agaagacgac ttgaatctac attttcgtta     49260
     tcatctatga aataaaaatc tactatcatt tcttcttttt tgaggtgttt taaagattct     49320
     aagaataatg ttaaaatctc tggcttttga tgaataggac ttgcaactaa tatccttttt     49380
     ttatgtttca tttcctacac caactttttc tatcggaatt tttgtttcta aatatccctt     49440
     attatgaagg tatttaggat cgttgggtct ataagtacct gctaattcat tatgatgatt     49500
     tgccttttca taatctccta aagcatcata acaaacacaa agctgaatat gaggaatcca     49560
     tgtggaataa gcttgatttt gaattcctaa attatccgat gtaactcctg ttttcgttgc     49620
     tgaaccatac caaaaaacag cagattggta atcatttttt tcaataaaat aatgagccaa     49680
     tcggcaacaa atttcaggtc taggagcagt ataagtaaaa gatcgtagta gagatttaat     49740
     cattctttct ttatcaaaaa tttcaagata acaatcggcc aaatttctac atgctgcaat     49800
     attatcttca atccatcctt tttccgttga aagaaatttt tcataaaact caattgctct     49860
     tttaaattgt cgatgatctt ttaattcatt tgcaaaataa tataaatctc ttggagaaaa     49920
     atcttcacca gtaagtagct ttttttcata gatttttaaa ttacggtcag agtcgtggtg     49980
     aatactttta tgggttacgg caacttcgct attcataata tttccccata cttcaaggta     50040
     ttcgtggaca gccccaatcc aacggaagcc attccttctt tttactaatc ggtttctcct     50100
     taaacttgag gtaacgttac catattcatc agtagctaaa atatatttca tcgttactga     50160
     gtcgacagag gattctaggt tcagttttag tgccagcaat ttctgttgat cttcctctag     50220
     gaaaacatca tccgcatcta accataaaat ataatccttt gtggctttct caaacgcgta     50280
     gttacgggcc tttgaaaagt catgaaccca ttcaaaatca taaattcgat tcgtatattt     50340
     actcgcaatt ttttttgttt gatcattcga acctgtatca atgatattta tttcatcaac     50400
     taattggtaa atactctcta agcatcgtcc aatcgaatcc tcttcatttt ttacaatcat     50460
     acataaacta atagaaacca taacttgtcc ctcctataaa tttttgatac atgtgtggtt     50520
     atcatccatt tttatgaata gaaaaactgg acgcctcgtt ataaagcaat atggaattta     50580
     tccaatcatg ggttagagta tcagtatatg tggagtaaag agtgaaaaaa atttaaaatt     50640
     atcattttct catagctcat cttatgtatg ttttactaag atattaacct taaatttcgt     50700
     tatatgaata gttagtaaaa aaggatgctt ttgtatattt acaataattc tattgaaata     50760
     cttgtaaaac atttgtgatt ttagtcatat ttatatcctt gtaaggcatt tttaaaagta     50820
     ggaggtacta tagaacgaaa atggatggat tcctaaaaag tcatttaatg aaacggagga     50880
     aaaataattg aatgtctatt caaaacctga tcgttaatgg aggatttgaa acaggaacgc     50940
     tttcatcgtg gttaattgct aatacagtaa ttaccagtga atattcgcat tctggatttt     51000
     attcagcgag attacaagga ggggcaacct tctcttatat ttcgcaattt gtcccaattg     51060
     agccagggga gagattagag attttggcct ctttagctac ggtaggacag gcacctgcca     51120
     ttttcattac tatccaagta ttttactatg ataatcagtc taatttgctt gaaaatggac     51180
     ttctcgtaac agttccaggt aatcaaattc ctaatgtaga gaatcatacg tggctagaaa     51240
     actatcatac tacaaccgca gctccaccag gttccacaca agcattcatt gttattaata     51300
     ctcttccgca agtagagacc tcagatgttt tagtggatga tgtggccgta ttagttgtaa     51360
     ataacaatgg agccataggg gcaacaggag ctactggagc aacgggagct accggagcca     51420
     ctggaatcac tggagctacc ggagtcacgg gagctactgg aattactgga attaccggag     51480
