spacer

EBI Dbfetch

ID   CP001940; SV 1; circular; genomic DNA; STD; PRO; 3097763 BP.
XX
AC   CP001940; ACYL01000000-ACYL01000066;
XX
PR   Project:PRJNA33629;
XX
DT   30-MAY-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Desulfurivibrio alkaliphilus AHT2, complete genome.
XX
KW   .
XX
OS   Desulfurivibrio alkaliphilus AHT2
OC   Bacteria; Proteobacteria; Deltaproteobacteria; Desulfobacterales;
OC   Desulfobulbaceae; Desulfurivibrio.
XX
RN   [1]
RP   1-3097763
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Detter J.C., Han C., Tapia R., Larimer F.,
RA   Land M., Hauser L., Kyrpides N., Mikhailova N., Sorokin D.Y., Muyzer G.,
RA   Woyke T.;
RT   "Complete sequence of Desulfurivibrio alkaliphilus AHT2";
RL   Unpublished.
XX
RN   [2]
RP   1-3097763
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Detter J.C., Han C., Tapia R., Larimer F.,
RA   Land M., Hauser L., Kyrpides N., Mikhailova N., Sorokin D.Y., Muyzer G.,
RA   Woyke T.;
RT   ;
RL   Submitted (16-FEB-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; b22ef6b2bcf8f8bf855ae9c71b6837bd.
DR   BioSample; SAMN02598502.
DR   EnsemblGenomes-Gn; DaAHT2_R0001.
DR   EnsemblGenomes-Gn; DaAHT2_R0002.
DR   EnsemblGenomes-Gn; DaAHT2_R0003.
DR   EnsemblGenomes-Gn; DaAHT2_R0004.
DR   EnsemblGenomes-Gn; DaAHT2_R0005.
DR   EnsemblGenomes-Gn; DaAHT2_R0006.
DR   EnsemblGenomes-Gn; DaAHT2_R0007.
DR   EnsemblGenomes-Gn; DaAHT2_R0008.
DR   EnsemblGenomes-Gn; DaAHT2_R0009.
DR   EnsemblGenomes-Gn; DaAHT2_R0010.
DR   EnsemblGenomes-Gn; DaAHT2_R0011.
DR   EnsemblGenomes-Gn; DaAHT2_R0012.
DR   EnsemblGenomes-Gn; DaAHT2_R0013.
DR   EnsemblGenomes-Gn; DaAHT2_R0014.
DR   EnsemblGenomes-Gn; DaAHT2_R0015.
DR   EnsemblGenomes-Gn; DaAHT2_R0016.
DR   EnsemblGenomes-Gn; DaAHT2_R0017.
DR   EnsemblGenomes-Gn; DaAHT2_R0018.
DR   EnsemblGenomes-Gn; DaAHT2_R0019.
DR   EnsemblGenomes-Gn; DaAHT2_R0020.
DR   EnsemblGenomes-Gn; DaAHT2_R0021.
DR   EnsemblGenomes-Gn; DaAHT2_R0022.
DR   EnsemblGenomes-Gn; DaAHT2_R0023.
DR   EnsemblGenomes-Gn; DaAHT2_R0024.
DR   EnsemblGenomes-Gn; DaAHT2_R0025.
DR   EnsemblGenomes-Gn; DaAHT2_R0026.
DR   EnsemblGenomes-Gn; DaAHT2_R0027.
DR   EnsemblGenomes-Gn; DaAHT2_R0028.
DR   EnsemblGenomes-Gn; DaAHT2_R0029.
DR   EnsemblGenomes-Gn; DaAHT2_R0030.
DR   EnsemblGenomes-Gn; DaAHT2_R0031.
DR   EnsemblGenomes-Gn; DaAHT2_R0032.
DR   EnsemblGenomes-Gn; DaAHT2_R0033.
DR   EnsemblGenomes-Gn; DaAHT2_R0034.
DR   EnsemblGenomes-Gn; DaAHT2_R0035.
DR   EnsemblGenomes-Gn; DaAHT2_R0036.
DR   EnsemblGenomes-Gn; DaAHT2_R0037.
DR   EnsemblGenomes-Gn; DaAHT2_R0038.
DR   EnsemblGenomes-Gn; DaAHT2_R0039.
DR   EnsemblGenomes-Gn; DaAHT2_R0040.
DR   EnsemblGenomes-Gn; DaAHT2_R0041.
DR   EnsemblGenomes-Gn; DaAHT2_R0042.
DR   EnsemblGenomes-Gn; DaAHT2_R0043.
DR   EnsemblGenomes-Gn; DaAHT2_R0044.
DR   EnsemblGenomes-Gn; DaAHT2_R0045.
DR   EnsemblGenomes-Gn; DaAHT2_R0046.
DR   EnsemblGenomes-Gn; DaAHT2_R0047.
DR   EnsemblGenomes-Gn; DaAHT2_R0048.
DR   EnsemblGenomes-Gn; DaAHT2_R0049.
DR   EnsemblGenomes-Gn; DaAHT2_R0050.
DR   EnsemblGenomes-Gn; DaAHT2_R0051.
DR   EnsemblGenomes-Gn; DaAHT2_R0052.
DR   EnsemblGenomes-Gn; DaAHT2_R0053.
DR   EnsemblGenomes-Gn; DaAHT2_R0054.
DR   EnsemblGenomes-Gn; DaAHT2_R0055.
DR   EnsemblGenomes-Gn; DaAHT2_R0056.
DR   EnsemblGenomes-Gn; DaAHT2_R0057.
DR   EnsemblGenomes-Tr; DaAHT2_R0001.
DR   EnsemblGenomes-Tr; DaAHT2_R0002.
DR   EnsemblGenomes-Tr; DaAHT2_R0003.
DR   EnsemblGenomes-Tr; DaAHT2_R0004.
DR   EnsemblGenomes-Tr; DaAHT2_R0005.
DR   EnsemblGenomes-Tr; DaAHT2_R0006.
DR   EnsemblGenomes-Tr; DaAHT2_R0007.
DR   EnsemblGenomes-Tr; DaAHT2_R0008.
DR   EnsemblGenomes-Tr; DaAHT2_R0009.
DR   EnsemblGenomes-Tr; DaAHT2_R0010.
DR   EnsemblGenomes-Tr; DaAHT2_R0011.
DR   EnsemblGenomes-Tr; DaAHT2_R0012.
DR   EnsemblGenomes-Tr; DaAHT2_R0013.
DR   EnsemblGenomes-Tr; DaAHT2_R0014.
DR   EnsemblGenomes-Tr; DaAHT2_R0015.
DR   EnsemblGenomes-Tr; DaAHT2_R0016.
DR   EnsemblGenomes-Tr; DaAHT2_R0017.
DR   EnsemblGenomes-Tr; DaAHT2_R0018.
DR   EnsemblGenomes-Tr; DaAHT2_R0019.
DR   EnsemblGenomes-Tr; DaAHT2_R0020.
DR   EnsemblGenomes-Tr; DaAHT2_R0021.
DR   EnsemblGenomes-Tr; DaAHT2_R0022.
DR   EnsemblGenomes-Tr; DaAHT2_R0023.
DR   EnsemblGenomes-Tr; DaAHT2_R0024.
DR   EnsemblGenomes-Tr; DaAHT2_R0025.
DR   EnsemblGenomes-Tr; DaAHT2_R0026.
DR   EnsemblGenomes-Tr; DaAHT2_R0027.
DR   EnsemblGenomes-Tr; DaAHT2_R0028.
DR   EnsemblGenomes-Tr; DaAHT2_R0029.
DR   EnsemblGenomes-Tr; DaAHT2_R0030.
DR   EnsemblGenomes-Tr; DaAHT2_R0031.
DR   EnsemblGenomes-Tr; DaAHT2_R0032.
DR   EnsemblGenomes-Tr; DaAHT2_R0033.
DR   EnsemblGenomes-Tr; DaAHT2_R0034.
DR   EnsemblGenomes-Tr; DaAHT2_R0035.
DR   EnsemblGenomes-Tr; DaAHT2_R0036.
DR   EnsemblGenomes-Tr; DaAHT2_R0037.
DR   EnsemblGenomes-Tr; DaAHT2_R0038.
DR   EnsemblGenomes-Tr; DaAHT2_R0039.
DR   EnsemblGenomes-Tr; DaAHT2_R0040.
DR   EnsemblGenomes-Tr; DaAHT2_R0041.
DR   EnsemblGenomes-Tr; DaAHT2_R0042.
DR   EnsemblGenomes-Tr; DaAHT2_R0043.
DR   EnsemblGenomes-Tr; DaAHT2_R0044.
DR   EnsemblGenomes-Tr; DaAHT2_R0045.
DR   EnsemblGenomes-Tr; DaAHT2_R0046.
DR   EnsemblGenomes-Tr; DaAHT2_R0047.
DR   EnsemblGenomes-Tr; DaAHT2_R0048.
DR   EnsemblGenomes-Tr; DaAHT2_R0049.
DR   EnsemblGenomes-Tr; DaAHT2_R0050.
DR   EnsemblGenomes-Tr; DaAHT2_R0051.
DR   EnsemblGenomes-Tr; DaAHT2_R0052.
DR   EnsemblGenomes-Tr; DaAHT2_R0053.
DR   EnsemblGenomes-Tr; DaAHT2_R0054.
DR   EnsemblGenomes-Tr; DaAHT2_R0055.
DR   EnsemblGenomes-Tr; DaAHT2_R0056.
DR   EnsemblGenomes-Tr; DaAHT2_R0057.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP001940.
DR   SILVA-SSU; CP001940.
DR   StrainInfo; 833593; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4084538
CC   Source DNA and bacteria available from Gerard Muyzer
CC   (g.muijzer@tudelft.nl)
CC   Contacts: Gerard Muyzer (g.muijzer@tudelft.nl)
CC        Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Desulfurivibrio alkaliphilus AHT2
CC   Culture Collection ID :: DSM 19089
CC   GOLD Stamp ID         :: Gi02998
CC   Funding Program       :: DOE-CSP 2008
CC   Isolation Site        :: Sediments from a highly alkaline saline
CC                            soda lake in Egypt
CC   Isolation Country     :: Egypt
CC   Latitude              :: 30.418502
CC   Longitude             :: 30.333323
CC   Oxygen Requirement    :: Anaerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3097763
FT                   /organism="Desulfurivibrio alkaliphilus AHT2"
FT                   /strain="AHT2"
FT                   /mol_type="genomic DNA"
FT                   /country="Egypt"
FT                   /isolation_source="sediment from highly alkaline soda lake"
FT                   /note="type strain of Desulfurivibrio alkaliphilus"
FT                   /db_xref="taxon:589865"
FT   gene            505..1860
FT                   /locus_tag="DaAHT2_0001"
FT   CDS             505..1860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   dps:DP0278 chromosomal replication initiator protein DnaA;
FT                   SMART: Chromosomal replication initiator DnaA domain"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84718"
FT                   /db_xref="GOA:D6Z561"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z561"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADH84718.1"
FT                   /translation="MIWPEVRKILQHQLPESVFNLWIEPLRCLAEDDQVLELAGPDRFF
FT                   CSWVADHYHAAMQEALQRLEKPGVGIRFRVDPELVSDDTAGAGADGRVGKEQLRLPQMP
FT                   KGRPRIRTLHPRYTFDEFMVGESNALAFTACEAIAAGGAEAEPCVFINAGTGLGKSHLA
FT                   HAVAHHLYNHSPSTRLCCLTTQQLTAELVRHIRSNTMDQFKEKFQRQCDVLLVEDVQTL
FT                   SGRGKTQVELAEAVDCLLENGRRVLFTGAVGPREIPDLDDGVRSRLASGLVTSINPPDM
FT                   QTRRLIIQRKAAYHKLALDEEMVEFLAEKVRGDVRRLESAIVGLKAKANLRKSQPTMAM
FT                   VKEVVATVVGGDGGGLSAEAIRDFVAAQFQVSVGELQSKSRKKDVAFPRQVSMYLARKL
FT                   TDEALAGIGKAFNRDHSTVVHSIRVITEAVARNGSVRGQVEHLTEKLKQRQK"
FT   gene            complement(1851..3248)
FT                   /locus_tag="DaAHT2_0002"
FT   CDS             complement(1851..3248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0002"
FT                   /product="protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="TIGRFAM: protoporphyrinogen oxidase; KEGG:
FT                   dps:DP0277 protoporphyrinogen oxidase; PFAM: amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84719"
FT                   /db_xref="GOA:D6Z562"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR004572"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR027418"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z562"
FT                   /inference="protein motif:TFAM:TIGR00562"
FT                   /protein_id="ADH84719.1"
FT                   /translation="MDQQHAVIIVGAGLSGLATAHFLAAAGTPALLLEADGRAGGAIRS
FT                   FNDEGYRAEWGPHGFLDNNPASRQLLQETGLEQEALKAPLGQNVRYVCHHGRLVALPQS
FT                   PQALLTTPLLSLAGKLRLALEPFKKTLADGASIGQWAEHRFGREVLPLVDAAVTGTFAG
FT                   DYQRLSIDAVMPGVRRLEKEHGSLLRGLWRERRQRRSKPPATTGAKSGPAGLPAMTSFP
FT                   QGMEQLITRLSQQKEIVYQCRVEKIRPLTEGGWEITTNSGPYQAKRLVLALPVNQALEL
FT                   LADFKPPVGSVPEARIVTVALGFSRDEATIPAGFGYLAPERENRFTLGALFSSHMFPER
FT                   APAGHVLLEALVGGRRHPERLELDDAAMIANIYQDLRQLLPLKAPPAFARVLRGAGGIP
FT                   QLEQDHPRLLAWREKLATRHPSLQLTGFGWDGIGMNDMMKAAQKAAELITRGRQEEEQA
FT                   AVRPVYF"
FT   gene            3537..4214
FT                   /locus_tag="DaAHT2_0003"
FT   CDS             3537..4214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0003"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP3069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84720"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z563"
FT                   /inference="similar to AA sequence:KEGG:DP3069"
FT                   /protein_id="ADH84720.1"
FT                   /translation="MPSAPVRVLVLFYSYSGQSSVLIRRLVAGLSDEGVEVCQERLQPR
FT                   QLLRFPLGSVVKTIWLMIITFFRTRFAIQPLAVSDDDPFDLVVLAGPTWSWSPSGPVLT
FT                   LLDQHPGLFRQRPVLAVISCRGYWRAHWRYLRKRLTGLGADPFGPLVFSHPQREPWRTI
FT                   GVFLKVAGMAPERSSSLFSRLYPRFGHTRQQCDEAYALGRQLATRLKSGVGAEKVRDFK
FT                   CLP"
FT   gene            complement(4239..4766)
FT                   /locus_tag="DaAHT2_0004"
FT   CDS             complement(4239..4766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0004"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="TIGRFAM: cob(I)alamin adenosyltransferase; KEGG:
FT                   sfu:Sfum_1039 cob(I)alamin adenosyltransferase; PFAM:
FT                   ATP:corrinoid adenosyltransferase BtuR/CobO/CobP"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84721"
FT                   /db_xref="GOA:D6Z564"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z564"
FT                   /inference="protein motif:TFAM:TIGR00708"
FT                   /protein_id="ADH84721.1"
FT                   /translation="MTTGLFIIYTGHGKGKTCAAFGQALRAVGQGLRVCLIQFVKSRAC
FT                   GELHALEKLAATTGLVEIHQVGSGFSWRDREMTRFRESALAGWQLACRKLEADSCDLLI
FT                   LDEFSYLIHFGILKAGEVLPIFQQRPATMHLLVTGRDPGAELLTAADLVTEMQEIRHPF
FT                   QKGIKAQKGIEW"
FT   gene            complement(4763..6586)
FT                   /locus_tag="DaAHT2_0005"
FT   CDS             complement(4763..6586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0005"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="KEGG: dps:DP0525 hypothetical protein; PFAM:
FT                   peptidase M48 Ste24p; SMART: Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84722"
FT                   /db_xref="GOA:D6Z565"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z565"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADH84722.1"
FT                   /translation="MPYNNLIYLLVVIIILATRGIPDEPAFSGPVTFLLLAGKTLLFAA
FT                   LCHYYFRRPGPFQASAYFSLEKRLSILAVFNFALDVYLLDIKFYFASLPGSTLLPTLVP
FT                   YAGVALFLCYLVLVWNRSRPAYNLIFGGNHSGQAFLLSNLKLNLVILLPWLLITFVADL
FT                   LRLTPLEPVKRLLTSAWGEPLLILTFFLLLLLVFPWLATRLWGCQPLPDGPLRRRLEEF
FT                   CRHHRVGFREIMLWPLFEGRLLTAGVMGLSRHFRYLLITPGLLQTVNQEELEAVVAHEI
FT                   GHVRHRHLPLYLLFFLGFALLAHLASLPMLAVLLNSELLGGLMAVSGQTAGAIISLLGT
FT                   VTLLTLVIVYFRFIFGFFMRNFERQADLYALSAMGHAAPLIRVFEKIAGPDGRIRDLPS
FT                   WHHFSLGQRIDFLAACDDNPRLIKQHHRKVGRAMGLFLLLLLGLLLAFWQLPGEQAEEQ
FT                   ARLRLAEIIIKEEIRREPENPVWRQHLGDLRYFQGEYRAAIGAYEEALGLAPEHPDVLN
FT                   NLAWLLLTAEDTAVHDYPRALELALQAAALAPQAHILDTLAMAWWRNGERDKAVAAAKA
FT                   ALAASDNGRYYRQQLEKFRRQAPPQPPEPKP"
FT   gene            complement(6597..7475)
FT                   /locus_tag="DaAHT2_0006"
FT   CDS             complement(6597..7475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0006"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   gsu:GSU2756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84723"
FT                   /db_xref="GOA:D6Z566"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z566"
FT                   /inference="protein motif:PFAM:PF00226"
FT                   /protein_id="ADH84723.1"
FT                   /translation="MTLMLAEKDLYRACEVIFGPELDISRDFLEYLQLSGVKCAYRKRA
FT                   LETHPDRFAATGHLPPEHQDGLHFHDVQQAYESLRQYLEAREKGIIIPGKEPAGQRQRP
FT                   AGNSCRPRTTPGRNRHSGSNQAGARSQAGSSNKQGQRSGTIHPFWDIDALYRGPLPNRR
FT                   LLLGHFLYYSGVASWRNIVQALAWQRSQRPRIGEISRRYGLLNDREIAMVLNTRQANQR
FT                   FGETAHALGLLTDPQLRLLIQAQKRLQRKFGEYFVAENILTREKLARLLAAYHRHNNRL
FT                   FREFTGQRSFL"
FT   gene            7735..9351
FT                   /locus_tag="DaAHT2_0007"
FT   CDS             7735..9351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0007"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="KEGG: dps:DP0796 glucose-6-phosphate isomerase;
FT                   PFAM: phosphoglucose isomerase (PGI)"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84724"
FT                   /db_xref="GOA:D6Z567"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z567"
FT                   /inference="protein motif:PRIAM:5.3.1.9"
FT                   /protein_id="ADH84724.1"
FT                   /translation="MTGADDYLVDFTSYKSYSALRSLAAEPFNLKTPGVMSPERIAACR
FT                   AVGGGFELLFFGQRVARPELAALQELADEARLVEQFAALRRGAVFNRIAGFASEERQVL
FT                   HCSCRDIFRDRPAEPHATAQAKAELDKLQQFLADLDQGRLTTPQGEPFTGMIQIGIGGS
FT                   DLGPRALYLALQAYAHPDRRVEFISNVDPDDAARVLKEMDLSRTLVNVVSKSGTTLETL
FT                   ANEELVRRAYRQAGLDPNAYFVAVTGQGSPMDNPANYLRSFYMFDYIGGRYSATSMVGL
FT                   VMLGFALGYEPVQEILQGAHAADEAAMEPDIMKNPALLLALLGIWNRNFLRHESLAVLP
FT                   YSQALVRFAAHLQQLDMESNGKSIDRRGQALNWDSGPIVWGEPGTNGQHAFYQLLHQGT
FT                   GQAPAEFIGFRHSQYGQDLEIQETTAQEKLLANLLAQSLALAVGQDDPNPNRRFPGNRP
FT                   SSILLADRLTPERMGALLALYEAKVVFQGFVWNINSFDQEGVQLGKRLANRLLEQFAAR
FT                   RRGENPPEDPVGQALLKNAGL"
FT   gene            complement(9595..10887)
FT                   /locus_tag="DaAHT2_0008"
FT   CDS             complement(9595..10887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0008"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="TIGRFAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; KEGG: dps:DP3011
FT                   3-phosphoshikimate 1-carboxyvinyltransferase; PFAM: EPSP
FT                   synthase (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84725"
FT                   /db_xref="GOA:D6Z568"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z568"
FT                   /inference="protein motif:TFAM:TIGR01356"
FT                   /protein_id="ADH84725.1"
FT                   /translation="MKEQNEWQEITPCGPITAAVEVPGSKSITQRALIAAALAKGESIL
FT                   RGPLASEDTDYTTKALLAMGMVIDTGRDKWRIFGQGGRVAPPATEIYLGNNGTATRFLT
FT                   SVAALGRGIFLINGDERMQQRPIEPLLQALRGWGVQIRSIQGTGCPPLEIQADGLAGGA
FT                   TVLPEGKSSQYLSSLLLVSPYARQPAELKVEGEVLSKPYVAMTLAVMRDFGIEAEAAPE
FT                   LNHFKIPQGIYQGREYRVEGDASSASYFWAAAAVTGGKVTVTNVPSPSLQGDAVLVDIL
FT                   EQMGCRVERDQAGISVAAPDELRGVEVDMGDCPDVVPTLAVVAALAQGRTRINNIAHLR
FT                   IKECDRLGVMAAELAKLGVKTEEGPDYLVVEGRGRQHDYQGAEIATHNDHRIAMSFAVA
FT                   SLAIPGIRIENPGCVKKSFPDFWQRLESILP"
FT   gene            complement(11099..11911)
FT                   /locus_tag="DaAHT2_0009"
FT   CDS             complement(11099..11911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0009"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="KEGG: dps:DP3012 shikimate 5-dehydrogenase; TIGRFAM:
FT                   shikimate 5-dehydrogenase; PFAM: Shikimate dehydrogenase
FT                   substrate binding domain protein; Shikimate/quinate
FT                   5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84726"
FT                   /db_xref="GOA:D6Z569"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z569"
FT                   /inference="protein motif:TFAM:TIGR00507"
FT                   /protein_id="ADH84726.1"
FT                   /translation="MLKIDGSTEVYGIIGNPVRHSRSPAMHNAAFAACGLNKVYVPLPA
FT                   LDGAAAVAAIRTLGIAGASVTIPHKETVIEQLDKVDPVAARIGAVNTIVRRGDELHGAN
FT                   TDWLGANQALGEALELAGAKVLLLGAGGSARAIGFGLREAGAKVILASRTPERGQELAQ
FT                   QLDCPWVPLEQAAEQAANALVNATSVGMAPLAEQSPLPAAALAAFPVVMDIVYSPLQTR
FT                   LLREAEAAGCHCIDGLAMLLYQGAAQFTMWTNQEAPLAIMRQTLLENL"
FT   gene            complement(11978..12847)
FT                   /locus_tag="DaAHT2_0010"
FT   CDS             complement(11978..12847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0010"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: dps:DP3013 3-dehydroquinate dehydratase; PFAM:
FT                   dehydroquinase class I"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84727"
FT                   /db_xref="GOA:D6Z570"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z570"
FT                   /inference="protein motif:PRIAM:4.2.1.10"
FT                   /protein_id="ADH84727.1"
FT                   /translation="MTPATIASRICVSIARRSLGEFPPAAATAARGAELVEIRLDALSD
FT                   RSTTMEAVQSLPTAVQAPLLFTNRPQWEGGEAREPEEQRLAPLLAALAADRAWVDIELR
FT                   TAPDLRRQVIEAARRGSTGGRRLFWTHDPDRADGANKTGKPDKVGQPDKVDRSGNAEKA
FT                   ENLAAQNIFSTSRVIVSWHDFTGTPDAAALRAILREQYESGADMGKMVTMAHSPLDVLR
FT                   ALALLEQAAELNFPLIVFCMGDRGKISRLATCLLGGFMTYAAEDGGSATAPGQLPASKL
FT                   RQLENLLQ"
FT   gene            12947..13486
FT                   /locus_tag="DaAHT2_0011"
FT   CDS             12947..13486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0011"
FT                   /product="2'-5' RNA ligase"
FT                   /note="KEGG: gme:Gmet_3530 2',5' RNA ligase; TIGRFAM: 2'-5'
FT                   RNA ligase; PFAM: Phosphoesterase HXTX"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84728"
FT                   /db_xref="GOA:D6Z571"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z571"
FT                   /inference="protein motif:TFAM:TIGR02258"
FT                   /protein_id="ADH84728.1"
FT                   /translation="MYRLFTAIDLPPELAARLAAMGFGLPGARWVPEEQLHLTLRFIGE
FT                   VDGGIFHEIREALADVRAEPFTMHLQGFGCFPPRGPARILWAGVEPVPPVAALYRKVEN
FT                   VLVRRGLVAPEKRKFAPHVTVARLQQAPKSRLGNFLAGNNLYRSEEFTVDQFHLYSSQL
FT                   TNKGAIHYLEASYDLR"
FT   gene            13817..14602
FT                   /locus_tag="DaAHT2_0012"
FT   CDS             13817..14602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0012"
FT                   /product="chain A, iron Centre cytochrome c protein"
FT                   /note="KEGG: dhd:Dhaf_3269 chain A, iron Centre cytochrome
FT                   c protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84729"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z572"
FT                   /inference="similar to AA sequence:KEGG:Dhaf_3269"
FT                   /protein_id="ADH84729.1"
FT                   /translation="MEQEAKVTKKVEGIDLSRREMLIGAGALMAGVAASQLGVLNTAKA
FT                   AQASNGEVWPWPYEKLDPARVGETAYHAWYDVFCSQAVTTGLFEQLREKVGEPWSSFPI
FT                   NSLRFGMGGMLGWGLTCGAPVSGALVIGLVTPAEVATPMVRDLLGWYANTPMPVYSPQN
FT                   GRYNGEIPKSVAQSPLCHQSVGRWMKTADRPFGSDERRHRCASVTASVAYRTAEMLNDW
FT                   KDGKYVVPADNWDGAAAMGLPSQQNCMSCHSDGVPSPPR"
FT   gene            complement(14672..15895)
FT                   /locus_tag="DaAHT2_0013"
FT   CDS             complement(14672..15895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0013"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="KEGG: dps:DP0257 bifunctional
FT                   2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase/2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase protein; TIGRFAM:
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; PFAM:
FT                   MECDP-synthase; 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84730"
FT                   /db_xref="GOA:D6Z573"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR026596"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z573"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ADH84730.1"
FT                   /translation="MAQKPDSAAIIAAGGSGTRMGGELPKQFLELAGIPLFVHCVQAFA
FT                   AVPEVGRIVVVARSDYLTAARQMLARHDLADVLVVAGGASRQDSVACGLAALAALPERY
FT                   ELVAVHDGARPLVSPNLIQRTLAAARRQGAAIAALPVRDTLKKAGAAEGNANLPLIDST
FT                   ISRTGLWQAQTPQAARFILLQKALAAADTDGFTGTDEASLLERIGCPVALVEGESANFK
FT                   ITTPQDLPLAQATLASTSLPVTGHGDRLPLPRIGHGYDVHRLVTDRPLILGGVTIEHHL
FT                   GLLGHSDADVLTHALCDAILGALGAGDIGRHFPDNDQQYRGISSLKLLAQVMTKVWAAN
FT                   CRLHHADLTIIAEKPKLAPQLAAMQANLAAACQVNPSQINLKATTTEGLGFAGREEGIA
FT                   AHAVALLL"
FT   gene            complement(16032..16331)
FT                   /gene="rnpB"
FT                   /locus_tag="DaAHT2_R0001"
FT   ncRNA           complement(16032..16331)
FT                   /gene="rnpB"
FT                   /locus_tag="DaAHT2_R0001"
FT                   /product="RNA component of RNaseP"
FT                   /note="Bacterial RNase P class A as predicted by Rfam
FT                   (RF00010), score 259.89"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            complement(16460..17185)
FT                   /locus_tag="DaAHT2_0014"
FT   CDS             complement(16460..17185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0014"
FT                   /product="protein of unknown function DUF164"
FT                   /note="PFAM: protein of unknown function DUF164; KEGG:
FT                   dps:DP0633 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84731"
FT                   /db_xref="InterPro:IPR003743"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z574"
FT                   /inference="protein motif:PFAM:PF02591"
FT                   /protein_id="ADH84731.1"
FT                   /translation="MKDEIAQLKALQTIDLEISALEEQLTAVDSELEKRRQTIQEYQQT
FT                   AEQLRETQNSLSQRKQELETGLEEDLEKIRDRQAKMMNIQTNREYQSLLKESDDAKKAN
FT                   KEREEELLRIAEELEELEKKIEETDNLRSGEEKLLKEDTKKAEKRHAALTNDKEKIIKK
FT                   RNTKVKNVPPAMLKKYDTLRERRNGLALAGVEAGVCRGCFMNIPPQLYNDLLKEERLLL
FT                   CPTCNRIMFPQEAEEKEKV"
FT   gene            complement(17239..18069)
FT                   /locus_tag="DaAHT2_0015"
FT   CDS             complement(17239..18069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0015"
FT                   /product="protein of unknown function DUF34"
FT                   /note="PFAM: protein of unknown function DUF34; KEGG:
FT                   dps:DP0634 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84732"
FT                   /db_xref="GOA:D6Z575"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z575"
FT                   /inference="protein motif:PFAM:PF01784"
FT                   /protein_id="ADH84732.1"
FT                   /translation="MSITFTVNKLLKLLDSFSPFARTEEWDNTGLLVGDGQREVRGILL
FT                   ALDPTEDLLAECQAHQCNTIITHHPLIFKPLSQLRPDLPPGRLLFTAVHQGINIIACHT
FT                   NLDVVPGGVSEALALRLGLHNLQVLHPTAPPPADDREGIGFGRIGELTEPIGGDDFLAR
FT                   LLTALELEAAPVAGPLPAMVRKVAVCGGSGSDLAAAAHRAGADIYVSGEIKHAVARWAE
FT                   MEEFCLVDAGHYHSENPIIEGLTARLARELAAAGHDLPVLSSRRQQSPFRLHKK"
FT   gene            complement(18296..18372)
FT                   /locus_tag="DaAHT2_R0002"
FT                   /note="tRNA-Met3"
FT   tRNA            complement(18296..18372)
FT                   /locus_tag="DaAHT2_R0002"
FT                   /product="tRNA-Met"
FT   gene            complement(18530..19189)
FT                   /locus_tag="DaAHT2_0016"
FT   CDS             complement(18530..19189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0016"
FT                   /product="Nitrite reductase (NAD(P)H)"
FT                   /EC_number="1.7.1.4"
FT                   /note="KEGG: dol:Dole_2652 nitrite and sulphite reductase
FT                   4Fe-4S region; PFAM: nitrite and sulphite reductase 4Fe-4S
FT                   region; nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84733"
FT                   /db_xref="GOA:D6Z576"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR017220"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z576"
FT                   /inference="protein motif:PRIAM:1.7.1.4"
FT                   /protein_id="ADH84733.1"
FT                   /translation="MLKDGEKGAVLQRDKESYAIVPHLPLGLINPAQLRRIADVAEKYQ
FT                   CAAIKVTSAARIAIVGLKEGEIDQAWQDLDMAPGAAVGMCVRSIKTCPGNTLCRLGKQD
FT                   SMGLAKELDENYHGKELPGKLKLGVSGCPNQCGESSVKDIGFVGKANGWTILVGGNAAS
FT                   RPRLAETLMEDVDDAQARRITAAIIDYFAKEGKKGERMGRFIDRVGFETFKQQVCS"
FT   gene            19457..20899
FT                   /locus_tag="DaAHT2_0017"
FT   CDS             19457..20899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0017"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   geo:Geob_1385 protein of unknown function DUF195"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84734"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z577"
FT                   /inference="protein motif:PFAM:PF02646"
FT                   /protein_id="ADH84734.1"
FT                   /translation="MSASLINFAPAVLLGALAGSVVAWLYWRQHFKRLRETAEQRRLAD
FT                   QELWAERLAGRDTRLEELRQEIARLHDQTGELQQENAGLQARVAELNASLAGERKVTEE
FT                   KQALLLEARRELADTFKALSGDIFQQNSRAFMELAKSAFGRFQEQAGGELDQRRRAIAE
FT                   LVTPLRESLQKVDQQLRQVEKERLTAYAGLSEQVKTLATTQARLQGETANLVRALRTPN
FT                   TRGRWGEIQLRRVVEMAGMVNYCDFYEQEAAPAADSRLRPDLLIKLPSNKNIVVDSKAA
FT                   LSAYLEALEAPDDETRRLKLKEHARQIRTHLGQLSSKSYWEQFQPTPEFVVLFLPGENF
FT                   FSAALEQDPELIEAGVAQRVILATPTTLIALLRAVSYGWRQEKIAEHAHRIGDLGRQLY
FT                   DRLGVLVSHFLAVRRGLAGAVESYNKAVGSLESRVLVTARKLKELDPGLDKELESPEAL
FT                   DLQPRLPQSGAEQDPEEQPPKE"
FT   sig_peptide     19457..19528
FT                   /locus_tag="DaAHT2_0017"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.852) with cleavage site probability 0.823 at
FT                   residue 24"
FT   gene            20907..23225
FT                   /locus_tag="DaAHT2_0018"
FT   CDS             20907..23225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0018"
FT                   /product="Spermine synthase"
FT                   /note="PFAM: Spermine synthase; KEGG: nth:Nther_0905
FT                   spermine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84735"
FT                   /db_xref="GOA:D6Z578"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z578"
FT                   /inference="protein motif:PFAM:PF01564"
FT                   /protein_id="ADH84735.1"
FT                   /translation="MAFMKRRVCVAILVMGFSGLVAEILLLRELLIVFSGNELSIGIIL
FT                   ANWLLLEAFGCYFVGRRTERSRRRLMDFTFLTVLFSLALVLAVFLTRLIKPLLGVSIGE
FT                   SIGVMPMFYSSLLILLPVSILHGALFTYSCQIYADLSARNASPAGRVYVYETVGTIIGG
FT                   IACTYLLIPHLHALQAVVWLALLNFAVCLVLLAPLRQAGAGPKAVLAAVGGLLVLGGYA
FT                   ALSGQVERWHHHAIKVQWQGLNVVHYQHSPYGNISVVENEGQYIYFLDGVAAIFAPIPD
FT                   IPMVEKFVNIPLLVHPEPREVLVLSGGAGGVINEILKHPTVDSVEYAEQDPLLLELLER
FT                   FPTPLTVSELTDPKVRVHPIDGRLWLKTSRERYDLIFIGVAEPANLQANRYFTAEFFAL
FT                   VQSRLKPDGIVVLGLPGSLTFLNDELKNLNSSIFHTLESVFAHLRVIPGDGRNLFMASD
FT                   APAITTLDAPKLLARLEAREISTEGMMPWHIERQLHPGWQEWFADFIADSSRKINYDFQ
FT                   PLAMFYQLTHWNALYSPAFGRLFQQFERVNLGSGALLLLGLPVACLLARRLAVRPLRLG
FT                   IPLAIAGTGFAGMIYSLVVIFAFQTIYGYVFSWIGLLVAAFMAGAAAGAMLTSAALGGG
FT                   VKTAPLKLFKQLELVIIGFSLLLPLLFVAINAYALSESALLFARLLFLLVSLAGGLLVG
FT                   AQFPLANQLYLGSQTGLSHTAALLYTSDLLGGWVGGIIGGVVLLPVLGLTGTCMAIGML
FT                   KVVSFVIISSEPAGLYKEV"
FT   gene            23225..24301
FT                   /locus_tag="DaAHT2_0019"
FT   CDS             23225..24301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pth:PTH_0928 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84736"
FT                   /db_xref="GOA:D6Z579"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z579"
FT                   /inference="similar to AA sequence:KEGG:PTH_0928"
FT                   /protein_id="ADH84736.1"
FT                   /translation="MMKNKFPHHCTRRCFLADTAKFGGRLALATLLLKPLAAEARSRPA
FT                   DNGFEPSYLRLHRSGELRQRAEKLWAMMAECRLCPRQCGVNRLEGATGFCRSPGSNLVI
FT                   SSAHRHFGEERPLVGRRGSGTIFLTHCGLRCVFCQNWEISHLGRGHTSSEEDLAEMMLH
FT                   LQQTGCHNINLVSPSHYSASILKALDIAAGKGLRLPIVYNTCGWERQEIVALLDGVVDI
FT                   YLPDFKYWDPGMSEKYSAGADDYPGVTRQAILEMHRQVGVARPGPDGIMQRGLMIRHLV
FT                   MPNNKGGSKKIMEWIAENLPQDTYVNIMAQYTPYHKAFDFPKIARRITREEYQEVVERA
FT                   RELGLTNLDVQGYWWLRR"
FT   gene            24378..25349
FT                   /locus_tag="DaAHT2_0020"
FT   CDS             24378..25349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0020"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   rmr:Rmar_1488 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84737"
FT                   /db_xref="GOA:D6Z580"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z580"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADH84737.1"
FT                   /translation="MSKKSIPAWRQLAADELARRAAVAHERLRACESCPRRCRVDRLAG
FT                   KLGFCRTGALAQVASYGPHFGEEEPLVGRGGSGTIFFGNCNLGCVFCQNYDISHPHDDQ
FT                   AGGMEVDAAALAGMMLELQEQGCVNINLVTPSHVVPQILAALVEARRLGLALPLVYNTS
FT                   SYDSLATLQLLAGVVDIYLADFKYWRPAEAKRLLRAEDYPQRAREAIEEMHRQVGDLQL
FT                   DDQGLAHRGLLLRHLVMPGGLADSEAIFHFLAQKISPHTYTNIMEQYHPSGQAHQFPPI
FT                   DRPLDRAEYQQALELAHRAGLHRLDERAAARLLRRLLRGGGG"
FT   gene            25454..26203
FT                   /locus_tag="DaAHT2_0021"
FT   CDS             25454..26203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mdi:p2METDI0011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84738"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z581"
FT                   /inference="similar to AA sequence:KEGG:p2METDI0011"
FT                   /protein_id="ADH84738.1"
FT                   /translation="MSEQQGHTEYIAFLDECGDHSLTKIDRDFPIFVLSLLLVKRTDYR
FT                   DVILPTINALKLKYWDHEGVSLHSRDIRKSTGPFAILQNSSLRRPFMEDLSALMRDLPY
FT                   EVFIVGIHKQKLRDRYVRAENPYELALTFAMERLLYCLEQREQSILPIIAEARGTNEDN
FT                   ALKAAFFDLISNGTRYIGKGRFERMVFPLRFHNKRKNIAGIQLADLCAHPAARHILKPE
FT                   QPNQAFAIVRNHLYGGNGKVNGWKVFP"
FT   gene            26417..27189
FT                   /pseudo
FT                   /locus_tag="DaAHT2_0022"
FT                   /product="hypothetical protein"
FT   gene            27369..28328
FT                   /locus_tag="DaAHT2_0023"
FT   CDS             27369..28328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0023"
FT                   /product="regulatory protein, DeoR"
FT                   /note="KEGG: dau:Daud_1294 regulatory protein, DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84739"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z582"
FT                   /inference="similar to AA sequence:KEGG:Daud_1294"
FT                   /protein_id="ADH84739.1"
FT                   /translation="MSSKLDRIYWLYQQLKADRRPSRARYCRRFEVAASSFKRDLEFLR
FT                   HRLQAPIAYDRRLNGYRLTDDAFELPSCWFDPPALIFLAAACNQLRHLDGGGFRELADK
FT                   MENLLRLHHSALPALISCENVGWVNCPSGHLDTLLEAMLDRRLLNLVYHTGHSDRTNHD
FT                   APRKVEPYRLHHYMGTWYLIGYCHRRRAARIFQVARIAELTLSEESFSRPRFDVDAHIR
FT                   QSYGIFKGGADLQQVTLKFDPYMARFVGREFWHPEQHTEPTADGGLLLTLPVTNHTEIM
FT                   MQTLRYGHHVEVLAPPELRRRMVEEIRRMGGVYGGEWG"
FT   gene            28377..28598
FT                   /locus_tag="DaAHT2_0024"
FT   CDS             28377..28598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0024"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dat:HRM2_01300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84740"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z583"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84740.1"
FT                   /translation="MDTDERGLAIEATHKKFLSVRLEGKLEVKRLTVCKPERFSMKWQR
FT                   NWPKASLKSFTKNGCQIQQKPRVILTKL"
FT   gene            28828..29394
FT                   /locus_tag="DaAHT2_0025"
FT   CDS             28828..29394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0955 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84741"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z584"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84741.1"
FT                   /translation="MSSKPDRIYWLYQQLKADRCPSRARLDRRPYPERRKLLPAAIRCG
FT                   CPHPPILRDFQRRGGPAAGHPEIRPLHGPFRRPGILAPGAAHPEQHTEATADGGLLLTL
FT                   PVTNHTEIMMQTLRYGHHVEVLAPPELRRRVVEEIRRMGGVYGGVSNGAGGHFFGFGKF
FT                   SDGVGHYMGQGVVTLDGHGIWRSSF"
FT   gene            29696..30496
FT                   /locus_tag="DaAHT2_0026"
FT   CDS             29696..30496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpi:Cpin_2121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84742"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z585"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84742.1"
FT                   /translation="MAQSWAKSFGDKLDAIRKIEKSIDHADARSSLWKRLEWLGSWARK
FT                   RKEDWNTEANRLDCLRASTKNEAESMRLHTQFDVGDDGSPTWARVVDAFEKLSTAERIW
FT                   DVTAHGGPDHSKSSASQLVQRHDVHFGVDSLPTVRPDIRSLRIVSANGPDIWIYPSMIA
FT                   VGGLYDSPALVDLMEVQVSCAPKRFIEKEQLPSDARQVGHTWRYINKDGGPDRRFSDNP
FT                   QWPVMLYGEIDLKSTGGLFERYHVSDIEKARQFARCLTEHKATI"
FT   gene            30621..36587
FT                   /locus_tag="DaAHT2_0027"
FT   CDS             30621..36587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0027"
FT                   /product="superfamily I DNA and RNA helicase and helicase
FT                   subunit"
FT                   /note="KEGG: cli:Clim_2107 superfamily I DNA and RNA
FT                   helicase and helicase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84743"
FT                   /db_xref="GOA:D6Z586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR021754"
FT                   /db_xref="InterPro:IPR025103"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z586"
FT                   /inference="similar to AA sequence:KEGG:Clim_2107"
FT                   /protein_id="ADH84743.1"
FT                   /translation="MILEKPINVSIHCEAAAKLNFACHQSAFALLRELRIDNADRETRL
FT                   DDVLVTLSSNPSFLKPKSWRLARIAPEGSISIKDRDIELDGGFLLNLADAVRGTITITA
FT                   EKNGVVLAEETKSVDLLAYNEWGGAGYMPELLAAFSMPNDPAVDRVLRDASLVLRKAGK
FT                   LDGIDGYKAGSRQRVWEIASAVYTAICNLGITYSVPPASFERDGQKIRLPSQVLENRVA
FT                   TCLDCTMLISSALEQAGLNPIIALPEGHAVVGVWLQPEEFTTIVVDEAETLRKRIQLKE
FT                   LVLIETTYATSHPSPPFSKAVAAAAEVIAPDKDNTFNSAIDIRRARAHRISPLGLKSSQ
FT                   PLGPTGDEGRERIELVLEEAPVLPDFDDGAEDEEALDTSVSRLERWQRKLLDLSARNPL
FT                   LNHKSTKTSLRFICPAPGLLEEKLAEGARILIQPVPRPTSRGQDEELHRQRTGEIIAEE
FT                   YASNALAKKQVLVDLPGEELARRAIEIYRKAQTALQEGGANTLYLALGFLLWKRDEKDQ
FT                   RRLRAPLILVPITLERKSVRSGLRMLAHDDEPRFNTTLLEMLRKDFEIDIRGLDGELPG
FT                   DQRGIDVSKIWNKVRKAVKDTPGFEVVEDVVLGHFSFAKYLMWKDLVDRTDALRQSAIV
FT                   KHLIDTPRDPYPSDIAFVDGADVDRHFKPSDMLTPLPADSSQMAAIATADRGKDFIIIG
FT                   PPGTGKSQTISNLIAHTLGKGKTVLFVSEKTAALDVVYRRLRDIGLGRFCLELHSNKAR
FT                   KVDVLAQLSDAWEHHQSAKAEAWEKEAERLRSLRDQLNCVVDRLHIPRRNGMTAHYAIG
FT                   VKVRDEDLASRAVFSWPSSDQHDEDQLDAMREAVERLRVQVAAVRVVTDSPFQLVSQGD
FT                   WSPQWEGQVIERAGRLSTAASAADRACEALLDVTGIAVPDRSMARMDAIAELATVLLES
FT                   YRKQAAYALGSNGPDCIEALEEAVQRLKGYAEAQAALSCAYEPMAWRELDGDDIARRWQ
FT                   EAEAAWWPKSFFARRRLVKDMKLRGALGVPDPVCDAPVLKQLRVEGEAIDRLDKQLTEF
FT                   KDWQGHTTSPDTALALQALGQRARLAVGRLVDDASTLVDIRNKVRTLMHDGNDLLAPEA
FT                   AVGRAAQEFLAANRELQEACGAFEAIAGQSVRKHFAETGRALPAILETAETIAARHAEL
FT                   REWCGWRRRRAEAMDLELGPLVEAIEKGHVPTEEIEATFEASYCTWWSGALIGEDEALR
FT                   TFSTPEHVATIEKFREIDSQFQNLTAAYIAAKLTGDLPDADDVKRSSSWGVLRHEIQKK
FT                   RQHKPVRELIRDIPDVLTKLAPCLMMSPLSVAQYLPADQALFDVVIFDEASQITTWDAV
FT                   GSLARGRQAIVAGDPKQMPPTNFFARADDDPDGEVATGGDLESILDEMLGAGIPQRTLN
FT                   LHYRSRKESLIAFSNSRYYGNELVTFPAPIHPDRGVRLIKSDGFYARGKARHNEGEAKA
FT                   IVAEILRILTHENEAVRRQSIGVVTFNTEQQSLIENLLDQARAKNPRIEWAFSMDSTHE
FT                   PVFVKNLETVQGDERDVILFSVTYGPDQGGHVTMNFGPLNRDGGERRLNVAMTRARSEM
FT                   LVFSTLSPDRIDLSRTQSRAVADLKHFLEYAERGPSALSAAVYGPMGDFDSPFESAVAR
FT                   ALRDKGWDIHPQVGVSAYRIDLGIVHPDKPGVYLAGIECDGAMYHSSAFARERDKIRQS
FT                   VLEGLGWTLLRVWSTDWWTNSAKALETLHQALKGRLDVDRREREKAPRNMEESAVGASS
FT                   RSEHVDGSGEEFSMPAMSADVTVDENGASNQDFEPHGGYIAASPAMPEPAANIMPSKRM
FT                   QGPSGNLCDSYVPAHFSGEGYKADPDMFYSEEYKPRLSAMIDHVIDTEGPIHEDLLVRR
FT                   IARHHGFQRAGRQIRDIVISIAKRRRGRTKEDVGMFFWRKGTVKERLVPARYKGRDDEL
FT                   RKVEYICNEEISAIVKLLSIGSDPIELARRIGIARLSQGARSRLSKVFAWNSPRG"
FT   gene            36580..36858
FT                   /locus_tag="DaAHT2_0028"
FT   CDS             36580..36858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84744"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z587"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84744.1"
FT                   /translation="MGDLIKVKYEKFLQIQTKWVMRPKHQWKNKLIQPKTKNIAVACAI
FT                   AEHSAPGSVPPARVSMIGNKTTIEWYGRHAAAISTQDESLTDTKRHG"
FT   gene            36859..37839
FT                   /locus_tag="DaAHT2_0029"
FT   CDS             36859..37839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0029"
FT                   /product="HNH nuclease"
FT                   /note="SMART: HNH nuclease; KEGG: gsu:GSU1364 HNH
FT                   endonuclease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84745"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR011396"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z588"
FT                   /inference="protein motif:SMART:SM00507"
FT                   /protein_id="ADH84745.1"
FT                   /translation="MNPLQEHIKHFTRLKRAPGPIWSEASRGRAPHKPLLLLAVLDLAH
FT                   RGVINSPFISVTDDLVELNELFNLYWRRIVPVGQSPSSIAFPFSRLDREPFWELVPQPG
FT                   QTITTPLINNTSSVSYLRRYALGAKLADGIFQAMQSEDGRSALREALLLSCFSTSAQAL
FT                   LREQSRINREAYDYSRLLEEQVHRQVKEAMAADRYSPEARSQGFRRLVVKTYDHRCALC
FT                   GIRIVTPDGHTVVEAAHIVPWRRTRNDDLRNGMALCRTCHWGFDKGMLGVSDQYTVLTA
FT                   PTIGIDPNFPGLLSMLAGRAIIPPVERDHWPSREYLAAHRREWRL"
FT   gene            37899..39464
FT                   /locus_tag="DaAHT2_0030"
FT   CDS             37899..39464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0030"
FT                   /product="putative transcriptional regulator"
FT                   /note="PFAM: AAA-4 family protein; KEGG: mma:MM_1668
FT                   ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84746"
FT                   /db_xref="GOA:D6Z589"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z589"
FT                   /inference="protein motif:PFAM:PF04326"
FT                   /protein_id="ADH84746.1"
FT                   /translation="MKPSEVKEILTTGEGLHVEFKEARDRLPGSFFDTVCAFLNTDGGT
FT                   IYLGVNDNGGVTGVEPRAVARLKSDIANLSNNPRQLDPPFLLFPHELAIDGKTVIAVQV
FT                   PLSSQIHRHGGEIMLRSEDGDYRLRGTHQLAGLANRKLSLFSEQRVLPHLTVADLRPEL
FT                   FDKARSLMRIGDRRHPWLAFSDEELLKVGGFFNRDPNSGRPGLTLAAALLFGSDEVIQN
FT                   AVPGYKFDCLLRRRNQERYDDRLIVRTNLIDAYDLMMGFIEKHLDDPFHLEGDLRISLR
FT                   EKIFREVVSNIIAHREYTSAAPATIKIYRDRVELENPHVAHFFGRITPDNVRPFPKNPT
FT                   ICKLMIQLGRFDELGSGVINVHRYLPLYANGATPVFQETGHSFVTTLPLTVDREGQGSE
FT                   RATEHATPEVGQQVTQQVIQQVTQQVGSADDYSRLLPVLRACATKSLSNKELQAAAGIR
FT                   DRSTFHINYLTPLLKLNLLERTIPDKPTSSKQKYRLTEKGRQLLAAANHSTDKRNEWPG
FT                   DTGD"
FT   gene            39466..41130
FT                   /locus_tag="DaAHT2_0031"
FT   CDS             39466..41130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0031"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: pca:Pcar_2730 putative ATP-dependent DNA
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84747"
FT                   /db_xref="GOA:D6Z590"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z590"
FT                   /inference="similar to AA sequence:KEGG:Pcar_2730"
FT                   /protein_id="ADH84747.1"
FT                   /translation="MEMSQPKLQKLLDHLVASWENEVVEFKQAGKDYPTDKIGEYFSAL
FT                   ANEANLRNQERAWLVFGVNNKSRQIVGSDYRLNPERLQSTKMQIAENTEPSVTFRNIHQ
FT                   LRNSKGRVVLFEIPAAPRGMPIAWKGHYYARAGESLTHLGLDKLDEIRQQTMAGDWSAR
FT                   LVADATFSHLDEGALQKARESFARKYANRFPAEEVMAWPLATFLDRAKLTQDGKITRAA
FT                   ILLLGRPESAYLLSPHPAQMTWKLEGPERAYEHFGPPFLLNTTRLYRRIRNIQLRLLPD
FT                   EALFAVEVSKYDQKVVFEALHNCIAHQDYSRNGRILVTELPDKLIFANEGGFFEGKPED
FT                   YVTGDKTPHRYRNAFLAQAMAELNMIDTMGYGIYSMHLGQARRYFPMPDYELGEPAAVK
FT                   MTVYGSVVDPAYSRLLIQKTDLPLDEILALDRVQKRLPISDDMIRRLRRDGLIEGRKPN
FT                   LHVSATVAKVTASKIDYIWTRAQDDDYYCKLITDYLKKFGRATRGEIDKLLLNKLSDAL
FT                   GQEQKKKKVGNLLTKLRRSKMIRNDGTRAKPKWVLAE"
FT   gene            41379..42344
FT                   /pseudo
FT                   /locus_tag="DaAHT2_0032"
FT                   /product="hypothetical protein"
FT   gene            42365..42705
FT                   /pseudo
FT                   /locus_tag="DaAHT2_0033"
FT                   /product="hypothetical protein"
FT   gene            42884..44092
FT                   /locus_tag="DaAHT2_0034"
FT   CDS             42884..44092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0034"
FT                   /product="Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)
FT                   binding domain protein"
FT                   /note="PFAM: Glyceraldehyde 3-phosphate dehydrogenase,
FT                   NAD(P) binding domain; Glyceraldehyde 3-phosphate
FT                   dehydrogenase, catalytic domain; KEGG: dps:DP0103
FT                   glyceraldehyde-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84748"
FT                   /db_xref="GOA:D6Z591"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z591"
FT                   /inference="protein motif:PFAM:PF00044"
FT                   /protein_id="ADH84748.1"
FT                   /translation="MKLGINGLGRIGKLSLWHHVSRQHFTELVVNVGREVGTSLADIAG
FT                   VIERDSTYGRLANYLYGCKAPNSVITDLDEGKGTMKVNGVPVTILRQSRDPKGIAWKDN
FT                   GVRLVVDTTGAFTDPTADADAPRGSLRGHLQGGAEKVLLSAPFKIKQKGLEMPEDAVTT
FT                   VMGINDTDYDSARHSLISAASCTTTCLAFMVKPLLDYFGADKFLSASMVTVHAATGSQP
FT                   VLDRVPGAGATDLRKNRSILNNIVLTSTGAAKALFLVLPEMKKIGFIAESVRIPTSSGS
FT                   LIILVVNFQDDPERPINRELINSVYSDFGKQTSYLMYSDEQLVSGDIVGAPAAAAVIEG
FT                   KETHTRTANINVNMGQFKCEGAPDKLEVPVTQAVIYGWYDNELGSYTNLLGDRTVSIAE
FT                   EMV"
FT   gene            44135..44617
FT                   /locus_tag="DaAHT2_0035"
FT   CDS             44135..44617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0035"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="KEGG: cms:CMS_0523 putative glycoprotein
FT                   peptidase-acetyltransferase fusionprotein; TIGRFAM:
FT                   ribosomal-protein-alanine acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84749"
FT                   /db_xref="GOA:D6Z592"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z592"
FT                   /inference="protein motif:TFAM:TIGR01575"
FT                   /protein_id="ADH84749.1"
FT                   /translation="MKIFIRDLAAADLPAVAAMEADEPGGWSLEQWTAELARAGGWQLV
FT                   ALDSATGRVIGYMAGMAVGNEAEIFRLLVAPDCRRRGVATGLLRQLWKRLPGLGVTSCF
FT                   LEVRAANRAALELYRQMGFEHCGLRPGYYHDPEDDAVVLARPVAKGPNMLNQGGSA"
FT   gene            44614..45792
FT                   /locus_tag="DaAHT2_0036"
FT   CDS             44614..45792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0036"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="KEGG: gur:Gura_2060 phosphoglycerate kinase; PFAM:
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84750"
FT                   /db_xref="GOA:D6Z593"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015901"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z593"
FT                   /inference="protein motif:PRIAM:2.7.2.3"
FT                   /protein_id="ADH84750.1"
FT                   /translation="MKNIRDIDLKDKKVLIRVDFNVPLDEQGNITDDIRIRSVLPTLNH
FT                   ALDENAAVIICSHMGRPKGQPKPEFSLAPAAKRLSRLIAKEVRLAPDCVGPEVEKLAAE
FT                   LKPGEVLLLENLRFHPEEQANDEEFARRLAALADVYINDAFAVAHRAHASVVGVPRQIK
FT                   EAGAGFLLQKEMDYFHRSVGDPARPLVAVIGGAKVSSKLGALTNMLDRVDKMIIGGAMA
FT                   NTFLKSQGLDVGRSKVEEELLDTARELLAKAKAKGVKLYLPVDCIVAQELDAKAETKRV
FT                   TCQEIPAEWMALDIGPATTMLFTEALEDAKTIIWNGPMGVFEVDAFARGTMAMVQALVR
FT                   SHALTIVGGGDTDVAIHRAGEVDSISYVSTGGGAFLMLMEGKKLPGVEVLGG"
FT   gene            45862..46611
FT                   /locus_tag="DaAHT2_0037"
FT   CDS             45862..46611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0037"
FT                   /product="triosephosphate isomerase"
FT                   /note="KEGG: dps:DP0100 triosephosphate isomerase; TIGRFAM:
FT                   triosephosphate isomerase; PFAM: triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84751"
FT                   /db_xref="GOA:D6Z594"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z594"
FT                   /inference="protein motif:TFAM:TIGR00419"
FT                   /protein_id="ADH84751.1"
FT                   /translation="MRTPLIAGNWKMHLNLDQAAELAAAVAGVAEACPDREVMIAPPFT
FT                   ALARVREVAGERLILAGQNVCWEEKGAFTGEIAPPMLRELGCRMAIVGHSERRHVFGED
FT                   DAMVNRRLRGAMAHGLVPILCIGETLDEREAGQTMAVLERQVRDGLQQVEISEAAGLVI
FT                   AYEPVWAIGTGKTASPDQAQEAHEFVRRLLCEVYEKNIAAGIRILYGGSVNAANVDEIM
FT                   AQADVDGALVGGASLSAETFERIIRFA"
FT   gene            46655..47029
FT                   /locus_tag="DaAHT2_0038"
FT   CDS             46655..47029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0038"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="KEGG: dps:DP0099 secretion protein SecG; TIGRFAM:
FT                   preprotein translocase, SecG subunit; PFAM: Preprotein
FT                   translocase SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84752"
FT                   /db_xref="GOA:D6Z595"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z595"
FT                   /inference="protein motif:TFAM:TIGR00810"
FT                   /protein_id="ADH84752.1"
FT                   /translation="MYTVLIVSHILVCLFLVTIVLLQHGKGASIGASFGGSSQTVFGTE
FT                   GPLPLMNKITTMAAVVFMITSISLAYISSRAGDGSVMERVRTTPAPIEEVLPESDEPVT
FT                   IPLPGATDGDVPRTFPGEAE"
FT   gene            47035..47119
FT                   /locus_tag="DaAHT2_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            47035..47119
FT                   /locus_tag="DaAHT2_R0003"
FT                   /product="tRNA-Leu"
FT   gene            complement(47210..48763)
FT                   /locus_tag="DaAHT2_0039"
FT   CDS             complement(47210..48763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0039"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="TIGRFAM: glucose-6-phosphate 1-dehydrogenase; KEGG:
FT                   drt:Dret_2487 glucose-6-phosphate 1-dehydrogenase; PFAM:
FT                   glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84753"
FT                   /db_xref="GOA:D6Z596"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z596"
FT                   /inference="protein motif:TFAM:TIGR00871"
FT                   /protein_id="ADH84753.1"
FT                   /translation="MSLQQTDCRQRTTQGSCNLRNSSELPSCSIVIFGASGDLTARKLI
FT                   PALANLFAHGCLPERFNIVGCGRSAMSHEEFRRHLAEFEPDRQAETSSEGWQRFAANLF
FT                   YQQLSYDSPDSYRQLAELLNQLDRQRGTAPNRMFYLSVPPALYPVIATQLGPAGLSNQD
FT                   AAHWSRIVVEKPFGHDLASAQALDQTLHAGFSEEQIFRIDHYLAKETVQNILMLRFANA
FT                   IFEPLWNRNYVDYVGIISAEKLGVEHRAGFYEQAGVLRDMFQNHMMQLLALTAMEPPSR
FT                   FKDIQVHDEKTKIFRALKPLNRGRLSDNLVLGQYGPGTIDGREVPGYRQEPGVAPDSLT
FT                   PTFAAMKLGIDNWRWRGVPFYLVSGKRMPAKESRIVIQFKEVPHSMFNHETAANLLANR
