Dbfetch

ID   CP001984; SV 1; circular; genomic DNA; STD; PRO; 5428 BP.
XX
AC   CP001984; DQ418780;
XX
PR   Project:PRJNA30165;
XX
DT   21-APR-2010 (Rel. 104, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Bacillus megaterium QM B1551 plasmid pBM100, complete sequence.
XX
KW   .
XX
OS   Bacillus megaterium QM B1551
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
OG   Plasmid pBM100
XX
RN   [1]
RP   1-5428
RA   Stevenson D.M., Zhou Y., Mueller K., Jablonski L., Vary P.S.;
RT   "Replicons of the Indigenous Plasmids of Bacillus megaterium QM B1551";
RL   Plasmid 37:232-232(1997).
XX
RN   [2]
RP   1-5428
RA   Kunnimalaiyaan M., Zhou Y., Scholle M., Baisa G.A., Vary P.S.;
RT   "Discoveries within the Seven Plasmid Array of Bacillus megaterium QM
RT   B1551";
RL   Plasmid 45:142-142(2001).
XX
RN   [3]
RP   1-5428
RX   DOI; 10.1128/JB.00449-11.
RX   PUBMED; 21705586.
RA   Eppinger M., Bunk B., Johns M.A., Edirisinghe J.N., Kutumbaka K.K.,
RA   Koenig S.S., Creasy H.H., Rosovitz M.J., Riley D.R., Daugherty S.,
RA   Martin M., Elbourne L.D., Paulsen I., Biedendieck R., Braun C.,
RA   Grayburn S., Dhingra S., Lukyanchuk V., Ball B., Ul-Qamar R., Seibel J.,
RA   Bremer E., Jahn D., Ravel J., Vary P.S.;
RT   "Genome sequences of the biotechnologically important Bacillus megaterium
RT   strains QM B1551 and DSM319";
RL   J. Bacteriol. 193(16):4199-4213(2011).
XX
RN   [4]
RP   1-5428
RA   Zhou Y., Edirisinghe J.N., Vary P.S.;
RT   ;
RL   Submitted (27-FEB-2006) to the INSDC.
RL   Biological Sciences, Northern Illinois University, Montgomery 306, DeKalb,
RL   IL 60115, USA
XX
RN   [5]
RP   1-5428
RA   Eppinger M., Bunk B., Johns M.A., Edirisinghe J.N., Kutumbaka K.K.,
RA   Riley D.R., Huot-Creasy H., Koenig S.S.K., Galens K., Orvis J., Creasy T.,
RA   Biedendieck R., Braun C., Grayburn S., Jahn D., Vary P.S., Ravel J.;
RT   ;
RL   Submitted (05-FEB-2010) to the INSDC.
RL   Institute for Genome Sciences, University of Maryland School of Medicine,
RL   801 West Baltimore St, Baltimore, MD 21201, USA
XX
DR   MD5; fd41f912abff981aa601f88ae19be9f7.
DR   BioSample; SAMN02603354.
DR   EuropePMC; PMC3147683; 21705586.
DR   PubMed; 11251820.
DR   PubMed; 14602653.
DR   PubMed; 15933003.
DR   PubMed; 21705586.
XX
CC   On Apr 8, 2010 this sequence version replaced gi:91718798.
CC   Bacteria available from the Bacillus Genetic Stock Center,
CC   (http://www.bgsc.org/), The Ohio State University, 776 Biological
CC   Sciences Building, 484 West 12th Avenue, Columbus. Ohio 43210 under
CC   inventory No. 7A116 or from Patricia S. Vary (pvary@niu.edu), Dept.