     tcactggggc tactggagca acgggagcta ccggagtcac tggagctact ggagctactg     51540
     gaattactgg aattactgga attactggaa ttactggaat taccggagtc actggagcta     51600
     ctggaattac tggaattact ggaattaccg gagtcactgg ggctactgga gcaacgggag     51660
     ctaccggagt cactggagcc actggaatca ctggagctac cggagttacc ggagtcacgg     51720
     gagttactgg aatcactgga gtcactggag tgactggagt taccggagtc acgggagcta     51780
     ccggaatcac tggagttact ggagaaactg gagttactgg agaaacggga gctaccggag     51840
     tcactggaat cactggagct actggaatca ctggagtgac gggaatcact ggagctaccg     51900
     gagtcactgg agtgactgga gttaccggag tcacgggagc taccggaatc actggagtta     51960
     ctggagaaac tggagttact ggagaaacgg gagctaccgg agtcactgga atcactggag     52020
     ctactggaat cactggagtg acgggaatca ctggagctac cggagtcacg ggagctaccg     52080
     gagttactgg aattaccgga gttactggaa ttaccggagt tactggagtg actggagtta     52140
     ccggaatcac tggagtgaca ggagccactg gagctaccgg aatcactgga gctactggag     52200
     ctaccggaat taccggagtt actggaatta ccggagttac tggagtgact ggagttaccg     52260
     gaatcactgg agtgacagga gccactggag ctaccggaat cactggagct actggagcta     52320
     ccggaatcac tggagttact ggagctaccg gaatcactgg agctaccggg atcactggag     52380
     ctaccggagt cactggagtt actggagtta ccggagtcac gggagctacc ggagctaccg     52440
     gaatcactgg agctaccggg atcactggag ctaccggagt cactggagct actggagtta     52500
     ccggagtcac gggagctacc ggagctaccg gagttaccgg aatcactgga gtcactggag     52560
     tcacgggagc taccggagtt actggagtta ctggagtcac tggagtcact ggagctaccg     52620
     gagttactgg agttactgga attactggaa ttaccggagt gactggagtt accggaatca     52680
     ctggagtgac aggagccact ggagctactg gagtcactgg agctactgga gttaccggag     52740
     tcacgggagc taccggagct accggagtta ccggaatcac tggagttact ggagctaccg     52800
     gagtcacggg agctaccgga atcactggag ctaccggaat cactggagct actggagcta     52860
     ccggaatcac tggagttact ggagctaccg gagtcacggg agctaccgga atcactggag     52920
     ctaccggagt cactggggct actggagcta ccggaatcac tggagtgaca ggagccactg     52980
     gagctaccgg agttactgga gttactggaa tcactggagt cactggagtt actggaatta     53040
     ccggagttac tggagtgact ggagttaccg gaatcactgg agtgacagga gccactggag     53100
     ctaccggagt tactggagtt actggaatca ctggagtcac tggagttact ggaattaccg     53160
     gagttactgg agtgactgga gttaccggaa tcactggagt gacaggagcc actggagcta     53220
     ccggaatcac tggagctact ggagctactg gagctaccgg aatcactgga gtgactggag     53280
     ctaccggaat cactggagtg actggagtca ctggggctac tggggctact ggggctaccg     53340
     gtccaactgc tagttcacca actttagctt tttctgaggc acctggaaca atagctatct     53400
     ttccaccttt aaacactgaa gtaacagttg caagtgttac tcaaaacgtt ctgattaacc     53460
     agcagcttaa aattgattat gctttagccg ttgaaataat tactacggcg aactggtcaa     53520
     ttgtattcga aatgcggtta tatagagata caacgctaat tgataccaga atattcaata     53580
     gaagtgcgac acaggcaggt actcaaagat ttccattagc cagtacgcag gtaaatatag     53640
     ctcctactac cacgacttct acgtacagtg tcagaatcat tgttacagca gctacaagca     53700