FT                   LVLEIYPEEKITLNFQAKTPGSKECLHRAEMGFNYERRQGERGAVNFDAYEMVLLDCII
FT                   GDHMLFWRQDGVELSWSFLTPILAECESCPETAAKLLQTYPAGTPGPAEAHHWMQLLAN
FT                   "
FT   gene            complement(48769..49911)
FT                   /locus_tag="DaAHT2_0040"
FT   CDS             complement(48769..49911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0040"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: wsu:WS1985 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84754"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z597"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84754.1"
FT                   /translation="MAIMLEFACLIHFMLTALTAWPGQGGALLAPDINTHGFIGVLGFS
FT                   YTMLLHFLVSPARYGEKTAALRRLLAILSLLLAAGALLTNKLLLTVTGGAFLLTSATLF
FT                   FYFIPTTNRREDLFLTWAVIISLLSWLYFIYALNFSELFGFKTRFSYVLLAFSFPMSLL
FT                   LFSRYVDLLKISAKRIRLTAVLLVGGVLSMFAGMLLAWPPLKLASAVLLLLLISWYLLQ
FT                   AHRLREPFLLTAFIGLLLTSLTGIWYLLAYILGYGYGPGTKVVLSLHAHLAHFSWATFG
FT                   IYYLLLRDQGGVSAHGAPATALATDGKMGHGRQQNHLLFALLPLLTALLLLSAYLLTDI
FT                   PWLPAAAVTMFLLSGLAPARALLKGRHLPAPRAQTTTERE"
FT   gene            50062..51075
FT                   /locus_tag="DaAHT2_0041"
FT   CDS             50062..51075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0041"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: det:DET1595
FT                   ApbE/NosX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84755"
FT                   /db_xref="GOA:D6Z598"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z598"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ADH84755.1"
FT                   /translation="MAESEKEQGAVFSRRSALKIFALAGAAGAFGLTFAGGERGWQVVR
FT                   RGQVLMGTPVDLVVYSRDRDQAQAAVAATLARMGELESRLSRFNPDSEVGRLNRSGEID
FT                   EAGEDLLAVLALAQQVSAKSDGAFDITTLPLLLRHQQGLTADPDQIAAARRAVAYEQLQ
FT                   VGKRRVRLGRPGMGITLDGIGKGYIVDRGVDTLAAHGFDRVYVAAGGDLVARGGKPRNE
FT                   PWRIGIAPPRPGMNRELAVVAGDNLAVATSGDYLQHFSADYRHHHIINPRTGFSPPQLA
FT                   SCTVTAPDAALADALATACLVLGLPDSLDLLAAFPGCEGYFIDKDLKVRHTDGFRV"
FT   gene            51079..52491
FT                   /locus_tag="DaAHT2_0042"
FT   CDS             51079..52491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0042"
FT                   /product="NADH:ubiquinone oxidoreductase, subunit A"
FT                   /note="KEGG: pae:PA2999 Na(+)-translocating NADH-quinone
FT                   reductase subunit A; TIGRFAM: NADH:ubiquinone
FT                   oxidoreductase, subunit A; PFAM: Na-translocating
FT                   NADH-quinone reductase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84756"
FT                   /db_xref="GOA:D6Z599"
FT                   /db_xref="InterPro:IPR008703"
FT                   /db_xref="InterPro:IPR022615"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z599"
FT                   /inference="protein motif:TFAM:TIGR01936"
FT                   /protein_id="ADH84756.1"
FT                   /translation="MESMELTIARGLDIPISGAPRQVIEPAGRVGHVALLADDYPGLRP
FT                   SMEVREGDRVAAGQVLFTDKQNPGVNFTAPAAGVVSAINRGARRRLQSVVIALEGDEQR
FT                   SFAVGGGEGRSPEKIRRVLVDSGLWTAFKTRPYGKVASPSASPAALFVTAIDTRPLAAE
FT                   PAVVIAEASEDFRAGLQLLATLAPKTYLCTSPPAAPLPGEDLPGITVARFSGPHPAGLP
FT                   STHIHFLDPVGPGKEVWQIGYQDVMAIGHLFRHGRLASSQVVALAGPGMANPRLVRTAR
FT                   GAALPELLRDELVTGALPPETSPENLQGGGQAAALPGRLYRLISGSVLDGHHAHGPFAY
FT                   LGRYHQQICALPEDDGSCLFGWARPGWDRFSLVPAFLSALRRRPFAMSTATWGGRRAIF
FT                   PLGTYERVMPLDIIATSLLKALASGNLERCLELGVLELVEEDLALCSFVCPGKNDFAPL
FT                   LREMLTRIEEEA"
FT   gene            52496..53707
FT                   /locus_tag="DaAHT2_0043"
FT   CDS             52496..53707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0043"
FT                   /product="NADH:ubiquinone oxidoreductase, subunit B"
FT                   /note="KEGG: dps:DP1803 Na(+)-translocating NADH-quinone
FT                   reductase subunit B; TIGRFAM: NADH:ubiquinone
FT                   oxidoreductase, subunit B; PFAM: NQR2 and RnfD family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84757"
FT                   /db_xref="GOA:D6Z5A0"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR010966"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5A0"
FT                   /inference="protein motif:TFAM:TIGR01937"
FT                   /protein_id="ADH84757.1"
FT                   /translation="MIKALDRFLRSLAPHFHQGGRLQRWYPLYEATDSFLMGSRLTNPG
FT                   APHVRDAIDFKRIMITVIIALIPCVLMALWNTGYQANLALVNLGLELPAGWRGVVMSRV
FT                   GVDPASLSSNLVHGALYFLPVYLVCVVVGSVWETIFNIIRGHEFSEAFLVTSLLLPLTL
FT                   PPTIPLWQVAVGTSFGVIFAKEVFGGVGRNFMNPALTARAFLFFAYPAEMSGDEVWVGV
FT                   DGLSSATPLATLAAAPADQPVAALDFTWGAAFAGIIPGSMGETSALACLLGAALLLVTR
FT                   IASWRIMLAMLLGALACSLPFWLIGSPDNPMANVPPHWHLVLGGFALGLVFMATDPVTA
FT                   PHTEAGKWLYGLFIGALTIILRVLNPAFPEGVMLAILLGNIFAPLFDYLVIQANIRRRA
FT                   LRYG"
FT   gene            53700..54482
FT                   /locus_tag="DaAHT2_0044"
FT   CDS             53700..54482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0044"
FT                   /product="NADH:ubiquinone oxidoreductase, subunit C"
FT                   /note="KEGG: dps:DP1804 Na(+)-translocating NADH-quinone
FT                   reductase subunit C; TIGRFAM: NADH:ubiquinone
FT                   oxidoreductase, subunit C; PFAM: FMN-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84758"
FT                   /db_xref="GOA:D6Z5A1"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010204"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5A1"
FT                   /inference="protein motif:TFAM:TIGR01938"
FT                   /protein_id="ADH84758.1"
FT                   /translation="MAKESTARTVLTVLLLALVCSTLVAGTAVGLRERQEANQRQDEMR
FT                   NVLIAADLYQPGADVEELFKTVEARIINLEDGALLPPEKMDPAEYNQLKAALDRELGRE
FT                   LPKDADQARLGRREDYSLVYLVRENGELAKVVLPIRGRGMWSMMHGYVALGPDLNTVAG
FT                   ATFYRHGETPGLGSEIENRDWLAGWRGKKVYDADGRPALRVVKGEAPPGEEGRHQIDGI
FT                   SSATGTLRGVSDLLQFWFGDHGFKPFLERYRDGGIHNG"
FT   sig_peptide     53700..53777
FT                   /locus_tag="DaAHT2_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.910 at
FT                   residue 26"
FT   gene            54475..55101
FT                   /locus_tag="DaAHT2_0045"
FT   CDS             54475..55101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0045"
FT                   /product="NADH:ubiquinone oxidoreductase, subunit D"
FT                   /note="KEGG: dps:DP1805 Na(+)-translocating NADH-quinone
FT                   reductase subunit D; TIGRFAM: NADH:ubiquinone
FT                   oxidoreductase, subunit D; PFAM: RnfA-Nqr electron
FT                   transport subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84759"
FT                   /db_xref="GOA:D6Z5A2"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011292"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5A2"
FT                   /inference="protein motif:TFAM:TIGR01939"
FT                   /protein_id="ADH84759.1"
FT                   /translation="MAEETRGQLFFKAIFERNPITVLVLGICSALAVTGNMATALVMSI
FT                   CLTLVTAIASTTISLLRENIPNTVRIGIQITIIATLVILVDQVLKAYFYDLSRQLSIYV
FT                   GLIITNCIVMGRAEGFAMSNPPDKAFLDGLGNGLGYSFILMSVAFFRELFGAGTLFGVT
FT                   VLPLVTRDGWYQGNGMMLLPASAFFLVALLIWLLREIYPSQREKE"
FT   gene            55111..55722
FT                   /locus_tag="DaAHT2_0046"
FT   CDS             55111..55722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0046"
FT                   /product="NADH:ubiquinone oxidoreductase, subunit E"
FT                   /note="KEGG: dps:DP1806 Na(+)-translocating NADH-quinone
FT                   reductase subunit E; TIGRFAM: NADH:ubiquinone
FT                   oxidoreductase, subunit E; PFAM: RnfA-Nqr electron
FT                   transport subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84760"
FT                   /db_xref="GOA:D6Z5A3"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010967"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5A3"
FT                   /inference="protein motif:TFAM:TIGR01940"
FT                   /protein_id="ADH84760.1"
FT                   /translation="MFGHYFEIFFTALFVENLVLTFFLGMCTFLAISRQVKTAFGLGLA
FT                   VVIIQAITVPLNNLIYNLVLQPGALGWLGLADIDLTFLGLLVYIGVIAATVQILEMFLD
FT                   RYVPALYNTLGIFLPLLTVNCAILGASLFMVERDYALGESVAYGLGAGGGFLIAVVLLA
FT                   GIREKLEYADPPAGLRGLGVTFIAAGLMAMAFMGIAGIAF"
FT   gene            55722..56948
FT                   /locus_tag="DaAHT2_0047"
FT   CDS             55722..56948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0047"
FT                   /product="NADH:ubiquinone oxidoreductase, subunit F"
FT                   /note="KEGG: dps:DP1807 Na(+)-translocating NADH-quinone
FT                   reductase subunit F; TIGRFAM: NADH:ubiquinone
FT                   oxidoreductase, subunit F; PFAM: oxidoreductase
FT                   FAD/NAD(P)-binding domain protein; ferredoxin;
FT                   Oxidoreductase FAD-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84761"
FT                   /db_xref="GOA:D6Z5A4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR010205"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5A4"
FT                   /inference="protein motif:TFAM:TIGR01941"
FT                   /protein_id="ADH84761.1"
FT                   /translation="MFEIVVAIVAYLVIQTFLVGLIIAAKRKLLPGGDLTIVVNGEKKL
FT                   TVPPGGKLLTALADQGIFLSSACGGGGSCAQCRATVKSGGGAILPTERSHINRREAREG
FT                   VRLACQVPVKRDMEIEVPPEMLETKKWRCVVESNHHIATFIKELVLKLPPGEEVDFKPG
FT                   GYIQIEIPPYVLSFSDFDIAEKFLGDWTRFKLFQYMSKVHQPVTRAYSMANYPGEKGML
FT                   KLNVRLATPPLDEEEVNPTPPGKASSYIFNLKPGDEVTISGPYGEFFIREGESEMVYVG
FT                   AGAGMAPLRSHIFELLKGRQSKRKISFWYGGRCLREVFYLNDFEQLAREFPNFSFHLSL
FT                   SRPRPEDNWTGPVGHIHKTLYQNYLKDHEAPEDIQYYACGPPAMTASLIEMLQELGVER
FT                   DHIFFDDFG"
FT   gene            57419..58447
FT                   /locus_tag="DaAHT2_0048"
FT   CDS             57419..58447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0048"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   dol:Dole_1103 cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84762"
FT                   /db_xref="GOA:D6Z5A5"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5A5"
FT                   /inference="protein motif:PFAM:PF01578"
FT                   /protein_id="ADH84762.1"
FT                   /translation="MENLISAVETYSQGGALLMPLLLLCALLLTVTGLGNLLAPRPFMP
FT                   RWSGRLLQLTAVLMLLGFLGMIWFHWQIAQHAVLELPEQLAAMLNQQLEAMNRGATYGI
FT                   PLYDPQSPPRYLIPPWIEYQRYYFWFFCFALMALLVHRRLDNQRFRGSLYLLLAAQLVV
FT                   LYVWADPFREPLPRFFAEITPWFTAPSAWEQLGMFMQLYPRLEFYYTASYMWFHPPLLF
FT                   ISYACITIFFAVSLLMLIRRELEVERVGYDYAKFGYFLLTLGMLLGYPWALKAWGPNWW
FT                   WDPKVSSSIMLWAIFSTYLHTRIYANKKGMWYFSAALGLLCFVAMIFTFVASYIFPGEH
FT                   SL"
FT   gene            58603..59220
FT                   /locus_tag="DaAHT2_0049"
FT   CDS             58603..59220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0049"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: deh:cbdb_A763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84763"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5A6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84763.1"
FT                   /translation="MEAKGSSSYDYKLILATTAVLGIISVICVAAMFYFKAAAIHELPA
FT                   AAQWAYMNTMNGIMAPFIIALILLLGICVPKRLLPERWLNRFTVALLAAALVTFLAVGG
FT                   HPALLLILFASLALQLVVLGMALAGSASLNFESKNYWVRLGSSLVHLGLILFVLDLYFH
FT                   NYHTLHLVLFWVTTGAVVLGMLFCFYAEQVAGLVRRYWPARG"
FT   gene            59274..60074
FT                   /locus_tag="DaAHT2_0050"
FT   CDS             59274..60074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0050"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: dvm:DvMF_0388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84764"
FT                   /db_xref="GOA:D6Z5A7"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5A7"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADH84764.1"
FT                   /translation="MPLSLMQWLLLTGLLLITQPAFSATSSPASDPTSGPAEPPRLVLN
FT                   SPFSAPITSPDQDGFLDLLYAELFGRLGIDFEIQLLPGERALRNADAGIDDGDVCRIAG
FT                   LDAIYPNLRRTSEAVLEYRMTIFSRRHDFEVTGPASLEPYELGFLSGWKILEDVTADHP
FT                   RRIMLDDTEQLFLMLAHDRLDLALIDRILGLEAVARLDVEDVRVLEPSLLHGHWYLYLH
FT                   KRHQELLPAIDRELRRLKEDGTYERLRRRAFGKFETFDAEEHIP"
FT   sig_peptide     59274..59345
FT                   /locus_tag="DaAHT2_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.989 at
FT                   residue 24"
FT   gene            60074..61948
FT                   /locus_tag="DaAHT2_0051"
FT   CDS             60074..61948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0051"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="KEGG: sfu:Sfum_2943 multi-sensor hybrid histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; response regulator receiver; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84765"
FT                   /db_xref="GOA:D6Z5A8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5A8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH84765.1"
FT                   /translation="MSNTRFSWWHSIGRRFIIYILLFSSVVTLLGTAVHLYFEYRRDLR
FT                   SIEANIKQIETGYLASISEGLWSFNERMVRVQLLGILDLPDIRYLEIKREGEAPFAIGE
FT                   PVRERSVMYHFPLRYSHRGQEIDLGRLKVVVGMDEVYARMWSRVLVIFATQAVKTFFVS
FT                   TFIFFLFYFLVGRHLGVLADYARSLKLSRLDRPLVLHRGGLSGSDQDELGQVATAINEM
FT                   RQALLAESEQREKMAAQLLQAQKMEAVGTLAGGVAHDFNNILTPIIGYCELAKMQLSPA
FT                   EQEKMQVEEILQAARRARDLVQQILTFSRRQEQERVRLELQPIIKENIKFLRSSLPSTI
FT                   EISQDLAADCGQVLADLTQIQQVILNLCTNAAQAMEEQGGVLEINLRRVEIGDSQQLAG
FT                   EPLPPGNYACLTVSDTGVGMDGVTRQRIFEPYFTTKEQGKGTGLGLAMVHGIVRGHGGR
FT                   LAVYSEPGKGTVVRVFLPLAEAAGGTAATPAADTGESAPRGTERILVVDDESRIVEMLT
FT                   GLLGHLGYRAQGRTDSREALALFRQDPRAFDLVISDQTMPGLTGGELAKALREIRPDLP
FT                   VIICTGFSTRMSAEQARREGIDGYLMKPFSLDDIAGLVRRVLDGDSAT"
FT   gene            complement(61971..64949)
FT                   /locus_tag="DaAHT2_0052"
FT   CDS             complement(61971..64949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0052"
FT                   /product="AsmA family protein"
FT                   /note="PFAM: AsmA family protein; KEGG: noc:Noc_2265
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84766"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5A9"
FT                   /inference="protein motif:PFAM:PF05170"
FT                   /protein_id="ADH84766.1"
FT                   /translation="MKIIKITLITLISLILLLIVGLVAAVHLIDINRHHDRIAQVVYDQ
FT                   TGRTLSIEGDFEWGLWPELYLKGGPLSLGNAPGFDREPFFHLESFHFSVTTWPLRRSEV
FT                   HLQTLQVAGLQLNLERNQEGIGNWEDLAAEPDPAPAARPHKKKDPGAGLPFAALALGGI
FT                   QIDRVNVNWYDQASGQQAHISDLRLTVGALQFGEPMQLELEFTAASNQPELEVAANAQA
FT                   TLLYDLNAGRYAIKPLQAAATFSGPTVPGEQTTMTLHTLLNLDTETSRAKLEDFRLQGL
FT                   GTLVQAQLAMHDLEAGIPGCQGEVTVEVADLVELLEVFDSPLGRQLTAVQDRSINLATE
FT                   FTVDPQQGRIMVPKLTAKLLGTTVRGRLEADNIYSDQPEVLGGIRAEGSDLPALLAIAA
FT                   RLQPGADQQALSRALAGLRDRGLLAEATFNSEGADIVVPHLHLRALATELTVNGRVSKL
FT                   DAELPALDGQARLAGRDLPLLLKVASAFQGGPTAQTDDGPPPGAELWALADRIAAARRH
FT                   SFNLSTGFSAEPDLQRLSIDNLSAAILGLEAQMDLAARNLLSEPDFKLALSLAPFNPRQ
FT                   LLPILEVELPDTADPRTLTSLQLKAEIDGTPERFTVKPLRLVLDDTSIGGEVTVHDLAR
FT                   QDLAFKIEVDAIDLDRYLPPESEEQPVTPETAAAGTALLPVELLRELLLEGELKVGELK
FT                   VSGLRVSNFMMQARARDGEIRVAPLQAALYQGEMDSTINIDARGEQPQLQTTNRLRGVR
FT                   IGPLLRDLTQEQEKIRGRADISYELTTRGNELDEFKANLNGKAELSFQDGEVVGINLGR
FT                   LLRQTTALIERRTFAADEQAVTDFTTLSGSARITNGLVSNQDLRMMSPLLRVTGEGTAN
FT                   LVSEEIDYLLTAAVVATAEGQEGAELDALQGLVVPIRISGTFENPTFRPSLDGAAQAKL
FT                   QENLRRLQDRLQQEGRRALEDLLGVPLDRPDRKDPEAPSPQQQLEEELEERLRDELRRR
FT                   LRF"
FT   gene            65279..66460
FT                   /locus_tag="DaAHT2_0053"
FT   CDS             65279..66460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azo:azo1674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84767"
FT                   /db_xref="InterPro:IPR021973"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5B0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84767.1"
FT                   /translation="MRRIPTAAQIAVIAVRTPETKAAMNLNAILSGISAWPVKPAGGGA
FT                   PGIKPSEAAQDRGPSAGGDIFEQGQWWKNRAMARVDAVSAGACSCGSCTSCGVRAYGAF
FT                   ARGGPGPVAGAAVAGQTVAAVGGLPPANAGEAVRENSSAPAAEESNRVAPGYFPYPFAG
FT                   EAGAAGRNEGGPLNPLAPAAGGERAQAVEPAVEPTVQREAGQALVQELSREEKLEVARL
FT                   QQLDSQVKAHEMAHLAVAGPYARGGASFTYTTGPDGKKYAVGGEVSIDTSREPSPEATI
FT                   RKMRIIRAAALAPADPSPQDRKVAAQADAAMTEARRELEMIRLEQQREAARHELDMRFI
FT                   GAGEGGLDPAADNEPEAATYTPPFGPASPVAARRAAAALAAFDQAAPQLQVRA"
FT   gene            66704..67357
FT                   /locus_tag="DaAHT2_0054"
FT   CDS             66704..67357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dal:Dalk_0467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84768"
FT                   /db_xref="InterPro:IPR025517"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5B1"
FT                   /inference="similar to AA sequence:KEGG:Dalk_0467"
FT                   /protein_id="ADH84768.1"
FT                   /translation="MKLRRVTSLTALVSFVLLMITSVVLYIVPTGRVAHWADWQLLWLS
FT                   KSQWEDLHLNLGILFLLSIFLHIYYNWQPITAYLKDRLGRLRVFNGNFCLALLISLVVG
FT                   VGTYLEVPPFVNIIQLSDTFKERAEEKYGEPPYGHAELSTLAEFASRLRYDLPQVKEAL
FT                   RKGGMEFDDEQQTVLAIAQANRVSPQQLFQLIKAEVVSDRDGSPGPPRRGQAAE"
FT   sig_peptide     66704..66781
FT                   /locus_tag="DaAHT2_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.522 at
FT                   residue 26"
FT   gene            complement(67302..68213)
FT                   /locus_tag="DaAHT2_0055"
FT   CDS             complement(67302..68213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0055"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: tcx:Tcr_1604 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84769"
FT                   /db_xref="GOA:D6Z5B2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5B2"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADH84769.1"
FT                   /translation="MISEQRKGELYLLAEEFLWGWFPIVTLLTYPYLAPLWSMGLTLAV
FT                   AAVFFGLLMSKRLGSNLWRELGNRRAWKDLAWSSFYIMLLFVLLFTGLAHTTAGNAALI
FT                   LFLQVFFAFLYFNLLQGEKMSPPHLAGAALMSLGAFLVLFPGEAGLNKGDLLVLLAAMV
FT                   APIGNRYQQRARRHVHATTLLFVRTVTSLPVVLLLAWAYANPPALADLQATWWLVALNG
FT                   VFLMGLSKIYWIEALHRLSVTKISAMTALSPLFTMLFAFFILQEVPGGWQVAGILPILT
FT                   GGMLITRPLDPGEAVRGCRPGR"
FT   gene            complement(68230..69036)
FT                   /locus_tag="DaAHT2_0056"
FT   CDS             complement(68230..69036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0056"
FT                   /product="carbonic anhydrase"
FT                   /note="PFAM: carbonic anhydrase; KEGG: cvi:CV_1136
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84770"
FT                   /db_xref="GOA:D6Z5B3"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5B3"
FT                   /inference="protein motif:PFAM:PF00484"
FT                   /protein_id="ADH84770.1"
FT                   /translation="MARTTLFTFSLLLTILLGLLLTLSPAVSQPTLEALPKIRAGTPPH
FT                   SVLGNIMGSNRQFMQGIKATDPGRQLTQAPHLIWLADPDPRISPEMVWERKAGGIYTVR
FT                   NLANQLEPAAAAIDYGVRSLHGTILLITGNTDNQAIAQFNEGYEHLGTAIRRELNQLHP
FT                   PLARLLATTGKSAEEMQKLLVRQVESNVDYQVSRALERYRDRVDSGRLVVAGGVIDLAN
FT                   HYGGGPGRLYLINLNGETEPGKIRQSSHVVRVPPEMRDYLGRRSAR"
FT   sig_peptide     complement(68950..69036)
FT                   /locus_tag="DaAHT2_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 29"
FT   gene            69260..69880
FT                   /locus_tag="DaAHT2_0057"
FT   CDS             69260..69880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0057"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: sfu:Sfum_1035 GrpE
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84771"
FT                   /db_xref="GOA:D6Z5B4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5B4"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ADH84771.1"
FT                   /translation="MEEKEKMAKPGAGPDGAEELGAAAGPAGAGESAEGELQSAEQEQG
FT                   EETDDLLVQLSEARSEAHDLEDRMLRLAAEFENYKKRMQRERESAFKYAEEDLLKELLP
FT                   ALDNLERAIEQGHKTNDASALLEGVEMTYRGLLAGLEKFGLKPLESRGQAFDPNYHEAM
FT                   AMEASDEFPANTVISEFQRGYLYKDRLIRAAKVVVSNGPGSSA"
FT   gene            69981..71900
FT                   /locus_tag="DaAHT2_0058"
FT   CDS             69981..71900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0058"
FT                   /product="chaperone protein DnaK"
FT                   /note="KEGG: dps:DP1643 chaperone DnaK; TIGRFAM: chaperone
FT                   protein DnaK; PFAM: Heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84772"
FT                   /db_xref="GOA:D6Z5B5"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5B5"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ADH84772.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMEGGDPKVITNAEGSRTTPSVVAFNDA
FT                   GERLVGQVAKRQAVTNPDRTLYAIKRLIGRKFTDAEVKKSVDISPFKIVEGSGGDAAVE
FT                   VDGKVYAPAEIAAMVLGKMKQTAEEYLGEKVTDAVITVPAYFNDSQRQATKDAGQIAGL
FT                   NVQRIINEPTAASLAYGLDKKSEEKIAVFDLGGGTFDVSILEIGDGVFEVKSTHGDTFL
FT                   GGEDFDLRIVNWLADEFKRDQGIDLRQDKMALQRLKEEAEKAKMELSSTMETNINLPFI
FT                   TADASGPKHLNIKLSRSKLESLVADLIDRTEGPCRTALKDAGVSASDVDEVILVGGMTR
FT                   MPKVQEKVKEIFGKEPHKGVNPDEVVAIGAAVQGGVLKGDVKDVLLLDVTPLSLGIETL
FT                   GGVMTKLIEKNTTIPAKKSQVFSTAADNQPAVSIHVLQGEREMASDNKTIGRFDLADIP
FT                   PAPRGVPQIEVTFDLDANGILHVSAKDTGTGKEQSIKIQASSGLSEEEIERMKKDAESH
FT                   AEEDRKRKELVEVRNQADSLIYASEKSLRDLGDKVDADTKGKVEGEIANLKKAMEGDSV
FT                   DAIKQSIEALTQASHKLAEMMYSQAGAQQGGPEGGAGGDDAGSAGKADDDVVDADYEEV
FT                   KDDK"
FT   gene            72040..73005
FT                   /locus_tag="DaAHT2_0059"
FT   CDS             72040..73005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0059"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="TIGRFAM: tryptophanyl-tRNA synthetase; KEGG:
FT                   dps:DP1644 tryptophanyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84773"
FT                   /db_xref="GOA:D6Z5B6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5B6"
FT                   /inference="protein motif:TFAM:TIGR00233"
FT                   /protein_id="ADH84773.1"
FT                   /translation="MRVLSGIQPSGQLHIGNYFGMMQPMISNMAEHELYAFIVDLHALT
FT                   SVHDAQRLATGTLEAAVDFMALGLEPERCIFWVQSDVPEVTELTWVLSTLTPMGLLERC
FT                   HSYKDKIAKGIASSHGLFAYPVLMAADILLYQAQRVPVGKDQKQHLEVARDIAIKFNSL
FT                   FGDTFVLPEPVIDADLAVVPGLDGQKMSKSYGNTIPIFTGEKELKKRVMAIVTDSTPVD
FT                   EPKDPDRCNLYNIFKLFAPADRLKEVRDLYLNGGAMYGKIKLELLELLWEYFRPARQRR
FT                   EQLLADPGQVRDILRQGAEKARAKAAPTLEEVRRRVGLRY"
FT   gene            73095..73355
FT                   /locus_tag="DaAHT2_0060"
FT   CDS             73095..73355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0060"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84774"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5B7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84774.1"
FT                   /translation="MKTINRVKLKLLLALVLTVLAIVVILQNVEPVTVQLLFVKVSMPR
FT                   AALLAITLLVGVFIGILISLGITGGRRGAGSKLLDFDTNDH"
FT   sig_peptide     73095..73181
FT                   /locus_tag="DaAHT2_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.589 at
FT                   residue 29"
FT   gene            73461..74712
FT                   /pseudo
FT                   /locus_tag="DaAHT2_0061"
FT                   /product="hypothetical protein"
FT   gene            75034..76104
FT                   /locus_tag="DaAHT2_0062"
FT   CDS             75034..76104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0062"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: mgm:Mmc1_3223 diguanylate
FT                   cyclase; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84775"
FT                   /db_xref="GOA:D6Z5B8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5B8"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH84775.1"
FT                   /translation="MNAAVVAAHQNLKAPLPGQEASIYGNQVDSLLVQLDHYRRQTLWL
FT                   ALVNKLQGRLAGATDLPGMLEAFSLWLMPHVEHELVGFRNFDGSRKHVLCSSHGPLRRR
FT                   MLEMADKFLVSPTSETASPCCWQDDFYGCRWTIELASDSGVLLLMRRAATIDQEGIDLL
FT                   AGIVGILAEPLQRGLDYGDLFDQARRDFLTGLANRRVFDERIGPLLESARRYQQPLTLL
FT                   SMDLDRFKLLNDSCGHAEGDRALCRVAETLAGMVRTCDLLVRMGGDEFLLVLPGSDAKA
FT                   AKIMAQRIRSAVSALSFGEDRRKMGISVGIVQWAAGLSLDDWLQRADEALYRAKGLGCC
FT                   CLEPLSKQEQDSRNSS"
FT   gene            76400..79024
FT                   /locus_tag="DaAHT2_0063"
FT   CDS             76400..79024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0063"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="TIGRFAM: ATP-dependent chaperone ClpB; PFAM: ATPase
FT                   AAA-2 domain protein; AAA ATPase central domain protein;
FT                   Clp domain protein; Clp ATPase-like; KEGG: dal:Dalk_3434
FT                   ATP-dependent chaperone ClpB; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84776"
FT                   /db_xref="GOA:D6Z5B9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR023150"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5B9"
FT                   /inference="protein motif:TFAM:TIGR03346"
FT                   /protein_id="ADH84776.1"
FT                   /translation="MKFDKFTMKSQEAVQEAQSLALERQHQELQPEHLAKVLLDQTDGV
FT                   IAPVLQKMGVSREKLAAEMEALVSKLPQVSGAGATQLYASTAFQRLLDRAFKVASGMQD
FT                   EYVSQEHLVLALLEDKDAAAARVLTAQGVTKDAFLKALESVRGSQRVTDPNPEDKYQAL
FT                   EKYARNLTDVARQGKLDPVIGRDDEVRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLA
FT                   QRIVNGDVPDTLRNKQVIALDMGALVAGAKYRGEFEDRLKAVLKEIQQRQGEVVLFIDE
FT                   IHTLVGAGAAEGSMDASNMLKPALARGELHCVGATTLNEYRKYIEKDAALERRFQQVLV
FT                   KEPSVEDTIAILRGIKEKYEVHHGVRIKDSATVAAATLSNRYITDRFLPDKAIDLVDEA
FT                   ASRLRIEIDSMPTEIDEVERKKIMLEIEREALKKESDKSSQERLSKVEAELADCNEALQ
FT                   AMKGHWSLEKEIIQEIRDIKAKIDEARIEEQQAERQGDLSRVAEIRYGRIVELEKQLAA
FT                   KNERLAEIQQDRKMLKEEVDEEDVAAVVAKWTGIPTDRLLEGEKEKLVNADAKLSERVV
FT                   GQQEAIAAVANAVRRARAGLQDPNRPLGSFIFLGPTGVGKTELARSLAAFLFDTEKAMI
FT                   RLDMSEFMEKHSVARLIGAPPGYVGYEEGGYLTEAVRRRPYSVILFDEIEKAHPDVFNV
FT                   LLQILDDGRMTDGQGRTVDFKNTILIMTSNLGSQLIMDLGEERRQEMKARIDEILHAQF
FT                   KPEFLNRVDEIIIFHALNREHLSRIVDIQLQLLTQRLLEQHFKIELTPAAREFVIEVGY
FT                   DPNYGARPLKRAIQRHIQDALAMKILEGAFVEGDTIRIDRPEGSDALSFSRVAGDEAGL
FT                   DSA"
FT   gene            complement(79168..79830)
FT                   /locus_tag="DaAHT2_0064"
FT   CDS             complement(79168..79830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0064"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU0016 peptidyl-prolyl cis-trans
FT                   isomerase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84777"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5C0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84777.1"
FT                   /translation="MKSFITVLLVLFLAAACGQEKQEMIGTEAGPAPEEGYIVQVGESY
FT                   ITPSDVEQELQGMPESRRLMYETPDGQDRLFDEMIKREMFRQEAVRAGLDQSEAYRKRV
FT                   EYLARLALVEMFLEEKIQASVTVSDREVQDYYEANKDTEFTNPLSGETQPFTSVRNSIR
FT                   RLLLLEKQREAFDKYMEDMMGRYVVRVSDDYRPDSGDELPMVEEGFGQLPDDLPAAE"
FT   sig_peptide     complement(79774..79830)
FT                   /locus_tag="DaAHT2_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.739 at
FT                   residue 19"
FT   gene            complement(80004..81677)
FT                   /locus_tag="DaAHT2_0065"
FT   CDS             complement(80004..81677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0065"
FT                   /product="formate-dependent nitrite reductase periplasmic
FT                   cytochrome c552 subunit-like protein"
FT                   /note="KEGG: gur:Gura_4004 formate-dependent nitrite
FT                   reductase periplasmic cytochrome c552 subunit-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84778"
FT                   /db_xref="GOA:D6Z5C1"
FT                   /db_xref="InterPro:IPR003321"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5C1"
FT                   /inference="similar to AA sequence:KEGG:Gura_4004"
FT                   /protein_id="ADH84778.1"
FT                   /translation="MIKNPKSLLGAAVAFALVGGLSLFGASGAQAAAKPVDVNTCYNCH
FT                   DNTGPGSDIKAFHVRGSHASINCGHCHTETEAHVRNFNVKPVTSVDQRTCGQCHAEQFN
FT                   SMLQVNWDRPPKEEKATPTGRTSRYDTLMRPHGFTKEHAEPRSHVFMLVDHLLVDRAYG
FT                   GRFQLKSWELIGDGAAAQAGAWNILYDVEPETNNQKAFRGQVATAANPVCMFCKSQDNI
FT                   LNWAYMGDPHPKAKWDRTSNVVDFARSLNHALNCFTCHDPHSTEPRITRDAQIQAIVDR
FT                   GEGTYPYDKEKSKRITVEKVEFRDGFRAIGLLSEPDSNMMCAQCHVEYNCNPGIDAATG
FT                   ERVTMADQRTNLMQWSNVFDFNRRMYEDFKFIDFRNAVTGADQMKIQHPEMEVFWGSKM
FT                   EQAGVECKDCHMPKMVSKAGVKYTSHFQTSPKYHGYENTCLVCHDDWTPERADYTIHAI
FT                   KNYVRGKINKAEFWLAELIDTFVRAKDLGVPESVLAEVRKHHTEANTHWEWWVAENSDG
FT                   FHNPEQARESLAYSMTQSQQGIALLEKAIEERRKAIAKLR"
FT   sig_peptide     complement(81582..81677)
FT                   /locus_tag="DaAHT2_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.961 at
FT                   residue 32"
FT   gene            82148..83155
FT                   /locus_tag="DaAHT2_0066"
FT   CDS             82148..83155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0066"
FT                   /product="dihydrouridine synthase DuS"
FT                   /note="PFAM: dihydrouridine synthase DuS; KEGG: dps:DP2400
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84779"
FT                   /db_xref="GOA:D6Z5C2"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5C2"
FT                   /inference="protein motif:PFAM:PF01207"
FT                   /protein_id="ADH84779.1"
FT                   /translation="MKENNGRVLEYGGLRISPPLLLAPMAGLTHSALRRLVQEQGGVGL
FT                   LSTEMLAAKRLPHENPTLSPYLVRHPSEQPLSFQLLLTSPAEVAAAVASAEELGAAAID
FT                   LNLGCPAPDIRRQGGGSRLMEEPQMVRRLVQETRRRTALPLSAKIRLGEELNAERLRAF
FT                   CLLLEDAGVDLLTVHARLRGEPYGRKPRWEWVGKVKHWLRIPVVANGGIFSAADAAACL
FT                   AASGADGLMIGRAAAATPWLFRQLAEGWATDFAPGHDELSTAPSQEQKAAIYRRFCELL
FT                   KESFTPERRLGRLKEFTHYYARNYQFGHHLAAAVQSSPDLDTARRRAEHFLATA"
FT   gene            complement(83175..84083)
FT                   /locus_tag="DaAHT2_0067"
FT   CDS             complement(83175..84083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0067"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="KEGG: abo:ABO_1172 cation efflux family protein;
FT                   TIGRFAM: cation diffusion facilitator family transporter;
FT                   PFAM: cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84780"
FT                   /db_xref="GOA:D6Z5C3"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5C3"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ADH84780.1"
FT                   /translation="MTGQQATNARLLRLAALASVSVATILIGVKFVAWSLTGSTSLLAS
FT                   LVDSMMDLAASGINFMAIRYALKGADHEHRFGHGKAESLAGMAQASFIAGSAVFLLIYA
FT                   GNRLLEPRPLENIDSGLAVMLFSLLLTMALVGFQRHVIKRTGSVAIRADSLHYVTDILT
FT                   ILVTIAALFLVRQGLLWADPLLALGIACYILYSAALIIRESLRHLMDQELSPEIKGQIR
FT                   TIVLNDQRVLGMHDLRTRQAGQTKFIQFHLDLSAELSLREAHAIGQEIAETLKQNIPGA
FT                   DITVHQDPIKRHSPLNNSHTR"
FT   gene            complement(84080..85402)
FT                   /locus_tag="DaAHT2_0068"
FT   CDS             complement(84080..85402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0068"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: dps:DP2866 hypothetical protein; PFAM: Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84781"
FT                   /db_xref="GOA:D6Z5C4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5C4"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADH84781.1"
FT                   /translation="MPQHPDHTPSLVYANARGEIKDLPDLLMAGRSGLDFQPPSLQALI
FT                   PLPPGSELFVLPQRRPVGIDPDSGEALLLEDDPAEPGAPAQAVAAFIAPAHTAILGAAY
FT                   QRESEEAVTLPLFAYTAVGWYRGRFWVCAWRSDHDRRQDFGRHRPEAIKKRTNRRLAAM
FT                   SNNRLVQHLGKCCLTYGCPAAVNYFMDSFEAPLPTSPVCNARCLGCISLQPSGCCPATQ
FT                   DRIKFVPTPAEIAEIAGEHLAKTAHVASFGQGCEGEPLLQDDTIAAAIKLTRKRTAKGR
FT                   INCNTNAGRPEALAKLVDAGLDAIRVSLNSAQDHYHKRYYRPLDFNLDRVRESIRHLKA
FT                   GGKFVSLNYFVLPGFSDDPAEYNALCRLIEECRPDFIQLRNLNMDPDWYLTELEFAPTG
FT                   EAMGIMAWRAALGRRFPKLGFGYFNPPPAGHRQRQRKGARS"
FT   gene            complement(85438..86187)
FT                   /locus_tag="DaAHT2_0069"
FT   CDS             complement(85438..86187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tmz:Tmz1t_3492 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84782"
FT                   /db_xref="InterPro:IPR021727"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5C5"
FT                   /inference="protein motif:COG:COG3495"
FT                   /protein_id="ADH84782.1"
FT                   /translation="MRWTLSIFFAFLLTAGLAALLFYPYGQSQRPRATDVEPATVAPAV
FT                   VSPPHQFANEGKRQARTESPAESAATPPEPEPGVRPPLRAAADKEKLLILDWEDMIPPD
FT                   WQPDLFFQDYDIDQLDDDDDLAIELLDKLQEIWAAAPVVEELDGRKVRLPGFAVPLDAE
FT                   PGKVSEFLLVPYFGACIHVPPPPANQIVYIKAARPGELFELELFDTVWVQGTMHTAGFS
FT                   AELGEAGYTMIVDKVEPYTDGGAIVLE"
FT   sig_peptide     complement(86107..86187)
FT                   /locus_tag="DaAHT2_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.552 at
FT                   residue 27"
FT   gene            complement(86371..87630)
FT                   /locus_tag="DaAHT2_0070"
FT   CDS             complement(86371..87630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0070"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   vcj:VCD_001808 ABC-type antimicrobial peptide transport
FT                   system permease component"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84783"
FT                   /db_xref="GOA:D6Z5C6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5C6"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADH84783.1"
FT                   /translation="MATLILAWKSLLNRRYTVGLTILAIALAVALLLGVERLRYEARSG
FT                   FAATISGTDLIVGARSSPVQLLLYSVFRMGEATNNISWRSYRQIADHPRVQWTVPLSLG
FT                   DSHRGYPVLATNQDYFQYYRYADGRPLEFGQGQKFADLFDAVLGYEVARELGYELGREI
FT                   IVAHGADDVAFVRHDNMPFTVVGILAPTRTAVDRTIHIPLEGFEAIHLGWQVGVPLPGR
FT                   QVSPEEARERDLTPRQITAFLVGLDSRAASFQLQRYVNDYPREALSAILPGVALHQLWD
FT                   LLGMAEQALLLVSWFVVGVGLLGMLSAQLSNLEARRREMAILRAVGAGPRYILLLICGE
FT                   ALLLALLGAILGTALLYALLLGAGPLIEARFGLFIGLSGLRSTELIYLAIVLLAGLLSG
FT                   LIPAFRAYRQAVVNGINMRL"
FT   gene            complement(87618..88364)
FT                   /locus_tag="DaAHT2_0071"
FT   CDS             complement(87618..88364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0071"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ppu:PP_0507 efflux ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84784"
FT                   /db_xref="GOA:D6Z5C7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5C7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH84784.1"
FT                   /translation="MPNATTNTPAIDCRDLRFRWHRGGPLVLDLPALRVDRGEKVFIAG
FT                   PSGSGKTTLLSLLTGVGVAETGRVKVLGQDLAALSGSRRDHFRADHLGYIFQLFNLLPY
FT                   LSLLENVLLPCRFSRRRRENAGGRPSALRAEALRLLAHLDLADPRLLRQPVAQLSVGQQ
FT                   QRVAAARALIGGPELVIADEPTSSLDMDRRESFVKLLFAECARQGATLVMVSHDHSLEH
FT                   LFDRSIQLAAINRAQPDVAGEAAWQP"
FT   gene            complement(88395..89150)
FT                   /locus_tag="DaAHT2_0072"
FT   CDS             complement(88395..89150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0072"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_00656 ABC-type metal ion transport
FT                   system, periplasmic component/surface adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84785"
FT                   /db_xref="InterPro:IPR021253"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5C8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84785.1"
FT                   /translation="MLVANKRKGKKLFLRQMLGLAVGLLLLQAQPVVAHNDAQGHHEKP
FT                   PGHSHHTHDHDSHGHDHGHDHDHGSGLGAHVHGLAEINLIAEDSLLIIDMVSPGFNLVG
FT                   FEHQPRTHEQRQAIREAKDLLAQGEKLFALPPAARCRLVRAEIGSDFDLDHQHGHGHGD
FT                   SHEHEERHGHGDPHGHDHQHGHEHKHNHDHAEFTGLWEFHCERPELLNRIDFRLFEYFP
FT                   GTERIRVQAVTPAGQVGADLRPQNSRLNL"
FT   sig_peptide     complement(89046..89150)
FT                   /locus_tag="DaAHT2_0072"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 35"
FT   gene            complement(89285..89692)
FT                   /locus_tag="DaAHT2_0073"
FT   CDS             complement(89285..89692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0073"
FT                   /product="single-strand binding protein"
FT                   /note="KEGG: dps:DP2579 single-strand binding protein
FT                   (ssb); TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84786"
FT                   /db_xref="GOA:D6Z5C9"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5C9"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ADH84786.1"
FT                   /translation="MINKVILIGNLGADPEVRYSQSGDAVTTFRIATTEVWKKQDGSKE
FT                   ELTEWHRIVTFKRLAEICGEYLSKGSRVYIEGRIQTRKWQDKDGNDRYTTEIVAREMKM
FT                   LSPRGAGGDSGNQFMDEPPPPEPPIGDDVPF"
FT   gene            complement(89925..91106)
FT                   /locus_tag="DaAHT2_0074"
FT   CDS             complement(89925..91106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0074"
FT                   /product="DNA repair photolyase-like protein"
FT                   /note="KEGG: sfu:Sfum_1261 DNA repair photolyase-like"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84787"
FT                   /db_xref="GOA:D6Z5D0"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5D0"
FT                   /inference="similar to AA sequence:KEGG:Sfum_1261"
FT                   /protein_id="ADH84787.1"
FT                   /translation="MNTFDELPADDPSRRLTSLRVEESCLDLPLTREILARAGDLPLTV
FT                   IPDGAEPAPDLTPYPQSLTHGKRILHLGRNRGRFLKPCPATRNYRCCDYQVLNIGAGCP
FT                   MDCAYCILQAYLNNPWLSFYVNIDDLFRELDETLDQATARQAGAEPERSFYRIGTGEFT
FT                   DSMALDRLTGLSARLIRYMATKSNAVLELKSKAVVLDHLPASGHNGRTVMAWSLNSAEV
FT                   MHRLELHTADLDTRLTAAAHCADLGYPLAFHFDPIIDHPGWEEGYRETIRRLYQAVPAT
FT                   SIAWISLGAFRFLPALKGVIGSRFPGATFIHEEFVPGLDGKFRYFRPRRTRMYQLLIDE
FT                   LNRRAAPHTCIYFCMENDQIWRQVFGHTPEEKGGLPAMLDTAARAAVEIAAST"
FT   gene            complement(91103..92101)
FT                   /locus_tag="DaAHT2_0075"
FT   CDS             complement(91103..92101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0075"
FT                   /product="thioredoxin reductase"
FT                   /note="KEGG: dba:Dbac_3408 thioredoxin reductase; TIGRFAM:
FT                   thioredoxin reductase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84788"
FT                   /db_xref="GOA:D6Z5D1"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5D1"
FT                   /inference="protein motif:TFAM:TIGR01292"
FT                   /protein_id="ADH84788.1"
FT                   /translation="MGIEKTNMSCPKPSSYPNSGDFHLHDLIIIGGGPGGLTAGIYAQR
FT                   AALDTVLLEKGVPGGQMNNTDMVENWPGTESIGGAELATAMADHVSSYGLEIQQQEVRQ
FT                   IEPCLGYHLVHLADGRSLAAYALIIAAGGSPRKLEVPGEDENYGKGVSYCAVCDGFFFR
FT                   NKTVVVVGGGDTALEESLYLAKIAGQVHLVHRREAFRGSMILQKRVQKEDNIRLHLNAV
FT                   VTAIMADGQGVTGVALEDTQNGDRSELACDGVFVFIGFVPDNKLVPAGTKMNADGYVIT
FT                   DDKCETNLPGIFVVGDLREKYVKQIITAAADGCIAAQAAARHVENRKGENK"
FT   gene            complement(92136..93245)
FT                   /locus_tag="DaAHT2_0076"
FT   CDS             complement(92136..93245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0076"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="KEGG: pca:Pcar_2713 magnesium and cobalt transport
FT                   protein CorA; TIGRFAM: magnesium and cobalt transport
FT                   protein CorA; PFAM: Mg2 transporter protein CorA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84789"
FT                   /db_xref="GOA:D6Z5D2"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5D2"
FT                   /inference="protein motif:TFAM:TIGR00383"
FT                   /protein_id="ADH84789.1"
FT                   /translation="MSAYNSGIIARVLGNAPLKAGLPPGTPIHVGERKTERVNITVLHY
FT                   DRHGCREETTEKAEQCRFYHDREGVSWINVDGLHHVDIIEKVSACFKLHPLTVEDICNT
FT                   TQRPKLDIFDDYLFLVARTQTYDQARGALASDQISIILGKNFLLTFQESPTPIFAGVRH
FT                   RINSGKGKIRTMGPDYLAYALLDAVVDSYFQTLENLGEEIETLEEEVLSAPRRENAEKI
FT                   HRLKREMILLRKSVWPMREILNSLLRHDETELIDPAINIYLKDLYDHTIQVIDTVETYR
FT                   DITAGLLDIYLGSLSNRMNEAIKVLTMFATIFIPLTFIAGVYGMNFDPEASPWNMPELG
FT                   WTFGYPLVLALMLAVAGGMLYYFKRKGWL"
FT   gene            93575..94411
FT                   /locus_tag="DaAHT2_0077"
FT   CDS             93575..94411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0077"
FT                   /product="Ion transport protein"
FT                   /note="PFAM: Ion transport protein; KEGG: psa:PST_3753
FT                   voltage-gated sodium channel subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84790"
FT                   /db_xref="GOA:D6Z5D3"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5D3"
FT                   /inference="protein motif:PFAM:PF00520"
FT                   /protein_id="ADH84790.1"
FT                   /translation="MTSSIDAGWRQQLYQWIEQRWVQQAVIGVIIANAAILGLETVPRV
FT                   NEPYGDLLYTLDRLCLTIFVVELTVAMIAMGPARFFRDPWRVFDFVVVGIALVPATGAF
FT                   SVLRSLRVLRVLRLVSASPRMRKVVAALLQAIPGLSSIATLLLLIFYVAAVMSTKLFGE
FT                   HFPEWFGSIGASMYTLFQVMTLESWSMGIVRPILAEFPYAWLFFVPFIMVATFTILNLF
FT                   IAVIVEAMQSQAQAAQAEQMHEIEALAEEKESALHRDIDKLRDEIRELKAILAQQR"
FT   gene            complement(94591..95472)
FT                   /locus_tag="DaAHT2_0078"
FT   CDS             complement(94591..95472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0078"
FT                   /product="HtpX domain protein"
FT                   /note="PFAM: HtpX domain protein; peptidase M48 Ste24p;
FT                   KEGG: tgr:Tgr7_2118 heat shock protein HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84791"
FT                   /db_xref="GOA:D6Z5D4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5D4"
FT                   /inference="protein motif:PFAM:PF06509"
FT                   /protein_id="ADH84791.1"
FT                   /translation="MKRIALFIATNLAIVLVLSIVLSLLGVGRILDETGTGLDMRNLII
FT                   FAAVFGFGGSFISLAISKWTAKRLTGAQVITTPRNEAEAWLVETVKNQARVAGIGMPEV
FT                   AIYDAPDVNAFATGARRDKALVAVSTGLLRAMNRDEAEAVLAHEVSHVANGDMITLALI
FT                   QGVVNTFVIVASRVVGHLVDRVVFKTEQGHGPGFYITAIVAQVVFGILASTIVFWFSRQ
FT                   REFRADAGGARLASRDKMVAALEKLKRNVDQPHLPDQMAAFGISGGIGQGLKRLFMTHP
FT                   PLEERIEALKRR"
FT   gene            complement(95489..96145)
FT                   /locus_tag="DaAHT2_0079"
FT   CDS             complement(95489..96145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0079"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: mhu:Mhun_2196 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84792"
FT                   /db_xref="GOA:D6Z5D5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5D5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH84792.1"
FT                   /translation="MIKLKNVEKKYRRGAEEVRALRGIDLEIQAGEFVSVIGPSGAGKT
FT                   TLLHILGCLDLPSSGEMHFDGLRVDKMRESELVTLRRNKIGFIFQQFYLIPGLSVLDNI
FT                   ALPLMFSKSKPAPGRIEELARAVGLGERLHHVPAQLSGGEMQRTAIARALVNDPEVILA
FT                   DEPTGNLDSANSEKIFDILHKLHQNGLTVIMITHNPELAERAGRTITIKDGIIEQ"
FT   gene            complement(96170..97336)
FT                   /locus_tag="DaAHT2_0080"
FT   CDS             complement(96170..97336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0080"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   mhu:Mhun_2195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84793"
FT                   /db_xref="GOA:D6Z5D6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5D6"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADH84793.1"
FT                   /translation="MSGMLKLSVQNLLRHRTRSFLTMLGIAAAVGVLFSVFSFNRGFDQ
FT                   GLARELQATGLHFMVVPVGCAHEVAALVLHGAVVPKYLDAGVIDDVRKIDGVELATPIL
FT                   VAQLPNPDRHRIDLIYGVEMEVLREIKPDWRISGEIPTAPNELLLGYDVAEHAGLRLGD
FT                   EFRYPAVDETFIVTGILERTNSQDDAFVYLDIGTAQRLMDNPDGATAIGVKVSAPERMG
FT                   SIINQLEEEMPGIQIVTMSQVMNSVANVAASAKSLSLAIALVALVIGAVGVMNSILMAV
FT                   FERSQEIGMMRAIGASRWNVFQIILKETTILTIVGGAAGIAIATVGAQLIENYVRRIMP
FT                   YVPGGDMLSFDPTLALACVGFALVVGLVAGLYPAWKASRINPIEAIKS"
FT   sig_peptide     complement(97214..97336)
FT                   /locus_tag="DaAHT2_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.679) with cleavage site probability 0.424 at
FT                   residue 41"
FT   gene            complement(97333..97722)
FT                   /locus_tag="DaAHT2_0081"
FT   CDS             complement(97333..97722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0081"
FT                   /product="nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /note="PFAM: nucleic acid binding OB-fold
FT                   tRNA/helicase-type; KEGG: mhu:Mhun_2194 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84794"
FT                   /db_xref="GOA:D6Z5D7"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5D7"
FT                   /inference="protein motif:PFAM:PF01336"
FT                   /protein_id="ADH84794.1"
FT                   /translation="MKRVNKTTRRPWVPMLLALLFMGLLLSGCGKETYGEGVDPSAPRV
FT                   AVQDIFLQPQLLNQKVTVQGTVYTQCESNGCWFVLRDETAQIYIDLSTNNFELPPMPGR
FT                   RVMATGTVTTFQNNLLLIAQGVETI"
FT   sig_peptide     complement(97630..97722)
FT                   /locus_tag="DaAHT2_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.602 at
FT                   residue 31"
FT   gene            complement(97880..98470)
FT                   /locus_tag="DaAHT2_0082"
FT   CDS             complement(97880..98470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dma:DMR_44630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84795"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5D8"
FT                   /inference="similar to AA sequence:KEGG:DMR_44630"
FT                   /protein_id="ADH84795.1"
FT                   /translation="MKNHIQELLERIKALEQELTEEIQRKEKEFAYQIKNRKVIFSSEA
FT                   KRRHRQLMQSVRRFLYESRLLVIITAPVIWACLLPAVLLDIFITIYHAVCFPIYGIPKV
FT                   RRRDYIVIDRHALRYLNIIEKLNCAYCGYVNGLIAYTREIAARTEQYWCPIKHARRTAA
FT                   IHGRYHKFVEYGDAEGYRRRLAEIRRDFEDLKA"
FT   gene            98730..99236
FT                   /locus_tag="DaAHT2_0083"
FT   CDS             98730..99236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0083"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cbh:CLC_0392 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84796"
FT                   /db_xref="GOA:D6Z5D9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5D9"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH84796.1"
FT                   /translation="MKQEGVELRREVYRQDVEKMADWMADREVTEYLNEDQNIDGELKN
FT                   LLSSSQLPIYSPHFNRNGSFFLVTLPSRGPIGFVRLVPKREQAEVVVVIGERRCWSQGY
FT                   GRQAIFQAARYAFFEWRKERVVATIHRENQRSKKVFKKAGFRKAERLATETRYTLPVEK
FT                   FHSVK"
FT   gene            99388..99693
FT                   /locus_tag="DaAHT2_0084"
FT   CDS             99388..99693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0084"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="KEGG: mgm:Mmc1_0100 nitrogen regulatory protein
FT                   P-II"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84797"
FT                   /db_xref="GOA:D6Z5E0"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5E0"
FT                   /inference="similar to AA sequence:KEGG:Mmc1_0100"
FT                   /protein_id="ADH84797.1"