CC   of Biological Sciences, Northern Illinois University, DeKalb, IL
CC   60115.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5428
FT                   /organism="Bacillus megaterium QM B1551"
FT                   /plasmid="pBM100"
FT                   /strain="QM B1551"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:545693"
FT   gene            8..190
FT                   /locus_tag="BMQ_pBM10001"
FT   CDS             8..190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM10001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM10001"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57123"
FT                   /db_xref="UniProtKB/TrEMBL:Q1PHU1"
FT                   /protein_id="ABE57123.1"
FT                   /translation="MPIMFQSESCVRFRTDILNIYIQLLTKTVCKLINVSSKIPILYPL
FT                   LFSSIGHDIIKKNGD"
FT   gene            407..1192
FT                   /locus_tag="BMQ_pBM10002"
FT   CDS             407..1192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM10002"
FT                   /product="replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM10002"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72258"
FT                   /db_xref="UniProtKB/TrEMBL:D5E383"
FT                   /protein_id="ADE72258.1"
FT                   /translation="MSLGEGWTIRKTQLQNKFSRRNVDAAWKELAIKQYAVGFSAYVDG
FT                   KKDYFYAVSDIPISQANFELLVIEQINLLQSQGKNVMTLSVIQHSPLEITEKISDVQNV
FT                   HQIQNKQISSDVRSVQHSVYNTERTPINKKETNEKLTNEKISSSPRDFIDDKLREKYNN
FT                   VPFDEVKSEMLNDTVIVDTNKQYKSLLEYRLKHWKPKQTKRKRVVRNARKEMVPKWLQT
FT                   NDENAVAEDLPVNNDFEAEKEKMKAELMQLDAELKAGNR"
FT   gene            1233..1742
FT                   /locus_tag="BMQ_pBM10003"
FT   CDS             1233..1742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM10003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM10003"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57125"
FT                   /db_xref="InterPro:IPR025052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1PHT9"
FT                   /protein_id="ABE57125.1"
FT                   /translation="MKNVSENERAYWNHEVAEQLDIGTSTLRKWCLELEENEYVFSKGE
FT                   QESRAFLKRDIDVLMNMKNEIRNKKKSLKDAAKIALEKARTGVVLVEQEQEQAPPVPVE
FT                   QAQPMFTLEDMRNIVREELQEQAKARENERDKALMGVMRELQDVKKMIAASQEVSKKKW
FT                   WEFWKT"
FT   gene            complement(2398..2745)
FT                   /locus_tag="BMQ_pBM10004"
FT   CDS             complement(2398..2745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM10004"
FT                   /product="helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM10004"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57126"
FT                   /db_xref="GOA:Q1PHT8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1PHT8"
FT                   /protein_id="ABE57126.1"
FT                   /translation="MANLRNLGREMVKAKNPELHKSLFGSTASIFGQLILEKRMSKGIS
FT                   QDDLALMANTTQKTISRVEGGNSNVTMDTYDKLFDALNISPEERGQAFLKKTERGNEVI
FT                   VGANPIYSHSY"
FT   gene            complement(2767..3309)
FT                   /locus_tag="BMQ_pBM10005"
FT   CDS             complement(2767..3309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM10005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM10005"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72259"