     ttacttcagc tactgcgatt aatcgtgatt taaacattat aacatttaca ccataacata     53760
     cttgtgattg ttactttgga taatctctaa ggatccctct tgggttaaaa atgtatattc     53820
     gagatagtta tcacgtagat gtattagaaa agaacagtga aaaattagtt tatgatcaag     53880
     agctatattc taagtattac tctgtcatcg aaaagcttta taaaataaaa tttcaaaatt     53940
     ggatacaaga tcagaagaga acttgttatt gtaggtaaat attaaattaa ctgaagattt     54000
     actttagtgg gggatgtggt gaccttgtaa aaactcatat aaataaaatg tattgtccgt     54060
     gttagggata cagagatctt aattcctttt ggggaagagc aaaaaagaac tcctctgggc     54120
     agcaggggga gttctttttc cttttatata gcaagatata aattaagaga gtaaacctgc     54180
     ataaaagcag ttacaaaggt aaagaagagc taactataag gattatcttc ctttcaatat     54240
     atataaatat taacgtttgc tgttcatcaa taatgaaagt gattgttttt gagggggtaa     54300
     atttatgggt gatataagtg aaggaaaatt tagctatgtt gactattggg aagagaatta     54360
     ttcgaatgga ggaacttctg gaaagggttc ctatggagtt ctagcacagt ttaagggaga     54420
     tgtaattaat cagtttataa aagggaaacg aattcataag gttattgaat ttggatgcgg     54480
     tgatggaaac caattgaaat atatgaatta ccctagctac ttgggtatgg atatttcacc     54540
     gacatctata gatatatgct caaagatgtt cggaaaagat aaaacaaaaa gttttctcct     54600
     atataatcct aaatatttta tcaataatgg atatttcaaa agcgatttag tagtgtgttt     54660
     agatgtttta tatcatatta caaatgagga tgatttctgg aaaaccttag atgatatttt     54720
     ttcttgcaaa cccttttata ttattttgta tacgagggtt actaaaccgg aagagtttgt     54780
     gtatggtatt ccaacgatcc aggatcggga tatcttaagt tgcctatcta gataccaaga     54840
     ctataagctt atccaaatta ttgagcaaaa atataaagaa ttgtcgggag caagttttat     54900
     tatcttagaa aaagtttagt aacattattt atcctcagat aaaggaggaa aactatgagt     54960
     atattcactt caaggtttat tcttaaaact gatccgtatt caaaacattt tgtctttaac     55020
     ttgccaaaga cctgggagac tagacctcat gaatatgaat gggcaaagaa ttttgctgaa     55080
     actgaggata ttgtgttaga tgcagcttgt ggactttctc acccattgaa attttattta     55140
     gccggcaagt gcaaagaagt atatgcttgt gatattgacg ctagaattct atctaaatcc     55200
     tctatcctta aggatattag agatacttat ggaaccataa ttgaaaattc ttttttaaat     55260
     cattatttcc accacattca tttttgtcat tcctctttat caaaactccc atatcaagac     55320
     aagagttttg ataagatttt ctgtatctct gttttagagc atttaagtaa agttgatatt     55380
     gagcaaacct ttaaggaatt taggagaaca ttaaaagatg aaggcctact tattgttacc     55440
     tttgactatc ctactattaa tttagaggcg ttaaagatac tgcttgataa ggtgaaattt     55500
     aaattttacg gtgattattc gcttgataaa cctgataatc ttttagtttc aacaatatgg     55560
     ggagagctaa attgttttag ggctgtgtta ataaaaaatt aagataaagg ttttagtatg     55620
     cagataattt gttaaaacca tgtggcataa gaatcatttc tatatattaa attgtatttc     55680
     tgtaagaaat aaaagggctt taatcctcaa atttgtatat caaaattaaa ggaggagaga     55740
     aatggcctat aaacgtgcaa ctaaagttag gtattttagt tctaaccacg ataataatta     55800
     tttaaaaaag gggaattgca aagagaagga ttgtatagat attacgggtt cccaaattag     55860
     acggttactt actattttgg atagtttaaa agacataatt cctctgatgc taagaaaccc     55920