FT                   /translation="MSNPNLITCIVQRGDADKVVAAAIKAGAEGATIYYGRGTGIRQQL
FT                   GLAGRFIRPEKEIILIVTRIEETDAVFNAVVKAAKLEEKGRGFAFLHKLDRAVGFL"
FT   gene            99739..100215
FT                   /locus_tag="DaAHT2_0085"
FT   CDS             99739..100215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0085"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ace:Acel_1971 thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84798"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5E1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84798.1"
FT                   /translation="MLKILSFFTLIWVAARFVYGLDFAPLLELLEQFIVAHNYPLQAAG
FT                   VLVALCLPGITRTFEGLGLYSLMYSLARLFFFLSTILVCLVSLAAVLFWFDLGVNLWAM
FT                   LGLIAALPILIAGSAAFSLHIADFNYPVKASLVPLLMLAGLSAFVVFLAAYYGI"
FT   sig_peptide     99739..99801
FT                   /locus_tag="DaAHT2_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.672) with cleavage site probability 0.667 at
FT                   residue 21"
FT   gene            complement(100258..102963)
FT                   /locus_tag="DaAHT2_0086"
FT   CDS             complement(100258..102963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0086"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="KEGG: tgr:Tgr7_0290 ATPase, P-type (transporting),
FT                   HAD superfamily, subfamily IC; TIGRFAM: ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; cation transporting
FT                   ATPase domain protein; Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84799"
FT                   /db_xref="GOA:D6Z5E2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5E2"
FT                   /inference="protein motif:TFAM:TIGR01494"
FT                   /protein_id="ADH84799.1"
FT                   /translation="MNPSPPDTPWHSQDTQQVLTSLEVSDRGLGADEARQRLERFGPNR
FT                   LPQPERTGPLKRFLLQFHNVLIYILIAAAAGTAFLQHWVDTGVILGVVLINAVIGFIQE
FT                   GKAEQALDAIRNMLSPKAMALRDGQRRTVPAEELVPGDIVYLQAGDRVPADLRLLRTHN
FT                   MRIDEAVLTGESVAVDKKTEPVEEAADLGDRTGMAFYGTLVAFGQGRGVVVTTGADTQI
FT                   GRISTMLGEVETLTTPLLRDIAIFGRWLSVVIIALAGFTFAFGYWLRDYDLMETFLAAV
FT                   SLAVAAIPEGLPAIMTITLAIGVQRMAARNAIIRRLPAVETLGSVTTICSDKTGTLTRN
FT                   EMTVKSMVTADQTFEIGGVGYEPHGGFALDGQDINPDEQPVLAEALRGILLCNDAELQQ
FT                   QEGQWKLEGDPTEGSLVTAALKAGLNQKQLNEFFPRDDVIPFESSYKFMATLHHHHENQ
FT                   HRFLYLKGAPERVLAVCAQERTSDGDREIDQDRWQQQMETIAARGQRLLAVATKEVETD
FT                   HNALEFSDIEDGGLTMLALCGIIDPPRDEAIEAVQQCREAGIDVKMITGDHGVTAKAIA
FT                   EELNIQTAGGVVTGQQLEQTSDEEMVQMVREVDVFARATPEHKLRLVRAIQANRQVVAM
FT                   TGDGVNDAPALKRADVGIAMGIKGTEATKEVAEMVLADDNFASIAHAVEEGRTVYDNLR
FT                   KAILFLLPTNGGQAFTIVAAIMLGLTLPLTPVQVLWVNMVTAVTLALALAFEPTEPGVM
FT                   KRPPRPPETPIITGFLIWRVVFVSALLVAGTFGHFLWMERQEVAVEVARTVAINTLVMG
FT                   QLFYLFNSRYILEPVCNREGLLGSRPVLIAIGVLIVLQGLFTYAPPAQFLFGTAPIGLE
FT                   DWGRILAFGLLLFVLVEVEKALFKSRQTRL"
FT   gene            complement(102960..105686)
FT                   /locus_tag="DaAHT2_0087"
FT   CDS             complement(102960..105686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0087"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="KEGG: tgr:Tgr7_0291 ATPase, P-type (transporting),
FT                   HAD superfamily, subfamily IC; TIGRFAM: ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; cation transporting
FT                   ATPase domain protein; Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84800"
FT                   /db_xref="GOA:D6Z5E3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5E3"
FT                   /inference="protein motif:TFAM:TIGR01494"
FT                   /protein_id="ADH84800.1"
FT                   /translation="MNTATDSNSHNRISARDWHARSGEEALTRWRTERQGLSADEAARR
FT                   LARYGPNSLAPPEKTGMVHRFLRHFHNVLIYILLLAALGTALLGHWVDTGVILAVVLIN
FT                   TLIGFVQEGKAEKALDAIRDMLSPMAVVVRHGQRREVPAGELVPGDIVHLQAGDRVPAD
FT                   LRLLEVKNLRIEEAALTGESVPVDKAVEPVATDAALGDRSCMAFSGTLVAFGRGVGVVV
FT                   ATGAHTEIGQISRMLGEVHSLQTPLVRQMEQFGRWLALVIITISAATFAFGYWVQSYPL
FT                   DEMFLAAVSLAVSTIPEGLPAIMTIALAIGVQKMAKRNAIIRRLPAVETLGSVSTICSD
FT                   KTGTLTRNEMTVRTVITAGQRFEVTGVGYDPRGGFLLAGKDVEPDDHPVLIESLRAGLL
FT                   CNDAVLHEREGAWVMEGDPTEGALITAACKAGLVTHTEQEHLPRTDVIPFDSDHKFMAS
FT                   LHHDHQGHGRVLLKGAPERVLELCRHQRTADGGHTPLDPAAWQQYMEETAARGERLLAV
FT                   ATREIEPDRRELTYREVETGGFTLLALLGIIDPPREEAVYAVSQCREAGIAVKMITGDH
FT                   LVTARAIGEQLGMGNGITAIAGHELEGMDEAALREAARRAGVFARTTPEHKLRLVEALQ
FT                   KEGRIVAMTGDGVNDAPALKRADVGVAMGRKGTEAAKEAAEMVLADDNFASIAHAVEEG
FT                   RTVYDNIRKAILHTLPTNAGQSLTIIMAIIMGYTLPLTPVQVLWVNMVTSVTLAMALAF
FT                   EPAEPGVMKRPPRSPDAPLISGFMLWRIPFVALLLWAGTFWHFVWMEEVAGASLELART
FT                   VAINTLVAGQAFYLLNLRLIHQPVLIGLEVFRSRAMWTAIGILIILQLTFTFAPFMNAL
FT                   FGTTAIPAEHWWRILLFGLLVFIIVEAEKIMIKRLLP"
FT   gene            complement(105788..106006)
FT                   /locus_tag="DaAHT2_0088"
FT   CDS             complement(105788..106006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dat:HRM2_40770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84801"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5E4"
FT                   /inference="similar to AA sequence:KEGG:HRM2_40770"
FT                   /protein_id="ADH84801.1"
FT                   /translation="MPGHQVIFFTPYPFTPGQKIRITAGPRRGDWEVAAIDEQKVTLRC
FT                   PVSGRQFSWNHFCYQSESRINEPWPIT"
FT   gene            complement(106053..106496)
FT                   /locus_tag="DaAHT2_0089"
FT   CDS             complement(106053..106496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0089"
FT                   /product="Smr protein/MutS2"
FT                   /note="KEGG: dat:HRM2_33020 hypothetical protein; PFAM: Smr
FT                   protein/MutS2; SMART: Smr protein/MutS2"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84802"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5E5"
FT                   /inference="protein motif:PFAM:PF01713"
FT                   /protein_id="ADH84802.1"
FT                   /translation="MSNRKNDLANPNIFSQSATSKKGFGSLVDQYLDDLENVAKSEKLP
FT                   PKPTLEQKLRRYPPPQEELDLHGLTAPEAEKAVKRFITHCRELRLATLRIITGKGLHSQ
FT                   GEPVLPPVTEAALATLQAEQKIAAFRWEKKRQGRGGALIVYLP"
FT   gene            106702..107604
FT                   /locus_tag="DaAHT2_0090"
FT   CDS             106702..107604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0090"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: dps:DP0999 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84803"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5E6"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADH84803.1"
FT                   /translation="MGRKLHFIVTSEYGRTRSFSIKKRRIMALGTVFVALLVISAVGWQ
FT                   AAVENITLRAKSAAVKYELAAVKEKHRQMLARAAAKEEQQRQTLDTAMEELRKRSEAIE
FT                   SILSAVDIDIEIGEGESNTGGPFIGLDDGTYDDLTFKVDHYLNFLESMPLGTPVPGTLT
FT                   SPFGRRTDPFTRQPAMHDGLDIHNRVGTKIKAPAAGVVTTSNYNRFNGNYLVIDHGNGF
FT                   ATRYLHLQRSLVKAGERVERGQKIARLGNTGRSTGPHLHYTILYNGEAIDPYRFVRVAS
FT                   VLDGSVSASGGSVRGQEVR"
FT   sig_peptide     106702..106833
FT                   /locus_tag="DaAHT2_0090"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.879) with cleavage site probability 0.407 at
FT                   residue 44"
FT   gene            107614..108159
FT                   /locus_tag="DaAHT2_0091"
FT   CDS             107614..108159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0091"
FT                   /product="protein of unknown function DUF583"
FT                   /note="PFAM: protein of unknown function DUF583; KEGG:
FT                   dps:DP0998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84804"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5E7"
FT                   /inference="protein motif:PFAM:PF04519"
FT                   /protein_id="ADH84804.1"
FT                   /translation="MVFWRKKKDDLEAGAVTSILGQELQMEGDVSFKGKLRLDGRVKGN
FT                   VQGDYLILGENGVVNGDVQVNTFVCSGRVDGNVNAKKFQISNRGVINGKVEASDLAVES
FT                   GAALNGEVKSRSKELRLVPGTSIPKEEWDAQVKGAASGASGAKKAAAAVAAAGKSGQQE
FT                   SSSAPDKPGKQEAAAVAG"
FT   gene            complement(108343..109752)
FT                   /locus_tag="DaAHT2_0092"
FT   CDS             complement(108343..109752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0092"
FT                   /product="type III restriction protein res subunit"
FT                   /note="KEGG: dsa:Desal_2267 type III restriction protein
FT                   res subunit; PFAM: type III restriction protein res
FT                   subunit; helicase domain protein; SMART: DEAD-like helicase
FT                   ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84805"
FT                   /db_xref="GOA:D6Z5E8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5E8"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ADH84805.1"
FT                   /translation="MVSGMMSNKPPAPSQQIPPILTVDHQARLSGGNAGLRALIKQRLT
FT                   LDNPKYRDARKYSRWVGKNLPPKLYFYQESGEALIFPRGWARQAVLLCRQEMGQTPEII
FT                   DRRREIAPQEFAFQGELRPYQHQAREAILGRDFGVLEAGTGSGKTVVACAVIAARQQPT
FT                   IVLVHTKELLYQWSERIGEFLGLEAGLLGDGHRRLEPVTVAIVNSARRMARELPPLFGQ
FT                   LCVDECHRVPSSLFTEVVTAFDCRYMLGLSATAYRRDGLTPLINFYLGDRVHRIDTGDL
FT                   QRSGAVLKARLIQRPTAFRYLYRGNYQALMKALTADQKRNQLIAEDIAREARATVGGNG
FT                   ATETGTILVVSDRVRHCQELARLLEQRGVDCQILTGATPAEQRSELVAAIQEGRVRVLI
FT                   STVQLIGEGFDCPGLRSLFLTTPIKFTGRLLQVVGRILRPAAGKQPTVYDYVDQVGVLQ
FT                   SSANSRALALQ"
FT   gene            109892..111580
FT                   /locus_tag="DaAHT2_0093"
FT   CDS             109892..111580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0093"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sat:SYN_01978 putative ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84806"
FT                   /db_xref="GOA:D6Z5S4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5S4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH84806.1"
FT                   /translation="MSNHEPDKIIYSMIKVSKFYDKQPILKDISLSYFYGAKIGVIGMN
FT                   GSGKSSLLRILAGEDKEFNGETHISPGYTVGYLAQEPQLDGNLTVRQVVEQGVQETVDL
FT                   VNEFNEINMKFAEPMDDDAMDKLIARQAAVQEKLDALNAWDLDSRLEMAMDALRCPPGD
FT                   TTINVLSGGEKRRVALCRLLLQQPDILLLDEPTNHLDAETVAWLEHHLQRYAGTIIAVT
FT                   HDRYFLDNVAGWILELDRGHGIPWKGNYSSWLEQKQKRLAQEEKQESDRRKTLARELEW
FT                   IRMTPKGRHAKAKARINAYEQLLGQEGEKRGRELEIYIPPGPRLGKTVIEAEGLSKSFG
FT                   ERLLFDNLSFSLPPGGIVGVIGPNGAGKTTLFKLINGQETPDAGTIKVGESVQLASVDQ
FT                   HRDALNPEDTIWQAISEGQETITLGNREVNSRAYVARFNFSGSEQQRKVGMMSGGQRNR
FT                   VHLARMLKSGANVILLDEPTNDLDVNTLRALEEALENFAGCAVVISHDRWFLDRIATHM
FT                   LAFEGDSQVVWFDGNYSEYEEDRRRRLGADADQPHRIKYRHLTRA"
FT   gene            111585..113570
FT                   /locus_tag="DaAHT2_0094"
FT   CDS             111585..113570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0094"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold domain protein; response regulator
FT                   receiver; Hpt domain protein; KEGG: cak:Caul_0720
FT                   multi-sensor hybrid histidine kinase; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS domain containing protein; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84807"
FT                   /db_xref="GOA:D6Z5S5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5S5"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH84807.1"
FT                   /translation="MALAEKFKMAWRALLGRSPVAFDAEERLRDSEGRLSAILQSIGAG
FT                   VIATDQQGRVAFLNPVAERLTGWDLVDALNRPVMEVLNLVDEASGRPLTAPLQRVQEDG
FT                   EIIDCSGELVLRSRQGKNYPVSCTVAPIASFSGIIGCVFVFRDTIREREIQRNLLSAKE
FT                   EAERASQAKSEFLASMSHEIRTPLTTILGMADLLDKTPLGAEQRQYVWASRAAGENLLD
FT                   LINGILDLSKIEAGKLEIEVMEFDLDHLLRQTCEIMALRAHQKGLEFTCRLSWQGSCLV
FT                   LGDATRIRQILVNLIGNAIKFTERGKVTVEAVRWPAEESAENTWFGFVVSDTGIGIPPD
FT                   KQEMVFEDFAQVDSSTSRRYGGTGLGLAISRKLVQMMGGTIRLASREGEGSRFTVEIPL
FT                   PWRGAILGASGKTSQEGALPAAGLPTAGAATRRLLLAEDAPENRLLFKAYLKGTPYLLD
FT                   LAVNGEEAVVKFKQGHYDLVLLDIQMPGMDGYAAARAMRAWEAEQGREAIPIVALTAHA
FT                   FRDDIRKSREAGCDGHMVKPIKMDDFLRTIRTYIGAAETATGDQPEIGQLDDLLADLVP
FT                   GYLARVRNDLTQMRKALSRRDYSKVCHLAHTIKGTGGGYGFNRLSELGAAMEEAAGGED
FT                   GEKINFYLEELNLYLDKVEVLHGIKE"
FT   gene            113627..114640
FT                   /locus_tag="DaAHT2_0095"
FT   CDS             113627..114640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0095"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; response regulator receiver; KEGG:
FT                   hmo:HM1_0560 two component diguanylate cyclase; SMART:
FT                   GGDEF domain containing protein; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84808"
FT                   /db_xref="GOA:D6Z5S6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5S6"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH84808.1"
FT                   /translation="MGTNSILIVDDALESRLILRRMLGANGYDKIHEADGAAATFTFFG
FT                   LDAEGVGVPRDNLDLDLILLDIVMPDIDGIELCRRLKSHEQLRDIPVIMVTADNTDDSL
FT                   RTVFDLGVADYIQKPVKQVELCARVKAALRLKREMDRRRDLTNALEEANRRLQRMALVD
FT                   GLTGIANRRNFDDFLDREWRRCQRDGQPIAICLFDIDYFKLYNDSFGHLQGDEVLKQVA
FT                   TALQQVASRPGDLVARFGGEEFVFVLSGSDQEGAQLVVQRAIEKIRELAVLHPQSPVNE
FT                   HLTVSCGISAVRPHPGLYPNLLLDCADKALYEAKQIRNNQVVTLLPPGPEDQAPRK"
FT   gene            114661..115572
FT                   /locus_tag="DaAHT2_0096"
FT   CDS             114661..115572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0096"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: tye:THEYE_A1262
FT                   amidohydrolase family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84809"
FT                   /db_xref="GOA:D6Z5S7"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5S7"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ADH84809.1"
FT                   /translation="MGYIAGHEDHLVGPCHRPRPRFCSRCLAGCCLTMSPIIDFHTHAF
FT                   PDQVAVRAIPALEAEVAGEVKACHDGRLSSLLAKMDEAGIAQSVLCSIATRPAQFVPIL
FT                   EWSQSIASERIIPFPSVHPADPEAVNRISQIRAAGFAGIKMHPYYQQFTLDEERMWPIY
FT                   ERIAAEGLILVMHTGFDIAFPRDPIASPARIIRVVERCPELKFIATHLGAWEQWEEVEA
FT                   SLAGRPIYMDLSYVLHLLPAADARRIILAHPADYLLFGTDSPWADQKKVIKELKNLGLP
FT                   AALEEKIFWQNAARLLPATLLK"
FT   gene            complement(115565..115795)
FT                   /locus_tag="DaAHT2_0097"
FT   CDS             complement(115565..115795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0097"
FT                   /product="protein of unknown function DUF167"
FT                   /note="PFAM: protein of unknown function DUF167; KEGG:
FT                   ava:Ava_3894 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84810"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5S8"
FT                   /inference="protein motif:PFAM:PF02594"
FT                   /protein_id="ADH84810.1"
FT                   /translation="MTMILQIKVKPRSQSSSLTQEADGSWLARLKSPPVEGRANRELIA
FT                   LVADHFRCRKADVEIKAGSSGRTKLVRVETT"
FT   gene            complement(115919..117121)
FT                   /locus_tag="DaAHT2_0098"
FT   CDS             complement(115919..117121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0098"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mag:amb1665 major facilitator superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84811"
FT                   /db_xref="GOA:D6Z5S9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5S9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADH84811.1"
FT                   /translation="MIHYGWYIVLAGTFCVFACLGLARFALGMILPGMGQGLDLSYSQM
FT                   GLVGTMNFVGYLAAVLFCGALADRLGYRLLITLALTLIGLTMILIGFSNSLAIILLLYM
FT                   LCGMGSGAANVPVMGLISHWFHRRQRGRATGFVVIGSGFAILLSGWLIPQINRLAGPEL
FT                   GWRLSWQVLGLLVLAIALLCLAIMRNSPQEKGLRPYGEQTGADGLPRPGDESNRITPKI
FT                   IAHLGAIYFLFGYTYVIYTTFIVTTLINEHGFAPTTAGYFWAVVGVLSLLSGPVFGTMS
FT                   DRIGRKKTLALVFAIQTTAYLLVAAGPPPALLLLSVCLFGLVAWSIPSIIAAMVGDYAG
FT                   PQQAARIFGLVTFIFAIGQIAGPAMAGIMAEKTGSFGGSFLMAGLCTILGLLLALRLKP
FT                   V"
FT   gene            complement(117128..118303)
FT                   /locus_tag="DaAHT2_0099"
FT   CDS             complement(117128..118303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0099"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   dps:DP2938 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84812"
FT                   /db_xref="GOA:D6Z5T0"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5T0"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADH84812.1"
FT                   /translation="MAISQKMIAFAERSSWIRKMFEEGAKLKSIHGADNVFDFSLGNPD
FT                   LPPPAQFATTLQKVAAEAGPGRHSYMPNGGYPFVRAALAAQIGNEQGMTLGEEEILMTV
FT                   GAAGGLNVILKALLDPGDEVIILAPFFVEYNFYVDNHGGTAKVVNTREDFSLDIAAIEA
FT                   AIGPKTKAIIINSPNNPTGQIYSADELARLATVLEEAGQPIYLIADEPYRKIVFDDHEV
FT                   PSIFQAYRHSLVVSSYSKDLSLPGERIGYIAVHPEIADKGPLMGAMTLANRILGFVNAP
FT                   ALMQRVVAELQGVTVDTEIYTRRRELFCKVLREAGYQFVPPKGAFYLFPKSPLADDAEF
FT                   VGLLAEEKILAVPGRGFGMPGYFRLAFCVEDEVISRAAAGFAAALAAAQQK"
FT   gene            complement(118489..119787)
FT                   /locus_tag="DaAHT2_0100"
FT   CDS             complement(118489..119787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0100"
FT                   /product="Phenylacetate--CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="KEGG: dps:DP1272 coenzyme F390 synthetase; PFAM:
FT                   AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84813"
FT                   /db_xref="GOA:D6Z5T1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5T1"
FT                   /inference="protein motif:PRIAM:6.2.1.30"
FT                   /protein_id="ADH84813.1"
FT                   /translation="MYWNEAKECMKRDELEQLQLERLQATLFRVATHVPFYRQKFKELK
FT                   IDPDGFRSLDELRSLPFTVKQDLRDNYPYGLFAVPLRDVVRVHSSSGTTGQATVVGYTG
FT                   NDIKTWSSLTARVLTAAGVGKDDVVQIAFGYGLFTGGFGLHYGAELVGASVIPISSGNT
FT                   RRQLRIMQDFRTTALICTPSYALLLADTIEELGLPLNAFSLKYGMFGAEPWSEAMRREI
FT                   ESKLNIIATDNYGLSEIMGPGVAGECQERSGLHINEDHFLVEIINPDTLEPVAPGEIGE
FT                   LVITTLTKEAFPLIRYRTRDLTRLIEEPCPCGRTLRRMERITGRTDDMLIVKGVNVYPS
FT                   QIENVLFEVEGTKPHYQIVVEREGRVDKITVLVEVTEAIFFDEMRKQREVIDTIKNRLA
FT                   SELGIGVNVRLVEEKSLERSEGKAQRIIDKRQL"
FT   gene            complement(120133..120858)
FT                   /locus_tag="DaAHT2_0101"
FT   CDS             complement(120133..120858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0101"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: dps:DP1271 high-affinity branched-chain amino
FT                   acid ABC transporter, ATP-binding protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84814"
FT                   /db_xref="GOA:D6Z5T2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5T2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH84814.1"
FT                   /translation="MLKVRNLEAGYGKLRVLKRISLHVNPGEIVTLIGANGAGKTTLLS
FT                   TITGLVRASAGEILLQDREISREKPEKIVAMGCSLVPEGRQVFVTMTVQENLVMGGYIQ
FT                   HKKGNRAFMQELDNIYQLFPVLQERREQLAGTLSGGEQQMLAMGRALMAQPSLIMLDEP
FT                   STGLAPLIVKNIFEIITRMRENGNTVLLIEQNAKAALKIADRGYVLETGKIILEGPAEA
FT                   LLANRDVQRAYLGRDLGQS"
FT   gene            complement(120851..121621)
FT                   /locus_tag="DaAHT2_0102"
FT   CDS             complement(120851..121621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0102"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: dps:DP1270 high-affinity branched-chain amino
FT                   acid ABC transporter, ATP-binding protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84815"
FT                   /db_xref="GOA:D6Z5T3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5T3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH84815.1"
FT                   /translation="MALLEIDNLCKRFGGLHAVSEVSFAVEPGIIKAVIGPNGAGKTTL
FT                   FNLIAGSLPVTSGQVSFEGKTITGSKPYQIAEQGISRTYQNIKLYHGMTALENVMIGRH
FT                   VRSSAGFIAGMLNLPGTRKEEREIRDYCMSLLEMLEVGHLADTEATSLSFGQQRTVEMA
FT                   RALALEPKLLLLDEPAAGLNIYETAEVGRLISKINQQGITVLLVEHDMSLVMEISHEIV
FT                   VLSFGRKIAEDEPAAIQQDQEVIKIYLGEADDDA"
FT   gene            complement(121608..122714)
FT                   /locus_tag="DaAHT2_0103"
FT   CDS             complement(121608..122714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0103"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: dps:DP1269
FT                   high-affinity branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84816"
FT                   /db_xref="GOA:D6Z5T4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5T4"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADH84816.1"
FT                   /translation="MKHLLPISLLLATVVLIQQLTLWTDTQFYLTQLTMTGYYSLLIIG
FT                   LCLLLGYAGQISLGHAGFFAIGGYTSAVLTTRDFSLHLDHPLLVVSDRLGLLMSRADYF
FT                   GGEIIHFHPWAAAALALAATMIIAYLIGVPVLKLKGHYLAMATLGFGIIIYRVALASPI
FT                   FGEADGIFEVPAFPLLAGLSISGDFGSRVSNYYIAWVLVAITMFLLLNLINSRVGRGLR
FT                   AIHGSEEAANAMGINTASYKLRTFILSAVLAALAGVFMTHYSSGIGPSEAGVMQSVRYV
FT                   AIVAVGGMANLWGALTMGVGLNFMSLRGMFGTYDEAVFGLILITIMLFAPQGLLRLSLF
FT                   NQLKDLLLPASLKGRLSKPGRKEEDGTA"
FT   gene            complement(122719..123609)
FT                   /locus_tag="DaAHT2_0104"
FT   CDS             complement(122719..123609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0104"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: dps:DP1268
FT                   high-affinity branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84817"
FT                   /db_xref="GOA:D6Z5T5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5T5"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADH84817.1"
FT                   /translation="MTVELFIQYFFAGITYGIIYAIVAIGFNIIYNTTGIINFAQGEFV
FT                   MLGGMISISLNAFFPLPLAIAGAVLITMMVGALVEVSFIRWLKSPSVIRMIIITIGVSI
FT                   LIREIALHIWGESVRALPYFLGDEITTIQILGARISPQVLWIIGVCTIIVIALSLFFRY
FT                   TMHGQMMRACAANRTAATLCGISAKNMVTFSFMLSAGIGALAGAVMSPVTYTEYDIGTG
FT                   LAIKGFTVAILGGLGNSMAAVAAGLLLGLLEAFSVTVVPLAYQDVIAITILLLIIFIRP
FT                   HGLFGRKDAAGLKEF"
FT   gene            complement(123744..124889)
FT                   /locus_tag="DaAHT2_0105"
FT   CDS             complement(123744..124889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0105"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   dps:DP2194 branched chain amino acid ABC transporter
FT                   periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84818"
FT                   /db_xref="GOA:D6Z5T6"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5T6"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADH84818.1"
FT                   /translation="MKKLLLTTIIALAMLGFSAVAAVAETIKIGAILAVTGGASFLGAP
FT                   EARTLEMLAEELNEQGGINGKKVELIIRDSAGSPERAMSFTRQLIEEQRVFAIIGPSTS
FT                   GETMRIKQIAEGGRTILISLAAAEAIVNPLARYVFKTPQNDRFAAMQIFKTMNDMGISK
FT                   IAVVSGNTGFGQAGRNQIAQIAPDYGIEILENEVYDSRATDLSALVTRLMSNREVEAVV
FT                   NWSIVPAQAILARNMRQAGWEVPLFQSHGFGNIRYVEAAGRAAEGIIFPAGRLLVADVL
FT                   PADHPQKEVLVTYQENYEARFNEPVSTFGGHAYDAFHILVRAIEEAGTDREAVRDAIEN
FT                   MQGFVGTGGIFNFSATDHNGLDIDAFSMLTVKDGQFVKLEQ"
FT   sig_peptide     complement(124824..124889)
FT                   /locus_tag="DaAHT2_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.468 at
FT                   residue 22"
FT   gene            complement(124923..125354)
FT                   /locus_tag="DaAHT2_0106"
FT   CDS             complement(124923..125354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0106"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   pth:PTH_2653 ACT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84819"
FT                   /db_xref="GOA:D6Z5T7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5T7"
FT                   /inference="protein motif:PFAM:PF01842"
FT                   /protein_id="ADH84819.1"
FT                   /translation="MKIRQITIFLENKSGRLADITATLAKHGINIRALSLADTADFGIL
FT                   RLVVSDTDQAAKALKEDNFTVGITEVVAVAVPDQPGSLDSILKVVQQAQLNVEYMYAFT
FT                   QHSGETGLLLFRFDDPDKACRVLQENGCKLLSDEEVHKL"
FT   gene            complement(125372..126673)
FT                   /locus_tag="DaAHT2_0107"
FT   CDS             complement(125372..126673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0107"
FT                   /product="Phenylacetate--CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="KEGG: dps:DP1266 coenzyme F390 synthetase II; PFAM:
FT                   AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84820"
FT                   /db_xref="GOA:D6Z5T8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5T8"
FT                   /inference="protein motif:PRIAM:6.2.1.30"
FT                   /protein_id="ADH84820.1"
FT                   /translation="MIWNEQAETMPREELETIQLRRLQNTVARVYATVPYYRQKMDQAG
FT                   VSPGDIRSLTDIKRLPFTTKEDLRQNYPFGLFTVPMERIVRIHASSGTTGKPTVVGYTK
FT                   RDLGLWAELMSRTLAAAGVSHRDIVQNAYGYGLFTGGLGAHYGAENLGCAVIPISGGNT
FT                   KRQIQIMQDFGTTVLLSTPSYALNIADTMAAMGVDPADLKLRVGVFGAEPWSEAMRAEI
FT                   ESRLKIKAIDIYGLSEIIGPGVAAECREEQRGLHIMEDHFLPEIVHRDTFEPLPVGEEG
FT                   ELVFTTLTKEAFPVIRYRTKDISRLIPDVCTCGRSFHRMPKVTGRTDDMMIIRGVNVFP
FT                   SQIEEVIMAIEGVEPHYQIIVTRQGSLDNIEVQVEVSEAIFSDRVKELENLQKKLQGNI
FT                   KDLLGISCKVSLVEPKSIQRSEGKAQRVIDQRKI"
FT   gene            complement(126713..127300)
FT                   /locus_tag="DaAHT2_0108"
FT   CDS             complement(126713..127300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0108"
FT                   /product="Indolepyruvate ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.8"
FT                   /note="KEGG: dps:DP1265 indolepyruvate oxidoreductase
FT                   subunit beta; PFAM: Pyruvate/ketoisovalerate
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84821"
FT                   /db_xref="GOA:D6Z5T9"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5T9"
FT                   /inference="protein motif:PRIAM:1.2.7.8"
FT                   /protein_id="ADH84821.1"
FT                   /translation="MNQGNIHFVGVGGQGILLASEMTAYALINAGFDLKKSEVHGMAQR
FT                   GGSVEAHLRFDQTRVYSPLIEPGTVDFQLAFETMEAARYLPYLNRNSKVIVNTQRIMPP
FT                   SVATGKATYPDNCLDALTRQGIAVIPVDAYAIAKELGNIKAANVVLVGALSTFLPLPAE
FT                   AFHEVIATRLPARIQEVNLQAFKAGRAAIEKD"
FT   gene            complement(127297..129117)
FT                   /locus_tag="DaAHT2_0109"
FT   CDS             complement(127297..129117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0109"
FT                   /product="indolepyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.8"
FT                   /note="TIGRFAM: indolepyruvate ferredoxin oxidoreductase,
FT                   alpha subunit; KEGG: dps:DP1264 indolepyruvate ferredoxin
FT                   oxidoreductase, alpha subunit; PFAM: thiamine pyrophosphate
FT                   protein domain protein TPP-binding; pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain protein; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84822"
FT                   /db_xref="GOA:D6Z5U0"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5U0"
FT                   /inference="protein motif:TFAM:TIGR03336"
FT                   /protein_id="ADH84822.1"
FT                   /translation="MTSQPSAPEKLWLSGNEALALGAHEASVKVASGYPGTPSTEILEN
FT                   VVNYSEIYTEWAPNEKVGLEVAIGASFAGVRALATMKHVGLNVAADPLFTASYTGVRGG
FT                   LVIVVADDPSMYSSQNEQDSRNYAYAAKLPMLEPADPGEAKDFLKIAYHLSEEYDTPVL
FT                   LRSCTRVSHVKGIVTSGQVESSALTPGIELLPAKLVMLPANARNRRVEVEKRQQRLREL
FT                   AETSELNRIEPGDNKIGFIAAGTSYLYVKEAFPEATVLKLGLVYPLPEQLIRDFAARVE
FT                   KLYVVEDLDPFLETRIKAMGIACIGKEVIPAIGELTPSVVRRAITGQAPADLFEPVELP
FT                   PRPPNMCPGCPHRGLFYNLNRLKVFVSGDIGCYTLGFLPPLSAMDACVCMGASVGMAHG
FT                   MDKALGEEAQGKVVAVIGDSTFLHTGLNGLINSVYNKGCSTIIILDNRITGMTGQQPNP
FT                   ASGTTINYDPSPTIDFPELCRAVGVKHVRTVNPHEIEATYQVLKEEIARPEVSVVITRF
FT                   PCVLTVDEKKRPKKPFHSVTENCTGCTMCLRLGCPAINWQPLTPEEAKAMGKKEKQKGY
FT                   ALINEDMCIGCGQCYELCKFEAISKEEVSR"
FT   gene            complement(129251..130633)
FT                   /locus_tag="DaAHT2_0110"
FT   CDS             complement(129251..130633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0110"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tye:THEYE_A0864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84823"
FT                   /db_xref="InterPro:IPR025388"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5U1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84823.1"
FT                   /translation="MIKKISTLALAGLVAWPALAAADTDRIAELEGQMQAMQAEITELK
FT                   QQDESGKGGLSSDQLSMGGEVIFRGYRIRNVWTFDDDNKGDDRDAFRLKGSLWANYQAT
FT                   DDVSVRIQFTNQSWGETDDAGDNVDNKVFLDNAYIQANNLFGLPVDATLGRQNLIYGSG
FT                   FVILDGQSQYGSTSIYFDGIKLRFHLTDLVSLDAIYMKDRENTPGHSVRDDITLAGFYL
FT                   INQECPLTGMRQELYALNRKDETLDKDIWMYGARFSDRLQNGLDYSLEGAIQRGDATKD
FT                   VDQKAYGMKLDAGYTLQNTAFTPRFYANYSYLSGNKRGTDDNEQWDVFYGGWPQWGDLL
FT                   AWKYLNVPPNNLNQAYSSFGDYSGVTGEAIYSNLQIITVGASAQLTPKLSANLSYSDLS
FT                   FNRTDPGVDKDFGDYYQATFRYQYTPQLSFGLYAAMLEPGDAFEDNDDSATEVFWEVAY
FT                   RF"
FT   sig_peptide     complement(130571..130633)
FT                   /locus_tag="DaAHT2_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.714 at
FT                   residue 21"
FT   gene            130865..131662
FT                   /locus_tag="DaAHT2_0111"
FT   CDS             130865..131662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0111"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: sfu:Sfum_0751 silent information regulator protein
FT                   Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84824"
FT                   /db_xref="GOA:D6Z5U2"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5U2"
FT                   /inference="protein motif:PFAM:PF02146"
FT                   /protein_id="ADH84824.1"
FT                   /translation="MDTSLVKAAEVLAGSRFTLALTGAGISVESGIPDFRSAGGLWARF
FT                   NPAEYATIEAFRQDPHKVWRMLAEMDRLLVRSRPNPAHLGLAELERLGYLQFVITQNVD
FT                   NLHQAGGSQRVIEFHGNAATLACLACHAVYSRAEVSNQAVPPKCVCGQVLKPEVIFFGE
FT                   EIPPPVLAQAHDLVSLARVLLVIGTSAEVAPASMLPRLAKEHGATIVEINPEKTRLTDE
FT                   LTDILLQGRAGEIIPALVAELKRRTTDGWPPVTGCSRSAPRPG"
FT   gene            complement(131999..132074)
FT                   /locus_tag="DaAHT2_R0004"
FT                   /note="tRNA-Lys2"
FT   tRNA            complement(131999..132074)
FT                   /locus_tag="DaAHT2_R0004"
FT                   /product="tRNA-Lys"
FT   gene            132233..133420
FT                   /locus_tag="DaAHT2_0112"
FT   CDS             132233..133420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0112"
FT                   /product="Saccharopine dehydrogenase"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG: dde:Dde_0572
FT                   saccharopine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84825"
FT                   /db_xref="GOA:D6Z5U3"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5U3"
FT                   /inference="protein motif:PFAM:PF03435"
FT                   /protein_id="ADH84825.1"
FT                   /translation="MAKVLIIGAGGVGSVAAHKCAQVPEVFSEIVLASRSVDKCEAIRD
FT                   SVKQRTGREIEVAQVDAGQKSELVALLQKVKPAMVLHLALPYQDLTIMEACLECGVDYL
FT                   DTANYESEDNPCFDYSRQWPFDESYRNKGIMGLLGSGFDPGVTNVFCAYAAKHYFDEIH
FT                   YIDILDANGGDHGYPFATNFNPEINIREVTARGRYWENGQWVETEPMEKKWVFDFPGIG
FT                   PKDAYLLYHEELESLVKNIKGLKRIRFWMTFSEQYLKHLEVLGNVGMTSIEPVMFEGRE
FT                   IVPLQFLKALLPDPASLGPRTKGKTCIGNIMEGVKDGKPRKIYIYNNCDHEECYREVGS
FT                   QAVSYTTGVPAMIGAMLMVNGVWRKPGIYNMEQLDPDPFMEQLNQHGLPWQVKEL"
FT   gene            133423..134598
FT                   /locus_tag="DaAHT2_0113"
FT   CDS             133423..134598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0113"
FT                   /product="carboxynorspermidine decarboxylase"
FT                   /note="KEGG: sfu:Sfum_1921 carboxynorspermidine
FT                   decarboxylase; TIGRFAM: carboxynorspermidine decarboxylase;
FT                   PFAM: Orn/DAP/Arg decarboxylase 2"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84826"
FT                   /db_xref="GOA:D6Z5U4"
FT                   /db_xref="InterPro:IPR005730"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5U4"
FT                   /inference="protein motif:TFAM:TIGR01047"
FT                   /protein_id="ADH84826.1"
FT                   /translation="MAATSPFPFVERVPSPCYVCDTGKLAANLAALDEVQRRTGAKIIL
FT                   AFKGFAMWSLFPQIRAVLPGASASSLDEARLAAEEFGGEVHVYCPAYREEDFAEMLGYA
FT                   DHLVFNSFSQWQQYQGQVAAHQRQISCGIRVNPEYSEVEVDLYNPCGRYSRLGVTREHF
FT                   RPELLAGPEQLAPAIEGLHFHALCEQNADALAGTLAAFNEKFGRFVQGMKWLNFGGGHH
FT                   ITRADYDRELLCRLIDETQQRYGVQVYLEPGEAIALNIGVLVARVLDIVENEISIAILD
FT                   TSAATHMPDVLEMPYRPHIFGAGEPGQYPHTYRLGGLSCLAGDIIGDYSFPEPLTPGQR
FT                   LVFGDMAHYTMVKNTTFNGVRLPSIATYDPATDNLKVIRRFGYEDYRNRLS"
FT   gene            134739..136835
FT                   /locus_tag="DaAHT2_0114"
FT   CDS             134739..136835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0114"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="PFAM: Peptidase M1 membrane alanine aminopeptidase;
FT                   KEGG: sfu:Sfum_1115 peptidase M1, membrane alanine
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84827"
FT                   /db_xref="GOA:D6Z5U5"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5U5"
FT                   /inference="protein motif:PFAM:PF01433"
FT                   /protein_id="ADH84827.1"
FT                   /translation="MKLMKLTILMATIGLTVAILWQPVAEAVGDPTVHHDLELELFPAQ
FT                   GRLEAVSQLTLPQAGASARLFLSPQARVSEVALNGASLPHNFTGGILDIRLPTEVRGRS
FT                   VTLAIHYAGRFTDQPPQDPVMTEDPSFGVAAAISEQGTFLSGGSGWYPDPRLGKATWQL
FT                   SVTAPPGYLAVTAGRLVEQTTTAEYSRSVWEEHIPLTNLTVSAGPYEVRSIQVGEIPVS
FT                   TYFYPHSQDLAANYLEATREYLELYQELFGTYPFEKFAVVENFFPTGYGFPSWTLLGSR
FT                   VIRLPFILETSLGHEIAHSWWGNGVRVDIAQGNWSEGLTTYVADYLYLERSSAEQARDY
FT                   RLRILRDYAALVPPELDFPLARFLRRTDRPSQAVGYGKAAMIFHMLRHKVGEEIFWGGL
FT                   REMAETRLFDRVNWDDFASLYSRLGDTDLGPFFEQWVRRPGAPILSLEDVQVRRDKDQW
FT                   HLSGRLSQQEPPFVLQLPLTLETEGESVVQWITLDDHETHFTMTVADAPRRLLVDPDAH
FT                   LFRRLHPTEIPASVNSIRGSGRLLAVLAEDLPAPTAEAARLILQALRQQDVRIFEEGEV
FT                   CPEQLVEHDVLFLGLPRRFADPLFDGTELSVDREGFAFAGQRFDGAQAALFAAVTPRDA
FT                   PDTHWAYFIPNSPESASDAARRIPHYGRDSYLIFDQGENRARGTWDIRESPLIRNFNFL
FT                   EAAP"
FT   gene            136832..137707
FT                   /locus_tag="DaAHT2_0115"
FT   CDS             136832..137707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0115"
FT                   /product="protein of unknown function DUF399"
FT                   /note="PFAM: protein of unknown function DUF399; KEGG:
FT                   sfu:Sfum_1114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84828"
FT                   /db_xref="InterPro:IPR007314"
FT                   /db_xref="InterPro:IPR016773"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5U6"
FT                   /inference="protein motif:PFAM:PF04187"
FT                   /protein_id="ADH84828.1"
FT                   /translation="MKTGALIASLTIAFWVCAGNAWTHPHILDLSSSQEIPFEDLITDL
FT                   ENARVVFIGELHDHEGHHRMQLEIIRALQERGRPVAIGLEMFQAGYQDALDQWIAGEMP
FT                   EDNFLPVYHRNWSMWPLYRPIFMYAREEGVPMLGLNIPREITRQVARHGFASLDQEQLR
FT                   DMNLEGFACIVDPAYKQFIRRALNMHNHGEDRSFTRFCEAQLLWDAAMANNLLAFLEEH
FT                   PDHTVVVLAGSGHSWKYGIPTQLDNLVEVDYRVLLPELPGRINRRSASSADADYLWLDY
FT                   GPDGWQVSTQ"
FT   sig_peptide     136832..136903
FT                   /locus_tag="DaAHT2_0115"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.883) with cleavage site probability 0.595 at
FT                   residue 24"
FT   gene            137967..138551
FT                   /locus_tag="DaAHT2_0116"
FT   CDS             137967..138551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0116"
FT                   /product="outer membrane lipoprotein Slp"
FT                   /note="PFAM: outer membrane lipoprotein Slp; KEGG:
FT                   tgr:Tgr7_0667 outer membrane lipoprotein, Slp family"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84829"
FT                   /db_xref="GOA:D6Z5U7"
FT                   /db_xref="InterPro:IPR004658"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5U7"
FT                   /inference="protein motif:PFAM:PF03843"
FT                   /protein_id="ADH84829.1"
FT                   /translation="MKPLRALLGLLFMVPAGLWLAGCATQVPAPIRQAPVLDPTPEEVR
FT                   AAPLRFEEATIRWGGGIATVENRIDHALIHVVSRPLGRNGRPRDTDAGYGRFLARVPGF
FT                   VDPEIFKPGRELTVSGRVAGIKHLAVGEFEYPYVLVDVEVKYLWPVHEPVRDPYHPYPH
FT                   YYPFHYDPWWYDPWYDPWFPRHSPFFRPRHR"
FT   sig_peptide     137967..138047
FT                   /locus_tag="DaAHT2_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.473 at
FT                   residue 27"
FT   gene            138658..139149
FT                   /locus_tag="DaAHT2_0117"
FT   CDS             138658..139149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0117"
FT                   /product="outer membrane lipoprotein Slp"
FT                   /note="PFAM: outer membrane lipoprotein Slp; KEGG:
FT                   tgr:Tgr7_0668 outer membrane lipoprotein Slp"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84830"
FT                   /db_xref="GOA:D6Z5U8"
FT                   /db_xref="InterPro:IPR004658"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5U8"
FT                   /inference="protein motif:PFAM:PF03843"
FT                   /protein_id="ADH84830.1"
FT                   /translation="MRQLALMLLLPILLAGCATGPRYDTGPVALDLMPAMVSANPEPYR
FT                   GTEVLWGGLIVATHNLPDYTEIEVLSYPLDRAQRPLADRTPQGRFLLRQAGYLEELDFA
FT                   SGRRVTVKGVLAAPKQGRVGEAPYTYPVVEASDLHLWPPARREPERTRFQIGIGVIFGR
FT                   "
FT   gene            complement(139204..140232)
FT                   /locus_tag="DaAHT2_0118"
FT   CDS             complement(139204..140232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0118"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.12"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: methionine-R-sulfoxide reductase; peptide
FT                   methionine sulfoxide reductase; KEGG: sth:STH1761
FT                   bifunctional methionine sulfoxide reductase A/B protein;
FT                   PFAM: Methionine sulfoxide reductase B; Methionine
FT                   sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84831"
FT                   /db_xref="GOA:D6Z5U9"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5U9"
FT                   /inference="protein motif:TFAM:TIGR00357"
FT                   /protein_id="ADH84831.1"
FT                   /translation="MQLLFIVLLISLVFVSTLALAGGRTATAPGRAILAGGCFWCLEKP
FT                   FAQQAGVLAVTAGYTGGQSPDPTYEDYAAGGHLEAVEIIFDPQVISYRQLLDIFWRQID
FT                   PTDPDGQFADRGRGYSTAIFYHDEEQRRQAEESKRELARQGIFSRPLVTAILPAGPFYP
FT                   AEEYHQAYYRKNPRHYQAYRIGSGREGFLARIWGRERETNEKDNLRDRLTPLQYHVTQE
FT                   DGTEPAFNNKYWDNKREGIYVDIVSGEPLFSSKDKYDSGTGWPSFSRPLVPENIVEHHD
FT                   RRLFQVRTEVRSRRGDSHLGHVFPDGPPPTGLRYCINSAALRFVPKDELAAQGYAEFSD
FT                   DL"
FT   sig_peptide     complement(140167..140232)
FT                   /locus_tag="DaAHT2_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.981 at
FT                   residue 22"
FT   gene            140480..140680
FT                   /locus_tag="DaAHT2_0119"
FT   CDS             140480..140680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0119"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tye:THEYE_A0512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84832"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5V0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84832.1"
FT                   /translation="MTDQPIPKATPKAKPNPQKVAFLRQLPQEIKEQITGEEAQAFIFD
FT                   QEVPDSMLDKLKDYLVDDESQ"
FT   gene            140712..141062
FT                   /locus_tag="DaAHT2_0120"
FT   CDS             140712..141062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0120"
FT                   /product="putative cytoplasmic protein"
FT                   /note="KEGG: dba:Dbac_0540 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84833"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5V1"
FT                   /inference="similar to AA sequence:KEGG:Dbac_0540"
FT                   /protein_id="ADH84833.1"
FT                   /translation="MAEKQILFAFRGDPLCFVHVLLNALDLHEQELGGWIVIEGEAVKL
FT                   VGQISRPEHFLNAFYRQVREKGLIVAVCKACSAKMEVTAEVEAEGLPLVGHIAGHPSMA
FT                   HYLKEGYRVITF"
FT   gene            complement(141052..141231)
FT                   /locus_tag="DaAHT2_0121"
FT   CDS             complement(141052..141231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvl:Dvul_1811 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84834"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5V2"
FT                   /inference="similar to AA sequence:KEGG:Dvul_1811"
FT                   /protein_id="ADH84834.1"
FT                   /translation="MLNEEYLRELEQYIASGRMEQEFACAPEQQRLTMLDQLEKLMDVA
FT                   ELADQAVTRIIFKK"
FT   gene            complement(141231..143273)
FT                   /locus_tag="DaAHT2_0122"
FT   CDS             complement(141231..143273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0122"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   tye:THEYE_A1688 pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84835"
FT                   /db_xref="GOA:D6Z5V3"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5V3"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADH84835.1"
FT                   /translation="MKIVGSIDGKRVSSRELEERVQAAVNGGAHELEIEARGQHGIGGR
FT                   IWPKHAPVKLRVQGPIGQRLGAMGMMGTEIVAEGGASDDVGWLNCGAKITVLGDVTNGA
FT                   HNAGAQGVLYVQGGGGARCDTMTKHNPRFEPLQSWYFRDVGDSFAEFKAGGIAVVCGVN
FT                   PRHPENVLGYRPCVGMVGGVVYFRGNTKGYSEKDVQLLELTEADWQWLTDHIKPYLAAI
FT                   DRLDYLPELTKSAADWHKLIAYTPAEKKQRSSHRLATWEFRRSQWEPAVGKGGIFGDMI
FT                   ERPFTLLPFITTGQERRFKPVWNNEKQLPPCVAVCPSDIPSHRRFQLLRQGKRQEALDL
FT                   VLQYSPLAATVCGELCPNICMKACSRKVVDQPLDIKGLGRASRNLTLPKPATASGKQVA
FT                   VIGGGPAGLSATWQLWLKGHRVTLYEAGSRLGGRLWQSVEQGKVAADILEEDLGRISAG
FT                   GMTIHLDTTVDADRFKSLRQEHDGIIIACGAQDKEGTGLAFVGPEIHHQQGKIKTNQHG
FT                   QTDELKVFAAGDVVSRGLPTHLIGSGRRAALALNALLTDSQYHPESRPTIPYAGLKLEY
FT                   FAFQRGECTTADGRGSGNGNPIIGPVIPTAPPAATPESEAIRCVSCGLCRDCHICENTC
FT                   HYGAISRRDLGEGEFEYVVDPDRCIGCGFCAGTCPCGIWEMEENI"
FT   gene            complement(143434..145089)
FT                   /locus_tag="DaAHT2_0123"
FT   CDS             complement(143434..145089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0123"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase;
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   tye:THEYE_A1687 glutamate synthase, iron-sulfur
FT                   cluster-binding subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84836"
FT                   /db_xref="GOA:D6Z5V4"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5V4"
FT                   /inference="protein motif:PFAM:PF01645"
FT                   /protein_id="ADH84836.1"
FT                   /translation="MESAQRLDHNSELTLLEFPFIIRWREDRCSRCGRCTAVCPTRAIE
FT                   ASVMARRLVDSEGSTPLPRTIRRVSQVIRQVNDIDRHCVGCGTCSLVCPNMAIMPEYNP
FT                   NHKFLFHKNRGGVPYARGGRRNDPATSTLDKLKFTRISMLTDPSLDAGRHEFHIRTLMG
FT                   RILPAEQLPIQRDGELLQLAPGGFIPPVREIFPIRIGGMSIGALSPPMWEGLAMGVAYL
FT                   NEVENIPVVMCSGEGGLPPRLLKSRYLKYFIPQIASGYFGWDEIIHALPEMIEEPAAIE
FT                   IKYGQGAKPGDGGLLMAYKVLKLIAKIRGVPMYVDLASPPTHQTKYSIEEAVAKMIQSV
FT                   SMAWGFRVPVYPKISGTKTALAVLNNLARNPYAAALTIDGEDGATGAAYNVSMDKMGHP
FT                   IASNLRDCYLELVKSGKQNELPLFAAGGVGKEANLAANAASLILLGASGVDIGKYIMQA
FT                   AAECYGDERNRCNLCNLGRCPRGITTQDPRLYRRLDADRVAERVVDVFKTAEVELKKIF
FT                   APMGRSTQLPIGMSDGLGVGDQAIADRLSISYVC"
FT   gene            complement(145050..146183)
FT                   /locus_tag="DaAHT2_0124"
FT   CDS             complement(145050..146183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0124"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tye:THEYE_A1686 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84837"
FT                   /db_xref="GOA:D6Z5V5"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5V5"
FT                   /inference="similar to AA sequence:KEGG:THEYE_A1686"
FT                   /protein_id="ADH84837.1"
FT                   /translation="MCRLSAIAAGEYFSVMENILALDTMKEGHDGSGLGVTLQNLGGEF
FT                   EHLKEYPILSGICTDAGRRKIDDYMESLGFKVKFMWEPRIKEGPGINVKKRGHYLATAY
FT                   QYPDHYLDRPQAEKEELLTRTRLELRRQGAGDDSLYVFSFWPDVITLKEVGDPLEVGLF
FT                   FGFDTHPLTAKVILAQGRQNTNYAIQLYACHPFFLQGYCTMTNGENTAFIPNRDYLTGR
FT                   EVEGYTGYSSDSEVFCHTLHYVHHQLKYPLTYYKDVITPIQDGELAGRQDGQVLGLLKR
FT                   SLRQLCIDGPNCIIGFLPDGTIFLTQDSKKLRPGIVGGVPGKYGLMSEECGLEQVLPQR
FT                   RRENDIIPMRADMVIIPPGAQEVKVWNQLNGSITTPN"
FT   gene            complement(146199..148874)
FT                   /locus_tag="DaAHT2_0125"
FT   CDS             complement(146199..148874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0125"
FT                   /product="pyruvate phosphate dikinase PEP/pyruvate-binding
FT                   protein"
FT                   /note="PFAM: pyruvate phosphate dikinase
FT                   PEP/pyruvate-binding; KEGG: ade:Adeh_2962 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84838"
FT                   /db_xref="GOA:D6Z5V6"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5V6"
FT                   /inference="protein motif:PFAM:PF01326"
FT                   /protein_id="ADH84838.1"
FT                   /translation="MSYNYSHLSTGIRGLDRVIKGVMPGDNIVWQVREIDDYRYFVQRY
FT                   AKFADLKNQRLVYFRYASHPPLLDPEEFPAAEIHHPDPEEGFEPFITQIHETIKQHGRG
FT                   GYYVFDSLSDLANAWYSDRMLGNFFMLTCPYLLDMEALAFFALLRDQHSYSALTPVHET
FT                   AQVIFDIYKSRDNIYVHPLKAQQRYSATMYMLHAMRENEFVPVTNSALNSEILAFTPFH
FT                   STDHAFEERDRWNRYFQEAALAVQQSREVEIDPETRQRHLRRLLEMVVTRSERMQELAA
FT                   RYLEIENLLEIGKRMIGTGLIGGKATGMLLSRAILQKDAPELRDVVEVHDSFYVGSDVF
FT                   YTYMVINGCWWIRRQQKDTETLLGVAEYARRVILTGHFPEDIVRKLSDMLDYFGQSPII
FT                   VRSSSLLEDNYGNAFSGKYESVFCPNQGSSQRRLENLLTAIKLVYASTLSEKALHYREQ
FT                   MGILDKDEQMSLLIQRVSGDLHGNYFFPAVGGVGYSYNPYAWHPEIKPESGLIRIVYGM
FT                   GTRAVDRADDDYTRIAALSAPDKRPESSIDELRKFAQKRVDAIDLTANRLLPVDFDEIA
FT                   KYSPPQELRLAASQDPQTNAPYISFNGLFKNTPFVAHMQKLLGTLDSAYQYPVDIEFTL
FT                   NFTGEEGCRSLAASQDSRGEEVMACDPAANYRINLVQCRPFEVRKSEEVSLDFAEDKDK
FT                   QVLLAARQGTVIGRSRALNPRRLVLVSPDHYGALPVSQKHLAARAIGKIMKVTPEELPA
FT                   VLVGPGRWGTTTVSLGIPVTFSEICQAACVIEVVAMHEGLIPDVSLGTHFFNDLVEFDI
FT                   MYLAFYPGKEGSELNRELLAGFRNRYLDLVPEPEYRALAEIITVVDFSRDELVLAADIV
FT                   GQSYQLYRVPAGKEDFDNVP"
FT   gene            complement(148960..150294)
FT                   /locus_tag="DaAHT2_0126"
FT   CDS             complement(148960..150294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0126"
FT                   /product="Glutamate dehydrogenase (NADP(+))"
FT                   /EC_number="1.4.1.4"
FT                   /note="KEGG: mvn:Mevan_1556 glutamate dehydrogenase; PFAM:
FT                   Glu/Leu/Phe/Val dehydrogenase ; Glu/Leu/Phe/Val
FT                   dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84839"
FT                   /db_xref="GOA:D6Z5V7"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5V7"
FT                   /inference="protein motif:PRIAM:1.4.1.4"
FT                   /protein_id="ADH84839.1"
FT                   /translation="MEKVTEFMNKVIEKNPGESEFHQAVLEVVETLMPFIDKHPKYQEA
FT                   KILERMVEPERVIIFRVPWVDDRGEVQVNRGIRIQMNSAIGPYKGGLRFHPSVNLSILK