FT                   /db_xref="UniProtKB/TrEMBL:D5E384"
FT                   /protein_id="ADE72259.1"
FT                   /translation="MVNIVAEVISLPDLKGVDQMTDYMSMLFEDPAKDSLIKIGFITKA
FT                   MDALATVPKAQLPPRGRDAEGNHFFVGFELTTDPIDGVEYTLRPKAIKALRAEPIYELR
FT                   LSVERLNWHFRATFFPKYHPDTNQLFYCLVNPFEKEGKEGDNDDPTDENMQETYEVFKQ
FT                   VRAHFDDYRKYFDDLYQ"
FT   gene            complement(3985..4215)
FT                   /locus_tag="BMQ_pBM10006"
FT   CDS             complement(3985..4215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM10006"
FT                   /product="helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM10006"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72260"
FT                   /db_xref="GOA:D5E385"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5E385"
FT                   /protein_id="ADE72260.1"
FT                   /translation="MQCHLKKYLEEQDISVRKLSEEINERRDTINDLANNRDMNNRRIP
FT                   ASLLAKLMMYFDVTLDDLFTLIENNDKDKES"
FT   gene            4378..4752
FT                   /locus_tag="BMQ_pBM10007"
FT   CDS             4378..4752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM10007"
FT                   /product="transcriptional regulator, LuxR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM10007"
FT                   /db_xref="EnsemblGenomes-Tr:ABE57129"
FT                   /db_xref="GOA:Q1PHT5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q1PHT5"
FT                   /protein_id="ABE57129.1"
FT                   /translation="MEKAEKLLVGIENVLGMANELFDEVARLKQVEEECKILKEKLFLT
FT                   QFTRSEKEVFELALDSLSSSKMAEWLFKERSTISQQRKDICKKLGVKNIKEAVQKFQNL
FT                   HQEPQQEIHQESPQKLVNIS"
FT   gene            5019..5282
FT                   /locus_tag="BMQ_pBM10008"
FT   CDS             5019..5282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMQ_pBM10008"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMQ_pBM10008"
FT                   /db_xref="EnsemblGenomes-Tr:ADE72261"
FT                   /db_xref="GOA:D5E386"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D5E386"
FT                   /protein_id="ADE72261.1"
FT                   /translation="MDIIIRNIGKEYVKAIDEKAKALNMSRNEFLNRYLIGYAHHREAL
FT                   GREDRLEKFLNETQQQMLAFTMLMDMMTDTLRELSGLDDDES"
XX
SQ   Sequence 5428 BP; 1875 A; 873 C; 1018 G; 1662 T; 0 other;
     gatcattttg ccgattatgt ttcaatcaga aagttgtgtt cgatttcgga cagatatttt        60
     gaatatttat attcaactgt taactaaaac tgtctgcaaa ttaatcaatg tctctagtaa       120
     aattccgatt ttatacccac tcctattttc atcaatagga catgatataa taaaaaagaa       180
     cggagattga ggcctccgtt ctcttggttg tacttgttgc aatagtacgt ttatttggtt       240
     acgtatatta tagcaagtac tccaacaaaa aatcaatcgt tggaggaatt tagaaatgaa       300
     tggaattatc aaaacaataa aaacaacgca atatgctcaa atacataacg cgccattaca       360
     aacggacctg gaggacttgc ggtctatcgg tctattaagt catattatga gcttaggtga       420
     aggttggacg attaggaaga cccagttaca aaacaaattt tctcgtagaa atgtagacgc       480
     tgcttggaag gaattagcta ttaaacaata cgctgtcggt tttagcgcat atgttgacgg       540
     aaaaaaagat tatttttacg ccgtatcaga tattccgatt tcgcaagcta atttcgaatt       600
