Dbfetch

ID   CP001985; SV 1; circular; genomic DNA; STD; PRO; 9098 BP.
XX
AC   CP001985; DQ437521;
XX
PR   Project:PRJNA30165;
XX
DT   21-APR-2010 (Rel. 104, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Bacillus megaterium QM B1551 plasmid pBM200, complete sequence.
XX
KW   .
XX
OS   Bacillus megaterium QM B1551
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
OG   Plasmid pBM200
XX
RN   [1]
RP   1-9098
RA   Stevenson D.M., Zhou Y., Mueller K., Jablonski L., Vary P.S.;
RT   "Replicons of the Indigenous Plasmids of Bacillus megaterium QM B1551";
RL   Plasmid 37:232-232(1997).
XX
RN   [2]
RP   1-9098
RA   Kunnimalaiyaan M., Zhou Y., Scholle M., Baisa G.A., Vary P.S.;
RT   "Discoveries within the Seven Plasmid Array of Bacillus megaterium QM
RT   B1551";
RL   Plasmid 45:142-142(2001).
XX
RN   [3]
RP   1-9098
RX   DOI; 10.1128/JB.00449-11.
RX   PUBMED; 21705586.
RA   Eppinger M., Bunk B., Johns M.A., Edirisinghe J.N., Kutumbaka K.K.,
RA   Koenig S.S., Creasy H.H., Rosovitz M.J., Riley D.R., Daugherty S.,
RA   Martin M., Elbourne L.D., Paulsen I., Biedendieck R., Braun C.,
RA   Grayburn S., Dhingra S., Lukyanchuk V., Ball B., Ul-Qamar R., Seibel J.,
RA   Bremer E., Jahn D., Ravel J., Vary P.S.;
RT   "Genome sequences of the biotechnologically important Bacillus megaterium
RT   strains QM B1551 and DSM319";
RL   J. Bacteriol. 193(16):4199-4213(2011).
XX
RN   [4]
RP   1-9098
RA   Baisa G.A., Kunnimalaiyaan M., Edirisinghe J.N., Vary P.S.;
RT   ;
RL   Submitted (07-MAR-2006) to the INSDC.
RL   Biological Sciences, Northern Illinois University, Montgomery 306, DeKalb,
RL   IL 60115, USA
XX
RN   [5]
RP   1-9098
RA   Eppinger M., Bunk B., Johns M.A., Edirisinghe J.N., Kutumbaka K.K.,
RA   Riley D.R., Huot-Creasy H., Koenig S.S.K., Galens K., Orvis J., Creasy T.,
RA   Biedendieck R., Braun C., Grayburn S., Jahn D., Vary P.S., Ravel J.;
RT   ;
RL   Submitted (05-FEB-2010) to the INSDC.
RL   Institute for Genome Sciences, University of Maryland School of Medicine,
RL   801 West Baltimore St, Baltimore, MD 21201, USA
XX
DR   MD5; d6e35ffd95f090559d3216aed88f634f.
DR   BioSample; SAMN02603354.
DR   EnsemblGenomes-Gn; EBG00001189677.
DR   EnsemblGenomes-Tr; EBT00001768434.
DR   RFAM; RF01691; Bacillus-plasmid.
DR   PubMed; 11251820.
DR   PubMed; 14602653.
DR   PubMed; 15933003.
DR   PubMed; 21705586.
XX
CC   On Apr 8, 2010 this sequence version replaced gi:90900894.
CC   Bacteria available from the Bacillus Genetic Stock Center,
CC   (http://www.bgsc.org/), The Ohio State University, 776 Biological
CC   Sciences Building, 484 West 12th Avenue, Columbus. Ohio 43210 under
CC   inventory No. 7A116 or from Patricia S. Vary (pvary@niu.edu), Dept.