     aaataccgga aatatcaata ccctttctaa tttaatgaac cgccttatta ctttattaaa     55980
     tgaattaaag cctaattctt cagcagttac gtatttaatt accactgctc agagtttatt     56040
     gtcctctttg acaacaacat tattgcctcc aatgaggtta gtaagtctac tacaaaagct     56100
     gattaataga ttaattttac ttattaccct tttatgtttg aattcggaga catatatcct     56160
     tttactcaag aatttaaatc aacttgaggc tattttggct cagtatacat ctattggaat     56220
     cacaggagca acaggtccta ctggagctac tggcattaga gggaccccgg gacctcctgg     56280
     aggtcccgga gtgacgggca ttactggggt gactggccct actggagcca ccggagttac     56340
     tggagatccc ggaatcactg gggcgacggg ctctactggg gcgaccggca ttactggagc     56400
     ggccggagtt actggggtga ctggcattac tgggaccact ggagttactg gagatcctgg     56460
     aatcgctggg gcgacgggca ttactggagt caccggagtt actggagatc ccggaatcgc     56520
     tggagcgacg ggctctactg gggcgaccgg cattactgga gccaccggag ttactggggc     56580
     gacgggcatt actggagcca ccggagttac tggggcgacg ggcattactg gggccaccgg     56640
     aacaagttta actactaatt ctatgtttgc aggtaacaca gtggggagta cgattctagt     56700
     tgtattaggg gggaccagtg ttcctcttcc tagtaaccaa aacttagata gttttactgt     56760
     taacggtact aatactactt ttactgtccc ggccactgga cgttattaca tcacatacca     56820
     aattaatact acagctgcgt tacttgctgg atccagactt atactaaacg gtaccactcc     56880
     aattcccgga tccacaatat ctcctgctgt tgctgcttca agctacaata atgatgttat     56940
     tgtctctcta accgtgggtg acacaattac actgcaacta tttggtttac ttgctacggt     57000
     tgttttaaca ggtggcggat caactggagc tgcattaaca attattcgtt tatcttaata     57060
     aaaaggcggc tacgtgctgc cttttatgtt tacctataga aatcaataac tacatatatg     57120
     aacctgctcc gatagtctaa aagattattt aagaaatatg tataagtttc tttgacagtt     57180
     agcccaataa aattagtatt aagtgttcta attgacaata ttgaaataag atattatcat     57240
     gtaagtagta agtaataagt aataagtagt aagtatttga tttcgaatga atcatcactt     57300
     tactctttaa aataaaggga gtttttttat gaaaaatata gaagtttctc aaaagtattt     57360
     attactagta ctaaatgata aaggtggagt tgctcctatt ggcagtctac gtattcgtgc     57420
     atttatggtt gctagtggta ttttggaact tgtcctggat gatattgttt cattgtcaga     57480
     taatcaagtg acggtaaaac aagagttacc aagtgataaa gaatatttgc gttcaatcta     57540
     taataagatt tctacggaaa aatcaattca tctgaaaaaa ttagggagag aattgatttc     57600
     taaacgtgaa cttttcaagg aattattcaa ctcagttggt gactctttag ttgaattaga     57660
     tgtagtcact aaaactaacg gaggtatctt gggacaatct agtcactata taggtagtga     57720
     aaattctaag aagcaaatcg tggaacaaat gcgagcagag ttattagaag agggtccagt     57780
     tacaactgac actgttgttc tctcaagttt gttaataggt agtcgtactt tgaagaacta     57840
     tttcagtaag tttgaggata aagatcttaa cgacaagcta actatgcttc gcaaagatac     57900
     gagaaataaa gaaatttttg cattgataga tagtatatca cacacaatta ctacgatcat     57960
     tgcgtccgta ggttaattgg agggattgta gtgtcaagaa gacgttcatt agaggatatt     58020
     ctgcaatctg aatatgtatc tattggggaa ctatctcgac taacagattc gagatacagt     58080
     accttgaaat attacacaga agctggttta attccatttg aacaatcaga tgaaaattta     58140