     gcttgtcatt gaacaaataa atctcttaca atcgcaaggt aaaaacgtca tgacgttaag       660
     cgtgatacaa cattcgccac ttgaaatcac tgaaaaaata tctgatgtac aaaatgtaca       720
     tcagatacaa aataagcaaa tttcttctga tgtacgttct gtacaacaca gtgtgtacaa       780
     cacagaacgt acacctataa ataaaaaaga aacaaatgaa aaattaacaa atgaaaaaat       840
     tagtagtagt ccacgtgatt ttattgatga taaattacga gaaaaatata ataatgtacc       900
     tttcgacgaa gtgaaaagtg aaatgcttaa cgatactgta atcgttgata cgaataagca       960
     atataaatca ctattagaat accgtcttaa acattggaaa ccgaagcaaa caaaaaggaa      1020
     acgtgtagta cgtaatgcac gtaaagaaat ggttccaaag tggctacaaa caaatgatga      1080
     aaatgcagta gcagaagatc ttccagtgaa taatgatttt gaagctgaaa aggaaaaaat      1140
     gaaggcggag cttatgcaat tagatgcaga attaaaagca ggtaatcgtt aataaatatt      1200
     gaattacacc tacaaaagcg agagcgaacg aggtgaagaa cgtgtcagaa aacgaacgcg      1260
     catattggaa tcatgaagta gctgaacaac ttgacatagg tacaagcaca ttaagaaaat      1320
     ggtgcttaga attggaagag aacgagtacg tgttctctaa aggcgaacaa gaaagccgag      1380
     cttttttaaa acgtgatatt gatgttttaa tgaacatgaa aaatgaaata cgaaataaga      1440
     aaaaatcact caaagatgcg gctaaaatcg cgttagaaaa ggcaagaacg ggggtcgttc      1500
     tcgtagaaca agaacaggaa caagcacccc ccgttcccgt cgaacaagca cagccgatgt      1560
     tcaccttgga ggacatgcgg aacattgtac gtgaagagct acaggaacaa gctaaagcac      1620
     gtgagaacga acgagataaa gcactaatgg gtgtcatgcg tgaattacag gatgtaaaaa      1680
     aaatgatagc tgcttctcaa gaggtaagta aaaaaaaatg gtgggagttt tggaaaacct      1740
     aattttttta gaaatcttga gtgcaatata gtttaataca tcttgagcaa cttcaatgga      1800
     gtattatcaa caacatgtaa taggttattt cataatacag agaagaagtt ttattaaaaa      1860
     atgatacctt caaggtgtat ctttttttgt agcatggtat atagcatata atattttccc      1920
     tttatgtctg ttatataggc aattacaaag ttttcttaaa gataaggtca agtgggatgc      1980
     aattttcgag attgttattg atagatacta taaattacgt aagtaattat gtattatcaa      2040
     agctgctttt tttctcctgt tttgtttgta tgatgaatgg gggagacggc ggcaaggatg      2100
     aaggtataag aaaagccctc aagatttgtt gagggctttt cttacatgtt tggttgatta      2160
     tagctactgt ggtaaagagc ttgctttttt caatgtattc ctgaacaagg ttgaacaaat      2220
     agctttggga ataaataagt ggttggaaaa gttgtgggtt atttaaaaaa tagataaata      2280
     acagggagac gagaaatgat cctttaaaaa cgatttatta aattcatctt ttcttaatgt      2340
     ttgtaaggga gaataagtca aaaagacctg tagttgtgtg actacagatc ttgtctctta      2400
     ataactgtgg gagtagattg gattcgctcc tacaattacc tcgttccccc gttcagtctt      2460
     ttttaagaaa gcttgacccc tttcttctgg actgatatta agagcgtcaa acagcttgtc      2520
     atacgtgtcc attgtcacgt tgctgttccc gccctctaca cgagagattg ttttttgtgt      2580
     tgtattagcc attaaagcaa ggtcatcttg tgatatgcct ttgctcatac gcttctctag      2640
     gattagttgc ccgaagatag aggctgtact gccaaataaa gatttgtgca actcaggatt      2700
     tttagccttc accatttccc tacctaaatt ccgtaggttt gccatgaaaa atcatctcct      2760
     tatagcttat tggtagaggt catcaaaata tttacggtaa tcatcgaaat gtgcccttac      2820
     ttgtttaaac acctcgtacg tttcctgcat gttttcatct gttgggtcat cgttatctcc      2880
     ttctttccct tctttttcga aaggattcac taaacaatag aaaagttggt tagtatcagg      2940
     atgatattta gggaagaagg tagcacgaaa atgccaattt aatcgctcga cgcttaatcg      3000