CC   of Biological Sciences, Northern Illinois University, DeKalb, IL
CC   60115.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..9098
FT                   /organism="Bacillus megaterium QM B1551"
FT                   /plasmid="pBM200"
FT                   /strain="QM B1551"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:545693"
FT   gene            64..228
FT                   /locus_tag="BMQ_pBM20001"
FT   CDS             64..228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM20001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM20001"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72262"
FT                   /db_xref="UniProtKB/TrEMBL:D5E387"
FT                   /protein_id="ADE72262.1"
FT                   /translation="MICKVITSVWTSADIIKILLTLIDIVRVHNLKTEKDYFFPVKRSS
FT                   LFLLRNWVS"
FT   gene            complement(642..761)
FT                   /locus_tag="BMQ_pBM20002"
FT   CDS             complement(642..761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM20002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM20002"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72263"
FT                   /db_xref="UniProtKB/TrEMBL:D5E388"
FT                   /protein_id="ADE72263.1"
FT                   /translation="MNPSRSVTLPNGFAVVKKQKNSLPPGSFSVFLDVYYIYV"
FT   gene            871..1062
FT                   /locus_tag="BMQ_pBM20003"
FT   CDS             871..1062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM20003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM20003"
FT                   /db_xref="EnsemblGenomes-Tr:ABE01823"
FT                   /db_xref="GOA:Q1W5D0"
FT                   /db_xref="InterPro:IPR010070"
FT                   /db_xref="UniProtKB/TrEMBL:Q1W5D0"
FT                   /protein_id="ABE01823.1"
FT                   /translation="MHILEVLSIYGGENMGFGGCGYGGYGYGGGGSGFGSGFALIIVLF
FT                   ILLIIIGASCFGGFGGGC"
FT   gene            1814..2167
FT                   /locus_tag="BMQ_pBM20004"
FT   CDS             1814..2167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM20004"
FT                   /product="Bacterial mobilization protein (MobC)"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM20004"
FT                   /db_xref="EnsemblGenomes-Tr:ABE01824"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:Q1W5C9"
FT                   /protein_id="ABE01824.1"
FT                   /translation="MSETKGERRNEPKQVKFRVTEEEFERLSLMADNVGMTVPAFVKAK
FT                   AQGTRVRQPKINREGALAIAKELRAVGTNVNQIARWCNARDIEQLSEQELERLVYNLDE
FT                   IKKGLAAAWQQLS"
FT   gene            2149..3375
FT                   /locus_tag="BMQ_pBM20005"
FT   CDS             2149..3375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM20005"
FT                   /product="relaxase/mobilization nuclease domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM20005"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72264"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D5E389"
FT                   /protein_id="ADE72264.1"
FT                   /translation="MATIKLSTTKNANALLKYAEKRAEVSNSLDCDVDYVRNQFKATRE
FT                   IWGKNGGIQAHHVIQSFKPDEVDSHQANEIGLQLAEKLAKGYEVAVYTHTDKDHIHNHI
FT                   VINAVNYEDGRKFHAHGQETIDRFREASDELCKENGLSIVEERSADVRYTLAEQSLLEK
FT                   GESSWKDEIRTAIDQAKEQTASFEEFQEHLKEQGVQATLRGKNITYEHLESNKKVRGMK
FT                   LGLAYEKETILHGFERQVTRERETRNSAATAERGDTTVTAVISGDDLTSQNDRGLSLDV
FT                   PERKHEQRDDDRTRARTDQTDEPRRAAGNELNFDDIAQQIRERHRNTQAVYKRNFGRDE