     acacgacgat atccaagaga agcatcagtt caaagaattg agacaattaa acaattaaaa     58200
     aaatctggtt tgtccatctc agaaattagt gattgggtag ttaataatga ttaaaaaata     58260
     tgtatcccca atgcatcata agtgcaaaga aagcccaaag aatctatagg tttctttggg     58320
     ctttcggtaa tgtttcttca ttatttttat ctaactttgt acatggtata catagtctaa     58380
     gtatatgaca tagtgagcaa actcaatcat agattaacta aagactgtta aggagatttc     58440
     ggtataaaag tatttcaata ttaaaaaagt atccctgacc ggatgctatt ttgtgaatta     58500
     agctagttca ttgttttgtt cctttagtaa cttattttct aaatctaatt gcttcattct     58560
     tctttgtaat cccaaattct ctaaatcctg ctctagctca taagataaat caagccgttt     58620
     cttagcattc tccattagct ctctagtaat tgctaacctc ttttggtctc tttgattcat     58680
     attaacagcc cctttcctgt gaattgctag gttcgacatg acagatgaaa agtcctataa     58740
     caaacaccac caaaacgtat aaaaaggtct attatttttc atgtgtctaa aaaggtttat     58800
     ttttaagaat gaatagacgt tttgtcatta gttttttcgt tgtctaaaaa ggtgtacctt     58860
     tttagactat cttgttttga accaatatgc aatttgacta aagtttaaag aaagttaaaa     58920
     taaaaaatgt taataaaatc ctaaaataat tatatttaac aaattgattt ggttattctt     58980
     caggaggttg atatgtccta agaatactat gcatatgact ttgaataaaa aaggaggcta     59040
     agtgtgggat tattttttag aaagatagac cctgaaacag atagtaaata cagaaaatgg     59100
     ctgaatttta gcttagtaat agcaatacta ataaacttaa tcaatagttt gtttctaaat     59160
     ttgcgatggc tttatattac aatgactgct gtaattggta tactggccat tttaatattt     59220
     aaggaatata aggatgagaa gtaaagactc cataaaaccg tataaaactt aaaaacagta     59280
     aaggccacta gaatggattc tagtggcttt attttttaaa aatcgttata ttcttctaag     59340
     tcgtcatcgt ctaatgagcc agatatattt tctaaatctg caatctttcc ttctttcagt     59400
     tggggaacct ttgaaggctc ttcttctttg aaggaatcgt ttcctacaaa acctgttgtt     59460
     tttgctaatg tttttaaatc agctaactca ttctttatat gttcaagcat ttcgtaggtt     59520
     tttttgtctt caattgcttt tcttccagta gatgaatcat ctagatcacg tagaattaaa     59580
     gatgaaatat actcccctaa cttacgcgat ttagcatatg tagctagtct attataaact     59640
     tcatcactca atcgatttgt cttaatagta aacgcatttt gacgttctga catccctatc     59700
     acctacgttg ttaggattta acggctttct tctctgctgc ttgcttcttt tgaacgtaac     59760
     caatactacg aatctctaag ccaaataagt ttaaatggcg gctatcttgg ggaaccttat     59820
     gatacttttc cgtacgttct tctccaattt tttcacgcat actattcatg atagcgactt     59880
     ctaaagtagg agctaccccg ccgcagtata catacttacg tagtttattc gctggtggtg     59940
     gcgcaacatc atttaattta gctaataaga tttccacata ttcacgtagt gaagatttga     60000
     ttgtacttgt taaatcaatg gattcacctg tgttctcgtt tttcaataca aacttttgct     60060
     tgctgtagtt atcaagaata aattgatcaa aggcacgtaa gtctgtaaat aattctagaa     60120
     atttctcttt acgcaattta tcaatatgcg ctaaataagg aatgccttca atgctttgaa     60180
     atgattcacg gctattggca gccttcaacc cttcaggtag aataaccaca tcaatggaac     60240
     ctccaccaat gtccaccatg accgtttcac attctacata ctcattcgca tcttcacgat     60300
     cttgaagtgt taagtctttt tttaacgcaa aacgtgcact ttctccctct tttaagcatg     60360