     taactcataa attggttctg cacgtaatgc cttaatagcc tttggacgta aagtgtactc      3060
     tactccgtca attgggtctg ttgttaattc aaaccctacg aagaaatgat ttccctctgc      3120
     gtctctacct ctaggtggta attgagcttt gggaacagtc gctagtgcat ccattgcttt      3180
     agtgataaac ccgattttga ttaaggaatc tttggcgggg tcttcaaata acatagacat      3240
     gtaatccgtc atctgatcta caccttttaa atcgggtaat gagataacct ctgctactat      3300
     atttaccata catcatatca tataatacct aaattgtgaa aaaatttaag gcgtatatga      3360
     cgtttccccc ctttgatgta aaattaacgc cttttacagc gatatataaa ttttaatata      3420
     aaaaattaaa aaaaggggaa aaacttcctt tttaattaag tgagataaaa agattaaaat      3480
     ggtgtttttt tatgcaggta tttcaagcgc gttattcaca gaaacgttgt taaatcaaca      3540
     atgtataaaa agatgcataa tcaagaaaac tcttctttct gcgagccctt gcctcccaag      3600
     gtttcttttt tgtggtgggt tccggaaaga gtgtttatgt aaactagctt tgtatatcgt      3660
     atacataccc aaatgtttct tatctagtaa aagaatggtg atataattat aaatagatct      3720
     acacagggag taagaatatg atgaatccaa aagaaaagca aagttccaaa tttagcgttg      3780
     tgtttaagtc ctacgaacaa tttttgaaga agattttaaa tatgttcttt actagatgat      3840
     atttcataca aaaaaggctt ttaagaaata taacacttaa aagctttttt tggtgcctat      3900
     aagctgtttt atgttaacta gaaagaaata tataaacata tacatagcac tttttattga      3960
     ttaaaaagct gagtacatta gttctcagct ttctttatct ttatcgttat tttcaattag      4020
     cgtaaacaaa tcgtccaacg ttacatcaaa atacatcatc aatttagcta gtaaactggc      4080
     tggtattcgt ctgttattca tatcacggtt gttcgccaaa tcgtttattg tatcgcgtct      4140
     ttcattgatt tcttcagata atttccttac agaaatgtct tgctcttcta aatatttttt      4200
     tagatgacat tgcaatttta cgttctccaa aattgacctc cttctcaaaa aaattcaata      4260
     ttttattgac ctttcattat gtaagatgct atatttatgt taacaatttg acacgtttaa      4320
     cgtgccgata actgaattgt ttattccatt tattttaaca tatgggagct gattcaaatg      4380
     gaaaaagctg aaaaattgtt agtggggatc gaaaatgttt taggcatggc taatgaactt      4440
     tttgacgagg tagcacgttt gaaacaagtc gaggaggagt gtaaaatcct aaaagaaaaa      4500
     ttgtttttga cccaatttac acgctcggaa aaagaagtgt ttgaactcgc acttgacagt      4560
     ctttcatctt caaaaatggc tgaatggcta ttcaaagaac ggagcacaat ttcacaacaa      4620
     cgtaaggata tttgcaaaaa attaggcgtt aaaaatatca aagaagcagt acaaaaattt      4680
     caaaaccttc accaagaacc gcaacaagaa atccaccaag aatcaccaca aaaactcgta      4740
     aacatttcat aaaaaatgaa aaaagcgtat cgacagcagg tgcccacgag gggaatcagc      4800
     cacctaaata gttgaaaata tggaatattt ttagggggtt gaagggacat tgcaaacgtt      4860
     ttcagtgtac ccactggaaa aaatcgtggt atcacggtta agctaggctc tgcctagcct      4920
     agcacagtat gtgatagcaa aaacccctta tgctctttcg aagaaataac ggattaattt      4980
     ccagttacta ttttttttga aaaaaggagt tggttttttt ggatattatt attcgcaata      5040
     tcggcaaaga atacgtcaaa gcaattgatg aaaaagcgaa ggcattgaac atgtctcgca      5100
     atgaattttt gaacagatat ttaatcggat acgcacatca tcgggaagca cttgggaggg      5160
     aagaccgact ggaaaagttt cttaatgaaa cacaacagca aatgttagct ttcacaatgc      5220
     taatggatat gatgacagat actttacgag aattaagtgg attggacgat gatgaatcgt      5280
     aatcatatga cggttttttt atttaagggt cttctgaaac acgaggcaat acagcaaacg      5340
     tacgaaaatc gcctgtattt gatttttgat gtgtcggaag ataaataatt gccttatcat      5400
     taaaaacgtc atataaggca atatggaa                                         5428
//