FT                   DGHQSATERSEKEPGLSEQRVPSKQSSDQGRAREDQQQPGEQVRQLERDSEGRTQRGRK
FT                   KQQDYDLER"
FT   gene            3359..3502
FT                   /locus_tag="BMQ_pBM20006"
FT   CDS             3359..3502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM20006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM20006"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72265"
FT                   /db_xref="GOA:D5E390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E390"
FT                   /protein_id="ADE72265.1"
FT                   /translation="MISNAKLGVVFNGWLDWVKYGAGAAVFMVPMFFLFKWFFGLFGIN
FT                   LG"
FT   gene            3750..4424
FT                   /locus_tag="BMQ_pBM20007"
FT   CDS             3750..4424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM20007"
FT                   /product="replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM20007"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72266"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D5E391"
FT                   /protein_id="ADE72266.1"
FT                   /translation="MNLEKKLAEAEKKARLKDFKNKSYSSEEVSDIQRSLLDLMQEITG
FT                   EKHFIGKEKDIFAGEPFNQTMHRNLDLLTRINYLTTAEESFLFRIQAYLEFKSNVIICR
FT                   EDKFKKKRNNVVDDDYELPKAATVSEIAEMIGKSREKTSLIMNSLKKKEILLNPEGAGQ
FT                   VSENGRSVSPRTWIVNPYIMICAPRKNEVKLDKLTMRLFQHSLKNLKDPNGKKVNLPVR
FT                   FF"
FT   gene            complement(4755..5339)
FT                   /locus_tag="BMQ_pBM20008"
FT   CDS             complement(4755..5339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM20008"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM20008"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72267"
FT                   /db_xref="GOA:D5E392"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR025052"
FT                   /db_xref="UniProtKB/TrEMBL:D5E392"
FT                   /protein_id="ADE72267.1"
FT                   /translation="MEVITNMYMEFYEKVEGLARAIGVTTSTVKKYYLLFEEYGYNFKR
FT                   NQQGQLLFSQDDINLFKELIVLKNEKGMTVPKAVKEIIKDKVMTDTTDITDITATTEDI
FT                   TVISKHVTTVMSELDELKQLVKNQNEIIEKQQEDFKKQFLKQEAYIKDSLEQRDKTLIT
FT                   TLREVQESQKEMATSLSKDQAKKKWWQIWLD"
FT   gene            complement(6404..6997)
FT                   /locus_tag="BMQ_pBM20009"
FT   CDS             complement(6404..6997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM20009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM20009"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72268"
FT                   /db_xref="UniProtKB/TrEMBL:D5E393"
FT                   /protein_id="ADE72268.1"
FT                   /translation="MKMGNCKKQNRKRQELDINELFKRITFETKQSQRTFKEIENLLNR
FT                   SQQLMRKLLTNSNNILTSENAFFNVAGAPAAPVAPPTPPTPTPLPPITQTQQTLIINLL
FT                   STVRDIRSVSRQIRDTYEALIGGVLLLRRRAIERSEAFDEDQFDRADDLTRSIEDITLG
FT                   ILILESQLENLKTQLEGLQENLEIYIALLANTVL"
FT   gene            complement(6994..7161)
FT                   /locus_tag="BMQ_pBM20010"
FT   CDS             complement(6994..7161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM20010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM20010"
FT                   /db_xref="EnsemblGenomes-Tr:ABE01831"
FT                   /db_xref="UniProtKB/TrEMBL:Q1W5C2"
FT                   /protein_id="ABE01831.1"
FT                   /translation="MGNCKKYHDEDSDIRDLIKLLKSENNRIESIEKLLGKNEKLAEQL
FT                   LGIRAKRGKY"
FT   gene            7254..7376