     cactttcttc tactaatacc tttaacgtat tttcaaaacc aggcgtatgc acagtaaatg     60420
     tatggtcgcc taagaagcga ttagccatgg ctttttgagc cgccccaaat gtgctctctt     60480
     tcttaagtag ccagattggt aacatggtag aaaaatagtc aatttcaatt gtattgtctt     60540
     ttttattttt cgcatgcaac gcatggtaat acgcaatggc agctaaaaaa gtgatgtatg     60600
     gaatatgact tgtaatttta ttatgtaatt tattaatgtg attattagcc agcaattgac     60660
     tagctgcaat gtcacctact aagaaataac gctctttctc ttcgccctta atggttgtag     60720
     aaagtaaaat gcgcttctta aattcttctg gagctgtaac cgcatctgtg aaaaaggagt     60780
     cggctgcttc tttttgaagt tcaactacat tcgttggaaa atcaaataga tatccatcca     60840
     taatgttcat atcaacagag ttaccgcaat ctttattaaa acgtgaaatt ttcatttata     60900
     aacacctcat cttttaagtt gaacttatat tcaacttatt gtacttgata taggataaat     60960
     attcaatatg tgggagcaat ttagttatct acaaaacatt acatctatca acaattattc     61020
     aaattaagta gaacttgtat ctacaagcaa tattcagatt caatccttat gtaccttact     61080
     ttatatcatc aacataataa gagcctgcat caaaaatgat gcaggctccc ctctcttaca     61140
     acaaaataat tctcatgttc atttgccctt gtgaggccct ttcgttacgt atatcggttc     61200
     ataacgagag taccatccgt taaatcacaa tacctactgt caattggggt aatacgtttg     61260
     ctgaagtcgc tgttacgtct ttcaaaaccg aaccagtccc ttcattaagc taagtattta     61320
     acctttcaca gcattcaatt ctaaatgata ttgatactgt actatatgtg taccacatct     61380
     tttacaatta aaacataccg tattttattc tatttccttt ggttgtactt ttacaacgaa     61440
     aatgctttgt ttttcattat aggtatttag atacgcattc ataattagtt ttttactctc     61500
     ctaattctat accttcctgc tttgtctcct cttttagatt atatagaggt aatataaaaa     61560
     gcaaacctat aataaacaag actgctgctg cctcaaatat ggcaaccaat gaaaattgtt     61620
     cttttagaat accagctaca ctcatcgtca ataccatggc tcccgtaaaa agaggactta     61680
     aaatcccatt gaccctgcca ataaaagcag cttccgttct ctgtaagatc atcgtattga     61740
     tgccaatctg aatacatggt aacatgagac catttagaaa ctgagctccc agcgtcagcc     61800
     atagatttac tgataatccc attatggcaa acccaattgc attaccaacc attccaaatg     61860
     ccagcagcct ttgcggagct actgttttgg caaaaatcat caccactgct ccgcctaaga     61920
     tcatgccaat tccattagct gtaagtaacc actggagatt ttcttttgct aagcccaact     61980
     gctctgttac aaggaaaatg gaaagaggct gaataaaccc tattcctagt ccagctgcta     62040
     aaaagcatag acctaacagg ctcaactctt tcttccctaa aacatactta ataccacttt     62100
     tcatttcact tagcagtgat gtagttccat tctcttcttc catctttcga tcagaaggta     62160
     gaaaagtgag tgctgctgct gatagtaaaa aggctgtacc tgtgatggca atggagagac     62220
     ttataccaaa agcttgaaag gcaaatgttc ctagtattgg tcctagaacc ataaatatcg     62280
     caaagaccgt ttgatagact gacatcccta cctgcatttg ctcctccggt aaatgcattt     62340
     taaacagttt catccctgaa ggctgggaga attgggaaag gattgcagaa attaaagtgg     62400
     cgaaaaaaac aatgtgccaa gatccaagta taagcgtgac aagcacagca aatacagata     62460
     ttgcacttaa aatatcacac cacaccatgg tacgttttgg acgccagcga tctgcaaatg     62520
     ttccgccaat aaaggagaaa ataaaaattg gtgcaaattc ggctacagat attaaagata     62580