FT                   FLAFEQVFKNSLTTLPMGGGKGGSDFDPKGKSDQEVMRFCQSFMTELCKHIGAETDVPA
FT                   GDIGVGAREIGFMYGQYRRITNEFTGVLTGKSRNWGGSLIRPEATGYGAVYFAEEMFKV
FT                   RGTSLDGKTCVVSGSGNVAQYTIEKVNELGGKCVTLSDSGGFVHDPAGIDADKLAYVME
FT                   LKNVKRGRISEYAEKYDCKYYSGERPWGIPCDAAFPSATQNEIDANDAETLVKNGCVCV
FT                   SEGANMPSTSDAVRVFQKARIMYGPGKAANAGGVATSGLEMSQNSLKLSWTRDEVEGRL
FT                   KQIMEGIHESCYKFGKEGDYVNYVKGANIAGFVKVADAMIEQGVI"
FT   gene            150835..151173
FT                   /locus_tag="DaAHT2_0127"
FT   CDS             150835..151173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0127"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   dar:Daro_1291 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84840"
FT                   /db_xref="GOA:D6Z5V8"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5V8"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ADH84840.1"
FT                   /translation="MKKVEAIIKPFKLDEVKEAVTALGVHGMTVTEVKGFGRQKGHTEV
FT                   YRGAEYVVDFVPKVKLEIVVASEMVEQVVETIIQAARNGKIGDGKIFVLPVESVCRIRT
FT                   GEQDSAAI"
FT   gene            151229..152548
FT                   /locus_tag="DaAHT2_0128"
FT   CDS             151229..152548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0128"
FT                   /product="ammonium transporter"
FT                   /note="KEGG: chu:CHU_0916 ammonium transporter; TIGRFAM:
FT                   ammonium transporter; PFAM: ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84841"
FT                   /db_xref="GOA:D6Z5V9"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5V9"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ADH84841.1"
FT                   /translation="MKSKSIIAAAVCGLVATALPVAGWAGEQAVSGGDAIFTANNTWML
FT                   VATFLVFLMHLGFASLEAGMTRAKNTVNILYKNTAIIAIGILTYAVVGFNLMYPESFAL
FT                   GSWFGFAGFGVGTSPEDLKILEDGVGVYTYWTDFIFQAMFAATAATIVSGAVAERIKLP
FT                   SFLVFTTLYVAFVYPWLGSWQWGGGWLDEMGFYDFAGSTLVHSVGGWAALAGVIVLGPR
FT                   LGKYIDGKIRPIPGHNMPLATIGVFLLWLGWFGFNGGSVLSADPGLVSFVFVTTALAAA
FT                   AGVVSAMFASWTVTKKPDLTMALNGALAGLVGITAGADVVSVGAAVIIGLVAGTLVVFS
FT                   IMALDRLKLDDPVGAISVHLTCGIWGTLAVGIFAAEFSLMIQLLGVVAYGVVAFGAAMV
FT                   LFYAIKSSIGLRVDEEEERLGLDITEHGMEAYAGFEMNTK"
FT   sig_peptide     151229..151306
FT                   /locus_tag="DaAHT2_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.952 at
FT                   residue 26"
FT   gene            152646..153365
FT                   /locus_tag="DaAHT2_0129"
FT   CDS             152646..153365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0129"
FT                   /product="glutamine amidotransferase class-I"
FT                   /note="PFAM: glutamine amidotransferase class-I; KEGG:
FT                   rmr:Rmar_2798 glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84842"
FT                   /db_xref="GOA:D6Z5W0"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5W0"
FT                   /inference="protein motif:PFAM:PF00117"
FT                   /protein_id="ADH84842.1"
FT                   /translation="MNFLVLQHAPWEGPGQFLLAAARKLKIRLQVTRVWQEAIPDPLNF
FT                   DALLILGGGANVDQEKQFPYLREEKEVIRRVVAADLPCLGICLGHQLLAEALGARVGPN
FT                   FCSSVGFVEGYLTSHGRQHPAFAGMKSPLPLFKWHGYTVLEPLPGHLQVLMTSDHCQVE
FT                   ALSVAGRPHLLGLQSDNHAADPRDVGLWLEQDRQWLASLRDQRVDPSWVLAQSRRYRAA
FT                   IAADFQRLLGNYLRMLV"
FT   gene            complement(153410..156406)
FT                   /locus_tag="DaAHT2_0130"
FT   CDS             complement(153410..156406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0130"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase; KEGG:
FT                   azc:AZC_4111 putative decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84843"
FT                   /db_xref="GOA:D6Z5W1"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010977"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5W1"
FT                   /inference="protein motif:PFAM:PF00282"
FT                   /protein_id="ADH84843.1"
FT                   /translation="MTDNLDPDSWAELEAAWQQAMQAGIEHYQTLSEKPVWRPCPEEVK
FT                   DSFRTPLPRQGRPVAELVGQFRDQMLPYGNGNTHPSFFGWVHGGGNLYGALGEMCAALL
FT                   NSNLGGRDHVAVYIERQVLQWCRQLFSFPLSSSGILTTGTSMATLLALAVARQQAAGDE
FT                   VKARGLQRQDSPLVGYASAQSHNSVLKAFQLLGLGEEFLRSIPVNNDFTMDTGALAAQI
FT                   SADRQQGLTPFCVIATAGTVNTGAIDDLTAIKAICDQEQLWLHIDAAFGGTAILLEEYR
FT                   EALAPMAQADSVAFDFHKWFQVPYSVGGLLVKDGELHQATFSERKEYLAPASLGLAGGA
FT                   PWFCELGPELSRSFLALKVWFTFQALGTERLAAVVRKHCRLARELAQRVDREPQLERLA
FT                   PVTLNIVCFRYQATDPGVGDALNRAIVTQLQLRGLAAPSSTTLNDRAAIRVALVNHRTE
FT                   AKELHDLIDHVLELGRLFDTTLKPLLKPTRWHLVKGGDTRLELDQETGFNRYGSLPYPR
FT                   DEAITFSASTATSVSSQAYAEAEQCRQRLLHDCALAGSLAPLRRYSQELADAIATTFGF
FT                   HDLEGDLHLSPSGTDSQMQAVAAIVATRPDAPWTSIVCGSDETGSGTELAVTGCHFDET
FT                   TCLGVEVEKGSRLEGMPEVAFLGIPFRDEQGELHHLERVDEMIWQGVSDTVAAGRRVIL
FT                   HAMDQSRMGSWAPSPPMLDRIRRHFGESVQVIVDACQLRLDAEDLRDHIQKGDILLLTG
FT                   SKFFTGPTFSGVAVFPKSFADRLDCSRHSLPRGLADYIPQADLGSWQECLPEAQHPPNT
FT                   GMYLRWQAALDEARRYYLVPKEQRLQGLGRFCEEVMSRIAAHPLLDLLVEPSHPCFART
FT                   DMLGDELSIRRTIFPFLVRHHDGSYLTPEEARTLYEKLNCDIGDEPGIPAAEKELAAQC
FT                   CHIGQPTEIPGKKTAALRISAGARIISQCWQEGDGNMAKIEDELEQISTILDKISLCVD
FT                   TPDPLVSQS"
FT   gene            complement(156567..157865)
FT                   /locus_tag="DaAHT2_0131"
FT   CDS             complement(156567..157865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP0011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84844"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5W2"
FT                   /inference="similar to AA sequence:KEGG:DP0011"
FT                   /protein_id="ADH84844.1"
FT                   /translation="MDRSRNIFALLDQEGPFRVEKSVREEHLLAGSSRRRFTELKQRGL
FT                   LSKYRVTRSQLFELLQVRSFAEIPALLQDAARRRVVEKRAYRLLGNMFGLDGSEREVIA
FT                   HINSYSRIADGVINYLRNRVLANYASYIEMTNEIDSTRSPIDLLLILFDDRYHRKARFE
FT                   AKRKLILMSLAGAIDQRERETEVEQKFLRFLDFLNDEVWSRKAKIGELDIVYLHSHHHP
FT                   ESFACQEVAIKRRQELPPQTGPHEKITMIKRRCFPWGEQEVPVYVSIRKKPPEAKVLKL
FT                   LRKGEENPAVAVDDELGLMAVVDSPMEVKIFQQHLTASAARAGSLMTLEDLSDTLAGGG
FT                   YRSSTPGSSSGTAMYKFFARMGGMRVEFIVHTNRSFLNYIYQRGVSHDEYEVRRIFDSG
FT                   VADLLFPRDIYEIDIGEKKEALIRWFRSRIEEI"
FT   gene            complement(157879..158634)
FT                   /locus_tag="DaAHT2_0132"
FT   CDS             complement(157879..158634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sat:SYN_01621 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84845"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5W3"
FT                   /inference="similar to AA sequence:KEGG:SYN_01621"
FT                   /protein_id="ADH84845.1"
FT                   /translation="MKAKRYLQGITGGLLGCGLLAATATSAMAQPEEPWAELAVDAYSQ
FT                   YIWRGYAFSRDSLVIQPSMTVGWQGFSVNLWGNLDTDLYGADTSVWNETDLTLAYDHSF
FT                   GPLDLGIGYIYYGLGGEDDTQEFYLAVGYDTFLSPSLTIYRDTDAAPGWYVSLAVGHSI
FT                   ALADNLSLDLGAEAGYVYTSDYDALHDGVISAALPYQFGDYFTVAPVLAYSFALSSDAK
FT                   DELEAANDAAIGRDRANFVYGGLSLSMEF"
FT   sig_peptide     complement(158545..158634)
FT                   /locus_tag="DaAHT2_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 30"
FT   gene            159000..162062
FT                   /locus_tag="DaAHT2_0133"
FT   CDS             159000..162062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0133"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: sal:Sala_2826 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84846"
FT                   /db_xref="GOA:D6Z5W4"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5W4"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADH84846.1"
FT                   /translation="MRWVCGRRLLAGAMAFGMLFHGGGVVAQPMVGDEQPAPAVEAAAP
FT                   KDVAQRLLGPPVLSDWWLTLGESAPAAAAGSAGGMSKGLKIGALVTGGVVVTGATVVIL
FT                   ASSEDKNSNNDTDDQPGNAVPPDDVQAPLSWHQQQSQQQPDEWLAAEIRARDDYRFINE
FT                   WWTDKYGGEMPRINPYDLMGLSYAHAAGYRGEEIIIGLLDDTFQLDHPMLQGQVAGDSG
FT                   TLPGVNSNTYHGTHVAGLAAGHSATMIGVAPEAKLFLASFKNSTLNGWATKFQDARQAG
FT                   ARVHSNSWGWDADGLLDTRLAVELLADPVAALANWQETEDFNHWYLGFTDYAADQEFKL
FT                   SAYQDNPGLVLEAYFNIAYNSPSPAASWNNLAAAMHDFQTQGNGVILWALENHRLEAPD
FT                   GTFYADAPAALPELYPDLQGAWLTVANVNVFSHSDGQDYAVLYSSGCHQTASYCLSHNG
FT                   GFVNSAVPFNDYDQLTGTSMATPQVAGAVAILAQAFPGHSGEQLVNRLLATASNFDDWQ
FT                   AVEERDGSWYGTLTLPDNSSREVEFMVLPVEANQESPLDPGEIGVVDFGNGITHAYSEL
FT                   LGHGFVNLRAALQPVGEVAVPVGQQLDTVRREDLQASRVLLGPAFGDSLTAGLAGRTVA
FT                   VLDGLDGAFQVPLGHFVQAADPGSDLGGLLAGFGPPPLGPEIKLGRGGRLAAAFRSAEN
FT                   GPPAGLTAAKERQSKVAELSWRQELGRDSLLRFDYNRNPGLAFGLPAAGTVQPEWMVSR
FT                   QAFVNPLLSLVERGESLGADVALNRWATLRLGAFQGSQSQQWQQNELAPQEDHRRARLR
FT                   GAATELALGLGPAAAPAAGLALQAALVQEENTLLGSHSGGAFELAQGTSSYTVGLSGEL
FT                   ALGEWSGGGDLRLAANVFAAYAQPQAAADSLFTEVSTVAGRAWSVGLLAQRLLTPADRW
FT                   GLVLHQPLRVVDGQAELRLPVGHDGTELRHDTVRVDLRPTGRETRLEMFYGRPLMAGAD
FT                   LRGSLMLRRQPGHVHQAPSEGVALLRTTVTF"
FT   gene            162245..163507
FT                   /locus_tag="DaAHT2_0134"
FT   CDS             162245..163507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kse:Ksed_26930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84847"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5W5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84847.1"
FT                   /translation="MKEQSKMKWLGLAVVVTFALGLAGCSSSSSGGGGGNGEIDETEVG
FT                   ADQGETTSETYVLNEKEQAFVAALAGPGIMEMAQNFATTAAEVPDDPSGQPDEDSSGTS
FT                   SVYSLNATTRVIVDGEVPVLFECPHPDAEGFVGEGALRFAEGNLIAINQIEFPNLFSNA
FT                   GSLLAGQHADESGPDYAHDIYLRADCQVSAEDYDLGLLFRGGMDAAQLANVSGSGGQVV
FT                   AAVIGDFTGTGVDDRPDASEFMESTFNYDLSGEPQSLTSLYRGEIYACTGCVAGNLADF
FT                   SGNPGFDGTSQSFLEMSLQLPGGLEFEFQVGEDVNNPFTMQAAAAGNDQATVTMDGRLA
FT                   YLEPSTGCGFDVTYQTVEPLLIQDYDQDNPVTLSGTLQVTVNETGNTYTVEFLNDQATV
FT                   YDAAGNEVTPDTDPDALGCSV"
FT   sig_peptide     162245..162340
FT                   /locus_tag="DaAHT2_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.479 at
FT                   residue 32"
FT   gene            complement(163714..164304)
FT                   /locus_tag="DaAHT2_0135"
FT   CDS             complement(163714..164304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: maq:Maqu_1284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84848"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5W6"
FT                   /inference="similar to AA sequence:KEGG:Maqu_1284"
FT                   /protein_id="ADH84848.1"
FT                   /translation="MNFAKTLNWKNLALTLLLAAGLLAPQTAAAHCDAMDGPVVVEARQ
FT                   AIAAGDPQSLLKWVMPEHEEQIRRTFAQTMQVRKLSPEAREVADQYFLEALVRLHRESE
FT                   GASYTGIKPAGTIPGHIARADAALNEGSVDELAAHVANHVKREMLERFQQALAKKEQAG
FT                   QNAEAGRAFVEAYVHYVHFVEGIVGVISGDHAH"
FT   sig_peptide     complement(164212..164304)
FT                   /locus_tag="DaAHT2_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.660 at
FT                   residue 31"
FT   gene            164679..165281
FT                   /locus_tag="DaAHT2_0136"
FT   CDS             164679..165281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0136"
FT                   /product="selenium metabolism protein YedF"
FT                   /note="TIGRFAM: selenium metabolism protein YedF; KEGG:
FT                   ppd:Ppro_1708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84849"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR019870"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5W7"
FT                   /inference="protein motif:TFAM:TIGR03527"
FT                   /protein_id="ADH84849.1"
FT                   /translation="MQELNCRGLACPAPVTQVRDLLVQGKPSTLAVLVDNEAARENVSR
FT                   FLAYQGYQVMVEEVDEGFKVIGTGGDQACEVMDEKELAAAAGAGGKILVMITTDRLGHG
FT                   DDQLGSGLMLNFLKTLKEMGPELWRLVFINAGVKLTVAGAETLAPLQELATGGVSILVC
FT                   GTCLNHFNLLDQKQVGETTNMLDIVTSLQLADKVINV"
FT   gene            165408..166712
FT                   /locus_tag="DaAHT2_0137"
FT   CDS             165408..166712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM_0633 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84850"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5W8"
FT                   /inference="similar to AA sequence:KEGG:MM_0633"
FT                   /protein_id="ADH84850.1"
FT                   /translation="MKRAKLWPMFALLVCVAFGGWSGFAVFSAVAGEKEQVFAAGSFED
FT                   PEVCARCHRDIYQEWSHSMHAYAWDNQWFRADYEQAHRETGGATDMLCGPCHAPVAART
FT                   GQLPPHDGSEFDAVSQRGVSCDFCHTVTGLEQVYNMGHVSEPGRVKRGPRGDGREMYHA
FT                   VEFSELHTRAEFCGSCHQVIHPATGVAIIDTYQDWQNNEYGQKNIRCQDCHMTPTPGVG
FT                   QRRGRAATMGENRSNVAFHAFSGGSVYVQEFLGHREQARMAREMLRAAAVVELSPRVTN
FT                   DATLELTVDVRNVGAGHKIPTGVTYIRKMWLQVEVLNGAGEKVYSSGHLVEGNHVDPEA
FT                   VFFRLLFVDEQGELTGKSWRAQGIGYDRRIAANSSEREVYRIGLPARSDYTINTRLMYR
FT                   SFSQATIERLEGILDKALPPLGSVEMAKATAKVSY"
FT   sig_peptide     165408..165503
FT                   /locus_tag="DaAHT2_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.939 at
FT                   residue 32"
FT   gene            166978..168021
FT                   /locus_tag="DaAHT2_0138"
FT   CDS             166978..168021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0138"
FT                   /product="Cytochrome-c peroxidase"
FT                   /EC_number="1.11.1.5"
FT                   /note="KEGG: aae:aq_136 cytochrome c peroxidase; PFAM:
FT                   Di-haem cytochrome c peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84851"
FT                   /db_xref="GOA:D6Z5W9"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5W9"
FT                   /inference="protein motif:PRIAM:1.11.1.5"
FT                   /protein_id="ADH84851.1"
FT                   /translation="MKRFYALFVGGALLLAGAVGVAMASGHGLASYKDNFEPITVMYVD
FT                   NPDNPVTPEKVELGRKLYHDPRLSKSGLFSCNTCHNIATWGMSKLPVDIGHQWRLGPVN
FT                   SGTVFNAAFYEAQFWDGRAADLEEQAKGPILAHEEMAMPSEELAVERIASIPEYVSRFK
FT                   VSFPEDAEPLTYDNIANAIAAFERTLLTPGRWDRFLLGDNDSLSRAEHEGMKAFVDMGC
FT                   ARCHNGVALGGGFEKMGLVNNYPSESPSQGRYDVTGKQEDKNVFKMTTLRNIEHTYPYF
FT                   HDGAVWELEEAVRIMARLQLGRQLNDAETKSIVTFLKALTGEIPEHALRLPVLPASTAA
FT                   TPRPDPS"
FT   sig_peptide     166978..167052
FT                   /locus_tag="DaAHT2_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.860 at
FT                   residue 25"
FT   gene            complement(168194..169030)
FT                   /locus_tag="DaAHT2_0139"
FT   CDS             complement(168194..169030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0139"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: gme:Gmet_0697
FT                   inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84852"
FT                   /db_xref="GOA:D6Z5X0"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5X0"
FT                   /inference="protein motif:PFAM:PF00459"
FT                   /protein_id="ADH84852.1"
FT                   /translation="MDRLQHSLARCRDRRLAAILDSAGRAAFAAGEVLRRKYDTPLKIN
FT                   HKGRIDLVTEADLASEQAVLKVLQRDHPGIAVLAEESAPVTEKTAISGPLWVIDPLDGT
FT                   TNFAHAFPWFAVSIGYLEDGECRAGVIYNPVSEEFFCAAAGAGAWLNGRPIRVSRTNSL
FT                   EQALLATGFPYSVVEKGDEVAKVVEVLRAMLPKAQGIRRAGAAALDLAYVACGRLDGFW
FT                   EINLKPWDTAAGIALLKEAGGLATDFAGGDFSPFVPQLLASNSLLHQAIRQVINSP"
FT   gene            169536..169739
FT                   /locus_tag="DaAHT2_0140"
FT   CDS             169536..169739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0140"
FT                   /product="protein of unknown function DUF1458"
FT                   /note="PFAM: protein of unknown function DUF1458; KEGG:
FT                   rxy:Rxyl_1669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84853"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5X1"
FT                   /inference="protein motif:PFAM:PF07311"
FT                   /protein_id="ADH84853.1"
FT                   /translation="MGTVAKIIELSADSEKSFEDALAVGIARATKTLKNVKSVWIQDQE
FT                   VMIENNAPKKYRIHLKVTFVLE"
FT   gene            complement(169876..172344)
FT                   /locus_tag="DaAHT2_0141"
FT   CDS             complement(169876..172344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0141"
FT                   /product="glycoside hydrolase family 65 central catalytic"
FT                   /note="PFAM: glycoside hydrolase family 65 central
FT                   catalytic; glycoside hydrolase family 65 domain protein;
FT                   KEGG: ajs:Ajs_2162 trehalose 6-phosphate phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84854"
FT                   /db_xref="GOA:D6Z5X2"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5X2"
FT                   /inference="protein motif:PFAM:PF03632"
FT                   /protein_id="ADH84854.1"
FT                   /translation="MDSWRFVYEDYQPDQEGLREALCTLGNGYFATRGAAPDSAADGVH
FT                   YPGTYLAGGYNRLKTKIAGREVENEDLVNLPNWLPLTFRIDDGEWFRIDQVEILSCRQE
FT                   LDLKSGLLHRDLRFRDGQGRTTRWRERRLVSMADPHLAGLAVELRAEDWSGRLTVRSAL
FT                   DGSVTNSGVERYRDLANQHLETLELDHPDPDTMFLRVRTNQSLIQVAQAARTRLYRDGT
FT                   ELDAQRRHQADRDRISQEITMPLSAGEGVVVEKILALYCSLDQAISEPGLAARHALSAA
FT                   GRFDDLLTAHALVWKHLWEDGDIRLEEQTRGESGLKLRVHIFHLLQTVSFHTADRDVGV
FT                   PARGWHGEAYRGHIFWDELFIFPFLTLRMPVLTRALLRYRYRRLPEARRAAQEAGYAGA
FT                   MYPWQSGSTGREETQRLHLNPHSGRWLPDNSQRQHHINAAIAYNIWSYCQATDDHEFLY
FT                   YYGAEMLLEIARFWASIATHNEALDRYEIKGVMGPDEYHTAYPDRDPEAEGGLDNNAYT
FT                   NIMAAWVLSRALDVLEMLPKFHGHMLCERIGLRPEEVELWHEISRKIRVPFHDGGIISQ
FT                   FEGYGDLKEFDWTGYKKKYGDIQRLDRILEAEEDTPNRYKVSKQADVLMLFYLFSADEL
FT                   KLLFEQLGYPFAYDTIPRNVDYYLARTSHGSTLSQIAHSWVLARSDRAGSWDLFQRALD
FT                   SDIADIQGGTTPEGIHVGAMAGTIDLVQRCYLGIEMRANILHFDPSLPADLGCLKVRLR
FT                   YRRQILAVEADHDLLKISSCAFTANLVTVAYRGRFHQVAPGDSCQFRLLKPGERDRDEN
FT                   RARQGKTVLP"
FT   gene            complement(172363..174021)
FT                   /locus_tag="DaAHT2_0142"
FT   CDS             complement(172363..174021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0142"
FT                   /product="beta-phosphoglucomutase family hydrolase"
FT                   /note="KEGG: ajs:Ajs_2161 beta-phosphoglucomutase family
FT                   hydrolase; TIGRFAM: beta-phosphoglucomutase family
FT                   hydrolase; HAD-superfamily hydrolase, subfamily IA, variant
FT                   3; trehalose-phosphatase; HAD-superfamily hydrolase,
FT                   subfamily IIB; PFAM: trehalose-phosphatase; Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84855"
FT                   /db_xref="GOA:D6Z5X3"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5X3"
FT                   /inference="protein motif:TFAM:TIGR02009"
FT                   /protein_id="ADH84855.1"
FT                   /translation="MPPEPRNSGQRRDRSGTVRKEAVRANVSSPTLAAVLFDMDGVVTD
FT                   TAGAHAEAWQRLFDDYLRQRAERGEEKLPPFDPDRDYRRYVDGKPREAGVRSFLEARGI
FT                   EIPYGDESDPPERESIWGLAKRKDRYFRSWLAENRVTVYPGSRRLIDELSSRGLKTAIF
FT                   SASRNAAEVLANAGVDKLFDTKVDGRDLAALGLPGKPEPAMLLEAAARLGVAPEQAAVL
FT                   EDAIAGVEAGARGGFGLVIGVARGDYGEELQKAGARMVVHDLAELALDGDNTLFVKTLA
FT                   DLPSVAEAREGIRERLTAKKPAVFLDYDGTLTPIVEDHTKALLGEGMRAAVAELARHCK
FT                   VAVVSGRDLAMLKQLVGIESVFYAGSHGFEIVGPDGWNKTLEKGAEFLPELDRAEKSLQ
FT                   SELAGIKDHAVERKRFSIAVHYRRVADADLPRLEEAVERVLADHRSLKLGHGKKVFEIQ
FT                   PEIAWNKGRAVLWLLEQLDLEHSDVVPLYIGDDITDEDAFRVLAGCGLAIAVRDHESRP
FT                   TAADCTLADPEEVRRFLEFLTTLVAGRQGQPPGRG"
FT   gene            complement(174011..176119)
FT                   /locus_tag="DaAHT2_0143"
FT   CDS             complement(174011..176119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0143"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="TIGRFAM: glycogen debranching enzyme GlgX; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; KEGG: drt:Dret_0906 glycogen debranching
FT                   enzyme GlgX; SMART: alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84856"
FT                   /db_xref="GOA:D6Z5X4"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5X4"
FT                   /inference="protein motif:TFAM:TIGR02100"
FT                   /protein_id="ADH84856.1"
FT                   /translation="MSDLKVWPGKPYPLGATFDGEGTNFSLFSSVAERVELCLCDGQGG
FT                   ETRLELPEVTAYCWHGYIPGIRPGQHYGYRVHGPWEPEQGRRCNPAKLLLDPYAKAVSG
FT                   QVQWKEAVYPYRFGEPESRNDHDSAPFVPCSVVIEPGFDWGDDRHPATPWHQTIIYELH
FT                   VKGFTKNHPDIPPELRGTYAGLAHPAAIGYLQELGITAVELMPVHQFIHYAHLVEKQLR
FT                   NYWGYSTIAFFAPHNEYGAASEPGRQVEEFKGMVKALHQAGIEVILDVVYNHTSEGNHL
FT                   GPMLGLKGIDNAAYYRLTAEDPRYYMDYTGTGNSLNMLHPHVLQLIMDSLRYWVLEMHV
FT                   DGFRFDLAATLARELHEVDRLSAFFDIIQQDPVISQVKLIAEPWDLGEGGYQVGNFPPL
FT                   WSEWNGKYRDCVRDYWRGQDRTLAEFAGRLTGSSDLYENTGRRPYASINFVTAHDGFTL
FT                   RDLVSYNDKHNEANGEENRDGSDDNHSWNCGTEGPSDDPAVNALRARQQRNFLATLFLS
FT                   QGVPMLLGGDEIGRSQGGNNNAYCQDNEISWFNWDQADRELLAFSQRLISFYREHPVFH
FT                   RRRWFQGRPIHGAEVADIAWFTPEGHEMEEENWGEGYAKSFAVFLNGESLVTKGPRGER
FT                   IGDDRFYLVFNAHHEALTFALPGPEWAAGWVRVFDTAEGWRDEDKKLDPGGEFEVEARS
FT                   LGVLRHAS"
FT   gene            complement(176378..177655)
FT                   /locus_tag="DaAHT2_0144"
FT   CDS             complement(176378..177655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_1475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84857"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5X5"
FT                   /inference="similar to AA sequence:KEGG:Tbd_1475"
FT                   /protein_id="ADH84857.1"
FT                   /translation="MILVERYGFLGGNATAALVMPLMSFDTDKPRREKEGATTLFRTDH
FT                   GPGEPVIAGVLNSFLQRLTQAGGAAAPTLKTGYTVPFDPETFKLVAMEMLDEAGVHFLF
FT                   HALAGETIVTRNTIKGVVFETKSGPVVIRAKAVVDGTGDGDVAASAGAPYETGREDDRL
FT                   VQPMTLMFRMADFERTAFENYVKEHPEQWRGVHGLWDLVQQATLKGDLRLPREDILFFG
FT                   TPHEKEVVVNSTRVNRVLGSDVWDWSYAEWQSRAQMRQISAFLRKYVPGFEQAYVLQSG
FT                   AQAGVRETRRIIGEYQLTADDVLTARKFPDVVAPNTYPIDIHNPEGMGTVIKRVPQGEA
FT                   YDIPLRCLLPRKIDNLIVAGRCISGTHEAHSSYRVMPVSVATGQAAGVCAALAVKTGRI
FT                   PRSLPAGEVQAELLRQGAELGIKKPR"
FT   gene            177712..177774
FT                   /pseudo
FT                   /locus_tag="DaAHT2_0145"
FT                   /product="hypothetical protein"
FT   gene            177775..177846
FT                   /pseudo
FT                   /locus_tag="DaAHT2_0146"
FT                   /product="hypothetical protein"
FT   gene            complement(177848..178744)
FT                   /locus_tag="DaAHT2_0147"
FT   CDS             complement(177848..178744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0147"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: hmo:HM1_2350 thioredoxin reductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84858"
FT                   /db_xref="GOA:D6Z5X6"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5X6"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADH84858.1"
FT                   /translation="MPEQDYDCIIIGAGPGGLQAAIHLARFNRRVILIDQGGGRTRHAL
FT                   HLENYLGLIAGSGKALVDTGIKQIQSFGVTFRHDQVSSVQRDHDFFVVGTGKGADYRAP
FT                   YLILSTGGAENLPRIMGMNRFFGRSIFTCVDCDGYHTTGKKLVILGRSLQTVRLALAMK
FT                   QMFTPNITLVMPAGRLPDDHAELLAEDEIRFIEGEAEEFLGDGELTGVKLTDGRQLSCQ
FT                   VVMLSYSYILNDSFLTELSLQREADGKKLATDHNCETSTKNLFALGALRAGNAQAIIAA
FT                   GQGAMVGIEINQRLLEL"
FT   gene            179002..179514
FT                   /locus_tag="DaAHT2_0148"
FT   CDS             179002..179514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0148"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: afw:Anae109_2857 rhodanese domain-containing
FT                   protein; PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84859"
FT                   /db_xref="GOA:D6Z5X7"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5X7"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADH84859.1"
FT                   /translation="MKSVKLTIMAMAMAMFWGLLTLVPGAMAAEVSVAKLHAVMSDAPA
FT                   QGFWQIRADELHEWIKQERTDFVVVDVRPNPAEFAAGHIPGAIQIPVQGILSPESLAKL
FT                   PKDKKLILICVTGQTQNLPVVPLRALGYDAYTMSFGYSAWIHDYHGAHTMQQAIENAAP
FT                   GKFPLFK"
FT   sig_peptide     179002..179088
FT                   /locus_tag="DaAHT2_0148"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            complement(179519..180121)
FT                   /locus_tag="DaAHT2_0149"
FT   CDS             complement(179519..180121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0149"
FT                   /product="protein of unknown function DUF309"
FT                   /note="PFAM: protein of unknown function DUF309; KEGG:
FT                   dat:HRM2_21250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84860"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5X8"
FT                   /inference="protein motif:PFAM:PF03745"
FT                   /protein_id="ADH84860.1"
FT                   /translation="MTATQHFDPFNDRLARDLRNELSEALAVDLDLLRLERSPQVAAVF
FT                   RQRPLQEVHRHYLEQRLAAYERVLVIIHQRELVEPFHRALVLWDEELFFEVHELLEPPW
FT                   YRAPAGPDKIALQGMIRAAGVYVFLAANRRDSAASMAAKAISGLNLWQQSNLPPFPDLP
FT                   RLQAALAGLEPAPLPWRRPCLTSSHLVPPCRGKSYSP"
FT   gene            complement(180142..180741)
FT                   /locus_tag="DaAHT2_0150"
FT   CDS             complement(180142..180741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0150"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   dps:DP1259 iron-sulfur flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84861"
FT                   /db_xref="GOA:D6Z5X9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5X9"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ADH84861.1"
FT                   /translation="MKIIGVSASARKNKSTCFLLEQCLDQLKESAATAGKSLEVELIDL
FT                   AALRFQGCLACDTCKKGVQCSQQDDFQELIPKLAAPEVRGIIVATPVYMGCMSSQAKAF
FT                   LDRTVLFRRNGFMFKNKLGGAIAVGGSRSGGQELTIQAVHAAMMIHDMIIIGDGDHFGG
FT                   TGWANHPDGYQGDTMGITTARNLGRRMAEVAALMQD"
FT   gene            complement(180862..182511)
FT                   /locus_tag="DaAHT2_0151"
FT   CDS             complement(180862..182511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0151"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein; KEGG: drt:Dret_1973
FT                   ABC-1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84862"
FT                   /db_xref="GOA:D6Z5Y0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5Y0"
FT                   /inference="protein motif:PFAM:PF03109"
FT                   /protein_id="ADH84862.1"
FT                   /translation="MDLRTFAHMGRYKEIVTILWRYGFNEVVERLEFPGHHLLGRIHTQ
FT                   SSELDTGTRIRKAMEELGPAFIKIGQFLSMRHDIFPPAVLRELRKLQDEVPPTPFPAIR
FT                   EVLENSLGRPIPEVFSHFEEEPLAAASLAQVHRAVLLEQRQVVAVKVQRPNTLELVRKD
FT                   LEILEIIARQINERVESLRVYNLPKLAQQIHRLMLKEIDFNREMRNMRIMRSILVEPGF
FT                   FVPAVFPDYSNSRVLTMELARGQKLKDIDLEKLADRHELARRGMSMVISQVLENGFFHA
FT                   DPHPGNFLIDKDGTISLLDWGMVGRLPAEMRYNMIDLVSSFVEKDTEEIVNIMLEFVSG
FT                   AEKADKRSLQNEVMEVINLFHHLPLKEINLGLILNDTTRILREQGLVLSAEPAIMIKAL
FT                   VTVESTAQQICPDLNTIEEIKPFVSRLTEERYKFANLRRGFMRNLKYFFKIQRKLPGSI
FT                   LAITDKIEHDELAIRFRHERLEGLQHTLERITNRMILGLITASLFVTSGLIIFADIGPP
FT                   LWGYPYLGMIGFLLAMALAIYLVISILRASKY"
FT   gene            complement(182515..182853)
FT                   /locus_tag="DaAHT2_0152"
FT   CDS             complement(182515..182853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dhd:Dhaf_3248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84863"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5Y1"
FT                   /inference="similar to AA sequence:KEGG:Dhaf_3248"
FT                   /protein_id="ADH84863.1"
FT                   /translation="MMVRDTIRKSLYAGLGVAVVTCEEIRKTVDRFVEAGKMSAEDSEA
FT                   LINELSTKGEKQQKEFQQWLTDIARTTFDRMEIADKQKVDELSAKVKNLEERITLLEDL
FT                   RHKEEKSH"
FT   gene            183119..184123
FT                   /locus_tag="DaAHT2_0153"
FT   CDS             183119..184123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0153"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /note="KEGG: lbl:LBL_2044 pseudouridylate synthase;
FT                   TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84864"
FT                   /db_xref="GOA:D6Z5Y2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5Y2"
FT                   /inference="protein motif:TFAM:TIGR00005"
FT                   /protein_id="ADH84864.1"
FT                   /translation="MTALGGKPTGPERVCAVRVEAGQAGGTVLDFVAGRFTYLTREQWQ
FT                   QELVDGRLRVNGEPVPPERLLAAADRVSYRGRELAEPPVASHFSVVYEDDDLLVVNKPA
FT                   PLPCHPGGRYFRHTLWRLLQERCGVPKPLLVNRLDRETSGLVVVAKKRAAARDCARQWQ
FT                   EQQVEKRYLVLVEGEFPLGAQAVAGFLAPDPASLVRKKSRFFPADQAAPAGAVSCATAF
FT                   RLLALQGGISLLEARPLTGRCHQIRATLCSLGFPVVGDKIYGLDEELFLRFLADRLSSD
FT                   DRRRLRLPRQALHSAGLKMRHPADHRPLEFTCPLPPEMAGLLPQALPVGAMES"
FT   gene            184271..184822
FT                   /locus_tag="DaAHT2_0154"
FT   CDS             184271..184822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0154"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: chl:Chy400_4041 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily; TIGRFAM: RNA polymerase sigma
FT                   factor, sigma-70 family; PFAM: sigma-70 region 4 domain
FT                   protein; sigma-70 region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84865"
FT                   /db_xref="GOA:D6Z5Y3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5Y3"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADH84865.1"
FT                   /translation="MRFEDRSDEELMAAYAAGDLDAFAVLYDRHRGRILGYLFSRLAGR
FT                   DEAEEVFQKVFARLHESRQKYRAGTPFLPWMFVLMRNVLIDHVRQVQRRRRRLVYSEEA
FT                   VLGAVAPETVAGSGRLRDGGYLDGLDARQRRALELRFEQGFSFAEISARLGLSTVNARQ
FT                   IISRALRRLRQTFGEQGNQR"
FT   gene            184819..185418
FT                   /locus_tag="DaAHT2_0155"
FT   CDS             184819..185418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_2666 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84866"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5Y4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84866.1"
FT                   /translation="MSNHKLSRESSQKLSLDWSHEARCEFSAFVEARPIMPRPATEAAI
FT                   FRLVRERSLFNLQAFSARFLPVQAVSGLATLAVCPQFGIGGHWGGRLEALLHVSANPWL
FT                   FYATCGLFFVLFGALLSGLLIGLRPRGAGGLGAYSLFAVYSLVAYLLLSLLGGEAFVLV
FT                   SLAWLVGALAGNILGFELGGRLRRTLGRFRPALGSA"
FT   gene            complement(185534..186469)
FT                   /locus_tag="DaAHT2_0156"
FT   CDS             complement(185534..186469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0156"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: dps:DP1323 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84867"
FT                   /db_xref="GOA:D6Z5Y5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5Y5"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH84867.1"
FT                   /translation="MAITLRQLEIFVAVAETSQVTKASAKLHLTQSAVSMALNELQNQL
FT                   DGPLFDRKGRNLLFNDRGRYLLPLAKEILGQINNIESLLGEKSGSVAGSLKIVASSTIG
FT                   NYVLPYFIGVFKKLHPQVSLDMLVCNTRHAETMIAEGEAGLGFVEGEVTNDQVRIIPWL
FT                   EDELVVIAGPTNPLAGKENFELPGDLELCEWIIREKGSGTGQVFKKKLGRHLPGLRVAM
FT                   ELGHTEAIKKAVEAGGGVACLSSLTVCREVEEGWLASLSVKGLDMRRTLQIIHYKNKAM
FT                   TGLMQEFVAFCSLINESGHGCSCLTSPWIL"
FT   gene            186637..187188
FT                   /locus_tag="DaAHT2_0157"
FT   CDS             186637..187188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dat:HRM2_18730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84868"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5Y6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84868.1"
FT                   /translation="MSGQEYFADYSVPITLKEAVRARSDFARNRWQHRFEPPFFSGTPG
FT                   GGSPLAITGPKACRRKKFPRFAPRRDFYVLHREVGRVINVGMGGLCFTYFDDPSRQGEL
FT                   PEEGLLLAGTGQCVKGVPFETMADQVVVPLLAGKYRVKRRCVQFGELTEHQIEELERFI
FT                   LDNAYVPQLAGAPGRRTCWK"
FT   gene            187202..187678
FT                   /locus_tag="DaAHT2_0158"
FT   CDS             187202..187678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0158"
FT                   /product="protein of unknown function DUF417"
FT                   /note="PFAM: protein of unknown function DUF417; KEGG:
FT                   sru:SRU_1144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84869"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5Y7"
FT                   /inference="protein motif:PFAM:PF04224"
FT                   /protein_id="ADH84869.1"
FT                   /translation="MSYRHDMTNQTSWLPKRLDQFDVRTSAWLDRHCQVVLRLSLAIIF
FT                   LWFGGLKLLGLSPEEELIKNTVYWIEPSSFIPILGWWEMAIGLGLLYRPLIRVALLLLI
FT                   LQIPGTMLPLVLLPEVCFTRIPFGVSLEGQYIIKNLFLVSAAFVIGGKVRHTGR"
FT   gene            complement(187757..189022)
FT                   /locus_tag="DaAHT2_0159"
FT   CDS             complement(187757..189022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0159"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: dma:DMR_28930 UmuC protein; PFAM: UMUC domain
FT                   protein DNA-repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84870"
FT                   /db_xref="GOA:D6Z5Y8"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5Y8"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ADH84870.1"
FT                   /translation="MRKIYALLDCNNFYVSCERLFAPGLNGKPVVVLSNNDGCVIARSN
FT                   EAKALGIGMGEPFFKCRRQLAADKVRVFSSNYPLYADISHRVMTVLARLEPEVEIYSID
FT                   EAFIRLPAADPAVLRETGRRIRATIGREIGIPVSIGFGATKTLAKVANRLAKRQPEHGG
FT                   VFVLADREIDTMLASVPVAEIWGIGRRSAAKLALGGITTALALKNAEDRRLRRQLTVTG
FT                   LRTAMELRGIPCLPLEQCPPPSQSITTSRSFGRPVYEPAELKEALATYVGIAAEKLRAQ
FT                   RLTTGSLQVFLATSRFGAQQRQYANSTVVTLPSPCASTTELIRHAAKALQHIFRVGHAY
FT                   QKVGVILLELTPAGRLQPNLFQAQPDQRQEALMAAMDTINHKWGRETLHSAATGLLRDW
FT                   KNRQNRKSPAYTTSWHELPLVG"
FT   gene            complement(189031..189468)
FT                   /locus_tag="DaAHT2_0160"
FT   CDS             complement(189031..189468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0160"
FT                   /product="Peptidase S24/S26A/S26B, conserved region"
FT                   /note="PFAM: Peptidase S24/S26A/S26B, conserved region;
FT                   KEGG: syn:sll5123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84871"
FT                   /db_xref="GOA:D6Z5Y9"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5Y9"
FT                   /inference="protein motif:PFAM:PF00717"
FT                   /protein_id="ADH84871.1"
FT                   /translation="MKSDHTIASIHGFNRKGELRRPLFTCGVSAGFPSPADDYIEGRLD
FT                   LNQLMIANPAATFFVRVAGDSMIGAGIHHHDILVVDRSLEPTDGKVVIAVVDGELTVKR
FT                   LRRQNGTIRLQAENPDYPAIKLNEETSCEVWGVVTFVIHPL"
FT   gene            189690..190148
FT                   /locus_tag="DaAHT2_0161"
FT   CDS             189690..190148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0161"
FT                   /product="PEBP family protein"
FT                   /note="PFAM: PEBP family protein; KEGG: cyh:Cyan8802_2696
FT                   PEBP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84872"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5Z0"
FT                   /inference="protein motif:PFAM:PF01161"
FT                   /protein_id="ADH84872.1"
FT                   /translation="MQLTSSAFSPNGVIPVRYTCDGDNVNPPLAIAGVPAAAVSLVLIM
FT                   DDPDVPKKLRADGMWDHWIVFNIPPDLAKIEEGAEPPGVRGIGTGGNHDYHGPCPPDRE
FT                   HRYFFKLYALDCRLDLPAGATKTRVEAAMAGHILAQAELMGRYDRPRR"
FT   gene            complement(190199..190645)
FT                   /locus_tag="DaAHT2_0162"
FT   CDS             complement(190199..190645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_1392 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84873"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5Z1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84873.1"
FT                   /translation="MKSFAAKRKCAVLYVWVAGAARKLAAYGDYLSVEGEFNAGRNTGR
FT                   QDHIEINTAAVLRWHAFPWRRQVATSVAWGLGLSYALARPAIEDQPDRRASRSLLFMPT
FT                   ELTLGPPGANWQMLLRIHHRSGAFGVVDEATGSNFIALGLRFQL"
FT   gene            complement(190917..192254)
FT                   /locus_tag="DaAHT2_0163"
FT   CDS             complement(190917..192254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dat:HRM2_39220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84874"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5Z2"
FT                   /inference="similar to AA sequence:KEGG:HRM2_39220"
FT                   /protein_id="ADH84874.1"
FT                   /translation="MKPHFRGRPALLLLMLLLVLKLPPAAVAGPAVDDDDLFEFDFDPV
FT                   AFAPKPFSWGGYLELKGEHLRLNSDGALYLLRHYRQPRARLNRLTPAMQLQGRYRRGNL
FT                   VVQGKANAAASWDEATSTDRADLLEGYLSFTPSPRRSLDLGKKTYNWGTGYAFNPVGFI
FT                   QRPKDPDNPEESREGYVTGGLELTRSTTGALKTATLNLVALPVTGEINRDFGAADHLNL
FT                   AARLYLLYRNTDLNLLGYTGDSRPDRFGVAAARNLRPNFAIHGELAHIPRQNFQTLQAD
FT                   GSVLRHRAAATSYLLGLRYLTARQLTIITEYYHNGEGYRRRELGRFYDLIHDGHQQYQS
FT                   NGGTAELNQAAGLAPRYDRPQAGRNYLYTRLSWKEPADILYFTPALTLITNLDDGSASL
FT                   SPEALYTGFTNWETRLRLTLLTGGSGREYGERANQYRLELRLRRFF"
FT   sig_peptide     complement(192168..192254)
FT                   /locus_tag="DaAHT2_0163"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.950 at
FT                   residue 29"
FT   gene            complement(192251..193000)
FT                   /locus_tag="DaAHT2_0164"
FT   CDS             complement(192251..193000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dat:HRM2_39210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84875"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5Z3"
FT                   /inference="similar to AA sequence:KEGG:HRM2_39210"
FT                   /protein_id="ADH84875.1"
FT                   /translation="MIKLTLRVILIFGLLAATPLAVAAETPSAEEVLARVDRNLQPESA
FT                   EMYRRLINIEPDGSRKEFTLYSLRKGRDRMVALFLEPASERGRATLRRDDNMWLYIPEV
FT                   GRPIRITSLQSVVGGVFNNSDIMRLDYQSEYEAFAMSEYDDHYRLELKARSGAVAYDRL
FT                   VMLVDREALVPTEIECRTAEGMLIKTLRYSRLQDFGDGLLRPSVLETDSPLYEGYRSLM
FT                   VWGQITPRELADEVFTLSYLPRIEELR"
FT   sig_peptide     complement(192929..193000)
FT                   /locus_tag="DaAHT2_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.913 at
FT                   residue 24"
FT   gene            complement(193014..193412)
FT                   /locus_tag="DaAHT2_0165"
FT   CDS             complement(193014..193412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dat:HRM2_39200 iron-molybdenum cluster-binding
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84876"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5Z4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84876.1"
FT                   /translation="MNARSRFSCLLATVLWLLSLAPAGAAESVLIAVAAEGPEATAAVS
FT                   KVAARAPYLLLFDHQGNLTAAMANPYRQAGGAAGPQVAQFLADQGAGVVIAGEFGAKML
FT                   TAMQNQGLEPRIADGTAATVVQALLNRQ"
FT   sig_peptide     complement(193335..193412)
FT                   /locus_tag="DaAHT2_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.952 at
FT                   residue 26"
FT   gene            complement(193455..194693)
FT                   /locus_tag="DaAHT2_0166"
FT   CDS             complement(193455..194693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0166"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   glo:Glov_1801 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84877"
FT                   /db_xref="GOA:D6Z5Z5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5Z5"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADH84877.1"
FT                   /translation="MANLLKIALRNLLRYRRRTLLTTSLIAIGVIFVLLFVAVTGSFKN
FT                   LMIAQTTDSMLGHLQLHKRGYVASIENLPLNLNLSGEALNRVEEVLTRQPEVEAFSSRL
FT                   KFGAMFSTFVETTNIRLNGIDPERELATVPLLKGRLLAGDPELTPGRIWVPELLARGMG
FT                   IKPGDAVVVVATNQDGSVNGRQLTVAGILESATGPGGRDGYLHIDDAAAILRLPQREIS
FT                   EIAVRLHDFNRLPAVAAALEEKLAPYTTPQERPLYELHTWERLSPFYNIARMIEVMTFF
FT                   VKLMLIAIVLVSIMNVMIMAVYERIREIGTMAAIGTPPGRILTLFMLEGFSLGVAGAAA
FT                   GSLLGLLLIKLLNLAEITYDFGRQQGLVLQAEIAAGELLLISLIVISGAVLASLQPALK
FT                   ASRLDPIKALHHV"
FT   gene            complement(194686..195399)
FT                   /locus_tag="DaAHT2_0167"
FT   CDS             complement(194686..195399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0167"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: glo:Glov_1802 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84878"
FT                   /db_xref="GOA:D6Z5Z6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5Z6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH84878.1"
FT                   /translation="MNLVTAKDLGKEYQSGEVRVQALSDLDFEIAPASFVSFVGPSGSG
FT                   KTTLLNLIGCLDKPSRGTLTVAGKEVGQLERRAGARFRGRHIGFIFQDFNLLPVLTVAE
FT                   NIEYPLQLVLDLPAAERRRRVQTLLAAVEMEDQADKYPDQISGGQKQRVAVARALVSRP
FT                   QLVLADEPTANLDHRTAMRVIELMRRMRDEFGTTFIFSTHDPKIVGAAEIIHHLEDGRL
FT                   VKSEITGEKPGGHHG"
FT   gene            complement(195653..196384)
FT                   /locus_tag="DaAHT2_0168"
FT   CDS             complement(195653..196384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0168"
FT                   /product="protein of unknown function DUF82"
FT                   /note="PFAM: protein of unknown function DUF82; KEGG:
FT                   drt:Dret_2400 protein of unknown function DUF82"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84879"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5Z7"
FT                   /inference="protein motif:PFAM:PF01927"
FT                   /protein_id="ADH84879.1"
FT                   /translation="MIRLIFHGELAELLTAPQAAGEVRTTARGASIKDMVEACGIPHTE
FT                   VGKIAAGQSVNFSYIPADDERLDIFPLTPPVDITIPTCLRPEPFTAVRFIIDVNVAKLA
FT                   RRLRMLGFDALLPADHDDANLARLAAAGRILLTRDRRLLKRRQVLFGRLIRATDPQKQL
FT                   LEVLNHYGLQQRALPFSRCLNCNEILQPVAKEKIIHRLEPLTKKYYTRFKYCPACDQIY
FT                   WAGSHREKMQHLVEQALPHAR"
FT   gene            complement(196386..197837)
FT                   /locus_tag="DaAHT2_0169"
FT   CDS             complement(196386..197837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0169"
FT                   /product="protein of unknown function UPF0061"
FT                   /note="PFAM: protein of unknown function UPF0061; KEGG:
FT                   afr:AFE_0519 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84880"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5Z8"
FT                   /inference="protein motif:PFAM:PF02696"
FT                   /protein_id="ADH84880.1"
FT                   /translation="MASPTVSFEHSYAHELPGLYTPWQGQQWPKPQLVLLNERLAQALG
FT                   LDPAALTSVEGVAMLSGHAMPDTARPLAMAYAGHQFGGFSAQLGDGRAILVGEVIDPQG
FT                   KRWDLHLKGSGQTPFARGGDGRAVLGPVLREYMISEAMAALGVPTTRALAACTTGERIL
FT                   RQRGLEPGAVLARVAASHLRVGTFQFLAARGDNQLLQRLADYAISRHDPDLTEAPHRYL
FT                   KLLARVSARQAQTVAHWMGIGFVHGVMNTDNTTISGETIDYGPCAFMERYDPQTCFSSI
FT                   DHQGRYAYGNQPAIIFWNLARLAETLLPLINTDEDRAIEGALQVIKEAQTFYRAAWLQV
FT                   FTRKLGLNRPDAALIEEMHQLWQGQGVDFTSFFRALPAALGGDEAPLRALFDDDAAVGD
FT                   WLAGYRALASNATPELVARNNPVYIPRNQLVEEALQAASFQDDMEPFRRLLALVQAPFT
FT                   HVDSAEAYARPAPHDAPQIVTYCGT"
FT   gene            198029..198925
FT                   /locus_tag="DaAHT2_0170"
FT   CDS             198029..198925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0170"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: kko:Kkor_2437 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84881"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z5Z9"
FT                   /inference="similar to AA sequence:KEGG:Kkor_2437"
FT                   /protein_id="ADH84881.1"
FT                   /translation="MKVIRGLMAVGLSAALLVGCSSDGSSGKDKQGMLSLSVTDAPVAE
FT                   ATAVWVQFSGVELQSSSHGRQTFDFSEEPKQIDLLALEGGGSELLLDEVSLPAGNYQWV
FT                   RLMVDTEPGVLDSYLVSATGEHELTIPSGDQTGLKLIRGFVVPAGGHADFTIDFDLRKS
FT                   VVGDDEKGYKLRPTLRMVDNSEVGAVIGHVDIANLCGSEEGAAVYVFPGPDTSPVDINI
FT                   NEEQGPLVVAPVRFNEEEGQYCYRAAFLTAGEYTLALTCQADQDDPEATDDIAFVEQQN
FT                   VMVEAGAPPTQAHFPAE"
FT   sig_peptide     198029..198103
FT                   /locus_tag="DaAHT2_0170"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.848) with cleavage site probability 0.437 at
FT                   residue 25"
FT   gene            199141..200421
FT                   /locus_tag="DaAHT2_0171"
FT   CDS             199141..200421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0171"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; KEGG:
FT                   pjd:Pjdr2_0818 S-layer domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84882"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z600"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADH84882.1"
FT                   /translation="MKKTFLISGLMVFGLSMLLPVTAPLFAADCQVIGGEIESETNLLK
FT                   RQALARQGVVACPDDPRINFHYAYSLERFRQYREALKHYQQAAIHDPEFAASYFGMGDM
FT                   YLQLGRPEDAVKAYEFGLALAPEAGRAQRSLAEARSRLQEQATGRHDDDVTSFAGLMGL
FT                   EPEQEPDPEPVVEAVPQQEEPPKAVTHLLVYAAGAGGSIAGDVSQQVVEGEDGRKVTAE
FT                   PEVGYQFVAWSDGRTDNPRVDSGVSRDVTVAAGFAPVVYTVTALTGPNGDIAGRGSQPV
FT                   VHGGEVGFAVKPGAGYIASAEGSCDGYFDGDLYRIGSVTADCTVNFTFAAIRDEPEDAA
FT                   GVSVDEVVVEAAVEAPGVEATAVEMASPEPSTAVSDKPLEGERLGDTWWRVQGSDGAGS
FT                   ITESATVGQKMEQGGRLGDTWLRPLPD"
FT   sig_peptide     199141..199224
FT                   /locus_tag="DaAHT2_0171"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.997 at
FT                   residue 28"
FT   gene            complement(200464..201234)
FT                   /locus_tag="DaAHT2_0172"
FT   CDS             complement(200464..201234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0172"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   glo:Glov_0228 protein of unknown function DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84883"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z601"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ADH84883.1"
FT                   /translation="MFCGEVLPEQDTTTAAEASLWSAPHTGMEFVPVPGGSFRMGNIWD
FT                   DGGRDEQPVHLVQVAAFQLARYPVTQAQWQAVMGHNPAEASGQVFVGDDKPVVNVSWND
FT                   AKDFIARLNQASGENFRLPSEAQWEYAARSGGKEQKWAGTSEEKLLPEYAWYSANSQGR
FT                   PQPVGRKLPNGLGLHDMSGNVWEWCEDIWHPNYEGAPTDSSPRLGTAAGDREAERRVMR
FT                   GGSWNFNALNARTTYRDWNDTGYRFFVIGLRLAR"
FT   gene            complement(201416..203605)
FT                   /locus_tag="DaAHT2_0173"
FT   CDS             complement(201416..203605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0173"
FT                   /product="glutamine synthetase catalytic region"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   sat:SYN_01613 glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84884"
FT                   /db_xref="GOA:D6Z602"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022147"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z602"
FT                   /inference="protein motif:PFAM:PF00120"
FT                   /protein_id="ADH84884.1"
FT                   /translation="MCASSCCKKGAHHAVCCHGHGASSPARSGKTIGAAVPELFGANVF
FT                   SDQVMKARLPKETYKALQRTINAGASLQADVAAVVANAMKDWAIERGATHYTHWFQPLT
FT                   GATAEKHDSFISPSVEGTVIMEFSGKQLIQGEPDASSFPSGGLRVTFEARGYTAWDCTS
FT                   PAFLKEDGAGNVTLCIPTAFCSYKGEALDKKTPLLRSMNAVSRQALRVLRAMGNSTSQK
FT                   VIPTVGAEQEYFLVEKEYYSKRLDMMNCGRTLFGAPSPKGQELEDQYFGAIKDRVSAYM
FT                   KDLDTELWKMGVTSKTKHNEVAPAQYEMAPVFTSTNIAADHNQLVMETMQKVALRHNMV
FT                   CLLHEKPYAGVNGSGKHNNWSLATDDGINLLEPGQTPGDNAQFLVFLCAMIKAVDEHAD
FT                   IMRTTCGSSGNDHRLGANEAPPAIISIFLGQELTEILEKLAKGEKICSPEGCQFVKIGV
FT                   DSLPDLPKDNTDRNRTSPFAFTGNKFEFRMVGSSQSISGHNVALNTIAAEALDEIAGRL