FT                   /locus_tag="BMQ_pBM20011"
FT   CDS             7254..7376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM20011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM20011"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72269"
FT                   /db_xref="UniProtKB/TrEMBL:D5E394"
FT                   /protein_id="ADE72269.1"
FT                   /translation="MGCNKIYICLLLLFSVLYLLIEKVFVCLSYDIDNIIENSL"
FT   gene            complement(7574..8116)
FT                   /locus_tag="BMQ_pBM20012"
FT   CDS             complement(7574..8116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM20012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM20012"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72270"
FT                   /db_xref="GOA:D5E395"
FT                   /db_xref="InterPro:IPR008813"
FT                   /db_xref="UniProtKB/TrEMBL:D5E395"
FT                   /protein_id="ADE72270.1"
FT                   /translation="MNLKDWEKDLIGDTQRKKINKEVKETVTNDDGEKLFQRHIEESYV
FT                   SKEPDYVKIYLDNILQINNLSSGIQKTLNVLLKRMAYDNIVVLNAYIKKQMAEELGFNT
FT                   VQSLNNNINKLVKEGIMIRKGTGTYEMNPFLFGRGSWDNIRKIRFQVIFEEGKISQKAD
FT                   FDYKDEVAISHEEKTTD"
FT   gene            8330..8473
FT                   /locus_tag="BMQ_pBM20013"
FT   CDS             8330..8473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM20013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM20013"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72271"
FT                   /db_xref="GOA:D5E396"
FT                   /db_xref="UniProtKB/TrEMBL:D5E396"
FT                   /protein_id="ADE72271.1"
FT                   /translation="MFIEFYLFFSFILCTCFFVLFYWILERGIMLTNLYMIYSLKKRKT
FT                   NL"
XX
SQ   Sequence 9098 BP; 2913 A; 1451 C; 1688 G; 3046 T; 0 other;
     ggatccgtca gtagtttttt ctctgattta tagaaagaga cagaatggtt agtcgcataa        60
     tttatgatat gtaaagtaat tacaagtgtt tggacaagtg ctgatattat aaaaatttta       120
     ttaactttga ttgatatagt aagagtacat aacttaaaaa cagaaaaaga ctacttcttt       180
     ccagtcaaaa gaagtagtct ttttctgtta cgtaattggg tttcatgagt gatgcctcat       240
     tgcatcttgg gtagtttgct caatttatca ataacttatg tattaaaaga aaaacccacc       300
     tgatttgtca gaggtggatt tttcttttag aaaatctaca tatgattagt ttactctaac       360
     tattgtcttt tattcctaat aggcaagtta cctaaaggaa aataagggca tatgatgtat       420
     ttcgaataat tttcgtctta cacttagaat ccttttagtt tcatttttca ccttcataat       480
     ttacaaagtc aaaaaaaaga aaaaacaatc tgtattggaa gacagattgt tttttctttt       540
     aaatgagaga tggctttatc gaagtcgcat tcctagagcc ttctctaata atattcaaaa       600
     tcttttcaga taatgaattc caataaaatc cattatacta actaaacata tatataatat       660
     acatctaaaa aaacagaaaa actcccaggc ggcagggagt ttttctgttt tttaacaact       720
     gcaaatccgt tcgggagggt aactgatcta ctgggattca atgttatggt tcattcattc       780
     tatgtaaaat aatctaaatg gtttatatat atctacaaca atcctattat ttttaccagt       840
     ccagagtata ggcgagcatt ttaatttttt atgcatatct tagaagtatt aagcatatac       900
     gggggtgaaa atatgggctt tggcggttgc ggttatggcg gatatggtta cggcggaggc       960
     ggcagtggtt ttggcagtgg ttttgcttta attattgtcc tctttattct attaattatt      1020
     atcggggctt cttgtttcgg cggctttggt ggaggatgct aatcattaaa tctaatttgt      1080
     ttaaaaaaag ttagctagat gctagctttt tttatttttg gatgaaaatt cattttcaat      1140
     caatgggggc tagcctttat acaaggtacg agtcgtattt ttcaagaaac ccacttaaaa      1200
     aatctccact cttttctcct tgtataaaga ctttcggcag gtttgaatct ctcgccaagc      1260