     ctgcaaatgg gtccccgttt gtcttctcca ttatgaaaag aagtacagca aaatttctaa     62640
     cccatatccc tatttgcaag aataacccag agataataat agcttgaaaa acacggtttc     62700
     caaataagtt ggttgaatga tttacgggta atttctcttc caaaacaaaa aacctcctgc     62760
     gtattttctg aacaggagga agtacagtac aacaacagta ttgacatgac atttccaaag     62820
     aaaggaatac aatgatcaat ttgatttgta tgtaaaagta caatctaatc ctattcagaa     62880
     aaacaatcgt attatttaac gaatttttct tagaaaatag gattaattaa tcattgtttc     62940
     acgttcaccc ttcctttttt tactaataat aggataattt attatttata ataaatcaat     63000
     gcttttcaaa cccgaaattt ctacaaaata ttcgtttcac tcataatcaa tccattaaaa     63060
     atcaataatt atttttttga cagctttctt ctattctttc taggcatcta tctaactacg     63120
     ggcatgcgtt tatctattct cttatttgct cccagatttg ctgtgcaatt cctatacact     63180
     cttcttttat taacgtacta ttaaatgact gatttaatat atctgttatc tcaatcgcca     63240
     gactttcaac gttttctact ttgtatacca taggaaggat ccatgtagct tcatactcat     63300
     attcctcaga agcgtgcaaa gacagtggat tccatgtata gataattgat tgtatcgttt     63360
     cttttacatc attaaacctt gtactccatt gttgtccttt catccccatc accttctatt     63420
     agcttactca tcgttatctt tattataaac aaaagaatat ataaaagaaa aaaatagtat     63480
     ctatgcagtg ggcgttatac gaatttagaa cgaatagctt atagaaactt atccacgttt     63540
     gtcaggatga ttgctgtaaa tacagatact gcatttgatg cttcattttt ttcttgattc     63600
     ggtaaagcgc attatccacg gatttttgag gaagatttag gttctgagag atctgcatat     63660
     acgtttgacc cttcagatat agagtgaata catcttgttc aataggtgac agtatttctt     63720
     gtagcatttg ttccctttct cttttattct ccttttctac agtagcttgt tcggggctta     63780
     cagcacgtgg gtgaggaagc atctccataa gaatcaaatc atcttccaat cgctttgaat     63840
     tcttaggtat gtttaaagag agggcattat ttaaagggga atgtttttga cgagcacttg     63900
     cttttatagc tgtaatgagt tgacgtgtaa tgcatagatc agcaaatccc ctaaatgaac     63960
     tcatcccttc tgttttaaaa tcgcgaacag ctttatataa tcctagcctt gcttcttgta     64020
     agagatcttc tcgatctcct cctagtagga agtatctttt tacctttgac cagaccaaat     64080
     actcatattt ctttacgagc acattgaaaa catcttcgtc gcctttttga aacgcttgaa     64140
     caatctcttc atcatttagg gtcatctttt tttctcttat ttctacacct gctatcatgt     64200
     tcatctgcgt tcctcctcgt gttttatgct ttctatgtac tttacattat aaaaaagaaa     64260
     gggtataaaa aatgtcgaaa aaacaaagag tagaaagaat atttagggag gaagaagtga     64320
     gtcattacat caaaccttat atcatgtata tgacctgtat aatatggacg atttttaatc     64380
     ttgtttacga ctttaaaaaa gccaacaggc gttttctcgc atgttttacc cgttgctatt     64440
     ggatcaacga ttccgataca gccattgtga aaataagcaa gtttgtttta gtgcttattg     64500
     atattggtca aatcttgatt cggtgatttg cttgctgctt ctttcctcct tctatcttcc     64560
     gagtatgaaa aaagaagatt cttttgcctt caaacttttg ctttttttta cgttccattt     64620
     cttgtgctgc attccttttt ccgtagaatg tgctccaatg ttccgtgcaa aaaatttcgt     64680
     gagttcattt tataatttct cttttctcct tttgtcataa ttctttatct ctcttagtac     64740
     ctccctcctt tccaagccaa cttttaaaaa ttctcaggaa ggaatgttct tttctttcgt     64800