FT                   EKAKDVNKEIQALIKETMAKHGRIIFNGNNYSDEWVVEAQKRGLPNVKNTADALKTLVT
FT                   PKTIKLFDKYSVLSKEELHSRYEIYSEQYAKHLNIEARAAVQMTRRQYIPAVIRYISVL
FT                   GASAGAAGKHGNVQKKLLEKISKLLEAVDKKVDKLEAEAQKARAIEDVGKQASAFRDKV
FT                   IPTMLSLREDVDQLEELLPADLWPVPTYSDLLFKL"
FT   gene            203991..204383
FT                   /locus_tag="DaAHT2_0174"
FT   CDS             203991..204383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0174"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="KEGG: ppd:Ppro_1168 BadM/Rrf2 family transcriptional
FT                   regulator; TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84885"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z603"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ADH84885.1"
FT                   /translation="MQITRATDYAIRCVYCLARHPGELWMIDDIAREMEIPNSFLAKIL
FT                   QKLARAQIVESQRGVRGGFRLARAPEEISLHDVVVATEGPVAMNVCTLEGERCDRVEKC
FT                   RVHPVWVTIRQEVEEALQKRKFADFL"
FT   gene            204551..205954
FT                   /locus_tag="DaAHT2_0175"
FT   CDS             204551..205954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0175"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /note="PFAM: cytochrome c oxidase subunit I; KEGG:
FT                   gbm:Gbem_1237 cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84886"
FT                   /db_xref="GOA:D6Z604"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z604"
FT                   /inference="protein motif:PFAM:PF00115"
FT                   /protein_id="ADH84886.1"
FT                   /translation="MDRPAYNYDIVKHFVHWSILWGAVSVLVGVIISFQLVMPQLNFGE
FT                   YLSYGRLRPVHTNAGIFGFAVGGFFALFYYMVQRLCRVPIWSNGLARFQLWLFNIIIVL
FT                   SAVTLLLGFSQSKEYHEMEWPIDILIAVLWVGFTINILMTIFKRREPQMYISLWFMMAA
FT                   LIGVAVLFVVNGLSVPVTLFKSYSAFAGTNDANVQWWYGHNAVAMVLTVPPLAVFYYFL
FT                   PKSTGVPIYSHRLGIVAFWSLIFMYLWTGAHHLLWTPIPDWVQTLAMAFSIMLIAPSWG
FT                   SVINGYLSMNGQWHQMRENYLVKFFILAITFYGLQTLQGPMQAVRSFSGFIHYTEWIPG
FT                   HVHMGTMGWITLLICGAFYYLAPRLYGRELYSIPLANLHFWLVLIGQLIYSVSMWIAGV
FT                   VQASMWHSLNDDGSLTYTFVDSLLAMYPYWWIRGLGGVIYLLGIGVFVYNIAMTARGAQ
FT                   TPQQAAQQA"
FT   gene            205969..206835
FT                   /locus_tag="DaAHT2_0176"
FT   CDS             205969..206835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0176"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit II"
FT                   /note="KEGG: gem:GM21_3041 cytochrome c oxidase, cbb3-type,
FT                   subunit II; TIGRFAM: cytochrome c oxidase, cbb3-type,
FT                   subunit II; PFAM: cytochrome C oxidase mono-heme
FT                   subunit/FixO; cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84887"
FT                   /db_xref="GOA:D6Z605"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z605"
FT                   /inference="protein motif:TFAM:TIGR00781"
FT                   /protein_id="ADH84887.1"
FT                   /translation="MWERNPVIFLLLATAVIMVGTIVTMVLPFAYVNTERDAIESVVPY
FT                   TALELAGRDVYIKEGCNNCHTQTVRPLVAEVIRYGDYSKSGEFVYDRPHLWGSRRTGPD
FT                   LARIGGKYPDQWHYEHMRNPAGMVPGSNMPPYAFLDNRSVDPELTRRKMDVLGFPYTEE
FT                   EIRALAGKTDMDAMVAYMQKLGSDIPWREQQRVALVGELENPFSGDAAAIAEGRELYDR
FT                   NCAACHGSGLRGGFAASLDRLHYPEEVFFRIIHDGIQPLNMPSFAGMGSERIWKIVTYI
FT                   DSEQVAP"
FT   gene            206832..207011
FT                   /locus_tag="DaAHT2_0177"
FT   CDS             206832..207011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0177"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pph:Ppha_2076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84888"
FT                   /db_xref="InterPro:IPR008621"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z606"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84888.1"
FT                   /translation="MTWAGMVYLLMTIGMFAVFAAIVIWTFSGKRKERLEAPRERMLEP
FT                   DERSAEKSADKEEK"
FT   sig_peptide     206832..206894
FT                   /locus_tag="DaAHT2_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            207011..207223
FT                   /locus_tag="DaAHT2_0178"
FT   CDS             207011..207223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0178"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gem:GM21_3043 cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84889"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z607"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84889.1"
FT                   /translation="MMSEHNSAPQAGPHSDGIKEGHAPLPGYYKLLFGGLVVWAVLFMG
FT                   YFLSTGWSSAEYFERKMAEHQESIR"
FT   gene            207227..208018
FT                   /locus_tag="DaAHT2_0179"
FT   CDS             207227..208018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0179"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: gem:GM21_3044 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84890"
FT                   /db_xref="GOA:D6Z608"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z608"
FT                   /inference="similar to AA sequence:KEGG:GM21_3044"
FT                   /protein_id="ADH84890.1"
FT                   /translation="MIRPWRRAVQWLGALLFFSLPFGRWQGESLLRLDVPGWTLYLPGR
FT                   QLGVQEFYLVVPALLALIFLFLLVARFLGRVWCGWLCPQTWLNNLVEWLARGLKLRVDP
FT                   WRIGGAWWRLALLHLIGLLFALWCGATLVWYFVPPELYWQRLLAGEPGPWAPGFTLALA
FT                   ALIYLDALFVRRLACREFCPYGRFQVILLGKNTLTLGLTADHAERCLDCRACVRACPMG
FT                   IDIRRGYQVECINCGNCRDACRRVMAKAQPGRPALIAYRFG"
FT   gene            208256..208768
FT                   /locus_tag="DaAHT2_0180"
FT   CDS             208256..208768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0180"
FT                   /product="FixH family protein"
FT                   /note="PFAM: FixH family protein; KEGG: gem:GM21_3045 FixH
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84891"
FT                   /db_xref="InterPro:IPR008620"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z609"
FT                   /inference="protein motif:PFAM:PF05751"
FT                   /protein_id="ADH84891.1"
FT                   /translation="MPQQISRVDSPPVSIYRWPLMLGGLFLSFLLFSSWSIIQAGAKGS
FT                   PVVDPDYYASGQAYHNDERAWRAAAEAGWRLWLSKEDEELRVRLVDGAGQPISGGEVTL
FT                   RVARRAAGNPALWQVELSEVSPGVYRAMAAELPAGAVEMVLTAATAEAELQRRFKVVSG
FT                   PWQELAL"
FT   gene            208747..211296
FT                   /locus_tag="DaAHT2_0181"
FT   CDS             208747..211296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0181"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: gbm:Gbem_1231 heavy metal
FT                   translocating P-type ATPase; SMART: TRASH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84892"
FT                   /db_xref="GOA:D6Z610"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR021993"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z610"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADH84892.1"
FT                   /translation="MAGVGALNDSRCHHCQDPLPADGGFRGERDGEEYRFCCRGCLGAW
FT                   LIITGAGLEDYYRKRSWQDAGGMADVFAVEYDDQLLARYVRQGEEGAELAFLVEGIRCA
FT                   TCVWLIEKIVGGLEGVCTVRANYGSHRVFVVYDPDRLTPAKLFSAVARLGYRPRVLTRD
FT                   NLHRAAEAESRDLLLRFGTAFFLAMQLMGYSFALYAGYFQGMSALTRDVMQWLAALVTT
FT                   PVVFYSGWPFLIGAWRSLRSNLPNMDLLVALGVLAAYFYSLYATVVGREVYFETAAMIV
FT                   TLILLGRLFEHHARRRAAAGVDRLLHLTPDTALRLDDQGQQVVVDSAELRPGELILVRP
FT                   GERFPVDGMIVDGHSEVDEAVVSGESRPLARGPGEPVLGGSFNLTGALRVEVAKTTAES
FT                   FVARMALLVEEAQSRQAPVQRLVDRLAAAFVPLVLGLSLTALLFWLWQGLGLGPAMLIA
FT                   IAVLVVACPCALGLATPTAVLVAAGKAAGRGILYRGGDVLEASAKITHVAFDKTGTLTT
FT                   GRPRVVAVRPHISAAIDEASGGASRAEEIANRLLALAAAVESGSSHPLAEAIVAEAESR
FT                   GLLNGPVGAQPAGLPATDAVGEISAVAGRGMIAAGPAGKVVVGNRDFLLQQGIALPPRQ
FT                   AGRALPEHLRGQDSAVGEALTEVHLAEAGRYLGVILLQDTLRSDAPALVAELRARGLQV
FT                   LMLSGDNQGVAARVATEAGIEPDKVYSAVDPAGKKAIIEELQQGGARVLMVGDGINDAP
FT                   ALAAARVGCALAGGTDIAVGSAGLVLTRDRLAELAPALAMARHTMGIIRENLFWAFSYN
FT                   MVTLPLAVAGLLAPVYAAAAMAASSVLVVANSLRLAR"
FT   gene            211453..211629
FT                   /locus_tag="DaAHT2_0182"
FT   CDS             211453..211629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0182"
FT                   /product="cytochrome oxidase maturation protein, cbb3-type"
FT                   /note="KEGG: ank:AnaeK_1238 cytochrome oxidase maturation
FT                   protein, cbb3-type; TIGRFAM: cytochrome oxidase maturation
FT                   protein, cbb3-type; PFAM: cytochrome oxidase maturation
FT                   protein cbb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84893"
FT                   /db_xref="InterPro:IPR004714"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z611"
FT                   /inference="protein motif:TFAM:TIGR00847"
FT                   /protein_id="ADH84893.1"
FT                   /translation="MMLESTIALIIISLGLGLGAWLAFVWAVKKGEFDDLEGPKYRMMN
FT                   DDDEPPPPGGACR"
FT   sig_peptide     211453..211536
FT                   /locus_tag="DaAHT2_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.593 at
FT                   residue 28"
FT   gene            complement(211626..212660)
FT                   /locus_tag="DaAHT2_0183"
FT   CDS             complement(211626..212660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0183"
FT                   /product="Peptidoglycan-binding lysin domain protein"
FT                   /note="KEGG: sbp:Sbal223_0032 peptidoglycan-binding LysM;
FT                   PFAM: Peptidoglycan-binding lysin domain; SMART:
FT                   Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84894"
FT                   /db_xref="GOA:D6Z612"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z612"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ADH84894.1"
FT                   /translation="MKKTILTAALLGCVAIMTAKMQATADELTPHLVQEGDNLWSLSEH
FT                   YLSDPDRWSEIWQVNPELTNPHWIYPGQIVLIPLAPPPPPKEEVVIKPPPIVSTGEPLP
FT                   MQVTTPFRPKVAEEPEVDERLAAIQAELARQYDRGIGMVTWELPTEGRVLGSEVGWHHA
FT                   ASHQTVLIDAPGAQPGQRLGIYRDLGRVDAQRYLGKSPGHLLADVGIIKVIAPEGGKQR
FT                   AVVERSFTEIKQGDLLGPVPPVPEVTAESLDKDAYTIPATVVAVKHHRMVAASDNVVYL
FT                   DRGENDGLAPGQSFTVHSPDSSKNARRRGELLILRVTPERAAALVTSASTNHVRPGDLL
FT                   GQVR"
FT   sig_peptide     complement(212583..212660)
FT                   /locus_tag="DaAHT2_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.989 at
FT                   residue 26"
FT   gene            212925..213662
FT                   /locus_tag="DaAHT2_0184"
FT   CDS             212925..213662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpc:Cpar_1666 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84895"
FT                   /db_xref="GOA:D6Z613"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z613"
FT                   /inference="similar to AA sequence:KEGG:Cpar_1666"
FT                   /protein_id="ADH84895.1"
FT                   /translation="MFGVLEFDPLYGLAFVTALLGSGHCLGMCGPLVAALSLSSPELQR
FT                   PRVGVAFHLLYSTGRIITYTAVGALVGWFGSALAYTQNLVMVTAIALIFSDLFIIAVGL
FT                   ATAGAFRRLNVMGLNFPAPTALITGLVSQLALLPPALRALPVGLLMGFLPCGFLYAMFI
FT                   AAAQSAAPLTGALTMLAFGLGSVPALLLFGSTAAWLSGRARGRMLQVAGIMVVLIGLYN
FT                   LYRHLQMFDWLVAGIPFVEAICH"
FT   gene            213829..215421
FT                   /locus_tag="DaAHT2_0185"
FT   CDS             213829..215421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0185"
FT                   /product="putative signal transduction protein"
FT                   /note="PFAM: Metal-dependent hydrolase HDOD; KEGG:
FT                   tmz:Tmz1t_1797 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84896"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z614"
FT                   /inference="protein motif:PFAM:PF08668"
FT                   /protein_id="ADH84896.1"
FT                   /translation="MNSMVDQDSDSSPEESRLLEIFARMKIKGLPAMSSHVRELISLTQ
FT                   SSQSAGYELAQVILKDYSLTNKVLQVVNSAYYSLGRHVNSISRAVTILGFDAVRELAMA
FT                   IALFEDFVKSGREKELVSRVLTSSFLSAMQAREMAAEKDYGVAPEEAFICALLHNLGKI
FT                   IICIYLPEQYQQIEELQARGLSEQEAARKVLSGLTFHRVGMEVAAHWNLSANVIAAMAP
FT                   NPEEPKNRRDQTGYLRNLAAFTNRLTEQVCQGQDVGRLVRRFEQALQVNTEEVLDRLNR
FT                   SVDNSEEVSPAIRFGLSKLKIRNNLQRVEAELRHPGKAPKIVPPEKEPPANSWAESPEL
FT                   PEPAVENQVIEIADPAADPEAPKSVTDFIQEITETLMGEFNINDFYINLLEGLYRGVGF
FT                   DRVLLAIMMVRGKQHLLCGRFGFGDLDREGITGFRYDLASPGAIQQAVKNCRDLAVPPG
FT                   VPGAFPEIMQPLVAGRTVYLLPVCLENKPIGLIYLDRREGRPRLDAATLQTTRMFRDFA
FT                   VMAIRKLRQSKRR"
FT   gene            215441..215800
FT                   /locus_tag="DaAHT2_0186"
FT   CDS             215441..215800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0186"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   app:CAP2UW1_2077 cupin 2 conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84897"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z615"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADH84897.1"
FT                   /translation="MSRSSYRKIKAYITKDGSEIRELMHPGVHGNANQSLAEARVPPGA
FT                   LTLAHRHRVSEEIYHFTAGRGVMGLGETTFAVAAGDTVAISPGTTHWLENPGPGPLVVL
FT                   CACSPAYSHEDTELA"
FT   gene            215800..216318
FT                   /locus_tag="DaAHT2_0187"
FT   CDS             215800..216318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0187"
FT                   /product="Protein of unknown function DUF2452"
FT                   /note="PFAM: Protein of unknown function DUF2452; KEGG:
FT                   hha:Hhal_0051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84898"
FT                   /db_xref="InterPro:IPR019534"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z616"
FT                   /inference="protein motif:PFAM:PF10504"
FT                   /protein_id="ADH84898.1"
FT                   /translation="MNDDEKDKLPPAGSQKQSPTLYRGPDRRAPYPVSRMAPAFDLVDL
FT                   ARQIEDADRLIGTSVGGKLQVIAEQVRQLRRQAHEILDNARRDQELHRARCNFRRLPGH
FT                   TYHLYRRPDGESYFSMLAPEDWRDGPPHEYAGSWRLEADQSWTPMGQGDESGDSEEQQA
FT                   LLSALLEKR"
FT   gene            216421..216834
FT                   /locus_tag="DaAHT2_0188"
FT   CDS             216421..216834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_0531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84899"
FT                   /db_xref="InterPro:IPR016924"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z617"
FT                   /inference="similar to AA sequence:KEGG:Mlg_0531"
FT                   /protein_id="ADH84899.1"
FT                   /translation="MRKIIQYTGKPLCLLLLLSFVLLDLSIHSAKAGMIGTEAVIEARA
FT                   AEASRERVADFLERDDVRRALVKQGVDPVEASKRVEALTDAEVNRLARELEQLPAGAGI
FT                   NTIVGAAVFVFLVLLVTDILGFTEVFPFVKPVN"
FT   sig_peptide     216421..216519
FT                   /locus_tag="DaAHT2_0188"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.886) with cleavage site probability 0.700 at
FT                   residue 33"
FT   gene            216843..217784
FT                   /locus_tag="DaAHT2_0189"
FT   CDS             216843..217784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0189"
FT                   /product="peptidase C39 bacteriocin processing"
FT                   /note="PFAM: peptidase C39 bacteriocin processing; KEGG:
FT                   tbd:Tbd_1110 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84900"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z618"
FT                   /inference="protein motif:PFAM:PF03412"
FT                   /protein_id="ADH84900.1"
FT                   /translation="MFLAGLLLGLLLVLPFTGCAPAFQETLREQAGPGRVVIDSVPFYP
FT                   QEKYQCGPASLAMLLAWSGLEVVPEQLVDQVYSPDRQGSLQPSIVAAARRHGRVAYPLS
FT                   GQEEHLLAEVAAGHPVLVLKNLGLAWLPRWHYAVVIGYEREQEVVYLHSDSRGNKALSA
FT                   RVFANTWQRGGSWGLLVLPPDKLPATATEKTWLAAVVGLERTEQWPAAARAYEAALQRW
FT                   PDSVVAWMGLGNSRHALADYLGAVTAFTRAAELEPDFVPASNNLAFSLAAAGRVAEALA
FT                   VIERAMAANGPWLEQLEQTRREIMSRHQLMLP"
FT   sig_peptide     216843..216917
FT                   /locus_tag="DaAHT2_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.793) with cleavage site probability 0.791 at
FT                   residue 25"
FT   gene            complement(217804..219270)
FT                   /locus_tag="DaAHT2_0190"
FT   CDS             complement(217804..219270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0190"
FT                   /product="asparagine synthase"
FT                   /note="PFAM: asparagine synthase; glutamine
FT                   amidotransferase class-II; KEGG: hor:Hore_22410 asparagine
FT                   synthase (glutamine-hydrolysing)"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84901"
FT                   /db_xref="GOA:D6Z619"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z619"
FT                   /inference="protein motif:PFAM:PF00733"
FT                   /protein_id="ADH84901.1"
FT                   /translation="MSGIAGVTGEKVGKDQLQEMIGKLTHRGPDNTITRQVADGGLACC
FT                   ELSLSPRATPAMAGKEEPVVLLDGDIYQEIPPGQTNVGFIREVYQREGREGLAKIDGSF
FT                   ACAIVDRGETILARDAVGSRPLIYRARGNRLYFASEAKALLAWSDTVEELPPGHFYSSQ
FT                   EGLQPFPRHTFTTPDFSTPAEAAEILRELLIKATGKMMADGAVQGVSLSGGLDSSIIAA
FT                   IAKEIDPGIKLFSTTIKRYPSKDLEFAKLMAEFLDLEHHIYQITDQDIDRILDKAVYHL
FT                   ESFDEDCVSGTTANIYTSKLTTVFTNAILVGEGADELFGGYFAELKEVESEEQREEVAE
FT                   KLVQIAYNTALRRLDRSWLAHSVNYRTPFLDPEVVAFSRKIPLELKVYHDEARGIDIEK
FT                   WILREAFRGMLPKEIANRTKLRFAGGTGVDDLMDELTAKYVSEDEFKATPRSETGIKLN
FT                   SPKELYYYKLFRQHFPAGYEKMTARWDPFK"
FT   gene            complement(219419..221197)
FT                   /locus_tag="DaAHT2_0191"
FT   CDS             complement(219419..221197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0191"
FT                   /product="protein of unknown function DUF342"
FT                   /note="PFAM: protein of unknown function DUF342; KEGG:
FT                   eel:EUBELI_00564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84902"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z620"
FT                   /inference="protein motif:PFAM:PF03961"
FT                   /protein_id="ADH84902.1"
FT                   /translation="MASRTLFQLTVNMPSPASFYQKHHGEITAAPDGAVVLQDLLLRSL
FT                   REVAQKLRLRKLEEIPFGESNIFREMEEIIKALLQKIKRREADPHTRISFAVTTDPGPY
FT                   KRQVTFALSRSRSRLKISGVPPKDGVHGFLREKGRYAAARRARQQARRIDHYTTGEFAQ
FT                   TTKGELLAIIDNSRVNGEPGIDVRGAVIKPRTAIPYAIELGKGIEKQESERGKIRLFSA
FT                   LNGMVRTRYDGEGNLRYIEVERDLRLDEVGFRAGGHVKAGGGSDREQALDLDVAEFRTI
FT                   PSAFEAKTGGLIKVAELVQGKVYGAEIVAEMVNQADDKYLVATSGPITINRSIQKGALY
FT                   APEIIIGNGQLIATMMNARLHARHSFTGHKILLSGRNRLLLGNDTLRAHGCGPDSCDFS
FT                   GRNIFQHRRSLLANLAASRQQIKRTDEQLQKTLSAHLKEKNVNHQPAASGTERYAQDAI
FT                   LRLTQQYMHCPEEEEKDLHLEISNTLYDLGLENVLPVTRLITEKKQRQEEQRKFAARLA
FT                   EISPPIRMKLELEECKDGASFAIDCWDDHLLLKKIENEIVLERPAKEEQLVKLPAGRQS
FT                   IALVFNYDTTLLELAK"
FT   gene            complement(221410..221604)
FT                   /locus_tag="DaAHT2_0192"
FT   CDS             complement(221410..221604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84903"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z621"
FT                   /inference="similar to AA sequence:KEGG:Cag_0710"
FT                   /protein_id="ADH84903.1"
FT                   /translation="MGDSGKKKDKEQAAAKGLCKLVKGGLLADSPEQYRELVNNPRFVC
FT                   RKCGRVANREENLCRPTGL"
FT   gene            complement(221619..222812)
FT                   /locus_tag="DaAHT2_0193"
FT   CDS             complement(221619..222812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0193"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG:
FT                   bwe:BcerKBAB4_0687 beta-lactamase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84904"
FT                   /db_xref="GOA:D6Z622"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z622"
FT                   /inference="protein motif:SMART:SM00450"
FT                   /protein_id="ADH84904.1"
FT                   /translation="MSNAVPFTYTAGELFAQICQGPDFVLLDVRNEKDFANWSVEGPNF
FT                   FPYINIPYFHFMEDVQDSLAKIPAGEKIRIVCAKEGSAKYVADLLVDNGFTDVGYLQQG
FT                   IVGWGNLLAPRLVTPPEAPYLLYQCNRPGKASCSYLLIVGKEAMVFDPARNIETYIELA
FT                   ASHGAVITHSFETHRQADYISGGPDLVRETGCTMLVNKLDFDGADFPYQEVNHNEIFAF
FT                   KAGGPEVRALHTPGHTMGSTCFLVDGKYLLSGDTIFVNTSGRPDLGGKWEAWARELYLT
FT                   LMLRLRHLDDSTIVLPGHYTTWEEADDELLICGRLGQLRRQVTAFRLPHEKKFAEFIQE
FT                   NMRPQPGVYAEIRRVNGGWLKVSPEEANVMDLGKNECGASNYGKVGISAEVQRAATD"
FT   gene            223382..223924
FT                   /locus_tag="DaAHT2_0194"
FT   CDS             223382..223924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0194"
FT                   /product="protein of unknown function DUF502"
FT                   /note="PFAM: protein of unknown function DUF502; KEGG:
FT                   swo:Swol_1039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84905"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z623"
FT                   /inference="protein motif:PFAM:PF04367"
FT                   /protein_id="ADH84905.1"
FT                   /translation="MKTIGKYFLHGLLFLVPLLVTLYVLYLVFATIDGIFPFTVPGAGF
FT                   LLTIGLILAVGFVTSNLLGRGLVQLVDRLFARLPLVALLYTSLKDLVNAFVGDKKSFNR
FT                   PVEVALDAEGQIRVVGFITREDLERFGLKGQCAVYLPQSYNFAGNMLVVPHERVRPINA
FT                   DPAEVMKLIVSGGVSSR"
FT   gene            223967..224677
FT                   /locus_tag="DaAHT2_0195"
FT   CDS             223967..224677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0195"
FT                   /product="leucyl/phenylalanyl-tRNA/protein transferase"
FT                   /EC_number="2.3.2.6"
FT                   /note="TIGRFAM: leucyl/phenylalanyl-tRNA/protein
FT                   transferase; KEGG: sfu:Sfum_0044
FT                   leucyl/phenylalanyl-tRNA--protein transferase; PFAM:
FT                   leucyl/phenylalanyl-tRNA--protein transferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84906"
FT                   /db_xref="GOA:D6Z624"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z624"
FT                   /inference="protein motif:TFAM:TIGR00667"
FT                   /protein_id="ADH84906.1"
FT                   /translation="MQEVMPVYQLDPNLVLFPPPQVARYDGLLAVGGDLSPERLLLAYR
FT                   MGIFPWYGPGEPILWWAPDPRLVLLPGEFHISRRLARKLRQGRFSFSTNQDFAGVIRHC
FT                   AEIARPGQEGSWLSEEMIAAYLRLHELGYAHSVECRRDGRLVGGVYGVALGRVFFGESM
FT                   FSLETDASKAAMAHLVAAMETTGGTMIDCQVKSDHLLRLGARLVPGPVFYQRLALDIDD
FT                   EQLTSPPPPATLLL"
FT   gene            224809..226896
FT                   /locus_tag="DaAHT2_0196"
FT   CDS             224809..226896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0196"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit ; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: drm:Dred_1539 electron transfer flavoprotein
FT                   beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84907"
FT                   /db_xref="GOA:D6Z625"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z625"
FT                   /inference="protein motif:PFAM:PF01012"
FT                   /protein_id="ADH84907.1"
FT                   /translation="MSNYIVLVKQVPDVARITDNAFDPDTGNLIRSRLASVINELDAQA
FT                   LAFAWRMKEISGDTGARLICLSMGPPMAAEVLRYGLSRGADAGVLLTDRALGGADTPAT
FT                   ANPLAHAIKKIKAEMLADDDDYFVVAGMQSVDGDTAQVPPQIAEELGIGCIPYATEVEF
FT                   VDGRFRFHHIISGGSQVVEARRRPAVITVAQYDYTLYASFAATRQANRSELVQWGADDV
FT                   KPTAMGGSGSKTRVIRVFPPPKTNRLGRQLHSVAELAGVLRETLHQQSRPGDEGRQGPE
FT                   PDYLLPSRRSFWFDRPFEGTAKECDDFAQLASILVELGIKEPGQITEQVKEQVLAAEKL
FT                   SLSPKVAATMLDGLGQQETAYQGEVWVMAEHEEGALNAATFELTGKARELADSLEVPLG
FT                   VVLAGDGVRELAPELIAAGADKVYLLEHPLLEEFDPLSYRKAVAELFAVHRPQILLYGA
FT                   TPQGRVLAPMVAYRTGCGLTADCTELTIRDISRQGQLAVMMQTRPALGGNIMATICSRN
FT                   SSCQMATARPGVMQRRPADPARRGEIITHQVELTEEDLGLAIIERAAGGEKVDFACDIL
FT                   VGGGKGLASRDNFVRLLDELNAALTAKFKVKVGKGASRAAVEQGFIARAFQVGQTGTAV
FT                   GPKVYLAVGISGAIQHMIGVAASGTIIAINADPAAPIFKQCDYYLVGRAEQVIPELIVT
FT                   L"
FT   gene            227129..228799
FT                   /locus_tag="DaAHT2_0197"
FT   CDS             227129..228799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0197"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="KEGG: cbd:CBUD_1221 electron transfer
FT                   flavoprotein-ubiquinone oxidoreductase; PFAM: electron
FT                   transfer flavoprotein-ubiquinone oxidoreductase; Lycopene
FT                   beta and epsilon cyclase; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84908"
FT                   /db_xref="GOA:D6Z626"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR007859"
FT                   /db_xref="InterPro:IPR008671"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z626"
FT                   /inference="protein motif:PRIAM:1.5.5.1"
FT                   /protein_id="ADH84908.1"
FT                   /translation="MNDNPQDYRKVDVLIVGAGPAGLAAAIAAKHRRPELAICVIDKGA
FT                   APGNHALSGAVLEPGALARLLDPVRPGWQESDEAGAVLLARVESDDVLWLPGHRRAVSL
FT                   LPLLKTARLLGLGYGRMIHGGDYICSVSRLAAWLGKIAQELGVEVLPGFAAADLLWDQG
FT                   AGRAAGVKLVDQGRDKEGRPQRNFLAGETISADFILLAEGCDGLLSEKFITMAGLQRAG
FT                   EQLYSLGVKELIRVSDEQYAKFGDRRVVHAMGFPLWTPLSGPDVFGGGIMYPMGENRIA
FT                   VGIIAGLDYRYHDFNPQNALSLFKEHHYVKQFIDGGTLVETGAKMIPEGGWEAVPRCPQ
FT                   NGTVGKGNVVLLGDAAGLVNMLKIKGLHNAIESGLAAAEALAANGSPEKLAAAYTAALE
FT                   RAGVVREMAAARNFRQCIARFGTTAGLLLAAAGRLLPRFKIKPDYTHLQREAFPRRAPA
FT                   PYDKDTFTALARTGHREEEPCHLLIGDEALCRDHCLAKFNAPCITFCPAGVYEKIGPQP
FT                   RPANPSNCLHCKTCQRKCPFDNIRWTVPEGGEGPRYTTM"
FT   gene            228824..230449
FT                   /locus_tag="DaAHT2_0198"
FT   CDS             228824..230449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0198"
FT                   /product="Na+/Picotransporter"
FT                   /note="PFAM: Na+/Picotransporter; KEGG: dat:HRM2_10550
FT                   putative Na+/phosphate-cotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84909"
FT                   /db_xref="GOA:D6Z627"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z627"
FT                   /inference="protein motif:PFAM:PF02690"
FT                   /protein_id="ADH84909.1"
FT                   /translation="MGILEQLDIWRLLAGLGIFLFGMYMLEESIRLLAGRAFKSLIRRY
FT                   TGTRLRGIVAGAVSTSILQSSSAVSLMVLAFTGAGLMTLVNAQAVMIGAMVGTTMTTWI
FT                   VAVFGFKIKIEAFALPMIAVGGLGLILSANSPRYVNLCKLLVGFGFLFHGLDFMKSSVE
FT                   GVAAAIDIAALPDLGLWIYLLAGLLMTVIMQSSSATNAITLTMLFSGVVDFSGAGAMVI
FT                   GANVGTTVTVLIASLGGIAVKRQAALGQLIYISTTALVAYTLLPLLTWLVLEQFRFADN
FT                   PVLGLALFHTLYNVVGVMVFFPLIPRVTAFVRRRIPEPVPLHLTLYITKTSPEVPEAAI
FT                   EALRKEAINQARCSMDFVRMIYGIDPKGRTRGRVTYDDLERMHAEIFTFYARIQTQQME
FT                   EAEARRLEPYIRASRSIMNATKNFFEQNQEIDELRREDQRFMHEAWQRFLARLQNIGKL
FT                   VENIGEEPEVDHTALLEQSFAAVEEEDRNFIRACATEVASRRLQENEVTRLLMSNRLFT
FT                   QSCRMLVLSLQSLNLAVAAPEQET"
FT   gene            complement(230512..230952)
FT                   /locus_tag="DaAHT2_0199"
FT   CDS             complement(230512..230952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_1385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84910"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z628"
FT                   /inference="similar to AA sequence:KEGG:Sfum_1385"
FT                   /protein_id="ADH84910.1"
FT                   /translation="MQIKDPNLHLKLQEMCDCYLDTDYAVELARMAAGPESEPEENAVK
FT                   YLALAIMYGITEKADKLKLKRDKDGSIEAELKGEQKIKLPAPAGSVWEGMVATIRRILH
FT                   FDQEGGELPLALGLRAGSLDLKVKLKEKGDKSSLTIAFPSWK"
FT   gene            complement(231007..231363)
FT                   /locus_tag="DaAHT2_0200"
FT   CDS             complement(231007..231363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0200"
FT                   /product="sulfur relay protein, TusE/DsrC/DsvC family"
FT                   /note="KEGG: tye:THEYE_A0985 dissimilatory siroheme-sulfite
FT                   reductase, gamma subunit-like protein; TIGRFAM: sulfur
FT                   relay protein, TusE/DsrC/DsvC family; PFAM: DsrC family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84911"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z629"
FT                   /inference="protein motif:TFAM:TIGR03342"
FT                   /protein_id="ADH84911.1"
FT                   /translation="MAQLTYSGGSVEIDDQGFLVNLEDWTEEVARAMAAREGIEQLDEE
FT                   MMEVIRFMRSYYMKFKAFPILNYVCKNVDQPRNCVSDEFINPEKAWKIAGLPKLAGVHF
FT                   ISTDGQHYIMEPPT"
FT   gene            complement(231456..232307)
FT                   /locus_tag="DaAHT2_0201"
FT   CDS             complement(231456..232307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0201"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   beta subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, beta subunit; KEGG: drt:Dret_0516 pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase, beta subunit; PFAM:
FT                   thiamine pyrophosphate protein domain protein TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84912"
FT                   /db_xref="GOA:D6Z630"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011896"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z630"
FT                   /inference="protein motif:TFAM:TIGR02177"
FT                   /protein_id="ADH84912.1"
FT                   /translation="MTTIEDYGKYETAWCPGCGNFGILNALKQALVNCDLPPHRVLLVS
FT                   GIGQAAKAPHYLRANVFNGLHGRSLPAAIGARLANPELTVIAESGDGCLYGEGGNHFLA
FT                   ALRRNLDLTILAHDNRVYGLTKGQASPTSQQGMVTKTQPHGAFPPPFNPLAVAVTMGAS
FT                   FVARGYAGKLEQLSELISKAIKHRGTALVDILQPCVSFNKINTFQWYQEHCYELPPEHD
FT                   PTDRDQALRVALEFGENLPLGIIYQTQRPLFEEQFTPLKHGPLARQEVSRPKLEEIMQQ
FT                   YR"
FT   gene            complement(232318..234015)
FT                   /locus_tag="DaAHT2_0202"
FT   CDS             complement(232318..234015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0202"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; Pyruvate/ketoisovalerate oxidoreductase;
FT                   KEGG: dvm:DvMF_0184 pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84913"
FT                   /db_xref="GOA:D6Z631"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z631"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ADH84913.1"
FT                   /translation="MSQDIQILIGGEAGQGLVTIGQLLAKALVRSGREIFTSQSYHSRI
FT                   RGGHNTFALRVGPAPLAASRDNIDILVALNAETVELHQAQLTQRALIIADANTAPNTAG
FT                   AIPVPFAQLGPEKLWNTAALALLGQILGLPTEPLQQAVDEMFGHKQAEVLAENRKVMKK
FT                   SREWAGQHVPEHPFTLADRSTGAAKRLLLTGNQAIALGALAGGLKFCAFYPMTPATSIV
FT                   IELISHADTMGCIVEQAEDEIAAINMAIGASYAGAPAMVATSGGGFALMVEGVSLAAMT
FT                   ETPVLVVVGQRPGPATGMPTCTEQADLEFVLHAGHGEFPRAILAPGSIEECWSLTARAL
FT                   GLTEHTQSPVFLLTDQFLADSSRPVTPFDGDTVTPVRAGSDPQKVVPPYRRYYLTPDGL
FT                   SPRLLPGLSEHLVVADSDEHNEEGHLSEDYGLRKAMVEKRLGKLELLKRQALAPTLNGA
FT                   RGAELLLVCWGSSLGPVRETAEILRGQGQEVATLHFSQVWPLVPEQFLDILQAAGQVVC
FT                   IEGNATGQFARLIRRETGFAIDRRINRYDGLPFTAGYLLEHLEKSAAA"
FT   gene            complement(234034..234330)
FT                   /locus_tag="DaAHT2_0203"
FT   CDS             complement(234034..234330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dba:Dbac_1195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84914"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z632"
FT                   /inference="similar to AA sequence:KEGG:Dbac_1195"
FT                   /protein_id="ADH84914.1"
FT                   /translation="MKRQVEMQESMLRAHRDFIDNLEKSVELVARDLEDAKSVAQICTD
FT                   EWCAAAEETLDELAKLVFSISEPRWLTNEDSKKISALRRRIHDLYAQYKAVKK"
FT   gene            complement(234578..234826)
FT                   /locus_tag="DaAHT2_0204"
FT   CDS             complement(234578..234826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dol:Dole_0216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84915"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z633"
FT                   /inference="similar to AA sequence:KEGG:Dole_0216"
FT                   /protein_id="ADH84915.1"
FT                   /translation="MATKEELCSKIKEVFPDIGACGIDVEVDYDDTNKAWVVDLKKDQH
FT                   ELKTFLEEPEAQQCMEGKQCVSLGLQIAELRRNIDQL"
FT   gene            complement(234959..235318)
FT                   /locus_tag="DaAHT2_0205"
FT   CDS             complement(234959..235318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_3127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84916"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z634"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_3127"
FT                   /protein_id="ADH84916.1"
FT                   /translation="MSDSVYPTAEQPRTTTAKIVYILYLAGIIIGLTAVIGVVIAYINR
FT                   TEAPAWLASHYRFQIRTFWIGMLYLLLGSILATVVVGWLLVLFWLIWLIVRCAQGMRYL
FT                   DRHEPLPNPTTWWFN"
FT   gene            complement(235315..235938)
FT                   /locus_tag="DaAHT2_0206"
FT   CDS             complement(235315..235938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0206"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="PFAM: cytoplasmic chaperone TorD family protein;
FT                   KEGG: dsy:DSY4133 uncharacterized component of anaerobic
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84917"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z635"
FT                   /inference="protein motif:PFAM:PF06192"
FT                   /protein_id="ADH84917.1"
FT                   /translation="MQNFADEQQQARRAYIYRILSAMYYSPAAELLEMLENLPAALEAT
FT                   YPSLAPYAVDLLIEFKEQPADSTNLKVEYARLFVGPGTLVAAPYGSVYLDEGRKLMGET
FT                   TMNALEHYQAVGLKANKESNQPPDFIGTELEFMFFLGHCYLQSQNPDFIERQRSFLGQH
FT                   PALWIEPFTEAIIAHSTAEFYRLLATLTQQFILTDMQALQLANQ"
FT   gene            complement(236293..236592)
FT                   /locus_tag="DaAHT2_0207"
FT   CDS             complement(236293..236592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0207"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: gur:Gura_2538
FT                   rhodanese domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84918"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z636"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADH84918.1"
FT                   /translation="MRYKFFTILLATSICLLLAATAGARAWISDLSTEELKQRMDEPRR
FT                   IVVVDTRTEQEYRQGHISGAINISSQASNQFQDIARLLPDDKEVPLVFYCRGFD"
FT   sig_peptide     complement(236512..236592)
FT                   /locus_tag="DaAHT2_0207"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.862 at
FT                   residue 27"
FT   gene            236754..237545
FT                   /locus_tag="DaAHT2_0208"
FT   CDS             236754..237545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0208"
FT                   /product="protein of unknown function DUF980"
FT                   /note="PFAM: protein of unknown function DUF980; KEGG:
FT                   tbd:Tbd_0769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84919"
FT                   /db_xref="GOA:D6Z637"
FT                   /db_xref="InterPro:IPR010384"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z637"
FT                   /inference="protein motif:PFAM:PF06167"
FT                   /protein_id="ADH84919.1"
FT                   /translation="MGLWRWWKRWRRTRLLHRRALPAEVWEAACRHPPELFTGLSAEER
FT                   ARLRRLVTLFLAEKRFYGARGLQLTPAMRAAIAAQACLPILNLDLDCYRGWTSIVVYAD
FT                   TFVAPREETDEDGIVHSGSEVLAGEAWDGGPVVLSWADCARGSYPHGPASNVVIHEFAH
FT                   KLDMLSGAVNGMPLLPRGVSREAWAAALGGGYEQLRGELERGEEPALDEYAAEDPGEFF
FT                   AVISEYFFMAPLYLQHYLPAVYEQLTLYYRQDPAARQQRST"
FT   gene            complement(237634..238788)
FT                   /locus_tag="DaAHT2_0209"
FT   CDS             complement(237634..238788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0209"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: geo:Geob_3773 peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84920"
FT                   /db_xref="GOA:D6Z638"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z638"
FT                   /inference="protein motif:PFAM:PF01546"
FT                   /protein_id="ADH84920.1"
FT                   /translation="MPAKNEQPQRQPTLDHCHLDELLRNLIDIYSPSGKEEDIQLYLEE
FT                   VLRGAGLIVQRQEVEEDRYNLVVPLSPQAPKLYLVGHVDTVAARDLDEYEAREEDGLIY
FT                   GLGSADMKGGCAAMVEAFLTLARDLPPDRRPPVGLLLVVGEEENGEGSAAFIESCRQAT
FT                   PPWVVIGEPTGLTPNFAHYGYLEAYLLTRGRRTHSSLPELGHNAVESMLRVLLHLGRDP
FT                   LFDRGSSNIVYSIREMTSSRAGFVVPDHCETWIDLHLPPHTDPAEVEQVLRARADEAST
FT                   LIPDLDLELTCDLAAPGYSLELDNPLALRLQEIYRHRQLPWRCDAFRSHSDGNLFHQAG
FT                   IKPVILGPGALEVAHTSEEHTTLGEVIKAAEIYLDLCLAADNFL"
FT   gene            complement(238772..239356)
FT                   /locus_tag="DaAHT2_0210"
FT   CDS             complement(238772..239356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0210"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pca:Pcar_0274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84921"
FT                   /db_xref="GOA:D6Z639"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z639"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH84921.1"
FT                   /translation="MTVPTSFDSNNPVTDHEMPDAVLREQLQSSLCIREMTIDDLAEVF
FT                   HIGETVFTAEYSPSLYRTWDEYEVTSMFNTDSQLCLVAESAGRTVGFALGTTVEKQHSA
FT                   WKYGYLVWLGVCPRSQKLQVGERLFREMKRRMKAQGVRMIIIDTSADNHAAIHFFSKLG
FT                   FDHPQEHVYMTLNLATPKKKRRKKKKNAGKK"
FT   gene            239550..242075
FT                   /locus_tag="DaAHT2_0211"
FT   CDS             239550..242075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0211"
FT                   /product="protein of unknown function DUF342"
FT                   /note="PFAM: protein of unknown function DUF342; KEGG:
FT                   gym:GYMC10_4161 protein of unknown function DUF342"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84922"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z640"
FT                   /inference="protein motif:PFAM:PF03961"
FT                   /protein_id="ADH84922.1"
FT                   /translation="MTSGEEDRPEENRTAAGETAETPFLIRIRADRMAVDLEVRAPLAP
FT                   GQELSVEQIKEELGQRGVVFGFDDRSLAAAILELAGQPQGTGVVRLADGQAPVAGGVGS
FT                   LEYLVGPTAAGHDPETHDLVRPGQVLVRKIKASPGQPGRDVFGEELPAPAGKEPVLAAG
FT                   EHVRLAGEDDTEYQAELYGRARLEGDRIDVEPLVEVAPDGMSAWVPIYPRLADNSALAY
FT                   EHLEHSLQAAGVVHGIREEALRGVLEQQVVVPRMLAARGDEPEAGQDARVSFEFFLNDD
FT                   DPVRVDAARRAGTLPPGPVRKTLRLKGEVLAVKTPPVAPVAGCKVTGEIIAGREGRDWE
FT                   LTAGENVAVGDEARVFFVADQLAAGYPDYQDGTVWVSDPLQVSDDAMVAYLQVHPPGRA
FT                   ERGFSGEQILQLLAAHGVTRGVRKQHIRRAVEYAAAHRRVLPRIVAARGRLPEDGRDAT
FT                   IEVLVQAGQKPGLIVEPTENIDFRERNTINSVRRGDLLARRTPPGPGVDGWTVRGETIA
FT                   AKPGADLQFQPQPNVVISEDGLELLAGVDGMLTVLAPNKIAVLEIYEVKGDVDYRVGNL
FT                   DMVGALLIAGWIRPGFTVKASGDIRVGGGVEDAKLIAGANVEIKGGMVSRGKGKIKAEI
FT                   DVVARFLEWTRVHAGGNIVIHDQVMRSQVFAGGTLTVTAGKGRIRGGVCSAIQGIVANE
FT                   IGSPAGVRTVVMAGANPALRRRLLQVDRQMAEYARQKAKMDTVLGRYLKHGRGAGLPPE
FT                   VQRKLSLLAKQRRAVVQAEKRLARPREEMARQLAAIDLNKIRIVARKAVYAGTMVIIGT
FT                   SRYKVREDLLRPVTFMVDPSGREVKTLDD"
FT   gene            242150..242554
FT                   /locus_tag="DaAHT2_0212"
FT   CDS             242150..242554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0212"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   cph:Cpha266_0178 signal-transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84923"
FT                   /db_xref="GOA:D6Z641"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z641"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADH84923.1"
FT                   /translation="MIDIKKLRVRDLMQTSIQTIERTATLAEAARWMAENNCASPVVLP
FT                   LDDSDAYGIVTRKDILNIMVMEVHDDFVTQIGDIMTKPAITVGPALSLENCLLLMRSTG
FT                   TRRLPVVEGDKLVGMISNTDIFNRLVSELD"
FT   gene            242573..243352
FT                   /locus_tag="DaAHT2_0213"
FT   CDS             242573..243352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_2782 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84924"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z642"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84924.1"
FT                   /translation="MSAKQKSLDNILADEVKQEIAGRYFGFRKLIEEDTQDYTQKIRRH
FT                   SVILEKRISFDLIRLYLLLGREELIQQFLQLAGLKERLFFDPYLLESPTIQQRVFECQR
FT                   FKGWTRKGRFVRYSLTCYDNLAFHVKLYHQKLQELANDRYNIMATIEAFYEQNNISAIL
FT                   AFLRSLGDDHSTGAMQGDKEIGLAEGLDEKLKINPPAPLEQMLPLIKPLPPMVDLKRPL
FT                   RRLFKQAYLLQKPEIISLFDAHSTPCPERDYALKTDR"
FT   gene            243540..243785
FT                   /locus_tag="DaAHT2_0214"
FT   CDS             243540..243785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0214"
FT                   /product="zinc finger/thioredoxin putative"
FT                   /note="KEGG: ade:Adeh_4191 zinc finger/thioredoxin
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84925"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z643"
FT                   /inference="similar to AA sequence:KEGG:Adeh_4191"
FT                   /protein_id="ADH84925.1"
FT                   /translation="MKKQSLILSLLLAGGLMLAAGAGCQRADEQEQPPAATYDEPSPGI
FT                   YAAPEEDAPPAREPEPAAPAYGAPPAEPAPSGGYGL"
FT   sig_peptide     243540..243623
FT                   /locus_tag="DaAHT2_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.917 at
FT                   residue 28"
FT   gene            243883..245334
FT                   /locus_tag="DaAHT2_0215"
FT   CDS             243883..245334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0215"
FT                   /product="L-seryl-tRNA selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="TIGRFAM: L-seryl-tRNA selenium transferase; KEGG:
FT                   dps:DP1691 selenocysteine synthase; PFAM: Pyridoxal
FT                   phosphate-dependent transferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84926"
FT                   /db_xref="GOA:D6Z644"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z644"
FT                   /inference="protein motif:TFAM:TIGR00474"
FT                   /protein_id="ADH84926.1"
FT                   /translation="MTRSPSAAADSHSLLRAIPKVDEAVSWLASELEDPGAAESAWAVV
FT                   PPRLMKNVVREVLAEYRRRILAGDNPSLAELAREGLLPRLKERLAGRLQPNFRPVINAT
FT                   GVVVHTNLGRSLLPAAASANLAAVACRYSNLEYDLHTGRRGSRYSLVEDLLLELTGAEA
FT                   ALVVNNNAAAVLLVLQTLAHGREVIVSRGQLVEIGGSFRIPEVMARSGARLVEVGATNR
FT                   THRRDYEQAIGEETALLLKVHTSNYRISGFTSEVAAEELVDLARGYRLPVMEDLGSGSL
FT                   LDFSRYGLTKEPTVQEVLAAGVDVVTFSGDKLLGGPQAGLILGRRELIEQIKKNPLNRA
FT                   LRIDKFTLAALESVLRLYFDEEQACREIPTLRMLTSPYQEQRRRAQRLRRRLRGLPAAC
FT                   CELELVRVNSRVGGGALPEMPLPSCALALKPQRMSLNRLEQALRAAPVPVIGRIEDDRL
FT                   LLDMRTVADAEVAELASVVQEVLGT"
FT   gene            245399..247138
FT                   /locus_tag="DaAHT2_0216"
FT   CDS             245399..247138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0216"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; KEGG: dps:DP1692 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84927"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z645"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ADH84927.1"
FT                   /translation="MGFLLFQPESDHWQDPITGLPGAVALMAELTAWSGPAATEEPRGE
FT                   GDFLLLLEVYPQARNAAGGIKALRRAGDYLQSLFAAATPLYALGMGVFALLWPGVGPEN
FT                   ARHMADMLLRRLQREDFPRAQAGLVAIGRGGRQSEAEVLDEAWRALAVARRRGPFGLCV
FT                   AGSERVFPPLAAADRAKLSRLWRGRDCFALLLIRQDQVALSNHFSKRVRAALEPETPAL
FT                   FLNQREVLVYLDGAGEAEAEEWFQGFRRRMLAAGGSTFSAGIALYPCLNFRKSQIPINC
FT                   RKAVRHAELLGPESVAVFNAVSLNVSGDAYYNEGDLRKAVGEYRLGLTLQPASVNLLNS
FT                   LGVALVQLKQVRPALAAFEKALQVEPENFMALCNLGFAHLSADREGMALDFFERALAVE
FT                   GRSFDLLLQLGKLYCRHRKYREAVELLNRCVDDPRIEERRNGDLAAAHRLLGRALMALE
FT                   QYRPAMTAVQKALTFNPRDAQAMSLLGELYLHNGQGGEIAHSLCRQAVELDAGRSESWR
FT                   RLGWVQWQLGLPAEAAASLEHCLHLNRRDHWATAWLGEILAQQGQARRARHLQARARRL
FT                   AAA"
FT   gene            247194..247880
FT                   /locus_tag="DaAHT2_0217"
FT   CDS             247194..247880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   dal:Dalk_2693 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84928"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6G9"
FT                   /inference="protein motif:PFAM:PF03641"
FT                   /protein_id="ADH84928.1"
FT                   /translation="MMKITRAGVVDERQQYSLDNFKAGDSWRMFRILGEFVDGFDTLSS
FT                   VGRPAVSIFGSARTPMEDKYFELADKIAYELAMAGYAVITGGGHGIMGAANRGAAKADG
FT                   ISIGLNINLPFEQEPNGFANVPLHFKYFFVRKVMFIKYSMAFIGMPGGFGTLDELFESL
FT                   TLMQTRRIKAFPVILVGSEFWGGLVDWIKEQLLVTGKIDPDDMLYFQVMDDPAEVVKYI
FT                   KRTVVL"
FT   gene            complement(248028..249383)
FT                   /locus_tag="DaAHT2_0218"
FT   CDS             complement(248028..249383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0218"
FT                   /product="protein of unknown function DUF945"
FT                   /note="PFAM: protein of unknown function DUF945; KEGG:
FT                   dba:Dbac_1050 protein of unknown function DUF945"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84929"
FT                   /db_xref="InterPro:IPR010352"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6H0"
FT                   /inference="protein motif:PFAM:PF06097"
FT                   /protein_id="ADH84929.1"
FT                   /translation="MPAPKPKKLLRLWLPLIAGAALLAIAAAAYFIGLQAEQHFARSVA
FT                   RLNDQHRFQLELVSYQRHLFTAQAVTRLHQQQPPAAAEQLEEEAQQMVHHLQHGPLPLL
FT                   WGFSAQSPRPSLRPLLAAINSRLLSPAGTGREELLQAHTIVTFGGLIRSRFRLAAGQQQ
FT                   DPDTHGLTLIWQELAGELVVPVNLEKLEGKLSTAGLTLAGPAGSETTARVLELKGVELD
FT                   FGYQQQRDDQDGITLQAQQRLELAAINSAGEQYGPLRLALHWHNLDRQAAGDMLRLTPW
FT                   WQRLLLGPNGSQMPPATAQNMVETLARLLAKSPAVEINPLQLATPHGEAEARLHMAYRH
FT                   RANGRPFHPIMLLSGLQLNIEANAPERLLTALSSDYQLWRQAPAESSAEDSTTADQAVT
FT                   KSSDPLAGLHQRGYLNSDPDSNQVSFQLRYQNGELTINDRPAPLQALRHLLR"
FT   sig_peptide     complement(249303..249383)
FT                   /locus_tag="DaAHT2_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.515 at
FT                   residue 27"
FT   gene            complement(249428..250555)
FT                   /locus_tag="DaAHT2_0219"
FT   CDS             complement(249428..250555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0219"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   ana:all2040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84930"
FT                   /db_xref="GOA:D6Z6H1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6H1"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADH84930.1"
FT                   /translation="MNTESVTKPEPSAAAVAAFFTEPENIISAEPYGTGLINDTYLIRC
FT                   RAGEDFLLQRLNPEVFPQPTKLLDNIRRISSHLSNKARTTKLAPGQPILHLLPTREGAD
FT                   CCYDRENDCWRALNFIGESRVLPRITSEAQAQGAGLALGRFQALVNDFPPAELYDPLPT
FT                   LHVTPCALRAYDQLAAAYHGSGAGGPKAEISFCHDFIERRRHTAAVLEQARARGILPER
FT                   VIHGDPKLANILFAQYSDHPLALIDLDTVKPGLTQYDVGDCLRSCCNRAGENPANPDEV
FT                   EFDLDLARALLTGYLEEMRALLTYSDFSYFYDAARLISFELGIRFFSDYLDGNRYFKVT
FT                   DPEHNLHRALTQFRLTASIEDQEELLRLIINELTW"
FT   gene            complement(250720..251280)
FT                   /locus_tag="DaAHT2_0220"
FT   CDS             complement(250720..251280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0220"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC100274294"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84931"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6H2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84931.1"
FT                   /translation="MAGPGTPFNGYFLPATQVLTVCGKRWLNFDGLAKTRQTSWSVTRK
FT                   QLVTKRAQSAARLFATPTILVTWHAARPGAGHRAKPGSAATPPPPEPTAGTATRSPWAP
FT                   ATWVVPATRKNLPWLCLTPATAPPTAHHPGRNWCITARYLPTRSATGPGNAKKHGCSSG
FT                   CIPGKATVFVHLFPNTTSGSPPI"
FT   gene            complement(251223..252863)
FT                   /locus_tag="DaAHT2_0221"