     cgacataccc aaaacgaagg atatgggaat cggcttgttt aagcaagtat acctgccgaa      1320
     ccgccagctc ggccgtacaa aagtgctcat cttactccaa ggtaagcaac gcacttaaaa      1380
     acataagaag ccagcctcta ccccaaaaca aagggggaga taagctgcgt tgtcaatggt      1440
     aagcggaccg tagggagcat taaggaattg acaatgtcac tacaccaaag accctcttgg      1500
     cactcaaaca aacgagtttg tttgacgcca accggcgagg gagccccctc aaagttttga      1560
     gggggttggg ggtgtttgta caagccattc caaaggagct ttcctttggc aggtgtggac      1620
     agcgtccgcg gtttggctcc cccttgaaaa gggggctggg gggattgtta tgcctagcat      1680
     aaccaagctc aattgggtac caattgtaga gcttgcctta ttccgactgt ttggtgtatt      1740
     atggaagcat acagctggaa ttttacacca agttcaccac gttcagtagg tgaacataag      1800
     gaggaataaa gggatgagcg agacgaaagg cgagcgtagg aacgagccta aacaggtgaa      1860
     gttccgtgtt actgaagagg aattcgaacg gctatcgttg atggcggata acgtaggaat      1920
     gacggtgcct gcctttgtga aagcaaaggc acagggtacc cgtgtacgac agccgaagat      1980
     caatcgtgag ggtgctctgg ccatcgcgaa ggaattgcgt gctgtgggta ccaatgtgaa      2040
     ccagattgcg agatggtgca atgcacgaga cattgaacaa ttaagtgaac aggagcttga      2100
     gagattggta tacaatctcg acgaaattaa aaagggattg gctgcagcat ggcaacaatt      2160
     aagctgagta cgacgaaaaa tgccaatgcg ttactgaagt acgctgagaa gcgcgctgag      2220
     gtgtcaaatt cacttgattg tgatgtggac tatgtaagaa accaatttaa agctacaagg      2280
     gaaatatggg gcaagaacgg cggtatacaa gcccatcatg tcattcagtc gtttaaacca      2340
     gatgaagtgg attcccacca agccaatgaa attggattac aactggctga gaagttggca      2400
     aaaggttatg aggtggccgt ctatacgcac acggataaag atcatatcca taaccacatc      2460
     gtgattaatg cggtgaacta tgaagatggc cggaagtttc atgcccatgg ccaagagacg      2520
     attgaccgtt ttcgcgaagc aagtgatgaa ctgtgtaagg aaaatggcct ttccattgta      2580
     gaagagcgct cggcggatgt tcgctacaca ttagctgaac agtcattact tgaaaaaggt      2640
     gagtctagtt ggaaggatga aattcggacg gccatcgatc aagcgaagga gcagacagct      2700
     agttttgaag agtttcagga acatttaaaa gagcagggcg tccaagcaac tttaagaggc      2760
     aaaaacatca cgtatgagca tctagaatcg aataaaaagg tacgtggcat gaaattaggg      2820
     ttggcgtacg aaaaggagac gattttacat ggctttgaaa gacaagttac aagagaaaga      2880
     gagacaagaa attcagcagc cacagcagaa agaggagata caacagttac agcagttata      2940
     tcaggagatg atcttacgtc tcagaacgac agagggctat ctctcgacgt tcctgaaaga      3000
     aaacatgaac aaagagatga tgatcgaaca agagctcgaa cagatcaaac agacgagcca      3060
     agacgtgcag caggaaatga gcttaacttc gatgacattg ctcagcaaat tagagaacga      3120
     catcgtaaca cacaagcagt atacaaacga aactttggcc gagatgaaga cggccatcag      3180
     agtgctacag aacgatctga aaaagaacca ggactttctg agcaacgagt tccaagcaaa      3240
     caatcaagtg atcaaggacg agctagagaa gatcaacaac aacctgggga gcaagttcga      3300
     cagcttgagc gcgacagcga aggcagaact cagcgaggtc gaaaaaaaca gcaagactat      3360
     gatctcgaac gctaagttag gggttgtgtt taatggctgg ttagattggg tgaaatacgg      3420
     agctggcgca gctgtcttta tggtacctat gtttttcttg ttcaaatggt tctttggttt      3480
     atttggtatt aatctaggat aatagataag gcttttataa aattagttga aaaactgcga      3540
     aaagagtaga aaaaaaggga aattattgat agtgttgaat gtagtataaa tgagaaaaac      3600
     cgcccatgct ttggtcggca ggcggtttct caaaaacaga aagggaatgg gtcccttata      3660
     tacatattta tgtacatatt ctatcataag gggctggttc ctgccatata aggagaggaa      3720
     ttagtttgga aaacaacaaa aataatattg tgaatttgga aaaaaaactt gctgaagcgg      3780
     aaaaaaaggc aagattaaaa gatttcaaaa ataaatcata ttcatcagaa gaagtctctg      3840
     atattcaaag atcattatta gatctaatgc aggaaattac aggtgaaaaa cattttatcg      3900