     aatttcatct atttttttaa cggcaatcag atcgatattt tgtaaaagca tatccatgac     64860
     attcttgcct ttcttgcaaa ttgtggttcc ccactacaaa agagagaaga gcataagggg     64920
     tttctgctat cacatagggt gataggctag gcaaagccta gcgaaactgt gatatcaaga     64980
     aaaagctctt catgtccctt ttgggtcccc ttttcaccct taaacaccgt tttttcaggt     65040
     tgaatttcca ccctttaatt ccacaatttt atccatagtc ccttttgagt ccccttttgt     65100
     ttttttactt catgaccaga tcctgttctt tttcgttcaa ctttttcagc ttttcttgca     65160
     aatttttttg tttatcttca tagagtcgaa cgcttatatt actggattga atcgtatctt     65220
     tttttatcgc aatttttgat tctgcattgg ctttcccatc gttttttatt ttcttttttc     65280
     acaaaatctt tttctaactc atgtgaacat aaataaatat caatgtcctg tgaacctgca     65340
     ttttttttag aagggtcaca gtttatagaa taaaaattga ttcataaatg ataaaaaagc     65400
     acgcgtaaat cacttgtatt gtaagcaaaa acaaatggct tttttgatta tgaacgtgcg     65460
     aagaaaacaa aaaaagatcg cttacttctg tcttattttt ttcaaaaaac actttaaatg     65520
     aagtgaccct tgagggtaca tttatcaact atgaagggtc ggtgaagggg ttcgtggccc     65580
     aagtgttgca atcactgaag gtgcggtgaa gggactgccc tttaatttga gggtgcgctg     65640
     agggggttct tgcaaacttt tctttgtacc caaggttttg ttaggctctg cctaacccca     65700
     cacagcctgt gggggcaaaa accccttatg ctcttctctc tattttttaa agggcaccag     65760
     tattttgggg atttcaaata aaatatggaa cctaaaataa gaaatgttga tcctactgct     65820
     gtaaaaaaac ttgatgagtt agcaaagaaa catgatcaat catgacagaa gctttttaaa     65880
     aaattaagtt catacattag ctatttttag tcaacactcc taccaagaag aacctcttga     65940
     aaatttgctt ggggatcaca ttaagacgat aggacagtgt acaacttcaa tggaaaacct     66000
     gaaggatatg ttaaaagaat tgatcgaaga atatgaagat gatgaataaa acacgccaaa     66060
     tgatttcact cgatgaggat acccatcaat ccattcaaag ttatatgctt aaacaaaaat     66120
     gagatatctt ggtgatgcca tatccaacat ttgtatcaga tttagttatg agtaaaagaa     66180
     agaattgaat gtaacaacca ttacagaaac tgtttccatt gagttgaaaa acaattaaaa     66240
     aaagcaactt aaaaagttac aacctagcgt taacaatgct aataaacata tacaaatagc     66300
     taatgatata ggacgatttc cactctctaa atctaacaga aaaagcagtt tataccataa     66360
     agtagaaact gcctatatca tattcttagc tttttgcata gtgtcatttt ttatagtcct     66420
     tttttagaaa aaggactata aaaaatgaca ctacccagaa tatccattta cccttatcat     66480
     ggaaattgta ctaattcact aaatcttcaa cgatattaaa aactaagtat tataacacac     66540
     ttgttaatat ttgaggaggg gtaaaaaaat acccctcccc tactctaaaa aactcatata     66600
     tgataaaggt gattcctaca gcaatatagg atcactcgta gctaaatata cttgttttga     66660
     tatattttgc taatttttat tgaattatga gactagttaa cgctataata taactaacaa     66720
     aaacgtgcgg atagaaaaaa gacttcaact gtttaagtag tgcacacaca cccttaaacc     66780
     gttcccccta gttacagtag ggaaaacact tgtcgaagtc tcttgttaat ggagttagtt     66840
     ttgtttaatt taaaacttat ggttttattt tatatgaaat tgacatctat ttcaagagct     66900
     tagttcatca aaatcacggc attgttttcc ttttatcagg gagacagtgt cttttttgtg     66960
     ttccttaaag gagaagatga acaaa                                           66985
//