FT   CDS             complement(251223..252863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0221"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: Stage II
FT                   sporulation E family protein; PAS fold-4 domain protein;
FT                   ATP-binding region ATPase domain protein; KEGG:
FT                   tme:Tmel_1711 putative PAS/PAC sensor protein; SMART:
FT                   protein phosphatase 2C domain protein; PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84932"
FT                   /db_xref="GOA:D6Z6H3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6H3"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH84932.1"
FT                   /translation="MNKMILDNIEHPTEKRPGYLSSGGESSLTYSAPQILQAISDGVYV
FT                   TDRQRRIVYWNQAAERITGWRAEEVLGKSCYDNILCHVDKDGHRLCGEEYCPLHRAMRT
FT                   GRASEAPSLVFAQDKSGRRVPVMVNVSPIVDGQGKVIGGVEVFRDYSAQIHDQERARKI
FT                   QSLSMQLPTGETPGLNLAVKYLPHGVLGGDYYTMERLDEHRYAFCIADVMGHGTAAGLY
FT                   AMHLHSLWENNRRFIDRPATFVSSLNRNLCSLVRDGESFATGLFGIIDLRAEALALCAA
FT                   GSPSFILHRGGQGRQIRLSSLPLGLVEDHVYEVTFLPLEPGDGLLFYTDGLIEASNQQE
FT                   EMLGSEGLLAMLNQLDFPTDEEDMDQLVKKVLRFSNQIRFADDVTLLAMQYTGRYGNPA
FT                   FPSPEEQAKLAGEVTLLPNNFRDIDEVVESCWNRIKEVISQQGFGPLEVNIHMALAEAI
FT                   INAWKHGNRGNQHQPIIFRWCFNHNFTFEVLDQGAGFNYHNLPDPTEGERKVAECGRGI
FT                   FIIKTLANAVQWRDQGRHLTVTFSLQPKS"
FT   gene            complement(252879..255527)
FT                   /locus_tag="DaAHT2_0222"
FT   CDS             complement(252879..255527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0222"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; KEGG:
FT                   pmx:PERMA_0989 signal transduction response regulator;
FT                   SMART: EAL domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84933"
FT                   /db_xref="GOA:D6Z6H4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6H4"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH84933.1"
FT                   /translation="MVEKILARYRFLHEIIVRPFSSSLRAFLFSRFIGVTLAIFLMVLG
FT                   TATYFYDRLLSQQAQAAAEGIAAQTYTIINNLMPHGISREQLETVLDEIKAAHRDTPYQ
FT                   IEVYRSPLVSEIYGEIEQRIPFQATEKALAPGYGRKFTIENHTSTRHLYALTVEDQACL
FT                   TCHPNAEIGSVLGIVEVKQSIRDMVARMRSDYLWVFVFYGGLAVALVVGITTLVINRVS
FT                   STVEDFRRKTQEIKTVTDLPAISRLSRAEVGFSELNEAFQAVGELAERLHDVAVDKDIL
FT                   EFEIKILNKFIITSNVVQDWQLFVKELLLDINNILDTYALLAFFQEGENEYELDVFWRA
FT                   TPSYETRNELEKLVQGQIYNQFQLASDSPAVRIVHHDCGSPVPLPKSLSLKDIELRTKS
FT                   LFLDAPKVGGIVGIGVQSNMVMDSIYHIVLDSVLATLLNLVGSVKAIYKYTKDLEYYAT
FT                   RDPITQLHNQRMFWELLGYEVGRAQRHDYSFSLMVIDIDNFKTINDRYGHAFGDLFLQQ
FT                   LAEALRQAVRDGDFIARYGGDEFTVLLPTTTREQTISVAERIVKAISGMSVLTAEGIKV
FT                   QATVSLGIAMFPEHGKSAKDLFLVADNMMYKVKGEGKNAIAEPEEAEITEIFKEESKTN
FT                   FRVYQALEEKSIIPYFQPILDLATGEVEAHEVLMRIPADDGSMIAASDFIQAAGRIGLL
FT                   HKLDHLLMEKTFAVVAKQNYQGRLFINLSPKSFIFPEFFPKIQKLSQEYNIDPHRVIFE
FT                   VTERDTIRNVAMLKKFVTMMKAEGYRFAVDDFGSGYSSFKYLKLFPIDFLKIEGDFIRN
FT                   ILDDRDYMAYTKSIVTLARELGIKTVAEYVEDEKIINACRDLGVDYGQGYYIGRPAIGF
FT                   SKLPARPADQQ"
FT   gene            256015..256353
FT                   /locus_tag="DaAHT2_0223"
FT   CDS             256015..256353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0223"
FT                   /product="hydrogenase expression/synthesis HypA"
FT                   /note="PFAM: hydrogenase expression/synthesis HypA; KEGG:
FT                   app:CAP2UW1_0730 hydrogenase nickel insertion protein HypA"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84934"
FT                   /db_xref="GOA:D6Z6H5"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="InterPro:IPR020538"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6H5"
FT                   /inference="protein motif:PFAM:PF01155"
FT                   /protein_id="ADH84934.1"
FT                   /translation="MHEMSLAINIVALAEAECRAAGAGRIRRVEVEVGGLAGVMPEALR
FT                   FCFAAACRETMAEGAELEIIVVDGQGECASCRRPAPMAEHFALCPACGGLMRPLQGQEL
FT                   RLAAIEVD"
FT   gene            256453..257280
FT                   /locus_tag="DaAHT2_0224"
FT   CDS             256453..257280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0224"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /note="KEGG: cpc:Cpar_1639 hydrogenase accessory protein
FT                   HypB; TIGRFAM: hydrogenase accessory protein HypB; PFAM:
FT                   cobalamin synthesis protein P47K"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84935"
FT                   /db_xref="GOA:D6Z6H6"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6H6"
FT                   /inference="protein motif:TFAM:TIGR00073"
FT                   /protein_id="ADH84935.1"
FT                   /translation="MCDDCGCGPGAEGVSYTLAGKKAGPGTRHGAGHHHHHGRQDGGGA
FT                   DDGAAAGRRLQVARDVLAYNNQQAEHNRQHFKACRVLALNLVSSPGSGKTTLLEQTIRR
FT                   LGGARPVAVIEGDQQTLLDAERIEKTGVPVVQVNTGAGCHLDAAMVHRALHELELADDS
FT                   LLFIENVGNLVCPAMFDLGEAAKVVIISVTEGEDKPLKYPAMFAAARLCLINKIDLLPH
FT                   LDFDLAKCREYARRVNPDLQFIAISARSGEGMEEWLAALANLAATDPEGARAG"
FT   gene            257350..259935
FT                   /locus_tag="DaAHT2_0225"
FT   CDS             257350..259935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0225"
FT                   /product="(NiFe) hydrogenase maturation protein HypF"
FT                   /note="KEGG: cpc:Cpar_1638 (NiFe) hydrogenase maturation
FT                   protein HypF; TIGRFAM: [NiFe] hydrogenase maturation
FT                   protein HypF; PFAM: SUA5/yciO/yrdC domain; acylphosphatase;
FT                   zinc finger HypF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84936"
FT                   /db_xref="GOA:D6Z6H7"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6H7"
FT                   /inference="protein motif:TFAM:TIGR00143"
FT                   /protein_id="ADH84936.1"
FT                   /translation="MLTRWSLALGGLVQGVGFRPFVYRLARQHALAGRVCNSAAGVEIE
FT                   LEGPRPRLVAFLDDLQRQAPPAAVIEHLERRELPPVGEQGFVIADTQCGGPPVAGVVPD
FT                   LAVCADCLAEMLDPADRRYLYPFINCTNCGPRYTIIEKIPYDRPHTTMRVFTMCRRCQA
FT                   EYDDPASRRFHAQPNACPDCGPALALVSLNQQRQDKAPPPLAAGPSAVAETRRRLLAGE
FT                   IVAIKGIGGFHLAVNGADQAAVKRLRRRKGRPDKPLALMVRDLATARGLVQLGPMEENL
FT                   LVSPARPIVLALRQAAALPVAAAVAPGNRRLGLMLAYAPLHHLLLDSELPLLVMTSANP
FT                   SSEPLCIDNDEACRRLSSIADAVLLHDRAIVRGNDDSVIMQGPVKVIGCGTGVGAANPG
FT                   SGSFSAGILPASEVPAASCASMRPAAGKPAATGIGAPRPSSTLTLPWVIMAGNDRHPGA
FT                   APLVIRRGRGYAPGLLPFSHRGAAVLAVGGELKNTVCLAADGRAVISQHLGDLQNLESY
FT                   RVFGQTIADLSQLFAIQPQVVAYDLHPDYLASRWARQWAAEQGLPAVAVQHHHAHLAAC
FT                   LAENEHQGPALGLILDGTGYGPDGSIWGGEILLGDAGGFSRWGHLETMPLPGGDLAVRQ
FT                   PWRAALGFLYQAFAGDIPPLPFLAELQAADKVDWQALLPPLRQNINCPRTSSCGRLFDA
FT                   VAAMAGGCQKISYEAQAAVELMQAADGLQGPPFAYRLIENKVTEYGFHGAGGPGVLMQL
FT                   SPLVCEVAAAVSAGAGLTEISRRFHATLVDMFTAALVTAATATGIKTVALAGGVMQNEV
FT                   LLAGLKDSLAQAGLAAMLPRRLPSNDGGLAYGQAVVAATVSEQPHRIFG"
FT   gene            260253..260552
FT                   /locus_tag="DaAHT2_0226"
FT   CDS             260253..260552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0226"
FT                   /product="hydrogenase assembly chaperone hypC/hupF"
FT                   /note="KEGG: cts:Ctha_1825 hydrogenase assembly chaperone
FT                   HypC/HupF; TIGRFAM: hydrogenase assembly chaperone
FT                   hypC/hupF; PFAM: hydrogenase expression/formation protein
FT                   (HUPF/HYPC)"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84937"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6H8"
FT                   /inference="protein motif:TFAM:TIGR00074"
FT                   /protein_id="ADH84937.1"
FT                   /translation="MCLAVPGKVVEIFEENGLKMGHIDYAGAISRACLEYVPEIRLGDY
FT                   TVVHAGFALSILDEEEAAKSFAAWRELQAAAAREGVDLFGRPLADADADADEQE"
FT   gene            260560..261648
FT                   /locus_tag="DaAHT2_0227"
FT   CDS             260560..261648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0227"
FT                   /product="hydrogenase expression/formation protein HypD"
FT                   /note="KEGG: cts:Ctha_1826 hydrogenase expression/formation
FT                   protein HypD; TIGRFAM: hydrogenase expression/formation
FT                   protein HypD; PFAM: hydrogenase formation HypD protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84938"
FT                   /db_xref="GOA:D6Z6H9"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6H9"
FT                   /inference="protein motif:TFAM:TIGR00075"
FT                   /protein_id="ADH84938.1"
FT                   /translation="MLKHLDEYRDPALARKLLAEIAAVTTRPWVIMEICGGHTHAIIRH
FT                   GIDLLLPRQLELVHGPGCPVCVTPVALIDQALALARRPEVIFTSFGDMLRVPGSRESLA
FT                   RIRARGGDIRTVYSPLEAVNLAVQNPAQEVVFFAVGFETTAPGNALAVQQAARLGLTNF
FT                   SLLVSHVLVPPAIGALLAAPDNRIQAFLAPGHVCTVEGLQDYEAMAAAHQVPMVPAGFE
FT                   PVDILAAILLLVRQLEEGRAQVENEYRRSVRPEGNPAARLAVEQVFQVCHRTWRGLGEI
FT                   PASGLRLRPEFAAFDAQCKFALEETGEMESPQCISGAILRGESKPPQCPAFGKECTPEH
FT                   PLGATMVSSEGACAAYRHANRQ"
FT   gene            261667..262785
FT                   /locus_tag="DaAHT2_0228"
FT   CDS             261667..262785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0228"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /note="KEGG: cts:Ctha_1839 hydrogenase expression/formation
FT                   protein HypE; TIGRFAM: hydrogenase expression/formation
FT                   protein HypE; PFAM: AIR synthase related protein domain
FT                   protein; AIR synthase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84939"
FT                   /db_xref="GOA:D6Z6I0"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6I0"
FT                   /inference="protein motif:TFAM:TIGR02124"
FT                   /protein_id="ADH84939.1"
FT                   /translation="MSWQIKPENFGCPLPAADGATVQLAHGGGSRLAAELIEQTLVPAF
FT                   ADPVLSRLEDQAVLESPLGAGERLAFTTDSFVVDPLFFPGGSIGELAINGTINDLAMGG
FT                   ARPLYLSVALIVEEGLELAILRRVIADLGAAAKAAGVRVVTGDTKVVGRGSCDKIFINT
FT                   SGIGAVPAGLALSAANLQPGDKIIISGTMADHGMAIMSCRQGLSFAEPLTSDTAALHQL
FT                   TAAIMAAAGMPPAAPAQKANEPEAGQALRAMRDPTRGGVAAVLTEMARASRVGVVIAEE
FT                   TLPVAGPVRGACEILGIDPLFVANEGKLLAVVAPESAGAVLQAMREHPLGRQAAIIGEV
FT                   VAENPGLVALRTALGPHRIIDLPSGELLPRIC"
FT   gene            262875..264434
FT                   /locus_tag="DaAHT2_0229"
FT   CDS             262875..264434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0229"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; Nitrate and nitrite sensing domain
FT                   protein; histidine kinase HAMP region domain protein; KEGG:
FT                   nis:NIS_0636 hypothetical protein; SMART: GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84940"
FT                   /db_xref="GOA:D6Z6I1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6I1"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH84940.1"
FT                   /translation="MLLGLMTSEFSRYRQQQVVVEELALISELSALVHELQKERGLSTG
FT                   FLAYPEADYRDALLAQQAETDRKLAALGRADGAQAQRLQQELSLLRQRVISGEGAYPAD
FT                   YRHYSWLVQGLLDQVQSQGRRLGLAELKDDLVTHSHLMFAKEYLGRIRATVNHGLRLAG
FT                   EGREKMVEAARLQALFGEYRRLFQLAAAADLAGRLQQVLDTPAAEEVLKAMQASTMAGF
FT                   TELTISSGQWFALATEVIDDLKELEDHSLTLLLHEGEQQLDNLRRRLLIFSQGGLLIGG
FT                   GILVLVIYTLHGMIRSLDHLLAEIGQIGAEEDFGRRLPVAAGHEIGIIARHFNKLLEVV
FT                   ERLLREKDQLAGTDQLTGLNNRRRFKELLDQELIRYRRIPKPLSLLIFDIDHFKRVNDT
FT                   YGHETGDLVLKEMAQLLQATVRRTDTPARWGGEEFLVLLPATTAEAAMALAEKLRQAIE
FT                   EHDFPRVGRVTASFGVAAFHDGEQEESALLRRVDKALYQAKRQGRNRVVNWAAAAKPAD
FT                   LP"
FT   gene            complement(264487..267021)
FT                   /locus_tag="DaAHT2_0230"
FT   CDS             complement(264487..267021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0230"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold domain protein;
FT                   histidine kinase A domain protein; response regulator
FT                   receiver; KEGG: gbm:Gbem_2155 multi-sensor hybrid histidine
FT                   kinase; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS domain containing
FT                   protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84941"
FT                   /db_xref="GOA:D6Z6I2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6I2"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH84941.1"
FT                   /translation="MDNRQPRPKILQALALSGLAALLGLFLWWFHHREAATELAAAHQA
FT                   MAATNSLKTGQIEQWRQERLADAARMSRGLFAEATAAAWLQTPEDQQAVMAVKHRLQLQ
FT                   KAQGYADVLLVNAAGDILLSATGQEETLPEASRRSITAALTTGQVTLSPFFRADDREVY
FT                   LDTVAAVPAAVDPVLLVLRTPARDFFEPLLQFWPETGIDFRTFIIYPYDQELHTLCDCT
FT                   INPDKLAKRDLEAIGVAPAALTELYERQGKFAGNYRDGTPMLADLRLVPDTDWLLVTSR
FT                   PTSEILSETYYRTGLLGLVIVLGLLFTALLQHRRQADFFRRLYHSERTRREAEQEFRTT
FT                   LYSIGDAVITTDNEGRVRAMNRVAEQLTGWLEDEARGQELPKVFRIINQDSRVTVANPV
FT                   AKVLHEGKVVGLANHTLLISRDGSERPIADSGAPIRDDEGNISGVVLVFSDQTEAHATR
FT                   EALHKSQRLESMGLLAGGVAHDFNNKLAVIIGYAQVLQLRLPPEDPLQGEVGEIITAGR
FT                   RSADLVRQLLAFARKQTINPKLLNINEEIEGTIKMLGRLIGQHITLTWQPGEELWPMYL
FT                   DPGQLDQILANLAVNARDAIGNERPGEIVIATKRVAINEEFCRFCPDASPGQYVRLEVR
FT                   DNGCGMDDDTLGRIFDPFYTTKEIGKGTGLGLATIYGIVRQNKGFMEVFSSPGHGTTFR
FT                   IYLPRFHGPAPENAVTAGAAAELLKAVGQETILLVEDEVSLLNLIHNLLTMLGYHVLPV
FT                   ADPRQALRLADDQPGEIHLLLTDLAMPGLSGLELARRLQAKRPQLKILFISGHPLESFA
FT                   ELQEQGEEINFLQKPFSREELATKVRQVLGRS"
FT   gene            complement(267371..267880)
FT                   /locus_tag="DaAHT2_0231"
FT   CDS             complement(267371..267880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0231"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tye:THEYE_A1251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84942"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6I3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84942.1"
FT                   /translation="MKLVAATLLLLALTAVGNQSCATATGLSTIQVDQPPAAGTYHLLL
FT                   HGCNYTNDPHTIAFFWPTEQPYTFKPYSPAFQFRLLEGLPMADALAQAHDFVNCSPHFD
FT                   TARLRAVTKQPDGIIGYELRPLYVQPSPLLRRDVLQVYYRLLGAQEVRINIIPFTPLDD
FT                   DRNDID"
FT   sig_peptide     complement(267812..267880)
FT                   /locus_tag="DaAHT2_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.633 at
FT                   residue 23"
FT   gene            complement(267905..268606)
FT                   /locus_tag="DaAHT2_0232"
FT   CDS             complement(267905..268606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_00128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84943"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6I4"
FT                   /inference="similar to AA sequence:KEGG:HCH_00128"
FT                   /protein_id="ADH84943.1"
FT                   /translation="MQTMTAEPLFRITYHFHLSATEVVTFNLAFDNAIRLVDEQRYPPP
FT                   DWARLEQHQCPNCSLNSAQAPHCPAALNLAPLVTSFEHLLSHDEVLLEVITQERKISQA
FT                   TTIQRAVSSLMGLLMAASDCPLTTFFKPMARFHLPLASEEETIYRAAATYMLTQYFRNR
FT                   RGLVPDFALEGLNEIYRHIQEVNSAMAQRLRGSSKSDSSVNAIILLDMYAKAMPYAIKQ
FT                   ALEELAYLFTD"
FT   gene            268776..270278
FT                   /locus_tag="DaAHT2_0233"
FT   CDS             268776..270278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gym:GYMC10_5930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84944"
FT                   /db_xref="GOA:D6Z6I5"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6I5"
FT                   /inference="similar to AA sequence:KEGG:GYMC10_5930"
FT                   /protein_id="ADH84944.1"
FT                   /translation="MRILLLGLLALWAGGMLYGYSRRPASGFAVTGPWRQVSQVEFFCD
FT                   LSYERDGRPVLEQRILPAMLAAIARARRFVILDLFLFNDLGGHKVLGQGLQSPVACLTE
FT                   ALISARRQQPDLTVLFLYDEINTGYGSYSEPHLERLTAAGVATVPVDLARLPDSNPLYS
FT                   GLWRTLLQWWKPAGRGRLPNIFAADGPGMKLASYLRLFNFKANHRKLLITEQTALVSSA
FT                   NVHDASARHSNIAFQLRGGIIADLAACEAATARFSGHDFALPPGILPEVSPRPSDSLEG
FT                   EVSTVSEAGEFSGSVPLARLLTESAIGQALLAALDATRPGDRIWVAQFYLSDRRVMAAL
FT                   AGAARRGVTVRLLLDPSRDAFGHDKRGIPNRSSAAWLKARGGDRLAIRWYNTRGEQFHA
FT                   KLALIESSPAGAEEASTGRVTIIGGSANLTRRNLTGYNLESCLEIRAAATAPIAVEVRH
FT                   FFKRLWHNQEGEYLVDYEQYAEKRPLKAAWAAWQEFSGMGTF"
FT   gene            270278..271885
FT                   /locus_tag="DaAHT2_0234"
FT   CDS             270278..271885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0234"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-3 domain protein; KEGG: dat:HRM2_37850
FT                   two-component sensory box histidine kinase/response
FT                   regulator; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84945"
FT                   /db_xref="GOA:D6Z6I6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6I6"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH84945.1"
FT                   /translation="MTAAILLATLLGAGLGGGGAGWYFHRRHRRLCREQQQRTEAALRR
FT                   QLDEVFAVFRAINGGVYVADMETHEILALTGRDRGSFDATVVGSKCFEQAGANLGGPCL
FT                   FCTNRILLDDNGRPAPPVVREFRNPWSNAWYLAIGRAIHWFDGRLVRMEIAINITERKR
FT                   AEEALRCSEQNFRELVENSLVGIMLIQNGEIVFQNPEQQRLLGRLPSSFNLEDFTAVHP
FT                   EDRDKVRESYRKISNGLSPQVDLDFRLYTGGRRDEAGLAWVYCRARPMDFQGRKTILIS
FT                   MMEITRIKELERLLRQQDRMSSLGRVAAGIAHEIRNPLSGINISLTTLRQIYHSPQHRD
FT                   QVEDIFRRLATASAKIEAVVKRVMDFSKPGQLHPRSVSLNEPVAEALELAGVFLSKYQI
FT                   NLEVDLAPALPLCRVDPGQLEQVVLNLLTNSAEAMEAMPREAPRRLKIATRALADGVEL
FT                   LVDDSGPGLAPEVQGEIMDPFFTTKPEGTGIGLNISQRIINDHGGTIEPCVGTLGGACF
FT                   RIFLPAAGRERGNSLPGK"
FT   gene            271962..272399
FT                   /locus_tag="DaAHT2_0235"
FT   CDS             271962..272399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0235"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: dat:HRM2_38190 two-component system response
FT                   regulator; PFAM: response regulator receiver; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84946"
FT                   /db_xref="GOA:D6Z6I7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6I7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH84946.1"
FT                   /translation="MLAQNRDDLFAVLRHLKLLLVEDDELIRDSLALFFANEGCRLEVQ
FT                   ASAEDGLQLVRVREFDVVITDFRLPGMSGLEFLRILQEMQPEAQKILLTAYMNEEVLAE
FT                   AFRLGVHEFIEKPIATEDIEEALARLIRRRSPTRPTLPGGV"
FT   gene            272489..272917
FT                   /locus_tag="DaAHT2_0236"
FT   CDS             272489..272917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0236"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   kol:Kole_1745 peptidylprolyl isomerase FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84947"
FT                   /db_xref="GOA:D6Z6I8"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6I8"
FT                   /inference="protein motif:PFAM:PF00254"
FT                   /protein_id="ADH84947.1"
FT                   /translation="MTQAKSGDSVKIHYTGRLTDGTVFDSSDGREPLGFTIGNGEVIPG
FT                   FEEAVSGMAVGESKNVTIPMDKAYGPRLDQLIIDVPRSQVPPDLNPELDQRLQMSGPNG
FT                   ENVVVKVVDVSDDSIKLDANPPLAGEDLNFDIELVEIA"
FT   gene            complement(273101..275056)
FT                   /locus_tag="DaAHT2_0237"
FT   CDS             complement(273101..275056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0237"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: dal:Dalk_1166 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84948"
FT                   /db_xref="GOA:D6Z6I9"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6I9"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADH84948.1"
FT                   /translation="MLTRLNRTIDPLLDRFTIKQQISAGFILMIGILMLSGLASYIGVN
FT                   FIIRDANEMADSNRLDAELAQREVDHLMWVNQLNTLFTDDSVTRLQVSTDDRQCALGRW
FT                   LYGEGRQQAEKLLPSLAPLLRELEQPHFRLHQSAARIEAQFRPADQHLTNYLRNIKIRH
FT                   LEWLHSVKDALMDPEIGTARVQTDPRQCALGRWLYSSEFRQRRQLTPELASFWQKVEEP
FT                   HTQLHESVVRINELLAENRRQAAIDYFHESTMPAGEATLAAIDDTLAWLDENLAGYQAA
FT                   QATYTRETLTALAEVQSILHRIRKHVGDNLVSDEGLLHTAWGLKIRVSLVILLGLAVGL
FT                   GITWPLTIRLSRTLERAAREVEGSSSQVAVAAQEIASSSQSLSDTAASQASSVEETSAA
FT                   LEEIAAQSAQMVELTEGSEKLMRENIKKSGQSLKALAELTQSMTQIEKDSGQIRSIIAT
FT                   IDSIAFQTNLLALNAAVEAARAGEAGAGFAVVADEVKNLAMKTAQEANQIQQLLDTTVA
FT                   RITSCAGSLKEINQDFDDIVETATTIGDKNSAITEATEQQAKGVQQITEATHESSDATQ
FT                   RIAAAAEQSAAASEELSAQSEELKKVVAELEKMVFGSSHGQTATSRSQAASDGDDDDWR
FT                   WDDEETAQRPRLEDKS"
FT   gene            complement(275078..275389)
FT                   /locus_tag="DaAHT2_0238"
FT   CDS             complement(275078..275389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0238"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: mag:amb0333 anti-anti-sigma
FT                   regulatory factor"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84949"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6J0"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ADH84949.1"
FT                   /translation="MQIEASQNDNKVRISLEGVVDEKGAEELKKTIKQLPLASVREVEI
FT                   DCSRVKHIGSSGIGKLLLLYKHLASNGGQLRVTNLTGPLFELFTELKMDTLFTITRQG"
FT   gene            275767..276489
FT                   /locus_tag="DaAHT2_0239"
FT   CDS             275767..276489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0239"
FT                   /product="protein of unknown function DUF541"
FT                   /note="PFAM: protein of unknown function DUF541; KEGG:
FT                   tgr:Tgr7_2477 protein of unknown function DUF541"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84950"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6J1"
FT                   /inference="protein motif:PFAM:PF04402"
FT                   /protein_id="ADH84950.1"
FT                   /translation="MKNLQRLAVAVVCLLILLPVTAVKAGPALGGPEDGFTVQLSAWAE
FT                   EETVNDLLTAVLVVERSGPDHARLALAVANLMRRALGEVERYPEIKAHTVAYATQPVYQ
FT                   RRDGKNERVGWRIRQSLQLESTEVEKTVELIGRLQALELQLVAMNFTVSEQKKERLRAT
FT                   LTAAAIDAWRGKAEAAVRRLGGRVWRPYEVRIDDEYRPPVQPLLRTEAAMLSQPVESAV
FT                   EAGTSRLRVTVSGTAWGR"
FT   sig_peptide     275767..275844
FT                   /locus_tag="DaAHT2_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.570 at
FT                   residue 26"
FT   gene            276519..278528
FT                   /locus_tag="DaAHT2_0240"
FT   CDS             276519..278528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0240"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; General
FT                   secretory system II protein E domain protein; KEGG:
FT                   cak:Caul_2089 general secretory pathway protein E"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84951"
FT                   /db_xref="GOA:D6Z6J2"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6J2"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADH84951.1"
FT                   /translation="MKRPFHNTPWPEADLPAQGGADNPPAGKAGSSLDTFVYPESTKQL
FT                   LSVIISPEDAQAHLLLPLSFIGNELTVAVVHPEKREVLQDLRRRYDAFHVSFLPIGAQK
FT                   FTELYHELYQQPVKGLSEPGSPSSAPFSEPPGHGRTPVGPISAKGQELPEPMPNDSSTA
FT                   SASLAGPDLPDLPDLPGLAEALLTHAAKCRASAIHFEQEEGRGKVRYRIDGVLQELEPG
FT                   RLQESIQARPEDVVSRLKILANLEQADPLLPQHRVFRFAPANGALPEQDELVLRLATCP
FT                   AVDGESFTINILDSRKARPDLEMLGHAPPVLQALETCLAHGRGMVLVAGPPGSGKNTTL
FT                   QAILEFLRAPSRRIVMAEEYVTARLPGVMQTAIDPERGLTAPRLLRSFLPLDPDVIMLD
FT                   RFDDRPSMRQGVNCARQGPLFLSSIAAVDGSEVLARFEAAGCDRAELAALINGVLVQRL
FT                   VRRICPDCKTACVPERDEWGRLFVDYPSQLTFFLGKGCALCDFTGFKGRTLLSELFVPG
FT                   AAAAATRENGREGLREAAASNGLPSLLDDGLLKLGETTLGEILRVVPAAAIARFRQRTG
FT                   RGTGQNSAAAIKRGRSFLLTDPAGQRDRIDRMYEFYRELSLALASTRVVERALFHRFIT
FT                   TSYREIKRSAASGAITFNFTAAGDRVKIAAIPRH"
FT   gene            278562..279485
FT                   /locus_tag="DaAHT2_0241"
FT   CDS             278562..279485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0241"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   dat:HRM2_30920 ParA"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84952"
FT                   /db_xref="GOA:D6Z6J3"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6J3"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ADH84952.1"
FT                   /translation="MSRTIAITSGKGGTGKTTLAVSLAAQLAALGHRTCIFDADLGTAN
FT                   VNIMLGINPQADIGDVVKGSAAVRDIIIQDPAGIDIIPGSSGVEEVANLGAKRLASLVT
FT                   SFDAAGAYDFYLFDTGAGISRRVLAFCLAAAEVVLVITDEPTSLTDAYALLKVLTKHQY
FT                   GGRIRVVINRCPDLEAAKKVYRRFRVAVDFYLGLPLEPLGVLFQDRAVPASMQQQRPFI
FT                   ELFPKSKAADCIRLMARRLSDGGREPATAESIVAFWNHYASFCRLPLELAARGAKEEAH
FT                   RGEEVVAERQIYLLDLEAFAAENSNE"
FT   gene            complement(279609..279684)
FT                   /locus_tag="DaAHT2_R0005"
FT                   /note="tRNA-Arg5"
FT   tRNA            complement(279609..279684)
FT                   /locus_tag="DaAHT2_R0005"
FT                   /product="tRNA-Arg"
FT   gene            279836..281398
FT                   /locus_tag="DaAHT2_0242"
FT   CDS             279836..281398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0242"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="KEGG: adg:Adeg_1759 carbohydrate kinase, YjeF
FT                   related protein; TIGRFAM: carbohydrate kinase, YjeF related
FT                   protein; PFAM: protein of unknown function UPF0031;
FT                   YjeF-family domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84953"
FT                   /db_xref="GOA:D6Z6J4"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR026599"
FT                   /db_xref="InterPro:IPR026600"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6J4"
FT                   /inference="protein motif:TFAM:TIGR00197"
FT                   /protein_id="ADH84953.1"
FT                   /translation="MKLASAEQMRAGDRLAMEIFGIPGPVLMENAGRAVVEVMAHRYGL
FT                   AGEGEIAVLAGPGNNGGDALVIARHLQQLGARPWVVLLVEPERLQGDAALNLQILRQLP
FT                   VSLEVVTEVEQWQALQDRLQASRLAVDGIFGTGLSRELSGRFQVAVELLNRFPGPVIAV
FT                   DAPSGLDSDHGRVLGAAVRADCTVTFALAKPGLVTFPGRAWAGTVEVVDIGIPPAVYDR
FT                   LAPFKELLTAAELAPWLPRRRPVDHKGSFGHLLLLAGSRGMTGAALLAARGALRSGVGL
FT                   VSACVPRDLLVIFATAWPELMTVALPNSPLAAGAEDLATVQAALAGKSALVLGPGLGTA
FT                   PATAELVRQLYRTPGELQIPQVLDADALNIMAAAPDLLTEPPGPRVLTPHPGEMARLLG
FT                   MATAEVQENRWQAAAELAGRHGVWVVLKGAGTVIAAPDGQLAVSPTGNPGMAAGGMGDV
FT                   LAGLIGGLLAQGMGPWQAACLGAYAHGLAGDLLAAAGGLEFGFTASELADRLPAAFGSF
FT                   TKI"
FT   gene            281421..281873
FT                   /locus_tag="DaAHT2_0243"
FT   CDS             281421..281873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0243"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="KEGG: dal:Dalk_1651 CBS domain containing membrane
FT                   protein; PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84954"
FT                   /db_xref="GOA:D6Z6J5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6J5"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADH84954.1"
FT                   /translation="MQLAKDIMTAEVITVSPDLPVEKLASLLWERRISGAPVVDEQGEL
FT                   VGVVTESDLIDQAKKLHIPTAIAVLEAVIYLERGRKVEEELNKMAGSTVKDICTTKPAT
FT                   VAPDTPLDEIATVMAEKHLHTLPVMDRGKLVGVVGKADVIRALINK"
FT   gene            complement(281895..283889)
FT                   /locus_tag="DaAHT2_0244"
FT   CDS             complement(281895..283889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0244"
FT                   /product="para-aminobenzoate synthase, subunit I"
FT                   /note="KEGG: rmr:Rmar_2114 para-aminobenzoate synthase,
FT                   subunit I; TIGRFAM: para-aminobenzoate synthase, subunit I;
FT                   PFAM: Chorismate binding-like; Anthranilate synthase
FT                   component I domain protein; aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84955"
FT                   /db_xref="GOA:D6Z6J6"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6J6"
FT                   /inference="protein motif:TFAM:TIGR00553"
FT                   /protein_id="ADH84955.1"
FT                   /translation="MHQQHTAGRPGRTFSDQQLDQLLGLLEDEENFVFLESARLSAENR
FT                   RSLLFARPLKMLTLRPGTSAADFLAALEAELQQGHYLAGWFAYEFGYLLEPRLQRLLTA
FT                   QPAPLAVLGVYAAPLVYDHERGSWDDRDPAAVLAKKLPVTGAEQPLPSQRDPGLVTEAL
FT                   QRALPGAEYRRNVRRIKEYIAAGDTYQVNYTFKQQLPCRGSAAALYCALRRNQRVSYAA
FT                   LLNLAGEHIISLSPELFLRRQGDYCTVRPMKGTSRRGLTPEEDARWAAELPADRKNRSE
FT                   NVMIVDLLRNDLGRICRPGTVETLELFTLESYETLYQLTSTIRGELKADTGLAELFKAL
FT                   FPCGSVTGAPKIRTMEIIHELEQAPRGVYTGAIGFISPEQEMVFNVPIRTVTLDRGVAE
FT                   MGIGSGVVYDSDPEQEWRECKLKGNFLSRPTPPFVLIETMLWQPDQGYRLLELHLQRLL
FT                   ASAQRLAFEADPEEIRRLLAAHGNGFTAAALGPQRVRLTLAKDGTLALSHAPFAGHPCF
FT                   SWQELVEAENQTTAAGDGPKLPTAVIAPAAIDPDQPLLYHKTSQRDIYDRHREAALAAG
FT                   HCEALFVNTRGELTEGAVSNLFIRHQGRLLTPPVSAGLLNGVLRRHLLTQPRPRLQEQN
FT                   LRPADLATAEAVFIGNSLRGLTRIRVVEE"
FT   gene            284134..284820
FT                   /locus_tag="DaAHT2_0245"
FT   CDS             284134..284820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0245"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="KEGG: dvm:DvMF_2848 CBS domain containing membrane
FT                   protein; PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84956"
FT                   /db_xref="GOA:D6Z6J7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6J7"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADH84956.1"
FT                   /translation="MLIEDWMAKNVLTVDENTSLMRATRIMKENNIRRLPVVSHGKLIG
FT                   IVTDRDVKDASPSKTATLDIHELYYLLSEMKVKDVMTASPLTLKGKDSLELAAVIMLED
FT                   KISGLPVVDESGRLTGLLSETDLLRAFVRSTGIKDGSRRYVFDLPDAAGSVTRVMESLR
FT                   QYDARVISILTSFEDAPEGQKRVSIRITMDDAARAEELHQDLLAKFTVVDFGIDDIKNR
FT                   PRKKQS"
FT   gene            complement(284833..286887)
FT                   /locus_tag="DaAHT2_0246"
FT   CDS             complement(284833..286887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0246"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="KEGG: sat:SYN_00304 multimodular
FT                   transpeptidase-transglycosylase; TIGRFAM:
FT                   penicillin-binding protein, 1A family; PFAM: glycosyl
FT                   transferase family 51; penicillin-binding protein
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84957"
FT                   /db_xref="GOA:D6Z6J8"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011816"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6J8"
FT                   /inference="protein motif:TFAM:TIGR02074"
FT                   /protein_id="ADH84957.1"
FT                   /translation="MATKRTSKQQTRIWRQTQLSLFLLFIAGGLTGLLGSVLFVHITLD
FT                   LPDIGSLDSYQPAQTTLIYDHQGVVVDRVFTENRIVVPLDKLPEQLPQAFIAAEDARFY
FT                   DHSGVDGWSIVRALVHNLRAGERRQGGSTITQQVARALLLSREKTYIRKIREAILAYRI
FT                   DQKLNKDEILHIYLNHIYLGSGAYGVEAAAWTYFGKPARELNLAETALLAGLPQAPSRY
FT                   TPFRDYTAAKRRQAYVLNRMAEEAYITPTAARRAYLHPLLWASPRQNGQENSYFLQQVR
FT                   NQIEQTYGRNMLYNGGLRVYTGLDQELQQRAAAAVTLGVQNWERRQRRAAAQQEQPQAA
FT                   LLAMETGSGLVRAVSGGTDFSVSQFNRATQARRQPGSAFKPIIYAAALDHGMTPASVII
FT                   DEPLRLPGADRGRVWEPKNFSNRFYGPTTLRDGLVYSRNILSVKIMQEIGLAPVVKLAR
FT                   QMGISSPLSNNLSLALGSAEISVMELTAAYGALANGGVYHAPVFIKSVRDSNGRVLEQA
FT                   NLKGQRALDERTAYQVTRLLEGVVREGTGRSVAAIGLPVAGKTGTTDRYMDAWFIGYSP
FT                   ELVTGVWMGFDRARPLGRNESGARAAAPIWLHFMQGAKAQLAGKEFPRPPGIVLVPIDH
FT                   AVGHFEEETPNRVSLEAFRIDNLPPALLSPAPAAETPRLKKLQEMPAEG"
FT   gene            complement(287199..287507)
FT                   /locus_tag="DaAHT2_0247"
FT   CDS             complement(287199..287507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: geo:Geob_2338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84958"
FT                   /db_xref="InterPro:IPR026352"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6J9"
FT                   /inference="similar to AA sequence:KEGG:Geob_2338"
FT                   /protein_id="ADH84958.1"
FT                   /translation="MKLTATIITILAALAFVGTAIASMPGNTSEFEGGPMGKVVFSGQI
FT                   HADAGLSCGDCHTGIFQMKREVKITMADHNSGNLCFSCHQEGGKAFASNDCARCHQK"
FT   sig_peptide     complement(287439..287507)
FT                   /locus_tag="DaAHT2_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.937 at
FT                   residue 23"
FT   gene            complement(287695..288558)
FT                   /locus_tag="DaAHT2_0248"
FT   CDS             complement(287695..288558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0248"
FT                   /product="cytochrome c-type biogenesis protein CcsB"
FT                   /note="KEGG: dat:HRM2_18920 CcmC2; TIGRFAM: cytochrome
FT                   c-type biogenesis protein CcsB; PFAM: cytochrome c assembly
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84959"
FT                   /db_xref="GOA:D6Z6K0"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6K0"
FT                   /inference="protein motif:TFAM:TIGR03144"
FT                   /protein_id="ADH84959.1"
FT                   /translation="MQSAQLLSITTFVYLAASFLYIAILVFGTKNKTLGLTATLVTMGG
FT                   LLLSTMGIIIRWHEAYKLDFGYYAPFSNMYESLVFFAWCIALTYLVLEYLYKNQTLGAF
FT                   AMPFAFLSQALAEYWPQWDQQLKPLMPALQSNWLIAHVIASFVGYAAFAIAFGVAVMYL
FT                   TKARNVEKSGQPEGTGVFASLPPLKTIDEVIYKTILFGFLWFTVGGLIFGAIWANSAWG
FT                   TYWSWDPKETWSLITWFVYAATLHVRYTRGWTGKKIAWLAVLGFASTLFTYYGVNFLLS
FT                   GLHSYA"
FT   gene            complement(288623..289966)
FT                   /locus_tag="DaAHT2_0249"
FT   CDS             complement(288623..289966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0249"
FT                   /product="ResB family protein"
FT                   /note="PFAM: ResB family protein; KEGG: dps:DP1682
FT                   cytochrome c-type forming protein Ccs1"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84960"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6K1"
FT                   /inference="protein motif:PFAM:PF05140"
FT                   /protein_id="ADH84960.1"
FT                   /translation="MTKEQNQVWRFFASVKLAITIIFVIAVTSIIGTVIQQGRSHEFYV
FT                   EEYGPELARLFQVLDFTNMYGSWWFITLLIIFCVNLIVCSIDRLPNAWRMVVLDNLNNT
FT                   PERLQKMPLKAEFSVKADSPTVAADKIKGLLAGAGWKAQSRDQENGVLLFAQKGAWSRL
FT                   GAYLVHIGILVIFIGALVGSVFGYKASIMFPEGETVAHVFERKTSEPIPLGFEIHLENF
FT                   DIKYYPIGMVREFRSDVVINDPELDGPLRTSILVNHPLKHRGLTFYQSSYQPLTEYLVE
FT                   IQNRETGAKRSFMARPGRQLQWRDEGLIFGVTNTMSDRTGRVHEYEIWFSDQEESPSVF
FT                   NMRDQQTVTVQRPAGNYSFYIQQRYATGLQVANDPGVWIVYAGCGLMMLGLYACFMVTH
FT                   RRLWAYVKPADKGGAQLLLCGGSNRNKETFDKRFADLAQRLRQDQSIG"
FT   gene            290288..290476
FT                   /locus_tag="DaAHT2_0250"
FT   CDS             290288..290476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0250"
FT                   /product="ribosomal protein L28"
FT                   /note="KEGG: dps:DP1683 50S ribosomal protein L28; TIGRFAM:
FT                   ribosomal protein L28; PFAM: ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84961"
FT                   /db_xref="GOA:D6Z6K2"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6K2"
FT                   /inference="protein motif:TFAM:TIGR00009"
FT                   /protein_id="ADH84961.1"
FT                   /translation="MSKVCSVCGKKPEVGNNVSHAHNKSRRRWLPNLQSVRVAVPGGNT
FT                   RRTRVCTRCLRSGAVVK"
FT   gene            complement(290491..292698)
FT                   /locus_tag="DaAHT2_0251"
FT   CDS             complement(290491..292698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0251"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="SMART: metal-dependent phosphohydrolase HD region;
FT                   TIGRFAM: RelA/SpoT family protein; KEGG: dps:DP1165 GTP
FT                   pyrophosphokinase; PFAM: RelA/SpoT domain protein;
FT                   metal-dependent phosphohydrolase HD sub domain; TGS domain
FT                   protein; amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84962"
FT                   /db_xref="GOA:D6Z6K3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6K3"
FT                   /inference="protein motif:TFAM:TIGR00691"
FT                   /protein_id="ADH84962.1"
FT                   /translation="MTKAKPQAQQPPLTGIDDILRQAAGYMPEEDLQPLRLAYALAKKV
FT                   HKGTRHRYSGHPYLEHVLAVTEILTAMRLDVATLTAGLLHGILKQKEHPVSQAKLREEF
FT                   GEDVAGIVAGATRITAVQFNNRLAYQAENIRKMLLAMATDIRVLLVRLADRLHDMQTLN
FT                   ISDEESRREIAQETMDLYAPLAGRLGIDWIKRELEDLAFSHLQPEAYRYLMSKIQTSLP
FT                   DREAYVERIKGLLTHHLRDSGLTNFRILGRPKHLYSIHKKLLVQNITIDKVYDKVAFRI
FT                   IVGDVKECYQALGVIHSLWPPIDGRFKDFISHPKANGYQSVHTSVIGPNGDFMEIQIRT
FT                   EEMDRIAAEGIAAHWAYKEGQAASPQDVKLFKWLKQLVAMLQELEDPKELLETVKGELY
FT                   EDDIYVLTPNGEVKGFPRGSTPVDFAYSVHTEVGNRCSGAKINGQIAPLRTPLKNGDVV
FT                   EIITSPNQKPSRNWLHIVKTSRARNRIRQWLNQEQRERELEKGREICERELRKHDISLK
FT                   KLIKTGHLQELLKELACNSLDELLRKVGSGKLSMGALTRVLQPEELRREEEAEDQESAL
FT                   LEQVQKRQAKRSGKGGEEAVIVEGATGIPTKLANCCRPVPGDEIIGFITTGRGITVHKS
FT                   NCANLLGGESERRIGVRWSGAGRTPFRASVQAVGENRKGLLAALSSTISNDDANIANLE
FT                   VSTSADQARFNMVLEVEGIDHLNRILQHIRQLAGIIAADRK"
FT   gene            complement(292691..294421)
FT                   /locus_tag="DaAHT2_0252"
FT   CDS             complement(292691..294421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0252"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="KEGG: dps:DP1164 prolyl-tRNA synthetase; TIGRFAM:
FT                   prolyl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); YbaK/prolyl-tRNA synthetase associated region;
FT                   Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84963"
FT                   /db_xref="GOA:D6Z6K4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6K4"
FT                   /inference="protein motif:TFAM:TIGR00409"
FT                   /protein_id="ADH84963.1"
FT                   /translation="MRFSQLLLPTLKEDPAEAEVISHKLMLRGGFIRKLTAGVYSYLPL
FT                   GLAAIRKVEQIVREEMNRAGAQELLLPMVQPADLWRESGRWEKYGPELLRFKDRHQRES
FT                   CLGPTHEEVITDLVRMNIHSYRQLPVNLYQVQTKFRDEIRPRFGLMRGREFIMKDGYSF
FT                   DLDEAGAELTYRKMYDAYQRIFSRCGLAFRAVEADTGTIGGSFSHEFMVLAATGEDVVV
FT                   ICQHCDYAANLEKATANPDEAGRSEAPKTLEKVATPGRKTVTEVCEFLQIPQENLVKTM
FT                   IYLADGQPVAVLLRGDHEVQPVKLQNLLNAQEVELAEDDKILGLTGAPAGYLGPVGLKI
FT                   PLVMDEAVAGMVNFVTGANESDQHLVNVNLERDFSPNHRGDIRMVNEDDRCPRCGGRLA
FT                   LTRGIEVGHIFKLGTNYSEALNATFLDDQGQSRHFVMGCFGIGVSRTVAAAIEQNHDRD
FT                   GMIFPLPIAPFQVILLNLTPKDEVISAEAERLYQALTADGIEVLLDDRDERPGSKFKDA
FT                   DLIGIPIRLMVGKRFKNDGLLEIRTRADGQTSEATPAAAEAVIKEMVAAALTSTSQDHD
FT                   "
FT   gene            complement(294439..295509)
FT                   /locus_tag="DaAHT2_0253"
FT   CDS             complement(294439..295509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0253"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="TIGRFAM: 1-hydroxy-2-methyl-2-(E)-butenyl
FT                   4-diphosphate synthase; KEGG: dps:DP1163
FT                   4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; PFAM:
FT                   IspG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84964"
FT                   /db_xref="GOA:D6Z6K5"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6K5"
FT                   /inference="protein motif:TFAM:TIGR00612"
FT                   /protein_id="ADH84964.1"
FT                   /translation="MRPRKKTRQIRVGPVAIGGDAPIAVQSMTNTDTRNVETTVAQIKG
FT                   LEEAGCEIIRVAVLDLEAAAAIKAIREQIGIPLIADIHFDHRLAIAAMEHGAQGIRINP
FT                   GNLGGEDKLARVAAAAKAHGVAIRVGVNAGSLEKDILARHGRPTPAALVESARRNVEKL
FT                   ERLGFHELKISLKSSDVLTTIEAYRQLSNSCDYPLHLGVTEAGGLIAGTVKSSVALGIL
FT                   LHEGIGDTFRISLTRDPVEEIRVAYELLRSLHLRQRGPELISCPTCGRCQVNLFGLAEE
FT                   VERYIQKIDTPLKIAVMGCVVNGPGEAREADIGVAGGHGVGIIFKKGKIYKKVPEAQLL
FT                   AVFLAEIEQMTREYEH"
FT   gene            complement(295618..296166)
FT                   /locus_tag="DaAHT2_0254"
FT   CDS             complement(295618..296166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vap:Vapar_1224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84965"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6K6"
FT                   /inference="similar to AA sequence:KEGG:Vapar_1224"
FT                   /protein_id="ADH84965.1"
FT                   /translation="MLEIVLFAVLSIPLVFLSWRALFNLRRHGVYRFITWECILWIGVN
FT                   NINQPTESKAILGFSPATALLIAALLIVLSSLSVMLQHGKISGKRKDETLFGFEKTTSL
FT                   VEVGLFRYIRHPMYLSLLCLTWGLLLKNPEPGLLLVALVGTITCIYTALIEEQENIAYF
FT                   GEEYRQYMHRTKMFIPFIL"
FT   gene            296370..296873
FT                   /locus_tag="DaAHT2_0255"
FT   CDS             296370..296873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0255"
FT                   /product="Ferroxidase"
FT                   /EC_number="1.16.3.1"
FT                   /note="KEGG: mth:MTH158 ferritin like protein (RsgA); PFAM:
FT                   Ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84966"
FT                   /db_xref="GOA:D6Z6K7"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6K7"
FT                   /inference="protein motif:PRIAM:1.16.3.1"
FT                   /protein_id="ADH84966.1"
FT                   /translation="MLSQKMETALNQQVNAELYSSYLYLSMSAFFSGLNLGGSAHWMRL
FT                   QAQEELNHALKIYDFVNERGGRVELSGIEAPLHQWDSPTAVFEEVLRHEQKVTGLINDL
FT                   VDLAIAEKDHATNNFLQWFVAEQVEEEASANEVLQKMQLAVREGGLFILDQELAKRVPP
FT                   PTAQ"
FT   gene            complement(296918..298891)
FT                   /locus_tag="DaAHT2_0256"
FT   CDS             complement(296918..298891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0256"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: drt:Dret_0660 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84967"
FT                   /db_xref="GOA:D6Z6K8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6K8"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADH84967.1"
FT                   /translation="MKFSLRMKVMIIPLILVVASFTLLIGISLWVVNGLWQEEIETLTS
FT                   TQVALNENSIKDLEKGALGLGLLAAHYPGVREAYELAHQGNEEEGRTLLRQSFDLLQAD
FT                   ARRLLGGTQETQIHFHLPPAKSFLRTWRRPGENDGGDDLSAFRRTILQASQNQSVVSGV
FT                   EVGDQGFALRGIVPITGQNGRFLGTVEGIFSLQSMVDTALSGEGDNMAIYLLARDLDFA
FT                   RAARAANPPITGDLARVFTTAADETDPYIDNSFLQAAKTGVTTAQVNGRLLIAQPVFDY
FT                   TNEMKGVLVFVRDVEEQVAMIKGLRWALVVGGSALLAALAGLLYYFSSSIVCSISRLAK
FT                   GLDDGALQISSSADQVAASGQELAEGASEQAAALEENSASLEEISAMTKQNADNAGQAD
FT                   ALMREASAIVKRAEEAMAELTTAMQTINKSSEETSKIIKTIDEIAFQTNLLALNAAVEA
FT                   ARAGEAGAGFAVVADEVRNLAMRAAEASQNTASLIEDTVQRIQEGSQLVSKTNQAFVEV
FT                   STSTGKASGLVGEIAVASNEQANGINQLNTAMGEMDTVVQRTAANSEESAAAAEELSAM
FT                   ANQMKDYVRELSDLIAGDRCHSQPPRQKAPVRLSKQATSPRAAAAPAVAKQKIEPHRTA
FT                   PTKSKQNSAAVIPFDDDDFKDF"
FT   gene            299304..299504
FT                   /locus_tag="DaAHT2_0257"
FT   CDS             299304..299504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0257"
FT                   /product="Protein of unknown function DUF2065"
FT                   /note="PFAM: Protein of unknown function DUF2065; KEGG:
FT                   dps:DP2542 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84968"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6K9"
FT                   /inference="protein motif:PFAM:PF09838"
FT                   /protein_id="ADH84968.1"
FT                   /translation="MEFLLVLIGLILIVEGLPYAAFPEAMQRWLAQMQQLSPVTLRKAG
FT                   LVMLGLGLLLIYLARRTNFFS"
FT   gene            299573..300649
FT                   /locus_tag="DaAHT2_0258"
FT   CDS             299573..300649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0258"
FT                   /product="S-adenosylmethionine/tRNA-ribosyltransferase-isomerase"
FT                   /note="KEGG: dps:DP2843 S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase; TIGRFAM:
FT                   S-adenosylmethionine/tRNA-ribosyltransferase-isomerase;
FT                   PFAM: Queuosine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84969"
FT                   /db_xref="GOA:D6Z6L0"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6L0"
FT                   /inference="protein motif:TFAM:TIGR00113"
FT                   /protein_id="ADH84969.1"
FT                   /translation="MTAYSLDDYDYHLPPELIAQQPPPRRDGSRLLVCDGRRDFALSDQ
FT                   LFPDMLSWLAPGDLLVFNDTRVFPARLSGHKESGGRVELLLLAYPVLSDVSGPGATEAE
FT                   AWGLLKSSKGARPGTWLQFGDDLRALVEEKGEGGKVRVRLVLGAPLADCLARYGRMPLP
FT                   PYIKRENEQEEDRRRYQTIYAQTPGAVAAPTAGLHFTQELLGQIKKKGVGMAHITLHVG
FT                   YGTFAPVRSQDIRRHQIHAEEYLISRENAELINRTKAAGGRIWAVGTTSVRTLEAAAGE
FT                   DGRVNPGSGSCRLYIYPGYSFKVVDNLLTNFHLPRSSLLFLVSALAGRENILRAYRHAV
FT                   AERYRFFSYGDAMAIIRK"
FT   gene            complement(300670..300945)
FT                   /locus_tag="DaAHT2_0259"
FT   CDS             complement(300670..300945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0259"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="KEGG: gbm:Gbem_1496 regulatory protein, FmdB family;
FT                   TIGRFAM: regulatory protein, FmdB family; PFAM: Putative
FT                   regulatory protein FmdB"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84970"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6L1"
FT                   /inference="protein motif:TFAM:TIGR02605"
FT                   /protein_id="ADH84970.1"
FT                   /translation="MPIYEYECQSCQKITEARQSISDAPLSTCDSCGGALSKIISQSSF
FT                   QLKGGGWYADGYSNGKSKGCAAAGDCPAASSTPASPAPACGAACGC"
FT   gene            301335..301676
FT                   /locus_tag="DaAHT2_0260"
FT   CDS             301335..301676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_0943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84971"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6L2"
FT                   /inference="similar to AA sequence:KEGG:Gmet_0943"
FT                   /protein_id="ADH84971.1"
FT                   /translation="MQQIATVQAAAGMVLAKDVETGDNRVLCGKGTALTEAMIDRFKRM
FT                   DITHITVQGHPVVEEGAKTLKEEVMDIEQRFGRVRHIKPLMYLKKRIQERLIAARRPVE
FT                   PAAGQGDGE"
FT   gene            301673..302563
FT                   /locus_tag="DaAHT2_0261"
FT   CDS             301673..302563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0261"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   Metal-dependent hydrolase HDOD; KEGG: gur:Gura_0281 metal
FT                   dependent phosphohydrolase; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84972"
FT                   /db_xref="GOA:D6Z6L3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6L3"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ADH84972.1"
FT                   /translation="MSPEQEQKREAIRKALREVKNLPTLPGIISKLTKMADDPDTTTEQ
FT                   MGRTISKDHILAAKLLKLVNSAFYGFPQRISSLSSAIILLGFNVIKSLIISASIFELME
FT                   DQDMELWEHSLGCAVVCNVLAKRLGVSDPEEVSTAGLIHDLGKVAIKMELPGESEQVSA
FT                   LVVSRQINRFEAERELLGLDHAEVGGWLAKSWNLPAKLVEPISCHHDPSLAKAEPLAAA
FT                   IVHFADIVIRGMGYGHGPDIWVPALAPRAWELLRLKPVDIDEMLAEVEEKLWDVKGFSL
FT                   DIKAEAQSATQVPKG"
FT   gene            302566..303522
FT                   /locus_tag="DaAHT2_0262"
FT   CDS             302566..303522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0262"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /note="KEGG: gur:Gura_0282 response regulator receiver
FT                   modulated diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84973"
FT                   /db_xref="GOA:D6Z6L4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6L4"
FT                   /inference="protein motif:PFAM:PF00990"
FT                   /protein_id="ADH84973.1"