     gtaaggaaaa ggatattttt gcaggggagc cgtttaatca aactatgcat agaaatttag      3960
     atttgttgac tagaataaat tatttaacaa ctgctgagga aagctttttg tttagaattc      4020
     aagcttattt agagtttaaa agtaatgtta ttatttgcag agaagacaaa tttaaaaaga      4080
     aacgtaataa tgttgtagat gatgattatg agcttcctaa ggcagcaaca gtttcagaaa      4140
     ttgcagaaat gattggtaag tctagggaaa aaacttcttt aattatgaat tctttaaaga      4200
     aaaaagagat tttattaaat cctgaaggtg caggacaagt tagtgaaaat ggtcgttctg      4260
     taagccctag aacgtggatt gtaaatcctt atattatgat ttgtgctccg cgtaaaaacg      4320
     aagttaagtt agataaatta acaatgagat tatttcagca ttctttaaaa aaccttaaag      4380
     atccgaatgg aaaaaaagta aatttgccag ttagattttt ttaataatga ttttagatcg      4440
     tatcaaaaat gatacggtct tttttaagca tttggatttt tttaggtgtg acgaaaaggt      4500
     cacaaaacta ccctaaagtg tgacgaaaag gtcacacccc aaaaaccttg acaaacccag      4560
     tcataccaag ggctcatcgg ggtttgttaa ctttctctct attatcacta ttatttatta      4620
     gcaattcgct gatagaattg caaggatctt tttatacttt ttttcgttta aaaaaagtag      4680
     cctaaaggct aaaaaaaccg tctcaagacg gtcatctttt aatttaaaaa aactactcaa      4740
     tcaatttgag tagtttaatc tagccatatt tgccaccatt tctttttagc ttgatctttt      4800
     gacaagctag tagccatttc tttttgtgat tcttgaactt ccctcaatgt tgtaattaat      4860
     gtcttatctc gttgttctaa actatctttt atgtatgcct cttgttttag aaattgtttc      4920
     ttaaagtcct cttgctgttt ttctataatc tcattttgat tttttactaa ctgttttaac      4980
     tcgtctaatt cagacataac ggttgtgacg tgtttcgata taaccgttat gtcttctgtt      5040
     gtagcagtta tatccgttat atcggttgtg tccgtcataa ctttatcttt tataatttct      5100
     tttacagcct tgggaacagt catgcctttt tcatttttta aaacgattaa ttctttaaat      5160
     aaatttatat catcttgtga aaacaagagt tgtccttgct gattacgttt aaagttataa      5220
     ccatattctt caaaaagtaa ataatatttt ttgacagttg aagtagtaac tccaatagct      5280
     cttgctaatc cttctacttt ttcatagaat tccatgtaca tattagttat aacctccaat      5340
     ttatttagga ttataaccag tataacacca tcttgattta aaaatcttta gaattcatta      5400
     gggagaaatg ataagaacaa ttttaatact tgtttcgtac ttatcaaatt taataagtac      5460
     gaaacaagta tcaaagactt tttttaaagt tgaagggatg ctgtactaga tctctataaa      5520
     taattaaaac tgaaatatca ggaccaacat tacaaatttt aatatctata atctcaaaat      5580
     tattattttg aagaaagtca cgcaatcgtt cttcatattt atccaatgtg gtcgttaaaa      5640
     catgaatctt taatgtccta gaattaccta acataagatc atacacttct ttctatattt      5700
     gtcgtatatt acagtgtatg gagcttgtac agaatggaaa ctgcagttta tatctttttc      5760
     ttttataaaa aggatatatc taaagatgat taatgttttt aacaaaataa aaagctacct      5820
     cgccagtgga agcgaggtag ctcataaata gggttcatac gttgaaattt gtaaaaaata      5880
     gtctgattat taatatatca tattcacatg gaagatcaat tatgtggagt gtttagcata      5940
     tgaataaaag gtgcgctttt tattcatcta tttgtcactc agcccgagag gaaacgttga      6000
     taaatcaagg atgtataaaa agctgcatac tccggaaaaa gaaccctcgg cggaaccgtt      6060
     ctgcgacaag ggttcttttt tgggttgtgt tccggaaaga gtgattatgt taactacctt      6120
     tgtatatcat atacagcata aaaagagaaa aaactacctt ggttagaaga tagttttctc      6180
     tacatacatt tggtgttagg acgatgtttt gtgacatcat cagtattttg ttctaattat      6240
     ttttgtttta ttaattttga agattcactt agtaatgagt agcaatatat attaaaggct      6300
     gcttttagtt cattttatcg gttggatagt tcacttaaag tgagctaata aacataattt      6360
     atttggtaac taattataat ctttatctta attcttttca taattacaaa actgtatttg      6420
     ctaacaatgc tatataaatt tctaagtttt cttgtaatcc ttctaattgt gtctttaggt      6480
     tttctaactg ggattctaaa atcaatatgc caagagttat gtcctcaata gatcttgtta      6540
     aatcatctgc tctatcgaat tgatcttcat caaatgcttc tgatcgttct atagctcttc      6600
     ttcgaagaag gagaacacca ccgatcaacg cctcataggt atccctaatc tgtctactta      6660
     cgctcctaat gtcacgtact gtcgagagga gattgatgat caacgtttgt tgggtttgtg      6720
     taattggtgg cagaggagtt ggagttggag gagttggagg agcaacaggg gcagcagggg      6780
     ctcctgctac attaaaaaat gcattttcac ttgttaatat gttattacta ttagttagta      6840
     attttctcat taattgttga cttctattta aaagattctc gatttcttta aatgttcttt      6900
     ggctttgttt agtttcaaat gtaattcttt taaacaattc attaatatct agctcttggc      6960
     gcttacgatt ttgtttttta caattaccca ttttcaatat ttcccccttt ttgctctaat      7020
     tcctaaaagt tgttctgcta atttttcatt ttttcccaga agtttttcaa tactttcaat      7080
     tcggttattt tcacttttaa gcaatttaat taagtctcta atatctgaat cttcatcgtg      7140
     gtatttttta caattaccca tttttaaatt acctccattg atcaattttc agatgaatgt      7200
     aacaggattt ttgatagcct tgctatactt gtccttctta cgttcaccat cttttgggtt      7260
     gtaataagat ttatatatgc ttattacttc tattctctgt attatatttg ctaatagaaa      7320
     aagtgtttgt atgcttgtcc tatgatattg ataatattat agaaaacagc ctttagaagt      7380
     aactatttct aaaggctgtt tggttcttat aatattcatt atgttaacta cctttgtata      7440
     tcgtatacag cttaaaaaca gaaaaaacta ctggccatgc tctccagtag ttttttctgt      7500
     gacataatta gaagttagtc tagatgcctt tagacatctt gagtagtttg ctcaagttcg      7560
     taagaactta tgtctaatca gtagtttttt cttcatgaga tatagcaact tcatctttat      7620
     agtcaaaatc tgctttttga ctgattttcc cttcttcaaa gattacttgg aatctaatct      7680
     ttctaatatt gtcccaagat cctctaccaa atagaaatgg attcatttca taagttccag      7740
     ttccttttct aatcataatc ccttctttaa caagcttatt gatgttgtta tttaaacttt      7800
     gaactgtatt aaaccccaat tcttcagcca tttgtttttt tatgtatgca tttaaaacaa      7860
     cgatgttatc ataggccatt ctttttagaa gaacatttaa tgtcttctga ataccacttg      7920
     ataggttatt tatctgtaag atattatcta aataaatttt tacgtaatca ggttctttgg      7980
     aaacgtatga ttcttcgata tgtctttgaa atagcttttc tccatcatca ttagtaactg      8040
     tttctttaac ttccttattg attttttttc tttgtgtatc tccgattaag tccttttccc      8100
     aatctttcaa attcacacct cttttatatt ataatttata atctgtatcg tattataaaa      8160
     attagataat ttcaaggtgt tttgttataa tttataatct atttcagatt ataaattata      8220
     acaaatatga ttatgatctg taacgtatgt gattataatt tataataaat acgattatag      8280
     tttataacgt atacgattat agttaattca aagaaatgtt gttatatcaa tgtttataga      8340
     gttttatctc ttcttttctt ttattttatg tacatgtttt tttgtgttgt tttactggat      8400
     tctggaaaga ggtattatgt taactaactt gtatatgata tacagcttaa aaaaacgaaa      8460
     aaccaacctc tgagtcctaa aggttggttt ttctgctctt ggagaagaga ttcgtgttgg      8520
     acattggatg cctcacggcg tcatgagtag tttgcttaag aaataaaatt ttattcctaa      8580
     taggcaagtt acctaatcaa taacaaaaac atacagtgta ggaagaataa tttagactat      8640
     ggaatgaata actcttaacc tccgtttttt tgcacctcct tgatttatat agctaaagat      8700
     agaaaaacct atctcttctt agacaaaaga gataggtttt tctgttgcag aatttagttg      8760
     tatgagtcga tgcccgtata catcttgagt agtttgctcc aattattttt gtattattca      8820
     tctggacaat ttgcttagta atgggcagca acatatatta tgtatgacaa ataccacaac      8880
     tcttactcta ttttcatcct ttgtaaggat ggcaaacagc ccatgaatta attcatgggc      8940
     ttctttctag tagcaatata tgaactagag acctatttga agagcaagga ggttgctcaa      9000
     tattatagta tgcaaagtaa tgaaaaaggt ttggacaagc gttcatttta tctaagtttt      9060
     ctactatttc atacagccta aaaacagaaa aaactact                              9098
//