FT                   /translation="MSRLLVAGSPGFLPPAARTLLEAKGYQLKVCEQLPEAVALVLEDP
FT                   PDLLLLEKGFVGDGDQRLIKAVSGCLQKGNIPIILVLELTELETELDWGVYPVDDIVTL
FT                   PLVPSLLLARLQLAEARMMRVFDNNPLSRLPGNTSILRAMQRVLASGNDYAVCYVDIDN
FT                   FKPYNDRYGFSRGDEVILMVARIIVNVIEEKAREGSFIGHVGGDDYVFIIKAEKAEEVC
FT                   RQIIDNFNMVRNLFLNAEDIAAGAFVGLDRRGQETRFPLLSISIAVVTTGEGRYRHSGE
FT                   IAAAASQLKHYVKRLEGSNYLIERRDSCVSGQEMSAA"
FT   gene            303618..305900
FT                   /locus_tag="DaAHT2_0263"
FT   CDS             303618..305900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0263"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="KEGG: dps:DP2874 hypothetical protein; PFAM: Lytic
FT                   transglycosylase catalytic; Peptidoglycan-binding lysin
FT                   domain; SMART: Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84974"
FT                   /db_xref="GOA:D6Z6L5"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6L5"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ADH84974.1"
FT                   /translation="MKFAWCTHFLRSWSGAVGVAALLGALFFFSCPTGVQAEPFPVYDE
FT                   IKPKVAFWKDIYSRYPSTQGLLHDRFDLDLVYAVLEVENTWDNAARRRNRNQINAGREE
FT                   YRAILLHLAAGHAPRNAKEERVLALFGDRASPERLRRAADNIRFQRGLKDRFREGVIRS
FT                   GAYLAQIKEILRQYGLPEDLAYLPHVESSFNYEAYSRLGAAGIWQFMRATGRQYMTIDY
FT                   VLDERRDPIRATHAAAQLLRENHQRLGNWPLAITAYNHGATGMIRARNQHGDYPSIIRH
FT                   YSGNRFGFASRNFYSEFLAAREVAKNAERYFGPLDLEPQRRSHEIVLSGYVSLAELAAH
FT                   LGVDVATLHRYNQGLREPVLQGEKYVPKGYHLRLPADQPTVRLASALPDTMLRQAQRRS
FT                   AFYTVRRGDTAWEIARRHGVSLSALMAANQLNSRATIYAGQNLRIPGVDEPAVMLAAAS
FT                   GAGAGKTRVAEAPPAQEPTAPATAAAPPVEAAPEVVAVAGEPAPGQVTEQAAAEDYQVA
FT                   GALADPREVAAAGARLASARDNGWSLAMAERVAESRPDYVGEGVAPEAAGELLSSRRAL
FT                   SLSGNGSRLPAMTMAVAGAGEPATGAVNPAVVWGNLSVEEVRDLADGRRVGYIRVEVEE
FT                   TLGHYADWLSIPTQELRRLNGFPFGRPIRLEQRLMIPLDRGVEQAFFEEQRYEYHKSLE
FT                   EDFYAAYRVDGVETYRVRPGDNIWQLSHDEFELPLWLIRKYNPELVLDRLRPGDEIRVP
FT                   VVLARQR"
FT   sig_peptide     303618..303731
FT                   /locus_tag="DaAHT2_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.953 at
FT                   residue 38"
FT   gene            305940..308843
FT                   /locus_tag="DaAHT2_0264"
FT   CDS             305940..308843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0264"
FT                   /product="aminopeptidase N"
FT                   /note="KEGG: geo:Geob_3109 aminopeptidase N; TIGRFAM:
FT                   aminopeptidase N; PFAM: Peptidase M1 membrane alanine
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84975"
FT                   /db_xref="GOA:D6Z6L6"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012779"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024601"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6L6"
FT                   /inference="protein motif:TFAM:TIGR02414"
FT                   /protein_id="ADH84975.1"
FT                   /translation="MSADSELPRPVLLAEYRPPFFLLDEVNLQVELFADHALVRSSLCL
FT                   RRNPAVDDAEMLVLDGEELELLELRLDGQALPPERYRLEGVGNRGRLVIPTPPVQCTLE
FT                   TVSRIYPAANTALEGLYRSGSMFCTQCEPEGFRRITWYPDRPDVLAPFTVTISADRQTC
FT                   PVLLAGGNPVGRGELPEGRHWASFKDPFPKPSYLFALVAGDLVGVHDRFTTASGRQVAL
FT                   AIYVEAHNRDKCDHAMAALKKAMRWDEETFGLEYDLDHYLIVAVDDFTMGAMENKGLNI
FT                   FNARYVLARPESATDDDFENIEAVIAHEYFHNWTGNRVTCRDWFQLSLKEGLTVFRDQL
FT                   FSQQLHSAGVKRINDVRLLREQQFVEDAGPLAHPVRPESYLEINNFYTLTVYEKGAELV
FT                   RMLHTLLGPAGFRAGLRLYLSRHDGSAATIEDFLAAMAEAGGRELGAFARWYARAGTPR
FT                   LQITDDYDPAAGCYRLRVVQEMPVPATTGGECCDNAQGVAEAPPASEGRPEQPRPVAEG
FT                   RENLPLLLPLAVGLLSPAGEEVAAELLESTEWEQVFEFTGLHARPVPSLLRGFSAPVRL
FT                   TYDYRDEQLGLLLAHDTDPFCRWEAGQRLSGSLILELAGRWQAREYLQLPGGFVDTYRQ
FT                   LLARLPGLEDKSFAALLVALPTEEYLAEQMALIDVEALHTAREFVRRELAVALRPRWEE
FT                   IYRSFPVATEGEGTYDPRLAGGRRLRNQALFFLLALADDRELIALARQQFFQAGNMTDS
FT                   LAALRGLVHAAAVSEQPHRIFGRSARLTYLGYAAPVCLPEPAARLNAYGPLERQFSTPD
FT                   ERLPAARAVAAEALEEFAARWGHDPLVLDKWFTVQATAPSPDTLERVEALMAHPAFRLS
FT                   NPNRVRALIGAFAAANPVAFHRADGAGYRFLAAQIMALDSVNPQVAARLAARFSRWRRF
FT                   AGPRRELMRAELEKIATAPKLSRDVYEMVSKSLGSQA"
FT   gene            308978..309541
FT                   /locus_tag="DaAHT2_0265"
FT   CDS             308978..309541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0265"
FT                   /product="translation elongation factor P"
FT                   /note="KEGG: dps:DP0845 elongation factor P; TIGRFAM:
FT                   translation elongation factor P; PFAM: Elongation factor P
FT                   ; Elongation factor KOW domain protein; Elongation factor
FT                   P/YeiP protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84976"
FT                   /db_xref="GOA:D6Z6L7"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6L7"
FT                   /inference="protein motif:TFAM:TIGR00038"
FT                   /protein_id="ADH84976.1"
FT                   /translation="MYTTSDLRKGLKIQLDGEPYIITDFEFSKPGKGQALYRCRLRNMI
FT                   TGNAFDRTYRSNDKFEPAALEERTMQFLYAQGDEYNFMDNKTFEQIVITKDLLGDDINF
FT                   LIDNMEVDILLFKERAIGVTLPNFVNLTVTKADPWVKGDTSGSDSKPVTVETGYVLQVP
FT                   PFINEGEKIQIDTRTGQYVTRVKE"
FT   gene            309613..310497
FT                   /locus_tag="DaAHT2_0266"
FT   CDS             309613..310497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0266"
FT                   /product="tRNA synthetase class II (D K and N)"
FT                   /note="PFAM: tRNA synthetase class II (D K and N); KEGG:
FT                   gme:Gmet_1839 tRNA synthetase, class II (D, K and N)"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84977"
FT                   /db_xref="GOA:D6Z6L8"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6L8"
FT                   /inference="protein motif:PFAM:PF00152"
FT                   /protein_id="ADH84977.1"
FT                   /translation="MSDLWGRARVVRAVRRFFEQRDFLEVETPLMIPAPAPEPHLLPQP
FT                   AGRWFLQTSPELCMKRLLARGHAKIFQICKCFRRQERGRRHVPEFTMLEWYRAGADYLA
FT                   LMDDCEQLLTAVAAELALPGENGHQVSLVLPWERLTVAEAFCRYAAMEVDEALRRDLFD
FT                   QLLVEKIEPHLGVGRPTFLYDYPLELAALARPKPGQPEVAERFELYLGGVELANGFSEL
FT                   IDPVEQRRRFEADRRLIRAAGRRPPPMPEPFLAELDAMPQAAGIALGLDRLVMIMLGKE
FT                   NIDQVLAFPPETL"
FT   gene            310512..311138
FT                   /locus_tag="DaAHT2_0267"
FT   CDS             310512..311138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: drt:Dret_1218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84978"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6L9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84978.1"
FT                   /translation="MEAQELQRRSALIREYEEGFAHRLATRVINKPKLNIWLFLVPFLF
FT                   IYHFSELRRYKENLPALRQGLLRSKLHALTMAEEEIRTGQRKSDAEIVPPSDPELAKPS
FT                   MAEVRKRQEEELRLLLAHYRRLLGSSAEDYGRLVRQAYGDRRRYQDFIEDLQQRENELN
FT                   QTLLAAMARAKKSDEEAPLVVERLEKESLKLRVADMQQFFPLESA"
FT   gene            complement(311135..311347)
FT                   /locus_tag="DaAHT2_0268"
FT   CDS             complement(311135..311347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btk:BT9727_4528 cytochrome d ubiquinol
FT                   oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84979"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6M0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84979.1"
FT                   /translation="MNAKRKPKKTLWPVVLLVLLGGWVVGEFYRLPTVQTVRTAFAATE
FT                   IEVSAIWYADVDAYGEIKGKKAQLR"
FT   gene            complement(311566..313362)
FT                   /locus_tag="DaAHT2_0269"
FT   CDS             complement(311566..313362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0269"
FT                   /product="Uncharacterized protein family UPF0324"
FT                   /note="PFAM: Uncharacterised protein family UPF0324; KEGG:
FT                   dau:Daud_2170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84980"
FT                   /db_xref="GOA:D6Z6M1"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6M1"
FT                   /inference="protein motif:PFAM:PF03601"
FT                   /protein_id="ADH84980.1"
FT                   /translation="MSDQAKKGISDAIKEEESALQKGKSKWEDLWKKEDWWANWLGAFL
FT                   LLLGVAFFLYSPPENMKEIIAHNQAIMEAEQQRAPFPTIEYKEAERKLSGLQARRTPLG
FT                   QNLATLLQRPKRWDSSPGQSFILTEEAAAERRAAAQPRFEEAQQRRIEARDRAEEAQAA
FT                   AEAANFKDPALNQAADEAIEAWGGAVRAESRARSAATIKPYNVFPSMIALMVVLALLFS
FT                   VGMRFMGQKVGGFFIGFPFIFALSIIAYFIASHSFSTQYGLSYVLWAVLLGLLISNTVG
FT                   TPKWAKPAVQVEYYIKTGLVLLGGSILFGLILMIGAPGIVIAWGVTPTVLIIGYWVGER
FT                   FIRLPSKPLNVTIAAAASVCGVSAAIAAAAASRAKNEELTIAVGLSIAFTAIMMFAMPA
FT                   LVLALGMNPIVGGAWIGGTVDSTGAVVAAGELLGAGAMYTAATLKMIQNVMIGIIAFAI
FT                   AAYWATRVETAGSNVKLTFGGAMKEIWTRFPKFVIGFIGASVLFTIIYELMGDQVGNAI
FT                   ISEGALRGWANPLRGWMFCMAFVSIGLATNFRELAKYFEGGKILYHYAFTQGFNVVLTL
FT                   FLAWLMFMVAFPGITEHLMTIR"
FT   gene            complement(313388..313810)
FT                   /locus_tag="DaAHT2_0270"
FT   CDS             complement(313388..313810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0270"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: dma:DMR_33160
FT                   putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84981"
FT                   /db_xref="GOA:D6Z6M2"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6M2"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADH84981.1"
FT                   /translation="MNFLVPHDGSEHAFRALEEAVKLSQKLGGETNIEVLIVVPDLCLV
FT                   DVGIDECNIITNTLYKEAQGIKAKINEKLASLGTKAEVRIEAGSEVDSILKCADGCQAD
FT                   FIVIGAAGKHGSGRGRLGSVADKVVSKSDRSVMIIR"
FT   gene            314136..315995
FT                   /locus_tag="DaAHT2_0271"
FT   CDS             314136..315995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0271"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: drt:Dret_1221 multi-sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84982"
FT                   /db_xref="GOA:D6Z6M3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6M3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH84982.1"
FT                   /translation="MQASDYRRPDGEREKEGFAFSIGRRLHDSVGIQFKFLVGTGLILL
FT                   LNCLLIVLIVYQQEKGQLEDRAFAQSELVMAAVEASRAYVREELRPAMYLHLGNEQFVP
FT                   EAMSTSYVGRAVMERFAPAMAEEYQYRRVALQARNPSYEANELERRMIDYFNQHPAESE
FT                   WRGLVKVDGVEKFKRFRPVVFEAECLYCHGSPADAPEGLVAFYGDTLGFNRKPGELAGV
FT                   VAVGVPVASALADAKEKAFAVFWLVFMGMALVFILLSLFFHRMVLISLRGVLDIFREQE
FT                   ENGFAVPPLVPAPPAAKGAMVKGEDGYTGYSLGIIRGLVGKDELVELTAAACNMAEDLR
FT                   RTREQLRQYNRELERRVAERTRALRESEARLLQQELEKKIQQTEKMVAMGQLVAGLAHE
FT                   INNPLGIIICYVDLVKRQPNLSPRALQDLEVIGKQARGCKRIVGDLLDFARSGESRKQP
FT                   ADLNRIIEEVAGIVAPQFGKQGVAINLELAPGLPWLELDENKIKQVFLNLLLNARQAMQ
FT                   DEGGEIEIKSLLLAPSGPVRIEVRDNGPGIESEDLSKIFDPFFSTKRTGEGTGLGLSVS
FT                   YGIVKEHGGEIRVASRIGQWTCFTIDLPVSDHGAPHLATISPA"
FT   gene            316062..317468
FT                   /locus_tag="DaAHT2_0272"
FT   CDS             316062..317468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0272"
FT                   /product="putative two component, sigma54 specific,
FT                   transcriptional regulator, Fis family"
FT                   /note="KEGG: drt:Dret_1222 putative two component, sigma54
FT                   specific, transcriptional regulator, Fis family; PFAM:
FT                   sigma-54 factor interaction domain-containing protein;
FT                   response regulator receiver; SMART: response regulator
FT                   receiver; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84983"
FT                   /db_xref="GOA:D6Z6M4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6M4"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADH84983.1"
FT                   /translation="MTSRLLIIDDEADLLAALARILPAELAELQVETASKAEAGLALIR
FT                   EQSIDVLLLDIRMPEVSGLDLLSEVKKIDPWVTVVMMTAYGSIETAVTAVKRGAYDFIT
FT                   KPFEIPDLVMVLQKALERSRLIRENMNLRQRLPEQAGFAGLIGQSPRMRKLYEGVQALA
FT                   RTDYSVLIRGESGTGKELVARAIHQLSKRGQRPMVTVNCPAIPENLLESELFGHKKGAF
FT                   TGADKDHAGLFLEADGSTLLLDEIGDIPVSVQTKLLRALQEREIRPVGGDKPRSVDVRI
FT                   ISSTNQDLEAKIKAHSFREDLYYRLNVVTLHTPSLAEIPEDVPLLADYCLRVVCRELEL
FT                   PPKSFSVAALQEIARRPWPGNVRQLQNFVRRMVLFAPDQEIGLPEIGAVEEQSVGPAGG
FT                   NGGGEGRPAIEPYLQSKDKLLERFTADYVKQLLTMTQGNVTQAADMAGLSRVALQKIIR
FT                   RQKLRAEDFR"
FT   gene            complement(317473..318306)
FT                   /locus_tag="DaAHT2_0273"
FT   CDS             complement(317473..318306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0273"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="KEGG: afw:Anae109_1500 phage SPO1 DNA
FT                   polymerase-related protein; TIGRFAM: phage SPO1 DNA
FT                   polymerase-related protein; PFAM: Uracil-DNA glycosylase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84984"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6M5"
FT                   /inference="protein motif:TFAM:TIGR00758"
FT                   /protein_id="ADH84984.1"
FT                   /translation="MSNQSAPQTRRLPLRRLLTDLQGLVLLHRELGVDAYPASPGLLRL
FT                   LQPSCQGRQGRDSAKTGELGAAKSPAPPARPRSSKSAEAEREVPDLTVLAAQLQDCRQC
FT                   PHHQWRQKVIFGQGSAEARLLLIAGYPGAAEEGAGLPCQGAAGELLDRMLAAIQLSRRQ
FT                   IYLTTLVKCIPEAARQAATSPAPPEPAAISACLPFLQQQIAAIRPALICTLGPLPAQAL
FT                   LRTGKHLLQLRGRFHQYRDIPLMPTLAPDFLLHNPEMKKYAWQDLQLIQKFLQKN"
FT   gene            318526..319128
FT                   /locus_tag="DaAHT2_0274"
FT   CDS             318526..319128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0274"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: mfa:Mfla_1136
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84985"
FT                   /db_xref="GOA:D6Z6M6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6M6"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADH84985.1"
FT                   /translation="METIKAIESRRAIKHFDPNHRMSEAEEHQLLSLALLSPTAFNIQN
FT                   WRFVLVKDPILRQLIRAEAWDQAQVTDASLLIILCADLLSWEKNPQRYWHNATPEVQEF
FT                   LLPAIEFYYRDKPQVQRDEAMRSCGIAAQTLMLAARSMGYDSCPMDGFDYEAVARLINL
FT                   PEDHVVTMFVAVGKGIKPAWPRGGQLPLEEVVMVDRF"
FT   gene            319239..319787
FT                   /locus_tag="DaAHT2_0275"
FT   CDS             319239..319787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0275"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="PFAM: ROSMUCR transcriptional regulator; KEGG:
FT                   sfu:Sfum_0504 MucR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84986"
FT                   /db_xref="GOA:D6Z6M7"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6M7"
FT                   /inference="protein motif:PFAM:PF05443"
FT                   /protein_id="ADH84986.1"
FT                   /translation="MAKSLVEMAAELVQAQCSSTSLTAEEMAQSLQATYNVLHNLQQDE
FT                   SRGVAADVGLAKPALTGSPEKSIQKHKIVCLECGEEFKTLSSKHLQTHGLTGREYRQKW
FT                   GLSLRQPLCARELTDRRKKLGKARGLPDNLRKSIAARSGKTTTKASAGTKKATAGAGKK
FT                   TTTRKSKPSAAAKSAATKS"
FT   gene            319819..320622
FT                   /locus_tag="DaAHT2_0276"
FT   CDS             319819..320622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0276"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="TIGRFAM: glutamate racemase; KEGG: dal:Dalk_5046
FT                   glutamate racemase; PFAM: Asp/Glu/hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84987"
FT                   /db_xref="GOA:D6Z6M8"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6M8"
FT                   /inference="protein motif:TFAM:TIGR00067"
FT                   /protein_id="ADH84987.1"
FT                   /translation="MIGVFDSGVGGMTVARAIEQALPDYRLVYFGDLARTPYGSKSSDT
FT                   ISRYSCQNVDFLLSRGAKIIVVACNSAASVAAANLRAAYDLPIFEVIGPAVAQAARFSS
FT                   RGRVGVIGTRATIRSGVYEQLLQQQNAGCRVFSAACPLLVPLVEEGWLDKRETKMILRR
FT                   YLAPLKQQQVDTLVLGCTHYPLLKELIQRRIGRRVRVIDSSQALAAELAAFLNANPAVA
FT                   TTLSRREEGENLYYVSDVTEAAHHTARRIFGRSIDLRAATGTGDV"
FT   gene            320674..321378
FT                   /locus_tag="DaAHT2_0277"
FT   CDS             320674..321378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0277"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /note="PFAM: outer membrane lipoprotein carrier protein
FT                   LolA; KEGG: dps:DP2846 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84988"
FT                   /db_xref="GOA:D6Z6M9"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6M9"
FT                   /inference="protein motif:PFAM:PF03548"
FT                   /protein_id="ADH84988.1"
FT                   /translation="MFCSAREMVFDRRRLLLPLLLILLLFADRSTVEAEADPDPEKLAG
FT                   RLQEIYDQVTGFKAEFQQRTAMPMSRRQRAGEGTVMFRKPHQMRWEYAAPDHQVLVGDG
FT                   KEVHFYSARSNQLMISEVDTYLDSDVTYAFFAGTGDILRDFAVTAVPERERPALPAGYH
FT                   ALRLEPRELHSQVEYLDLLVGGEPFFIRRLDIVDHFGSVTTLEFSRVELDPELPADFYR
FT                   FEPPEEVEILRN"
FT   gene            321455..321979
FT                   /locus_tag="DaAHT2_0278"
FT   CDS             321455..321979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0278"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="KEGG: dol:Dole_0024 phosphodiesterase; TIGRFAM:
FT                   phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84989"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6N0"
FT                   /inference="protein motif:TFAM:TIGR00040"
FT                   /protein_id="ADH84989.1"
FT                   /translation="MRIAVISDTHDHIANLRAAVTYCNSYQVGLIIHCGDLVSPFMLSE
FT                   LAAFGGAVHLVYGNNPGDKHLISQFCGTRFPGLTHHGDFGALEAAGLKFAFTHYPQLAR
FT                   GMAAQGNFDVVCCGHNHRYQVEKIGETLLINPGELLGKDDQPGFAVLDALSRQVERVEI
FT                   GDRRQAGVDGK"
FT   gene            complement(321999..322793)
FT                   /locus_tag="DaAHT2_0279"
FT   CDS             complement(321999..322793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0279"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="KEGG: pmy:Pmen_0644 RNA methyltransferase; TIGRFAM:
FT                   RNA methyltransferase, TrmH family, group 3; PFAM:
FT                   tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84990"
FT                   /db_xref="GOA:D6Z6N1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6N1"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ADH84990.1"
FT                   /translation="MTRQPQKHAPGRKRDAGDRNLHAATTAWGFHAVYALLSHRPATVA
FT                   QLFISPRRDDQRIRELLELAARHGIPVHTEIPADLNLEEEISHQGVVARVKATGQPTLE
FT                   GLLASLQPKENQLLLALDSIQDPRNLGAIIRTAAAFGADGLLIPKDRSAPLTGTVMKAA
FT                   AGTLPLLTICRVTNLSQSLAQLKKHGFWIYGAGGQAPQQLHQTSFSGPICLVMGNEQKG
FT                   LRPLVSRHCDHLVAIPMAAGVESLNVAVATGVILSEIRRQQN"
FT   gene            complement(322790..323401)
FT                   /locus_tag="DaAHT2_0280"
FT   CDS             complement(322790..323401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0280"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="SMART: guanylate kinase/L-type calcium channel
FT                   region; TIGRFAM: guanylate kinase; KEGG: dps:DP2860
FT                   guanylate kinase; PFAM: guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84991"
FT                   /db_xref="GOA:D6Z6N2"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6N2"
FT                   /inference="protein motif:TFAM:TIGR03263"
FT                   /protein_id="ADH84991.1"
FT                   /translation="MNKGCLLVVSAPSGAGKTTLLKRILADTPGIGFSVSHTTRAPRAG
FT                   EENGVDYHFIDRQEFTRRREADDFLEWAEVHGNFYGTSREAVQQALIRGEDILLDIDVQ
FT                   GARQLKEQTGVEAVFLFIAPPSARVLAQRLHGRGTDSREVIELRLENARREMQEADWYD
FT                   YLVVNDELSEAEGLLRAIITAERCRRRRRPDGTPLPPFDS"
FT   gene            complement(323398..323691)
FT                   /locus_tag="DaAHT2_0281"
FT   CDS             complement(323398..323691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0281"
FT                   /product="protein of unknown function DUF370"
FT                   /note="PFAM: protein of unknown function DUF370; KEGG:
FT                   dds:Ddes_1405 protein of unknown function DUF370"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84992"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6N3"
FT                   /inference="protein motif:PFAM:PF04025"
FT                   /protein_id="ADH84992.1"
FT                   /translation="MDQRMINVGFGNAVPAGRVLAVVNTKSSPMKKLREEAKEQKRLID
FT                   VTEGRRTRSIIILDSNHVVLSAVQPETISLRFSAPLEQRGKGEEEQLKDASK"
FT   gene            complement(323709..324593)
FT                   /locus_tag="DaAHT2_0282"
FT   CDS             complement(323709..324593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0282"
FT                   /product="domain of unknown function DUF1732"
FT                   /note="PFAM: domain of unknown function DUF1732; YicC
FT                   domain protein; KEGG: dps:DP2862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84993"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6N4"
FT                   /inference="protein motif:PFAM:PF08340"
FT                   /protein_id="ADH84993.1"
FT                   /translation="MINFPRSMTAFGRGEASAGERTWTVEVRSVNHRYCDIKIRLPKSY
FT                   ASLEETVKREVAREYSRGRVEVNLGLAGGEAGTRLAVDLSLAREYWRGLNLLRDELSLA
FT                   DRPSLAMLKDLPGVFTPEEVRQDPEGDWPLIRQALVAALENTRVMRQQEGAATKEELRG
FT                   YLAGLRRHLERLTAEVPELVTRRGDKLRQRLQKLLGDQEIEPIRLAQEIALLTDKTDIS
FT                   EELARLESHCNQFAAFLAADEPSGRRLDFLLQEFFREINTIASKINEAGIAQLSVEMKN
FT                   EVEKMREQVQNLE"
FT   gene            324872..327175
FT                   /locus_tag="DaAHT2_0283"
FT   CDS             324872..327175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0283"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: azo:azo3383 putative two-component system
FT                   sensor protein; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84994"
FT                   /db_xref="GOA:D6Z6N5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6N5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH84994.1"
FT                   /translation="MSLNRLLERLLPGSTESSVILAVAFCALAVLGLALLALLGWLAEL
FT                   PRLASFGPGMIPMAPSTALFFLLCGLALLVLLEPFSTFWRRLLLLPPLMVLVAFSLLVY
FT                   FLAAKGVYMRVEHLGLDISGLLNGVPVGHMSPLTAFGFVWLGLVLALLLAARLWSRPAG
FT                   VEARAFYGLILIFVVLIAGIITAGFVSFRHHEQGHRAAMVHELSAVAALKAERITAWLR
FT                   ELQLNGEELARNHGFADRVEKWLQHDDLQEREVVLSRLADQMEVYNFYGITLLAADKQY
FT                   VYSQGLNWDRREEVKELLELAADTGWVVRSDLFKDDAGVVHMIWVVPIIADPRRPPVAF
FT                   VIRSVMAGDFLFPFLAGWPGASQSAETLLVRPEGKQVRYLNPPRFASASPLELVLPLGR
FT                   EEVPAVQAVLGRQGIVEGVDYRGVPVVAALQPVPQTSWYLLARMDMAEMYAPLRERLWV
FT                   IMLAVLVLLMVAAAGVVLLRRRQQHDQQLARLSREAQRQRHQKAELEQQVARRTAQLAT
FT                   VNRELEAFTYSVSHDLKAPLRGIEGYSRLLLRDYQEQLDEDGRLLVGYICRGVEQMQEL
FT                   IEALLAYSRLERREIKQQGVEPAGLVQAVLAGFADQLEAAGVELQVEVPECKVCADPEG
FT                   LRMALRNLLANAIKFSRNSRPPRVSIRAVPQGGKLLLSVQDNGVGFKMKDAERIFEIFT
FT                   RLARDHDEAGSGVGLALVRKAVERMGGRVWAESEPGCGATFWLEIPLAAAPHRDQTTAE
FT                   HPMNAHDRSIMQGS"
FT   gene            327178..330117
FT                   /locus_tag="DaAHT2_0284"
FT   CDS             327178..330117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0284"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s)"
FT                   /note="TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   response regulator receiver; PAS fold domain protein; KEGG:
FT                   app:CAP2UW1_2306 response regulator receiver modulated
FT                   diguanylate cyclase/phosphodiesterase with PAS/PAC
FT                   sensor(s); SMART: EAL domain protein; GGDEF domain
FT                   containing protein; response regulator receiver; PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84995"
FT                   /db_xref="GOA:D6Z6N6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6N6"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH84995.1"
FT                   /translation="MKGEAAGEATGKRILYLEDNPMDVDLTRRTLARLQPDCRLQVAGT
FT                   VAEALELLAPAEPPYDVVLLDLRLPDGSGLEVLSAIRARKLPLAVVVLTGSGSRDAAIA
FT                   ALQAGADNYLVKQDDYLERLPSTLEFALEHFRQQGSGWSRALRVLYAEHKTADAELVQE
FT                   HLAEHAPHVSLERFSDGAALLARLSGQQGVVAGDVLLLDFDLPDIDALEVVKRLREEIR
FT                   LDVPVVLIGNQGSEHEVAEAMGLGVADYLIKQSGYLYGLPNTLEQVARLAQLQREQAAL
FT                   RASEQRHRLLAAALDASRDGMVITDLKGKIVAINPAFTTITGYCQDEALGKNPRILQSG
FT                   RHDRAFYQAMWASLKKNGHWQGEVWNRRKNGEIYPELLSISTVYDDGGQPAYYVGVKTD
FT                   LTSLRRSEEQLQYLAHHDPLTGLPNRLLLEARLEHGLERARREGGKLAVMVINLDRFRT
FT                   INDSLGYAAGDRLLEEISQRLRDCVRAEDTLARLAGDEFALVLEMIHDYREAEIMGRRL
FT                   QQALDEPFTLPDEYEAFMHLSIGISVYPQDGDTVDILLRGADIAVGLAKEGGGGQVFYT
FT                   SADLNSQARRTLELEGALRRAQEQGEFLLYYQPKVDLHSGRVVGVEALLRWRRPGHGLV
FT                   SPGEFIPVAERSGLIADLGTWVIHEACRQIQAWREAGLGEVRVAVNVSARQFNHGDLKE
FT                   ILAGALKTHDVKGELLTLELTESMLMLNPEEAITRMATLKELGVKLALDDFGTGFSSFS
FT                   SLSRFPIDQLKIDRSFVAGLAVEADASTIAVSIIAMAHRMGLKVVAEGVETEVQSGYLR
FT                   QNGCEEMQGFLFSKPLPAEELAELLRQGRAMEVPEVADEQTLLIVDDEINVLKALQRLL
FT                   LDEGYRVLTAPDAATGLELLARHRVQVIISDQRMPGMRGIEFLSRVKEIYPDTVRMVLS
FT                   GYADLETVVEAVNEGALYKFLAKPWKDDLLLEHIREAFLYYQAVVRPRQ"
FT   gene            330301..331560
FT                   /locus_tag="DaAHT2_0285"
FT   CDS             330301..331560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0285"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: gme:Gmet_3478 PAS/PAC sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; PAS fold-4 domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84996"
FT                   /db_xref="GOA:D6Z6N7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6N7"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH84996.1"
FT                   /translation="MSKEELDGLPPGDYELQPQNSVIWQAKREWESIVDCLDVMVLLVD
FT                   QSGLIRRCNQAFACFLVRPYEEVNGRLWPELFAECGLVEEIRNGNRAEYYHGPSGRTFC
FT                   CCFYPFAAEYADVKGLVLALRDVSERHRVATELQRKNSELAAAYDDLKASQAKLLQQEK
FT                   LASIGQLAAGVAHEINNPVGFVTSNLGSMVKYLDKISRFLREEQRLLAAAADRELQEKI
FT                   EVQRQALKLDFVLADAADLLRESLEGVGRVKNIVQNLKRFSRVDQALYQRVDLNQCLED
FT                   TLNIVWNELKYKVTLTKEYGELPLTWCYPQQLNQVFMNLLLNAVQAIEKEGEIGIRTWA
FT                   EGGAILVSISDTGCGIPFEHQKRLFDPFFTTKEAGKGTGLGLSIVYDIVVQQHGGEVMV
FT                   CSEPGRGSVFRIWLPVREQE"
FT   gene            331600..333000
FT                   /locus_tag="DaAHT2_0286"
FT   CDS             331600..333000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0286"
FT                   /product="response regulator receiver modulated metal
FT                   dependent phosphohydrolase"
FT                   /note="KEGG: gme:Gmet_3476 response regulator receiver
FT                   modulated metal dependent phosphohydrolase; PFAM: response
FT                   regulator receiver; metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: response regulator receiver; metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84997"
FT                   /db_xref="GOA:D6Z6N8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6N8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH84997.1"
FT                   /translation="MIDKQQQPAAAGGPKEAAGGFVLFVDDEDNILRALRRLFQEEKFE
FT                   VVTATSGEEALEIISRRDDCAVIVSDQRMPGLSGVETLARVRKQAPLILRLLLTGYADI
FT                   EAAMDSINRGGVFRYITKPWQDEELLQTVRHAHQHHHLVKENLRLSELVKKQNEELKRW
FT                   NSELENMVQEQTEELQRSYDELKAFNSRLRANFKSVITALAGLMELRNKRMRSHSQNVA
FT                   EIAARVGSELKLAVAERENLVVAALLHDIGKLGMPDVMLLVDPFQMDEAEMEEYQKHPV
FT                   RGQVALDRIEDLREAARIIRHHHEHYDGGGFPDGLKQREIPQAARIIALIDFIDQETRR
FT                   YQGSSGLSIAFKKAREGAGSRFDPRLIAPVEKVARRFYRRRLPKVEFVEMELQPKDLAA
FT                   GMTLSRDFFSGTGILLLSKGTVLTEANLSILRRYAQLDPTKRGVFVSIKDDGDEEGEGE
FT                   DGGNGAEA"
FT   gene            complement(332997..333545)
FT                   /locus_tag="DaAHT2_0287"
FT   CDS             complement(332997..333545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cla:Cla_1119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84998"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6N9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH84998.1"
FT                   /translation="MLAANTQTYALNFQYFEQQTTWSSKSGGKTGADRSAGIHSLTTRV
FT                   TQLSLEVSRHSNVDFRNQSAAERLAVKLADGLPLSKFNQHGNLPTNQAEAKLLVGKDGY
FT                   WGVEKTAERLTQFVLKGAGDNLEMLRAGREGLLRGFKEAEKIWGGKLPDISYKTIDKAL
FT                   AAVDERIQQLGGNIIDRAA"
FT   gene            333791..334537
FT                   /locus_tag="DaAHT2_0288"
FT   CDS             333791..334537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0288"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   dal:Dalk_3247 protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADH84999"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6P0"
FT                   /inference="protein motif:PFAM:PF03692"
FT                   /protein_id="ADH84999.1"
FT                   /translation="MENQQFPEGMEPLGEEGFTFACNPEVPCYTRCCHRLELQLYPYDI
FT                   IRLKNRLKIGSEEFLENYAAVVQGANPFFPSVMLRMRPEDGYPCPFLDPASGCTVYRDR
FT                   PSACRTYPLERAVDRRRQQGRNRDFYFLVRHDYCQGHGRGRQWTVPEWLADQQLLPYNA
FT                   MADRWAEMDTLFAANPWQGEGAAGPRQLLAFMVCYNIDRFRAYVREHDLLRRQRLDKAR
FT                   RRAIEMDDEALLSFGFDWLRQVLSNS"
FT   gene            334671..336068
FT                   /locus_tag="DaAHT2_0289"
FT   CDS             334671..336068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0289"
FT                   /product="flagellar hook-associated 2 domain protein"
FT                   /note="PFAM: flagellar hook-associated 2 domain protein;
FT                   flagellar hook-associated protein 2 domain protein; KEGG:
FT                   csa:Csal_2033 flagellar hook-associated 2-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85000"
FT                   /db_xref="GOA:D6Z6P1"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6P1"
FT                   /inference="protein motif:PFAM:PF07195"
FT                   /protein_id="ADH85000.1"
FT                   /translation="MSVGSISTLGVGSGLELQSILEDLRGIDEKQRLDPLKKNIDRYEA
FT                   QLEAFTVVQNKLLDMRSHVRDLGLETTYLTSAASSSNESVATATAAAGVAEQSLSMEVE
FT                   RLASRSTLLSEGVADRGTVISDDASVFSYRVGDGDLVTVEVPEGTTLEGLVQLINNDPA
FT                   NAGVSARIIDNGDMDNPFQLILRANETGSNNFIQIEELPDASPAMDTRLEGEEPAALNA
FT                   SFILDGISYRRQGNTVANVIDGLTFELQQTGLTTLSVSQDTSNVRELVVDLVAAYNEVV
FT                   QEIAGKSRFDEETGKPGVLARTTVSGLRHELQNLMTATYQGDESGAIRNMFDLGLEFQR
FT                   DGSIVLNEEMLDEALAANPQAVRDFMLGDFKREAPGFADRLQDRLGSIASYGGQISTER
FT                   NSAEDRIRDLETRIESERERLDRRYAVLTRQFIELDSYMSRMTQMSDYLTSQFDSLSQL
FT                   APGSRKK"
FT   gene            336102..336560
FT                   /locus_tag="DaAHT2_0290"
FT   CDS             336102..336560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0290"
FT                   /product="flagellar protein FliS"
FT                   /note="KEGG: dat:HRM2_36900 FliS; TIGRFAM: flagellar
FT                   protein FliS; PFAM: flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85001"
FT                   /db_xref="GOA:D6Z6P2"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6P2"
FT                   /inference="protein motif:TFAM:TIGR00208"
FT                   /protein_id="ADH85001.1"
FT                   /translation="MYARNRVQAYRQSESAAVHPVKLIHMIYERVLTHLAYAEEAVVAN
FT                   DPLRRGENLSKAIALISELNAAVNPKDESEAAAFLRGLYGAIMVELPKVAINNDAEILR
FT                   QAARYIAELKKVWEETAMQESGVLAEKKAAMQPSQEAKAKMTPVSVSI"
FT   gene            336632..337042
FT                   /locus_tag="DaAHT2_0291"
FT   CDS             336632..337042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85002"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6P3"
FT                   /inference="similar to AA sequence:KEGG:BRAFLDRAFT_129391"
FT                   /protein_id="ADH85002.1"
FT                   /translation="MKPLTGQAHNQAMDPWMALEQYTAMQEEHLEALRRGNLREMSRWQ
FT                   AERERAFTILQRALDGLGDLRLLKDQGLVQHLRERIGALLARENLLRKQVRDHRQRTRE
FT                   QLASLRKGRQAVRRLGTQPEATPRPRFISNLA"
FT   gene            337205..337612
FT                   /locus_tag="DaAHT2_0292"
FT   CDS             337205..337612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0292"
FT                   /product="flagellar protein FlaG protein"
FT                   /note="PFAM: flagellar protein FlaG protein; KEGG:
FT                   pat:Patl_3084 flagellar protein FlaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85003"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6P4"
FT                   /inference="protein motif:PFAM:PF03646"
FT                   /protein_id="ADH85003.1"
FT                   /translation="MDVNLHNEAKSYGLPAATAVEREEKNRPPVTPVADSGAAAKGKPE
FT                   DRSRFDQPLRENRQVSPEEAEELAKEMQARLDSIGNTRLNFSLHRDPEAVVVQVTDRKS
FT                   GDVIKQFPAEESLALRQKLNELVGMLFDGKA"
FT   gene            338036..339316
FT                   /locus_tag="DaAHT2_0293"
FT   CDS             338036..339316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0293"
FT                   /product="sulfate adenylyltransferase"
FT                   /EC_number="2.7.7.4"
FT                   /note="TIGRFAM: sulfate adenylyltransferase; KEGG:
FT                   dsa:Desal_0228 sulfate adenylyltransferase; PFAM:
FT                   ATP-sulfurylase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85004"
FT                   /db_xref="GOA:D6Z6P5"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6P5"
FT                   /inference="protein motif:TFAM:TIGR00339"
FT                   /protein_id="ADH85004.1"
FT                   /translation="MSKLVPPHGGKGLVCCKLHGNELVAEQDKAKGLKKVQISARAKGD
FT                   LIMMGIGGFSPLDGFMTKADWKSVCENYTLADGTFWPVPITLDVSQADADAIKEGDEIA
FT                   LERDGVIYATMKVTEKYAMTETEKKWECEKVFKGKGEESADDKFWKIALEDHPGVQMVM
FT                   AQKEFNLAGTVKVLSEGEYPDQYKGVYLTPAETRAMFEERGWKEVAALQLRNPMHRSHE
FT                   YLAKIAIEVCDGVLIHSLIGNLKPGDIPADVRVKAIDCLVDKYFVKDNVIQAGYPLDMR
FT                   YAGPREGLLHATFRQNYGVSKMIIGRDHAGVGDFYGLFEAQEIFDEIPANSDPGKALLC
FT                   QPLKIDWTFYCHKCDGMASLRTCPHGKEDRVILSGTKLRKALSEGAEIVDHFGRDEVLE
FT                   ILKAYYQGLTEKVEVKMQGAASGDTMK"
FT   gene            339530..340633
FT                   /locus_tag="DaAHT2_0294"
FT   CDS             339530..340633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0294"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="TIGRFAM: 3-dehydroquinate synthase; KEGG:
FT                   tye:THEYE_A0155 3-dehydroquinate synthase; PFAM:
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85005"
FT                   /db_xref="GOA:D6Z6P6"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6P6"
FT                   /inference="protein motif:TFAM:TIGR01357"
FT                   /protein_id="ADH85005.1"
FT                   /translation="MERQGAIADATAVPVGLGARSYEILIRAGLLAEVGRDLAGLGIAR
FT                   RWAVVADDRVASLFGRELQESLAAAGIKAELLTFPHGEESKHLATVAELASGLARLGLD
FT                   RGDGLIALGGGVSGDITGFLASIYLRGIPFVQVPTTLLAQVDSSVGGKTGVDIPEGKNL
FT                   VGTFYQPRRVYIDTAVLERLPEGELLNGLAEVIKYGMIYDAAFLRRLKEQRQAILALER
FT                   PVLAGVIARCCAIKAEVVAADEREADLRRILNFGHTLGHAVEAASGYTLAHGRAVAIGM
FT                   AAVGEIAADKGLWRQEEADELRQLLTEYGLPVQVPPELDRQQIKKYLKTDKKTVAGRPF
FT                   FVLPTAPGKVIITDEVTEAQIDRALAV"
FT   gene            complement(340906..342627)
FT                   /locus_tag="DaAHT2_0295"
FT   CDS             complement(340906..342627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0295"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: dps:DP2890 NADH
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85006"
FT                   /db_xref="GOA:D6Z6P7"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6P7"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADH85006.1"
FT                   /translation="MSKKILIIGGVAAGPKTACRVKRLLPDAEVTIIDQDSLISYGGCG
FT                   IPYYVSGDVSDEKELRNTSFHLTRDESFFARAKGVTVSTRTRAVAVNRQEKKVLVEKLA
FT                   DGSREELAYDQLVLATGSSPNRLPIAGADLERVFTISDLHQAIAIKELIAKGQVGKAVI
FT                   IGGGAIGIEMAEAFVDLWGLEAAILEFMPQLLPRLVDWEFAGMLEQHLQEKGVEVFTGE
FT                   GATAIEGEDGRVRRVVTPQRTLEADLVVMAVGVRARSELAREGGLLVDPQGNIVVNDRL
FT                   QTSDPNIYAAGDCIAVKNRLTGKAGIAPMGSLANKEGRIVADNLAGIPTRYQGWVGSFT
FT                   LKAFERCIGATGLTLESALAEGFDAAAVTTAQSDRAHFFPTQAVIPLRMVFDRQNRQLL
FT                   GVQGFGPMGDAVLARIDAAAALLQQGATIDDVSQVEMAYAPPFATALDALNATANVADN
FT                   LASGRLRCVDNAVFLAWMDDFASRPDWVALDIRHPNEASVLVEKFGADKWLSIPYIEVR
FT                   ERFQELPTDKMMIIICDAGTRSSEIQIVLDSVGLDNNLVLGGGFNLIRRLGVSWLG"
FT   gene            342974..344251
FT                   /locus_tag="DaAHT2_0296"
FT   CDS             342974..344251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0296"
FT                   /product="sulfite reductase, dissimilatory-type alpha
FT                   subunit"
FT                   /EC_number="1.8.99.3"
FT                   /note="TIGRFAM: sulfite reductase, dissimilatory-type alpha
FT                   subunit; KEGG: dps:DP0797 dissimilatory sulfite reductase,
FT                   alpha subunit (DsrA); PFAM: nitrite and sulphite reductase
FT                   4Fe-4S region"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85007"
FT                   /db_xref="GOA:D6Z6P8"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011806"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6P8"
FT                   /inference="protein motif:TFAM:TIGR02064"
FT                   /protein_id="ADH85007.1"
FT                   /translation="MPKHETPLMDDLEKGPWPSFVSDLKRQAEKNPQCWDIIGQMELSF
FT                   KDRMTHWKHGGIVGVFGYGGGIVGRYSDVPEQFPGVAHFHTVRLNQPSSKFYRTDLLRK
FT                   MCDLWEKRGSGMTNLHGSTGDLILLGTRTEELEPLFYDLTHDLEWDLGGSGSNLRTPEC
FT                   CIGKARCEWSCYDTQATCHGMTMKYQDEIHRPAFPYKFKFKFSGCPNDCVAAIARSDLS
FT                   AIGTWRDNIRINQDEVKKYISGENVPNGGGIPAKAKKFDIQKEVIDLCPTGCMWMEGDA
FT                   LKIDDAECTRCMHCLNVMPKALRPGVDQGASVMMGAKAPILDGAQLGTLVVPFIKMDPD
FT                   NEFEELVDVIEKCWDYWMEHGKNRERLGETIQRIGLPTFLRVMEIEPIPQHVKEPRSNP
FT                   YVFWREEEVEGGWQRDVKEFRKKHAQ"
FT   gene            344326..345456
FT                   /locus_tag="DaAHT2_0297"
FT   CDS             344326..345456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0297"
FT                   /product="sulfite reductase, dissimilatory-type beta
FT                   subunit"
FT                   /EC_number="1.8.99.3"
FT                   /note="TIGRFAM: sulfite reductase, dissimilatory-type beta
FT                   subunit; KEGG: dps:DP0798 dissimilatory sulfite reductase,
FT                   beta subunit (DsrB); PFAM: nitrite and sulphite reductase
FT                   4Fe-4S region; nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85008"
FT                   /db_xref="GOA:D6Z6P9"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011808"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6P9"
FT                   /inference="protein motif:TFAM:TIGR02066"
FT                   /protein_id="ADH85008.1"
FT                   /translation="MGYDPENPMKDRITDIGPPHYEKMFPQVIKDNYGKWLYHEIVKPG
FT                   VLKHVSETGAECYTVRVGCARLVSVEYIREVCDIADKHCDGSVRWTTRNNVEFMVDAES
FT                   KVQPLLDDLASRGNKFPVGGTGACVSNVVHTQGWIHCHTPATDASGVVKAVMDELFDHF
FT                   TNMDLPAKCKVALACCLNMCGAVHCSDIAILGIHRKPPMVDHDAITGLCEIPLAIASCP
FT                   LGAVKPATVKDSSGKEIKSVKVNAERCMFCGNCYTMCPAMPLADPEGSGIAILVGGKVS
FT                   NTRSGPTFSKLVIPFLPNTPPRWPETVAAVKKILEAWAANARKYERVGEWAERIGWEKF
FT                   FEITEIPFTDKSIDDYRLAYDTWRTTTQFKFTSHIK"
FT   gene            345481..345711
FT                   /locus_tag="DaAHT2_0298"
FT   CDS             345481..345711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0298"
FT                   /product="Dissimilatory sulfite reductase D"
FT                   /note="PFAM: Dissimilatory sulfite reductase D; KEGG:
FT                   dps:DP0799 DsrD protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85009"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014793"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6Q0"
FT                   /inference="protein motif:PFAM:PF08679"
FT                   /protein_id="ADH85009.1"
FT                   /translation="MALSIEELKEKIMEKALKGPKTQLYVKDFYACDPEAKPRAVKNAA
FT                   NDLVKEGRMVFWSSGSTTMYAAKERAQKEQD"
FT   gene            345846..347438
FT                   /locus_tag="DaAHT2_0299"
FT   CDS             345846..347438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0299"
FT                   /product="peptide chain release factor 3"
FT                   /note="KEGG: pca:Pcar_0583 peptide chain release factor 3;
FT                   TIGRFAM: peptide chain release factor 3; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85010"
FT                   /db_xref="GOA:D6Z6Q1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6Q1"
FT                   /inference="protein motif:TFAM:TIGR00503"
FT                   /protein_id="ADH85010.1"
FT                   /translation="MISKLAKETARRRTFGIISHPDAGKTTLTEKLLLFGGAIQLAGSV
FT                   KARKAATHALSDWMSIEQERGISVTSSVMQFDYRDYTVNLLDTPGHQDFSEDTYRVLTA
FT                   VDSALMVIDHAKGVEPQTEKLMEVCRMRNTPVVTFINKLDREGMDPLEILAQIEDKLQI
FT                   ECVPLSWPVGMGKQFKGVYDLYRGQLHLFTPGRDTRADEGGVTIRDLDDPRLDELLGSA
FT                   ADKLREDLELLAGAANPYDHQEFLKASQTPVFFGSAINNFGVKELLDAFVELAPAPGCR
FT                   PAEPRPVCPDEESFSGFTFKVQANMNPAHRDRIAFFRICSGRFQRGMKVKHQRLGKEVV
FT                   LSNATIFMAQDRANVEEAYPGDIIGIHNHGTIKIGDTFTAGKDELRFTGIPNFAPEHFR
FT                   RVLLKNPLKAKQLSKGLVQLAEEGAVQVFRPLQGGDFILGAVGVLQFEVTVARLKAEYG
FT                   VEADYEPVAYGAARWVSADDRKLLEEFKAKNWNNMALDAEEHLTFLSESPWMLSRTMEM
FT                   FPRVTFHKTREHS"
FT   gene            complement(347451..349151)
FT                   /locus_tag="DaAHT2_0300"
FT   CDS             complement(347451..349151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cja:CJA_3193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85011"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR008023"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6Q2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85011.1"
FT                   /translation="MANQLQRKETDPIGEIPIAGEAYLAESPPPADGATIPADSPSWRK
FT                   PQPAGQEIKPPGRRRTSSSRRRQVANHLFWPGLLAAVLLFFYLAGALVLFPLTAPRLLS
FT                   QALEKKLDRPVTIARAEWRPLAGRMILHNGIIGPRKADPFDRVDPLLSFRTLTMDTSLL
FT                   SLLRRGRPVSAMAIHQGYAHLVREENRYTNFAHPRFFAGLRWFPEVLLLHNSRLEFSDQ
FT                   RQEPVFNLGLHEINGNLELKRSAELTFALSARGPTASVMELEGVLPGHDTGGVARAELT
FT                   LRQMPLTALAAYLEPRLAGTIKQGELDGRSNFVGHNGKIIINQQLVVGNLKLAATSEDG
FT                   PPLLLLQALLTNRQRQIPFELAASLDRERPESRYLDALTAKLSEWQTAAAEDPFSLLAR
FT                   ELPELQLTEQITFAPGSSTLSRESGRQLDQTAAALNRRPLLSLHLQGVSDFTCDRQALL
FT                   DKKEQAVQQQRRQAVAALARQLSGEGNEEELGQPPPESRPLQPGSITVGRDELRELAQQ
FT                   RRDAVLRRLQAALEEGREESLKPAPPLIAPPARAGQGCSGGVGLQLGHL"
FT   gene            349342..350067
FT                   /locus_tag="DaAHT2_0301"
FT   CDS             349342..350067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0301"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="SMART: phospholipid/glycerol acyltransferase;
FT                   TIGRFAM: 1-acyl-sn-glycerol-3-phosphate acyltransferase;
FT                   KEGG: sfu:Sfum_1596 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferases; PFAM: phospholipid/glycerol
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85012"
FT                   /db_xref="GOA:D6Z6Q3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6Q3"
FT                   /inference="protein motif:TFAM:TIGR00530"
FT                   /protein_id="ADH85012.1"
FT                   /translation="MKQISAVFNFFRGLMALLAIPLFTGLVSFAALPLAIFLGYRGEQL
FT                   QFLARWWGRAICRVSGVKVEVAGLQHLDPGRTYIFAANHQSQFDIFVLQGFLAFDFRWL
FT                   AKKELFQIPLFGWAMRRAGYIPVDRSHGRRAMVSLNEAAKEIAAGTSVIIFPEGTRSPD
FT                   GRLQPFKAGAMVLAIKSEVEIVPLAIVGTHEILPKGKLLPKPGRVLIRLGEPVKAADYT
FT                   VKDKQALAAKLENQVRSLM"
FT   sig_peptide     349342..349434
FT                   /locus_tag="DaAHT2_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.996 at
FT                   residue 31"
FT   gene            complement(350060..350995)
FT                   /locus_tag="DaAHT2_0302"
FT   CDS             complement(350060..350995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0302"
FT                   /product="Muramoyltetrapeptide carboxypeptidase"
FT                   /EC_number="3.4.17.13"
FT                   /note="KEGG: dal:Dalk_3806 peptidase U61
FT                   LD-carboxypeptidase A; PFAM: peptidase U61
FT                   LD-carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85013"
FT                   /db_xref="GOA:D6Z6Q4"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6Q4"
FT                   /inference="protein motif:PRIAM:3.4.17.13"
FT                   /protein_id="ADH85013.1"
FT                   /translation="MPATTEPAANRQPATARHLPPPLRPGDTIGVFAPAGPVQDRDAAE
FT                   AGLRLLNEAGFVIRHRRGLLERRRGYLAGEDRERVEELHELWRDPEVKALLALRGGYGC
FT                   LRLLPLLNWELLAARRKLLIGFSDLTVLQSALLQKTGTCPLHGPMLSTLATSDRESVRH
FT                   FFQVIGGDYCRPIRPAGLEIIRPGQARGPLLGGNLACLNHLLGTPWEPDLRGSILLLED
FT                   VGEAPYRIDRLLTQLALAGRLTGLAGLILGEFQDCGPQEDIWQLLLELTAAQQLPIWGN
FT                   FPVGHGRRNLTLPLGATASLDSSRGELIFT"
FT   gene            complement(350979..351761)
FT                   /locus_tag="DaAHT2_0303"
FT   CDS             complement(350979..351761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0303"
FT                   /product="transcriptional activator, Baf family"
FT                   /note="KEGG: gym:GYMC10_0059 putative transcriptional
FT                   acitvator, Baf family; TIGRFAM: transcriptional activator,
FT                   Baf family; PFAM: Bvg accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85014"
FT                   /db_xref="GOA:D6Z6Q5"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6Q5"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ADH85014.1"
FT                   /translation="MLLAIDVGNSHTVIGLFDGTRLRSQWRLGTSQAVTVDELAARLHT
FT                   LFTMEKITFGHISDMVIASVVPPVTSTWNRFAQRFLGQDLKVAPMVVSHELDCLIRVEL
FT                   PNPAEVGADRLVNAAAAYQQHQGALIIIDFGTAITLDCVSADGAYLGGTITPGIAIALE
FT                   AMGQRTAKLPRVDIATPPAAAIGNSTVEAIRSGVLFGYAGLVDGLIRRIRAQMAPADPK
FT                   VIATGGMAALIAPYSEGIEEVDPLLTLEGLRLIHARNH"
FT   gene            351977..352294
FT                   /locus_tag="DaAHT2_0304"
FT   CDS             351977..352294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0304"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; KEGG:
FT                   fal:FRAAL2149 putative divalent cation tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85015"
FT                   /db_xref="GOA:D6Z6Q6"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6Q6"
FT                   /inference="protein motif:PFAM:PF03091"
FT                   /protein_id="ADH85015.1"
FT                   /translation="MEYLEVVTTVATKEDAERIARTLLEEHLAACVQIVGPITSMYRWQ
FT                   GEIERADEYQCQIKCRADHFKRIEESIARIHPYEVPEVVAHPLPACSSAYEKWLQTELR
FT                   D"
FT   gene            352300..352512
FT                   /locus_tag="DaAHT2_0305"
FT   CDS             352300..352512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dol:Dole_1867 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85016"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6Q7"
FT                   /inference="similar to AA sequence:KEGG:Dole_1867"
FT                   /protein_id="ADH85016.1"
FT                   /translation="MAAQENNQPKRRRRRKSSFVCHCCRQTLPYCLNCPCGFEICEACF
FT                   KDNLWGLSNGPTWICPDCGRVRMTM"
FT   gene            352593..353543
FT                   /locus_tag="DaAHT2_0306"
FT   CDS             352593..353543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0306"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   dsa:Desal_0120 nucleoside recognition domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85017"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6Q8"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ADH85017.1"
FT                   /translation="MAPGELLTGLALPLVRIFFFISLGLILASLIEELGWSRMMSRLAL
FT                   PFVRFGRFSETSGASFALAFISGVSANTTLAEAYRDGKIGRREVLLANLLNSLPRFFLH
FT                   LPTVFFLMAPFIKGAALLYVGLTFCAALLRTLLIAATGRWLLPAPAARPVAPTGGGKPS
FT                   LREALLKAWKRLRRRLLRIMLITAPIYALFFMAAAWGYFALFSAWVEENFSLLAFLPPE
FT                   GIGIIVLVAATELTAGLAAAGALLDGHTMANREVVLALLTGTVLAAPIQALRHQLPYYA
FT                   GIFPPRLAAELIVVSQLFRAGSVILVGTVYFFLSA"
FT   gene            353887..354105
FT                   /locus_tag="DaAHT2_0307"
FT   CDS             353887..354105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0307"
FT                   /product="putative periplasmic protein"
FT                   /note="KEGG: dat:HRM2_01430 putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85018"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6Q9"
FT                   /inference="similar to AA sequence:KEGG:HRM2_01430"
FT                   /protein_id="ADH85018.1"
FT                   /translation="MKTCALQDFMEELKPWLDQDHIRRAEVDARGRFTLYFNDGMKNVY
FT                   AIDDCVQAQLAEVVQDLRRRGIEVEES"
FT   gene            354138..355058
FT                   /locus_tag="DaAHT2_0308"
FT   CDS             354138..355058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0308"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: sfu:Sfum_0698 thioredoxin-disulfide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85019"
FT                   /db_xref="GOA:D6Z6R0"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6R0"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADH85019.1"
FT                   /translation="MSERIIDVLIIGSGPAGLQAAVHAVRKKAEVVVLGKVERSAIYQA
FT                   HVENYLCVPGVTDGSELMATALEQAQKFGAEVIAEDVLNIEQDGELYKVKIESGRQFMA
FT                   RTLIFATGNARKKLKVKGEKELSGKGVSYCVDCDANFYRNAKVAVVGNESAAVDGAITL
FT                   TRYASEVHLVARKLEASPELRAELSQSPVQLHEGQWVKEIQGEQAVAGLVLENDTTLEV
FT                   EGVFIELGAKGAMDLAATMGVAMDPETFSFIATNKKQETNMAGIYAAGDIAGPPWQMAK
FT                   AVGEGCVAGWEAANFAAKQKRADAA"
FT   gene            355089..355574
FT                   /locus_tag="DaAHT2_0309"
FT   CDS             355089..355574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0309"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   afr:AFE_0741 cytidine and deoxycytidylate deaminase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85020"
FT                   /db_xref="GOA:D6Z6R1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6R1"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADH85020.1"
FT                   /translation="MVNQLPGAPPAPKDTSLMHQALEAARAAAARGEVPVGALLIDRQG
FT                   EILAVDGNRTIGDHDPSGHAEIVVLRRAAARIGNHRLTGTTLYVTLEPCLMCVGVMIQA
FT                   RIERLVFGANDPKAGAVVSLYRLAADPRLNHRLQVTAGVLARDAGQLLRDFFRARRS"
FT   gene            355731..355819
FT                   /locus_tag="DaAHT2_R0006"
FT                   /note="tRNA-Ser1"
FT   tRNA            355731..355819
FT                   /locus_tag="DaAHT2_R0006"
FT                   /product="tRNA-Ser"
FT   gene            355840..356547
FT                   /locus_tag="DaAHT2_0310"
FT   CDS             355840..356547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA6971 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85021"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6R2"
FT                   /inference="similar to AA sequence:KEGG:ebA6971"
FT                   /protein_id="ADH85021.1"
FT                   /translation="MTASFTALPIEPQPDTTTCGPTCLHALYRHYGREMALAQIIDEIQ
FT                   RLDHGGTLDVFLANHALARGFSAIVYTYNLKVFDPTWFVGRKTDLAAKLRAQARAKRRP
FT                   KLQVATDGYLSYLAGGGEIRYADLNRALLRRLLSNGEPVLTGLSATYLYRSAREWGPDD
FT                   IDDDVRGEPVGHFVLLAGYDRATREVLVADPMHDNPQGSQNYRVHVDRVIGAILLGALT
FT                   YDANLLVLRPCAN"
FT   gene            356535..357998
FT                   /locus_tag="DaAHT2_0311"
FT   CDS             356535..357998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0311"
FT                   /product="protein of unknown function DUF201"
FT                   /note="PFAM: protein of unknown function DUF201; KEGG:
FT                   hoh:Hoch_5784 RimK domain protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85022"
FT                   /db_xref="GOA:D6Z6R3"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR025839"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6R3"
FT                   /inference="protein motif:PFAM:PF02655"
FT                   /protein_id="ADH85022.1"
FT                   /translation="MRQLIVVSRPEDWPLKIAGVEKVTARDYLTDPVWSALKSARVYNL
FT                   CRSYRYQANGYYVSLLAAARGHKPLPAINTIQDLKSQNVIRVSSAELGRLIETNFKPLH
FT                   SDHFTLSIYFGRNLARRYERLSRALFNLFPAPLLRAEFQRLEDGWVLRRLGTPAFSEIP
FT                   ESHMDFLRESAELYFSGKRPRRTARKASRFDLAMLVNPDESDPPSDEKALKRFEQAGEE
FT                   LGFNIERIGPDEIGRLSEFDALFIRETTAVNHHTFRFARRATAEGLVVIDDPDSILKCT
FT                   NKVYLAEMLQRNQIAGPRTLLVHRDNAERIEAELGLPVVLKQPDSAFSIGVVKVHDAET
FT                   LRFRVNALLKNSDLIVAQEYLPTAFDWRVGLIDGRPLYVCRYHMARGHWQIIHREGGKK
FT                   HEGDADTLSVGEAPPAVIQTAVRAAGLIGKGLYGVDLKEVDGKIMVIEVNDNPSIDAGV
FT                   EDAVLKGALYREIMGVILQRVMAHKLGQR"
FT   gene            358109..359356
FT                   /locus_tag="DaAHT2_0312"
FT   CDS             358109..359356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0312"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="PFAM: glutamate--cysteine ligase GCS2; KEGG:
FT                   nmu:Nmul_A0909 glutamate--cysteine ligase, GCS2"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85023"
FT                   /db_xref="GOA:D6Z6R4"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6R4"
FT                   /inference="protein motif:PFAM:PF04107"
FT                   /protein_id="ADH85023.1"
FT                   /translation="MPTLEPVTPLLKLRAFAGYGIELEYMIVDHRTLAVRPLADRLLIG
FT                   PDGAVVNEVDHGELAWSNELVQHVLELKTNGPAESLVGLGARFHRDLVEINGKLAALGA
FT                   GLLPTAMHPLFDPARETHLWPYGQNEIYEAYDRIFGCRGHGWSNLQSMHINLPFYDEEE
FT                   FRRLHAAIRIVLPLIPALAAASPLEQGRRSAWLDNRLRYYRDNQKAIPEISGLVVPEPV
FT                   TGIEDYHRQILEPMYAAIRPHDPNEVLSDEWLNSRGAIARFERQTIEIRVIDLQECPAA
FT                   DLAIAEAVVELVRALYKERLAGFAAQQALSTEALAEQMWRCGEQGSQAEIGSEALLALF
FT                   GCDRPLTAAELWRKLLEDGLAVSPTAAGMLERIIVRGSLAEAIVRRLGSVPSEEEIRLC
FT                   YRELGLCLAENRLFLS"
FT   gene            359323..360030
FT                   /locus_tag="DaAHT2_0313"
FT   CDS             359323..360030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0313"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /note="PFAM: N-formylglutamate amidohydrolase; KEGG:
FT                   tbd:Tbd_1455 N-formylglutamate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85024"
FT                   /db_xref="GOA:D6Z6R5"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6R5"
FT                   /inference="protein motif:PFAM:PF05013"
FT                   /protein_id="ADH85024.1"
FT                   /translation="MSGRKPPVSVLITTEHASAAVPERWRPLFAGHEAILQTHRAWDPG
FT                   SRELGRALAEVLDAPLLEGQVTRLLVDLNRSAGHPRLFSEFSRALPASQRHVLMAEYWQ
FT                   PHWQAYAETVTRLPGPVLHLACHSFTPVLDGVVRTADIGLLYDPARPGERRWCQGLRSA
FT                   IAERLPGLRVRMNYPYRGVSNGLGQQHRRRFRAAQLITMELEVNTALVDGPGWDRIMTG
FT                   LVAAVSRAAGSRC"
FT   gene            complement(360124..361554)
FT                   /locus_tag="DaAHT2_0314"
FT   CDS             complement(360124..361554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0314"
FT                   /product="putative metal dependent phosphohydrolase"
FT                   /note="KEGG: dat:HRM2_02670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85025"
FT                   /db_xref="GOA:D6Z6R6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6R6"
FT                   /inference="similar to AA sequence:KEGG:HRM2_02670"
FT                   /protein_id="ADH85025.1"
FT                   /translation="MNADQQQVASDPNSPHLPIDRLIELVRSGGKVRTGVDVFNKHGLL
FT                   LLEKSVLVEDPQILVKARKLGAAMVPVSEQQTGGLWDRKGRKIALPSMAADAAGAEKPN
FT                   LAAAASDVDRRINEIMTMKKEAAYKYEKAKSCIKEVLESIRASGGEFDPEPVAATVNEL
FT                   VDFVSNSDNTFAYLTREIFSYDDYLYNHSINVCTIGTVVMQRFSNTFGTAINTFLNLHA
FT                   GEIPLVRPDDEQSFVYYTDSELRNIAIGYFMHDLGKVMVAPRTLNKTGKLTPAEFAEVR
FT                   SHVTDKASLILEKNKITDPHIVNVCRYHHAGLFRHEPDCYPEHDYRQVPTYVKVCKLAD
FT                   IYDAMTSKRCYKEAMNPVGVVTDIFHHYAGKNPLLQYVLHSFVKSVGIYPAGSVVTLTN
FT                   GQLAYVLDSNGPTLLPVTDTGGIPLSRRAEVIIPDQNQTAEGEQVIKVDRRRPPISPLE
FT                   AFHLLPGYLRRTLEVDFA"
FT   gene            complement(361749..362609)
FT                   /locus_tag="DaAHT2_0315"
FT   CDS             complement(361749..362609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0315"
FT                   /product="peptidase C26"
FT                   /note="PFAM: peptidase C26; KEGG: tgr:Tgr7_3159 peptidase
FT                   C26"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85026"
FT                   /db_xref="GOA:D6Z6R7"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6R7"
FT                   /inference="protein motif:PFAM:PF07722"
FT                   /protein_id="ADH85026.1"
FT                   /translation="MTGRKKFVTGSKQHLLPSRRLRPVVAVTGPDRGGWPAWLFTAWAV
FT                   RRAGGRPFRVRPGKPQAGRHFDALIIGGGADVDPELYAEDEGPAPGEIKAAEKRLAQRL
FT                   IGYFFYPFLWLLRLMFQAHGGVLDQRRDRLEKKLINQALAAGKPILGICRGMQLINVVR
FT                   GGTLNRDLSGFYTETPQVRGLLPVKKVDLAGNSQLAAIFAANSILVNAIHNQAVASLGQ
FT                   HLHATGREKNGIIQAIEAADSWCIGVQWHPEYLPQKNVHQRLFRALIREALDHQPGRAL
FT                   HPDNL"
FT   gene            complement(362575..363567)
FT                   /locus_tag="DaAHT2_0316"
FT   CDS             complement(362575..363567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_3160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85027"
FT                   /db_xref="InterPro:IPR022025"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6R8"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_3160"
FT                   /protein_id="ADH85027.1"
FT                   /translation="MPANFRPLPWTTGPNGQPRQVGVEIEMAGVDLATMAQAVQAEFGG
FT                   RVEYLNPFLSRVCVPEFDDFVIELDARVLQDRRYREHLRHLGIELDDEDSETLERWLAE
FT                   AAGILVPHEIVAPPLPLAALPRLDRVRAALQQQGARGTQSSLLYAFGLQINIEAHRLTA
FT                   DWLTAILQAFILLYEALVKAGNIDLARQISPYIRPFPGSYGRNILQPDYQPTMEQLIDD
FT                   YLEHNLTRNRPLDMLPLFAEIDPERIRTAPVEHELIKPRPALHYRLPNCEIDDPAWSLA
FT                   QPFNGWAEVEHLAADSQRLQSAAAAYLQRPAQALGQFADDWAEKIRDWF"
FT   gene            complement(363624..364166)
FT                   /locus_tag="DaAHT2_0317"
FT   CDS             complement(363624..364166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0317"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syg:sync_2884 redox protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85028"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6R9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85028.1"
FT                   /translation="MKTESYQEVPGFYRIIPLKPLRQTPGVLFDNVPMEVLPRIDAIDR
FT                   VLHQGGAVSPGPVGEVARPWYMHPHQDDNLIVLFGHRMVDIYHPKHGRLSFTVTPDKIL
FT                   ATDGSEIYPGPAMLVWPRYVFHRIVSGPEGSASLNFAVHYPGLDMRTNFNIYQLDETDG
FT                   KFQVIREGFRDQGDFPT"
FT   gene            complement(364308..365156)
FT                   /locus_tag="DaAHT2_0318"
FT   CDS             complement(364308..365156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0318"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   dol:Dole_0985 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85029"
FT                   /db_xref="GOA:D6Z6S0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6S0"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADH85029.1"
FT                   /translation="MSLNLRYSCVIPTRDRGDMVQEAVASVLAQTLPAAEIIVVDDGSR
FT                   DHTAATLRALYPGLHLLQLDGRGPGAARNAGVAAASTEIILFLDSDDLWLPDHAQRLLA
FT                   ALAGRYAVAYGPTRNLNLVDGGEFAIPAPGEAKTGDCFEALLRWCFLVPSAVAVQRRAF
FT                   TDCGGFGMEFPGEDWAFFLKLAARHHFAYTGDPPVTLRRLHAGSLCRLAAPEQLAAALN
FT                   RLAGLFAAGQDHHQLTALRRRQVRQRFAELAAWTESRSRQAQWSTIEAWQQDLRNNGML
FT                   D"
FT   gene            complement(365179..367446)
FT                   /locus_tag="DaAHT2_0319"
FT   CDS             complement(365179..367446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0319"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /EC_number="1.17.4.1"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; KEGG: pca:Pcar_1852
FT                   ribonucleotide-diphosphate reductase subunit alpha; PFAM:
FT                   ribonucleotide reductase large subunit; Ribonucleotide
FT                   reductase large subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85030"
FT                   /db_xref="GOA:D6Z6S1"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR024434"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6S1"
FT                   /inference="protein motif:TFAM:TIGR02504"
FT                   /protein_id="ADH85030.1"
FT                   /translation="MLEKASIKTAKMPAGLIKPKFSANAMTVLKRRYLKKDEQGKVLES
FT                   PQRMLWRVASTIANSERLYDATADTEALAMEFYRLMAELDFMPNSPTLMNAGRKLGQLS
FT                   ACFVLPIEDSMPSIFEAVKQTALIHQSGGGTGFSFSRIRPKNDVVHSTKGISSGPLSFM
FT                   SVFDCATETIKQGGTRRGANMAILRVDHPDIMDFIKVKSDLDVLHNFNLSVAITDEFMR
FT                   ALAENGDYALINPRNGEIVRYQNAAKLFRQIVKQAWLSGEPGVVFIDRINAENPTPEAG
FT                   EIESTNPCGEQPLLPYESCNLGSINLANMVKDGKLDYERLGYCVDTAVHFLDNVVDINN
FT                   YPLPEIEQVTKQNRKIGLGVMGFADLLVQLEIPYSSQEAVELAEALMRFIDERALKASI
FT                   ALGKSRGAFPNFPDSIYGRQDPKTPVRNATRTTIAPTGTISILAGCSSGVEPLFAVAFL
FT                   RRVMDNDELFEVNPRFEKIAKEEGFYSHELVKQIAHNGTLAGLEEIPAKYRRIFETAHD
FT                   ITPENHIAIQASFQRHTNNAVSKTINFPHQATEEEVRQAYLLAYELNCKGMTIYRDGCR
FT                   ENQVLNIGKTDKKAAAAVPVLPQKPFKRDRPAMLTGCTYQMSTGCGPMYVTINQDEDKH
FT                   LFELFNTVGKAGGCAASQCEAIGRLVSLAWRSGMPPEPMIKQLIGISCHKPAGFGENKV
FT                   TSCADAIAQAIRQHLEKTNGHRDQSLDEVNHLFGACPECGGVIEHEGGCCVCHACGYSE
FT                   CG"
FT   gene            367551..368000
FT                   /locus_tag="DaAHT2_0320"
FT   CDS             367551..368000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0320"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; KEGG: csa:Csal_1894
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85031"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6S2"
FT                   /inference="protein motif:PFAM:PF06094"
FT                   /protein_id="ADH85031.1"
FT                   /translation="MAKVMAKVKIKKAHRKFFLAALFLFLAASLFLLVAEQRGGVFRVE
FT                   VPESSPLYLEAEHPVFVYGTLRFALVRQLVFGGGGEPQPAVLPGYRRQGLDLLDEAESQ
FT                   VTGLLLQVGAVELAAMDRYERVGVRYQRLPVILADGTEAWVYRRL"
FT   sig_peptide     367551..367655
FT                   /locus_tag="DaAHT2_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.748 at
FT                   residue 35"
FT   gene            368170..368700
FT                   /locus_tag="DaAHT2_0321"
FT   CDS             368170..368700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0321"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swp:swp_2691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85032"
FT                   /db_xref="InterPro:IPR024513"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6S3"
FT                   /inference="similar to AA sequence:KEGG:swp_2691"
FT                   /protein_id="ADH85032.1"
FT                   /translation="MANQTIDQVARLFCQATKKTLDKSTGKSLKYANTLQDIPKVSLKP
FT                   AVGCFVQFNGDYNGLVIMNFSAGAAMELYRSYMLTMGMPESELANDYTSAEVVDTIGEM
FT                   TNQIMGRALRMVESNYELSSNMGQPKAIALNSAITLTPESEYQVSRRLSFSLETHRFYM
FT                   ELSLERTEFIAMK"
FT   gene            368837..369805
FT                   /locus_tag="DaAHT2_0322"
FT   CDS             368837..369805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0322"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="PFAM: ATPase-like, ParA/MinD; KEGG: dps:DP2935
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85033"
FT                   /db_xref="GOA:D6Z6S4"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6S4"
FT                   /inference="protein motif:PFAM:PF10609"
FT                   /protein_id="ADH85033.1"
FT                   /translation="MSTSCQSKKCNAQQQSTCQSKAATGARQNLDIDLALGKIRHKILV
FT                   MSGKGGVGKSTVAVNLAVGLARAGFKVGLMDVDLHGPDVCRMLNLQEPFAGTLEDGKMP
FT                   PWRTSDNLLVMSLENMLEDRDDPIIWRGPLKNQAIRRFIADVAWGELDYLVIDAPPGTG
FT                   DEPMTVAQMIKDARALVVTTPQRVALADVRKSLNFCKHVKLDVLGLVENMSGYVCPHCS
FT                   KTAELFKTGGGEELARSSGLPFLGRIPLDPRVMAAGDDGTPFVAMAVESPAITALQEMV
FT                   TAVAKALPVRRQAVAPPPLAMATPATGCGCQGVCDPNRCDC"
FT   gene            369966..370607
FT                   /locus_tag="DaAHT2_0323"
FT   CDS             369966..370607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0323"
FT                   /product="Hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="KEGG: dps:DP2934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85034"
FT                   /db_xref="GOA:D6Z6S5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6S5"
FT                   /inference="protein motif:PRIAM:3.1.2.6"
FT                   /protein_id="ADH85034.1"
FT                   /translation="MQITQLTVGSMGVCCYLLACEDSSQAMAIDPGGDEALILDHCRRN
FT                   NLQLKMLVCTHGHPDHVAANAALKEATGAEIVMHREDAAFFGKPEVGQYFSMLGLPPSP
FT                   PPDRLVQDRDTIELGSIKLEVIHTPGHTPGGICLYSPPHLFSGDTLFVGAVGRTDFPGG
FT                   DTATLVDSIRQRLLVLPPETVVWPGHGYGGSQSTIAAEAAENPFLQEKWY"
FT   gene            370627..372540
FT                   /locus_tag="DaAHT2_0324"
FT   CDS             370627..372540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0324"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /note="KEGG: dps:DP2933 selenocysteine-specific elongation
FT                   factor (SelB); TIGRFAM: selenocysteine-specific translation
FT                   elongation factor; small GTP-binding protein; PFAM: protein
FT                   synthesis factor GTP-binding; elongation factor Tu domain 2
FT                   protein; Elongation factor SelB winged helix 2; Elongation
FT                   factor SelB winged helix 3"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85035"
FT                   /db_xref="GOA:D6Z6S6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6S6"
FT                   /inference="protein motif:TFAM:TIGR00475"
FT                   /protein_id="ADH85035.1"
FT                   /translation="MREIVLGTAGHVDHGKTSLVKALTGTDTDRLKEEKARGITIELGF
FT                   AFLDLPCGHRLGIVDVPGHERFVRNMVAGAAGIDLVALVVAADEGIMPQTREHFEICRL
FT                   LGVERGMIVITKKDMVEAEWLELVQEEVRDFVQGSFLAEAPMLAVSSISGEGIAAVRET
FT                   LDQLVAASDFSEAHGPFRLPVDRVFTMKGFGAVVTGTSQAGRIALGDDVLFYPRRVPGK
FT                   IRGIQVHGREQNEVEAGYRTAINVQGVDKEEIRRGDVLATPGCLEPAFVFDAEFLYLSN
FT                   NEKKLKHRRRVRVHLGTAEVMGRVSLLEDEDLAPGGEAAVQLLLEEPVSVWPGDHYVVR
FT                   SYSPVYTIGGGVIRNCAAAKRRRFKEANREIFELYRSGSQEELALFHLRESGSTGLTLQ
FT                   ELSVRLGVFGKKTQKLLEKNISARKIIIIEPDKQRMIAGETLTALGAKAEKLLTDFHRE
FT                   NPLKSGLPSEELRRRLARDLSPRLFQILLTELLKQKRVVQEESLIRLASHQVSLAGDAE
FT                   TLRRELGQFYHRAGLSAPTIKETLEAHGKYPAELVRELLAVMVREEELVKVSEDLYYDA
FT                   RALAQLKEKLVAFLQAEGEIDAPRFKNLTGLTRKFSIPLLEYFDRTKVTLRIGDTRKLR
FT                   SG"
FT   gene            372672..373238
FT                   /locus_tag="DaAHT2_0325"
FT   CDS             372672..373238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pwa:Pecwa_0952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85036"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6S7"
FT                   /inference="similar to AA sequence:KEGG:Pecwa_0952"
FT                   /protein_id="ADH85036.1"
FT                   /translation="MMPTPHPQPGRRLAAVLEELASPEHYLFTSADLRGALPEISAGAF
FT                   KTLLSRAEKRGLLRRICRGLYLYPRVDYPRDLLLFHAAARLRADAFNYISLETALSDAG
FT                   VISQIPLNWITLMSSGRRNIVRCGHFGTIEFVHTSRQPATLANELTYDPRCRLWRASVA
FT                   LALRDMRATRRNLDLIDEELTRESA"
FT   gene            373225..374130
FT                   /locus_tag="DaAHT2_0326"
FT   CDS             373225..374130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0326"
FT                   /product="Domain of unknown function DUF1814"
FT                   /note="PFAM: Domain of unknown function DUF1814; KEGG:
FT                   sdn:Sden_0300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85037"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6S8"
FT                   /inference="protein motif:PFAM:PF08843"
FT                   /protein_id="ADH85037.1"
FT                   /translation="MNLLEQLAGEALRHRPELSLLRPAVEKELLHHDILRLLNEAGLLS
FT                   GLTFIGGTCLRACYGAERLSEDLDFSGGHDFRRESMAGLKAALENGLGAKYGLEVEVKE
FT                   PVREAGNTDTWKIRIITRPARRNLPAQRINIDICAVPSHDRRPLMLRNHYGVEMGTSGL
FT                   ILQAESREEILVDKLLALALRPNRVKNRDLWDIVWLKRHNINLSAALLARKIADRRLAP
FT                   EDFLNYLEQRQQLLAGGPDPRRDFIHEMTRFLAAATVEQTVAREDFWSYLLDSIADECR
FT                   QARTLLENLPQADNGVPRDS"
FT   gene            374282..374545
FT                   /locus_tag="DaAHT2_0327"
FT   CDS             374282..374545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0327"
FT                   /product="addiction module toxin, Txe/YoeB family"
FT                   /note="KEGG: gur:Gura_1444 addiction module antitoxin;
FT                   TIGRFAM: addiction module toxin, Txe/YoeB family; PFAM:
FT                   plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85038"
FT                   /db_xref="GOA:D6Z6S9"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6S9"
FT                   /inference="protein motif:TFAM:TIGR02116"
FT                   /protein_id="ADH85038.1"
FT                   /translation="MNWKLVYTKQAPRDAEKLAAAGLKPKAQQLLDILVDNPFQNPPPC
FT                   EKLVGDLAGACSRRINIKHRLVYQILEGLRTVKVLRMLTHYE"
FT   gene            374608..374709
FT                   /pseudo
FT                   /locus_tag="DaAHT2_0328"
FT                   /product="hypothetical protein"
FT   gene            374896..382215
FT                   /locus_tag="DaAHT2_0329"
FT   CDS             374896..382215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0329"
FT                   /product="YD repeat protein"
FT                   /note="KEGG: ank:AnaeK_1325 YD repeat protein; TIGRFAM: YD
FT                   repeat protein; PFAM: NHL repeat containing protein; YD
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85039"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6T0"
FT                   /inference="protein motif:TFAM:TIGR01643"
FT                   /protein_id="ADH85039.1"
FT                   /translation="MKSRQRAFKCKSWLAPLLLLVGILLLVGVSHTATDLVLGPEPTAI
FT                   AIHPDSEMAIISHEKDNRVTLLNLNNVEEKVTLPVGRAPMGVAINEATNTGLVCNSKDK
FT                   NVSVIDLEFFRELYSMEVGGRPRAVAVDSSRNRGMVVNRQDGTVSELDLYLGREDAVIP
FT                   VGRLPVAIAVDPGLNYAVVVDDVSPARDTVAIIDLDSRQVINKVEVGRGPVAVDIDPDS
FT                   HLAVVANERSSSLTVIDLATWESRHIPLEYRPVDVATSRVTGQALVLSRLNNLLLAVDL
FT                   ATGEIGKTYPVKHRAAALAVSPYSNRAAVVDASTNSLSLIQLDNPVPILQEVAPASADL
FT                   FSVPKTVTLVGHRFLKSAEVRLEKDGAILQLPFRFIDHRTLEVDLPDEVRSRPGQYLFR
FT                   VVNPEPVGGSSDPVMFEVRNVIKLEITSPADQSEVDVAGLTVSGTAISGYPITSVMVNE
FT                   VAAVYENGIFTAEIVLAPGENSITAVVQDQGGDTASSAITVNYTPKGPPDPVEEAPPLN
FT                   TTEATDIAAATEFLYTGPNPVQTGVEPETIEARRVAVLRGKVLNRNNVPLAGVTVTILN
FT                   HPEYGRTLSRADGLFDLAVNGGGLVTINYEKEGYLPVQRQVQTPWRDYVWAPDVIMIPL
FT                   DGRVTVIDLAAAETIQVAQGSEVADEDGARQATLLFAPGTTAEMVLPDGSSQPLSTISV
FT                   RATEYTVGDNGPEAMPAVLPANIAYTYCVELSVDEAMAAGATEVRFSQPVTFYLDNFID
FT                   FPVGGIVPSGYYDRVRGVWVPSENGRVVKVIGINNGLAELDISGNGQADSAEALAELGV
FT                   TTEERQNLAELYEPGKSLWRVPISHFTPWDCNWPYGPPPDAVPPPYDPPRPEDRDKPDD
FT                   PTECRGCVIEAESQVLGESIPITGTPHTLNYRSDRVPGYTGGRTIEIPLSGSSVPGSLR
FT                   RIELEIRVAGQVHRASFAPLPNQRTTFTWDGKDGYGRPVQGAVELTYHLRFVYPVVYLG
FT                   PANFRAAFGRAGGAAIGGSRGAAVLDFSRMHTVTLTGSVVDISGVGRWSLDRHHFYSAK
FT                   DNTTYRGDGTRQSATILGPIIETIAGTGSWGHSGGLAVNARLYRPSCVSIDPDGTIYIA
FT                   DTGNHRIRSVGTDGIITTHAGSGFRAGGLGDSGYSGDDGPAVNARLNSPTDIALGPDGS
FT                   IYIADSINHRIRRVGTDGIITTVAGTGPTGWWSGGFSGDGGSAVEARLDRPHAVAIGPD
FT                   GSIYIADTYNHRIRRVGTDGIITTIAGTGYRGFSGDGGPADEARLFGPIAVAIGPDGSI
FT                   YIADTYNHRIRRVGTDGIITTVAGTGSLGYSGDGGPATEASFSTPSGITFGPDGSLYIA
FT                   ANHRIRRVGTDGIITTIAGTGYRGFSGDGGPADEARLGPRGVSLGPDGSIYVADSNNHR
FT                   IRHIRQPITSLAYDEILIAAADHDEYYVFTPSGRHLRTLDSLTGTTRKTFSYDEQGRLV
FT                   RLEDGDGNATLIERNSDGDPTAIIAPDGQRTELALDANGYLASVTNPAGEAYRLAHTPS
FT                   GLLTKVIKPTGAKYTYNYNAVGRLTHTNDPDGGGWTIARTKTGTGTGGRMTSAEGRTWS
FT                   FDVDRLSKTELLRTSTNPDGAVSTRRITTTDSEITEVANTADGTVRTLRKGPDPRMGMS
FT                   APVLESAITTLPSGLQSTINFARLANLEDQDDPLSLVSLTDTVNINGRTLTSVYQAASR
FT                   TYTTTTTAGRTSSLVLDANGRISQSRPAGLLEVGYHYDLRGRLSSIAQGDGAQGRYLDF
FT                   TYDSQGYPAAISDGLGVLAAYEYDLAGRVTRQELADGREIRYGYDANGNLTAITPPGRS
FT                   PHLFTYTATDRQQEYLPPAAGAQPAATRYAYNLDGELTQITRPDGQTLELGYSGCCGKL
FT                   AYLDLPHGRIDYSYHSATGRLSGITTPENNTLAFTYDGFLPLTQSWTGEINGSVARGYD
FT                   NNFQLQSLNVNGQTITYGYDSDGLPIQAGDLTLARDPANGFLTGTSLAGVATTQAYNGF
FT                   GEMTAFSASHDATELFSTSFSRDQRGRITEKTETIAGTTTTFGYLYDEAGRLIRVTQDG
FT                   AIVEYTYDQNGNRLQHSAGGTTITGSYEAQDRMTAYGNATYQYTANGELLRKTQGTQVT
FT                   SYTYDVLGNLKAVNLPDGRNIEYIIDGSNRRIGKKIDGVLVQGFLYQDQLNPVAELDAN
FT                   GQVISRFIYASRANVPDYLIKNGTTYRIITDHLGSPRLVVNTSTGEIAQRIDYDEFGNV
FT                   LQDTNPGFQPFGFAGGLHDRDTNLTRFGARDYDPQTGRWTAKDPILFAGGDTNLYGYVL
FT                   NDPINWIDPEGKIGIAGAAVGGVIGAVSGALGAYTSGGNSWDIASAAFTGGLGGAVYGF
FT                   LPGAGLLAHIGKGAAIGGIQNFGAQFMGILNDPCQRFNYGSLAGSILGGAIGAGRANAV
FT                   KGLDSSALGQISQGILALGPSLAFGALGTSLGNL"
FT   gene            382743..383621
FT                   /locus_tag="DaAHT2_0330"
FT   CDS             382743..383621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0330"
FT                   /product="YD repeat protein"
FT                   /note="KEGG: ank:AnaeK_1325 YD repeat protein; TIGRFAM: YD
FT                   repeat protein; PFAM: YD repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85040"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6T1"
FT                   /inference="protein motif:TFAM:TIGR01643"
FT                   /protein_id="ADH85040.1"
FT                   /translation="MTNTPHQACLDAPAATRYAYNLDGELTQITRPDGQTLALGYSGCC
FT                   GKLDYLDLPHGRIDYAYHPATGRLSGITTPENNTLAFTYDGFLPLTQSWSGEINGSVDR
FT                   GYDNNFQLQSLSVNGQAITYSYDSDGLPIQAGDLTLARDPANGFLTGTSLAGVATTQAY
FT                   NGFGEMTAFSASHDATELFSTSFSRDQRGRISEKTETIAGITTHYVYHYDQAGRLIQVN
FT                   KDGGTAATYTYDDNGNRLQHSAGGTTITGSYDAQDRMTAYGNATYQYTANGELLKKTQG
FT                   AQTTRYTYDVC"
FT   gene            complement(383700..384485)
FT                   /locus_tag="DaAHT2_0331"
FT   CDS             complement(383700..384485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0331"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="KEGG: dma:DMR_29100 putative transposase orfB for
FT                   insertion sequence element; PFAM: IstB domain protein
FT                   ATP-binding protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85041"
FT                   /db_xref="GOA:D6Z0Z4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0Z4"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ADH85041.1"
FT                   /translation="MNPMPELIPMLKQLRLSGILDSLEARNRQAIEEKLAYTDFLAMLV
FT                   QDEVARRSQRKFAMRVRRANFRNHKTLEEFDFSFNPNINRALIMDLATCRFLEEGANLL
FT                   VVGPCGTGKSHIAQAIGHCAVRMGYDVLFTTQTKMLGQLHAARATNAYERRLNALAKVD
FT                   LLIIDDFGLKPLRTPQDEDIHDLIGERYERRSTIITSNLDLNEWGDAFPNKLLGSATID
FT                   RIRHGAYSLLLDGKSFRAARPLPKYPKNEVAENVKKGKN"
FT   gene            complement(384501..386030)
FT                   /locus_tag="DaAHT2_0332"
FT   CDS             complement(384501..386030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0332"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   dma:DMR_29110 putative transposase orfA for insertion
FT                   sequence element"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85042"
FT                   /db_xref="GOA:D6Z0Z5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0Z5"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADH85042.1"
FT                   /translation="MANRRFEMFQYRQVLTQMRSVQSDRQIAKAKLMGRRKAAQLRALA
FT                   QQQGWLDPAQELPDDAELAKVLALPAPGESAVPMLLPYQEQLKTWQAAGINGTTMYQAL
FT                   VREHGFTGSYSSVRRFLKTLKEDNPQATVMLDFAPGEAAQVDFGSGPKLLDSQTGKPFS
FT                   TWVFVMTLAFSRHQYAEIVRDQKVATWLGCHRRAFEFFGGVPAKVMIDNLKAGIIKACW
FT                   HDPAVNRSYAEFAEGYGFLISPCPPRQPQMKGRVESGVKYVKNNFLPLREFRSLVDANR
FT                   QLKEWVLATAGNRSHGTTKQKPLVMFAEAEKAFLKPLPAVAPELAVWAEHKLHGNCHLQ
FT                   FDKAYYSAPFKLVHKKLWVKATETTVKIYHQHQQVAVHPRCARPGQKATCVDHLPPDAV
FT                   AYLMRDPQWCLKQAGEIGPRCHHLVKRLLSHRVVDHLRAAQGVLRLAGKYGPERLEAAC
FT                   HRALIYDSPQYITVKTILGKGLDQQPPETEPVAAGVAYRGQGRFQRQQLFH"
FT   gene            386254..386820
FT                   /pseudo
FT                   /locus_tag="DaAHT2_0333"
FT                   /product="hypothetical protein"
FT   gene            387729..387992
FT                   /pseudo
FT                   /locus_tag="DaAHT2_0334"
FT                   /product="hypothetical protein"
FT   gene            388138..388631
FT                   /pseudo
FT                   /locus_tag="DaAHT2_0335"
FT                   /product="hypothetical protein"
FT   gene            388709..388810
FT                   /pseudo
FT                   /locus_tag="DaAHT2_0336"
FT                   /product="hypothetical protein"
FT   gene            complement(388831..390714)
FT                   /locus_tag="DaAHT2_0337"
FT   CDS             complement(388831..390714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0337"
FT                   /product="carbon-monoxide dehydrogenase, catalytic subunit"
FT                   /EC_number="1.2.99.2"
FT                   /note="TIGRFAM: carbon-monoxide dehydrogenase, catalytic
FT                   subunit; KEGG: dde:Dde_3028 carbon-monoxide dehydrogenase,
FT                   catalytic subunit; PFAM: Prismane"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85043"
FT                   /db_xref="GOA:D6Z6T4"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010047"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016101"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6T4"
FT                   /inference="protein motif:TFAM:TIGR01702"
FT                   /protein_id="ADH85043.1"
FT                   /translation="MAEKNKKSIEEKSLWEDARAMLRKAEQDGVETAWDRLEQQTPHCK
FT                   FCELGTSCRNCVMGPCRITAKMPRGVCGADADVVVARNFGRFIAGGSAGHSDHGRDLIE
FT                   VLEAIVEGETKDYQIKDEAKLRRIAGELGVADAGGGALAAVARAVMEILYADFGSRKKE
FT                   VAFLGRVPEKRRAIWQSLGMTPRGVDREIAEMMHRTHMGCDNDAASTLIHAARTALADG
FT                   WAGSMIGTELSDVIFGTPSPKKSTVNLGVINQEQVNILVHGHNPVVSEMIVAAANDPEM
FT                   LARAEAAGAGGINVAGLCCTGNEILARRGIPMAGNHLMTELAVVTGAVEAVVVDYQCIM
FT                   PSLLQAAGCYHTQFITTANKARFSGAVHFDIKPATALAQAKEIVQLAIDGFSKRDPQRV
FT                   EIPSQPVEIMTGFSNEAILNALGGSLTPLLEAIKAGKIRGVVGIVGCNNPKFQQDSGNI
FT                   GLTKALIQRDILVLVTGCVTTAAGKAGLLLPQAIDQAGPGLQEICGALGIPPVVHFGSC
FT                   VDNSRIIHLCALIAEELGVDISDLPVAASSPEWYSEKAAAIGLYAVASGIYTHLGLPPN
FT                   ILGSPAVTDLALNGLESLVGASFVVEPDPDKAADLLEARIVSKRKALGLPK"
FT   gene            complement(390895..392544)
FT                   /locus_tag="DaAHT2_0338"
FT   CDS             complement(390895..392544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0338"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: bfs:BF1027 putative iron-regulated transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85044"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6T5"
FT                   /inference="protein motif:PFAM:PF03929"
FT                   /protein_id="ADH85044.1"
FT                   /translation="MSFIFRFIFRVSKTLHKYFGLLLLIYLLPMGLSGLLLNNPGPISS
FT                   LSVPWAVTPDNYQPRNWNRMYLRAGTIIGDDWFLAGKPGVVHSPDGGRTFTMLDQGFPA
FT                   TPYRRDTLGLLVLPPPPGAETASPQVEGNQGPALELLAATRSGLYHQPPRQPWQAVELP
FT                   GARGEAVVDIVATDRELVAFTRSGAYRSPLPAHDRPSGAAPSAAKGTYRFTAADLAAAP
FT                   TTQPRPVPWFRILHDMHNGDIIGPAGKWLLDLVAVALIFLSLSALVIWYVPWRSRWLKK
FT                   WRRRPGRVFTFCWPWHLKIGVYAMAFLVILGVSGALVRPPLLIALAPYSLSQDHPLLAF
FT                   SPRSDDFGGNIQKALYLSDSDQILLATQGGFFQGPADFSHPFSPRRVPVPIHGMGVTVL
FT                   AEMEPGMILVGSFMGLYLWEEASGRTQRLPRPGLVGGNPYMSNDLLSAVVMEQVPAGAG
FT                   TGQWPRFRVDYHDGLMATDPRDYRRPPPMPAEIGRDTPMSLWHWLFELHNGRIFEKWLG
FT                   MSYMLIVPIGGVGLLLLSLTGLYDWFYRRKRS"
FT   gene            392859..394481
FT                   /locus_tag="DaAHT2_0339"
FT   CDS             392859..394481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0339"
FT                   /product="GTP-binding proten HflX"
FT                   /note="KEGG: dps:DP2918 GTP-binding protein HflX; TIGRFAM:
FT                   GTP-binding proten HflX; PFAM: GTP-binding protein
FT                   HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85045"
FT                   /db_xref="GOA:D6Z6T6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6T6"
FT                   /inference="protein motif:TFAM:TIGR03156"
FT                   /protein_id="ADH85045.1"
FT                   /translation="MLERLGRRRLDPDHIMTPEMARPMSELSREIGRQLGLIIDRSGQV
FT                   ELLLVGDHRSIMIPALPQNRVAGARLRGLRCLHTHLGGEKLTQDDFMDLLFLRLDLMSA
FT                   LEVDNQGRPGKLHSAHLNPRAMGERDPGAAAGAAKAEVKPWILLPPQQVSRQPDNLREL
FT                   ISSLEAEFSRLRPVREVDKGRDRAILVSVSSVPRAVAEESMAELKELAASAGVMVLAEV
FT                   IQRRDKINPRLILGRGKLGEIMLQALQLNANLLIFDQELNPSQVRSITDHTEMRVIDRT
FT                   QLILDIFARRALSREGRLQIEMAQLKYLLPRLGTRDDALSRLTGGIGGRGPGETRLEID
FT                   RRRTRDRLNTLAAKLKAVSKERYRRRERRRKKEIPVLSLVGYTNAGKSTLLNALTGSDI
FT                   LAEDKLFATLDPTSRRLRFPEEMEVIITDTVGFIRHLPAELLQAFKATLEELGEADVLI
FT                   HVVDISNPRFTEHIKVVEELLRELELDLLPRLTVFNKVDLLPDHEWVAAEAARYDAVVV
FT                   SALAPETLPPLLERARQAILKNW"
FT   gene            394635..395198
FT                   /locus_tag="DaAHT2_0340"
FT   CDS             394635..395198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dal:Dalk_0920 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85046"
FT                   /db_xref="InterPro:IPR025500"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6T7"
FT                   /inference="similar to AA sequence:KEGG:Dalk_0920"
FT                   /protein_id="ADH85046.1"
FT                   /translation="MRIFPGLLCWLAVIILLLPGPSVANEGRIDEMVVTNSDREVLLYF
FT                   QVRDFMTPEMEEGVKSGLPLTMIFLVELHRQRWGWRDRKLVELEFTHVLSYDSLKDEYR
FT                   VTREEEEGRVVSTASLAEARRLLGRVSGLAVLPLSELEPDQTYSLSAKARLAEKSRPPL
FT                   LGRLLPFRRLWSFETDWHSVEFYY"
FT   sig_peptide     394635..394709
FT                   /locus_tag="DaAHT2_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            395200..397449
FT                   /locus_tag="DaAHT2_0341"
FT   CDS             395200..397449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0341"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein; PAS fold domain protein; histidine kinase A
FT                   domain protein; KEGG: dps:DP2822 Ntr two-component system
FT                   sensor histidine kinase; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; PAS domain containing protein; histidine kinase A
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85047"
FT                   /db_xref="GOA:D6Z6T8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6T8"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH85047.1"
FT                   /translation="MTGINYEDIREEIVAQDRQRRRRRRRWIVLALLAFFALLTYFEAT
FT                   VFELGELDLPVSGNLLVFIMININILLLVAVVFLVLRSLVELIFERRRRVLGTRLRTKM
FT                   VISFVSLTLIPTGLLFFVSLQFVSTSIDYWFNINVEHSLVESLDLARDVYRDTRTETVR
FT                   EGEAIAALLQTRRYPYRPDQITQPFLRDTLNSHGLSGIEIIGEERSSLAAVYLPELAAA
FT                   GVPEVPADLLRQALGGESGLSVIQEVAAGELVRSLTPFTWSGLQQEEKAVLVLSRLIPA
FT                   ERLERMAAISSGLESYRQLMLFQTPIKTSLLVTLLIVTLLIVFCAIWFGFYVASGLTGP
FT                   IRKLAEATRRVADGDLEFELEKTSGDEMGTLVDSFNRMTRDLLASRRQIEQTAQELDRR
FT                   RRYTETILQNVAAGVISLDDSGRVITINRFAGELLKVRQEEIVGRHYRAILHREHLKVL
FT                   EGFLQELARSGKNSIQRPLRLTVEEEVLSLRINFTRLYDEEGRPLGVVLVFDNLSELEK
FT                   AQRMAAWREVARSIAHEVKNPLTPIQLSAQRLRKKYLERLAGDNEVFDLCTRTIISQVE
FT                   ELQRLVSEFSNFARMPAIAKSLNDLVVMVDDVLVLYREGHKEISFRREGEESVPLLFDP
FT                   KQMKRVLINLLDNAVAEVPAGQGEIKVLLSHDRERGVAVLEVCDNGPGIKEENKPRLFE
FT                   PYFSTKKAGTGLGLAIAGTVVTDHGGTIRVRDNQPHGACFVVELPLSGQSEPEEV"
FT   gene            397556..399367
FT                   /locus_tag="DaAHT2_0342"
FT   CDS             397556..399367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0342"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; response
FT                   regulator receiver; KEGG: cja:CJA_0757 putative signal
FT                   transduction protein; SMART: EAL domain protein; GGDEF
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85048"
FT                   /db_xref="GOA:D6Z6T9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6T9"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH85048.1"
FT                   /translation="MAFDQLCAMEICVVDEDPVRAQRLSALLRDEGDFTAVSWLDSQEA
FT                   LRQRFSPASPFDPPRPLHLALLSDSLPADNVLSLCKMLDEQGVTSVLMADAGGAWRGAE
FT                   ANRVFDAGAVDILFRPWSETEVIPRIFLALRLHQERLVRRRREVHLEKELAERRVMEAR
FT                   LKHRVGHDELTGLPNRSQLEGALELALIRAQNFQRSGALLYLDVDHFKLLNDTEGHESG
FT                   DKLLTGVAGVLRRRVLPRHLAVRIGGDEFAVLLENTTTEDVLKLAEELRELLHEYRFEG
FT                   CLGCYNLGASIGVALMSPGESLQAGELLSRADQACHVAKRRGRNRVHCYDPEDPEVVGL
FT                   KRDATWVPMLRQALRNGSFALEFQPIVRARDGACCHYEALIRLLENGKMYSPGEFIPSA
FT                   ERMGLIHQLDLWVVEAAVDRLAAMPLTEGQEPIRLSINLSAYALRNPVLMPLLERKLEM
FT                   TGLSPRRLMFEITETTAVTQLKQARELVERMRSLGCRFALDDFGSGFSTFNYLKHFPVD
FT                   MLKIDGSFVVNMLKNPTDELLVRSMVELAHSLDKQVIAEFVEDEATARRLREIGVDYLQ
FT                   GFYLGRPQSRMESLLPPSFLGAARAGS"
FT   gene            399375..400247
FT                   /locus_tag="DaAHT2_0343"
FT   CDS             399375..400247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0343"
FT                   /product="putative signal transduction protein"
FT                   /note="PFAM: Metal-dependent hydrolase HDOD; KEGG:
FT                   dde:Dde_1197 putative signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85049"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6U0"
FT                   /inference="protein motif:PFAM:PF08668"
FT                   /protein_id="ADH85049.1"
FT                   /translation="MSYSPLTDNSFDHVPVSLSPRDLVRGEITLASLPALYHELNRVVA
FT                   TPGSVAQDAALVIERDPALAARLLALVNSAYYGLVRQVDTIAHAITLVGLEELRTLVLA
FT                   TVVVEKFSGLPNELEDMADFWRQSLVCAVVARGLSLKTGRASVAGRLFTAGLLHRVGDL
FT                   LIFRRLPELARQALLHHRDNGLPRWEAERRLLGFDYAQVGAELAQWWQFPPELVELLAL
FT                   QQQPEKASICQQHCALLCLAVNAAHGGELPPAAASWQLAEVSPQVLAGILAEADRQVAE
FT                   IAGVYGISC"
FT   gene            400431..401825
FT                   /locus_tag="DaAHT2_0344"
FT   CDS             400431..401825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0344"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: dps:DP2823 Ntr family protein two-component
FT                   system response regulator; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; response regulator
FT                   receiver; helix-turn-helix Fis-type; SMART: response
FT                   regulator receiver; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85050"
FT                   /db_xref="GOA:D6Z6U1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6U1"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADH85050.1"
FT                   /translation="MKTEQQRRILVVDDEAGIRESMAGILADEGFVALTAENGEQGLEL
FT                   LENEPVDLVLLDIWMPGVDGMEILGRLRDLYPHLPVIMISGHGTIETAVQATRMGAYDF
FT                   IEKPLSYDKVILAINNALRLSRLEEENFIYRQQAKRHALTGESAPIRQLRQQIERVAPT
FT                   EAWVLIRGEHGTGKELVAQTIHRLSPAANQPMVELNCAAIPEELIESELFGHEKGSFTG
FT                   AATAKRGKFDQADGGLLFLDEIGDMSLATQAKILRILQEQKFERVGGAKTIKVNVRVLA
FT                   ATNKNLEEEIDKGNFRADLFYRLNVVPIFVPPLRRRREDIPLLVADFVAEFRNKSLGGK
FT                   DFTPEAVAVMQEYDWPGNVRELRNFVERTLIMSPEERIEAAMVRQLLALPGAAAGAAVD
FT                   PGSYLELSYKDAKRSFEREYLRMCLAANNGNISQTAEQIGLERSHLHKKLKTLELEPEG
FT                   NAPQGQ"
FT   gene            401847..403631
FT                   /locus_tag="DaAHT2_0345"
FT   CDS             401847..403631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0345"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="KEGG: sfu:Sfum_3055 ATPase; PFAM: ATPase AAA-2
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85051"
FT                   /db_xref="GOA:D6Z6U2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6U2"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ADH85051.1"
FT                   /translation="MSDTEDVNFPSQKELEREISEYLSNKYGKKVRIISAGQFPMAGQA
FT                   PAGDEEHAGQPAAVPPDFHFDLAPEELIAHLDQYVVGQEEAKAILATKICTHFNRISRS
FT                   LSRPGGEAGSGRNVGRIKNNVLLIGPTGVGKTYLIKLIAQHIGVPFVKGDATKFSETGY
FT                   VGGDVEDLIRDLVREADNDLERARFGIVYLDEVDKIAGGVDRRGLDVSRSGVQRALLKP
FT                   MEETEVEMKVPHDPIAMMEAVEHYRLTGKRQRKSINTRHILFIMSGAFSGLDEIIGRRL
FT                   QQRSIGFENTVAAAAPARPGALMARARAEDLVEYGFESEFIGRLPVLAVLSELSEDDLY
FT                   EILSSPNSAVVVGKKQDFRAYGIELRFEDAALRKLAALAARESTGARALVSVMERVLLH
FT                   FEKKLPSTDIRQLVVTPELVADPAGELAKLLKDSRVRKRHSKKCEKLAAAEQERLMTFI
FT                   RERLGDYLENHDVLPTPERLRMMAMEVEAEDLEPAEVCERFIDLVALVNDRARQVSRDC
FT                   GLELSFSEEAVDRLLARMPRSEETVGEACDQVLQAMEYGLRLLSQRRRAPELVIPADGV
FT                   DAPDSFINQVVNKTFKLE"
FT   gene            403799..404767
FT                   /locus_tag="DaAHT2_0346"
FT   CDS             403799..404767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0346"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="KEGG: dps:DP2824 delta-aminolevulinic acid
FT                   dehydratase; PFAM: delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85052"
FT                   /db_xref="GOA:D6Z6U3"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6U3"
FT                   /inference="protein motif:PRIAM:4.2.1.24"
FT                   /protein_id="ADH85052.1"
FT                   /translation="MIYPDYRPRRLRRNENLRSLVRETVLTPAQLIYPLFVMPGKNKRE
FT                   EISSMPGVFRLSVDQLAKEAKECRKLGVNHVILFGLPEKKDRVGSGAHATDGIIQRAIK
FT                   ELKNKAPELTVSTDVCLCEYTSHGHCGIIHEGMVDNDATVEVLARTALSHAKAGADIVA
FT                   PSDMMDGRVGEIRAALDEHNFDQVAIMSYAVKYASAFYGPFRDAADCAPQEGDRRGYQM
FT                   DPANAREALREATLDVEEGADILMVKPGMPYLDIIRLLRDEFDHPIAAYQVSGEYAMLK
FT                   AAAINGWLDEERVMAESLLSLRRAGADMILTYFAKQMAKLL"
FT   gene            404818..405657
FT                   /locus_tag="DaAHT2_0347"
FT   CDS             404818..405657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0347"
FT                   /product="protein of unknown function DUF785"
FT                   /note="PFAM: protein of unknown function DUF785; KEGG:
FT                   hha:Hhal_2272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85053"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6U4"
FT                   /inference="protein motif:PFAM:PF05618"
FT                   /protein_id="ADH85053.1"
FT                   /translation="MFIFSVLPWSLRLAVVVGLALLLGGCGSSRLVLAEQSELTQLHEE
FT                   LQRQQLQLAELALAQDETHFSLLDAAEEMRRQLAEIAADQKGMLTRQQEWEEFVRDNHL
FT                   LRSAQEEQKAALQVELPAFARTADDKQLVGAVEKVFLAPPGSMFSARIDTGATTSSLDA
FT                   HDIERFERDGESWVRFVLVDPEDDRRITMERKVVRHARIIQAVAEDPERRPVVKLGVTV
FT                   GHNTQTAEFTLSDRRHLEHPVLIGRNILRDIMVVDVSQRNIAPPRPPEEFVHPLPEE"
FT   sig_peptide     404818..404922
FT                   /locus_tag="DaAHT2_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.976 at
FT                   residue 35"
FT   gene            405662..407209
FT                   /locus_tag="DaAHT2_0348"
FT   CDS             405662..407209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_1106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85054"
FT                   /db_xref="InterPro:IPR025838"
FT                   /db_xref="InterPro:IPR025840"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6U5"
FT                   /inference="similar to AA sequence:KEGG:Tcr_1106"
FT                   /protein_id="ADH85054.1"
FT                   /translation="MRSRLLFYLLVLAMIMAGGFIAWQRHLQTGIPLLPGEQAPVWLVE
FT                   ARVDFNADGGAVTVNLDIPDDPPGFFLLAEQTASPGYGFSILEDNGNRRGEWTIRRASG
FT                   PQTMYYKIQLVPWGGQMASPAGAEERRAATRASVPEPVDVFWEEAEAVAARQLLAVARE
FT                   RSSTPESLTRELIKLLAAAEPDQNAALLLASSSLVPLLEKLLNYSRLPTRVVNGLYLED
FT                   GRRNQQLTPKLEVFVGGRWQLFDPHTARQGVPDNFLLWNQDRRSLLDVSGGYNSQVRFA
FT                   MLSQYVPSVQLARTTAGGSGFDLFGVHSLPVEEQAMLKMLLLLPVGALVLVFMRIMVGV
FT                   QTSGTFMPILIALAFLKTTLLPGLISFVSIVAFGLLLRGYLSGLNLLLVARIATIVIIV
FT                   IFIIVLSSLLGYQLGFNTGMTVTFFPIIIIAWTIERMSILWEDEGPWEVLKQGGGSLLV
FT                   AVLAYLLMQWPVMAHWSFHFPEINLIVVALIMLMGNYTGYKLLELHRFRALVRSEEA"
FT   gene            407206..408162
FT                   /locus_tag="DaAHT2_0349"
FT   CDS             407206..408162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0349"
FT                   /product="alpha-L-glutamate ligase-like protein"
FT                   /note="KEGG: cja:CJA_0063 alpha-L-glutamate ligase homolog;
FT                   TIGRFAM: alpha-L-glutamate ligase-like protein; PFAM: RimK
FT                   domain protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85055"
FT                   /db_xref="GOA:D6Z6U6"
FT                   /db_xref="InterPro:IPR011758"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z6U6"
FT                   /inference="protein motif:TFAM:TIGR02291"
FT                   /protein_id="ADH85055.1"
FT                   /translation="MSWWISPQRLRRLGILGMNCRNVDFIGRYNPRRLYPLVDDKLKTK
FT                   ILAEKHGIPAPQLLFSVREQFRLRKLAELLQPLTGFAVKPAKGSGGKGILVIQGQQDGV
FT                   YLKASGRRLGLEDVKRHISNILAGLYSLAGTPDAAIVEQLIQLDPRFENYSYQGIPDIR
FT                   VIVFQGYPVMAMLRLATQASDGKANLHQGAVGVGLDIATGRCLKAVQYSLPLTRHPDTG
FT                   ADFTRLQISDWPELLTMAARCYEVTGLGYLGVDIVLDKQRGPLVLELNARPGLAIQVAS
FT                   EQGLLARLRRLENLDRRHDSVAQRVEFTRRFFAGEPV"
FT   gene            complement(408192..409067)
FT                   /locus_tag="DaAHT2_0350"
FT   CDS             complement(408192..409067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0350"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: dps:DP1330
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85056"
FT                   /db_xref="GOA:D6YZP9"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZP9"
FT                   /inference="protein motif:PFAM:PF01171"
FT                   /protein_id="ADH85056.1"
FT                   /translation="MNAPSKPASQPPPGGCEEAAAKPTRLPAEINRLVGKAMHRYGMLA
FT                   DGDRVMIAVSGGIDSLVLCRLLDLWRRKAPIHYELLPVHLDMGFAGYRPRPGLYGGGPL
FT                   PPEAGALQADGLLPPLPGTGAAVQEQLEKLGLPYLIEETTYGPEALAAEEGKNGCYHCS
FT                   SRRRNRLFALAREHNCNKLALGHHQEDIIETFFLNLLYGGNISTMIPNQRLFAGRLHLI
FT                   RPLALLSKEMIQQLGRLFAVAAVPNPCPLTDLSKRHTVRTMVRQLTADDPRITANIFAA
FT                   LGNVRSDYLL"
FT   gene            complement(409074..409670)
FT                   /locus_tag="DaAHT2_0351"
FT   CDS             complement(409074..409670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0351"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="KEGG: ppd:Ppro_3040 imidazoleglycerol-phosphate
FT                   dehydratase; PFAM: imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85057"
FT                   /db_xref="GOA:D6YZQ0"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZQ0"
FT                   /inference="protein motif:PRIAM:4.2.1.19"
FT                   /protein_id="ADH85057.1"
FT                   /translation="MSTTTRQGSIQRRTGETDIDLTLVLDGRGRNKISTGVGFMDHMLT
FT                   LLAVHGFFDLEITARGDTQVDDHHTVEDLGIALGQALQQALGGKEGIARYGAAAVPMDE
FT                   TLVRVTLDCSNRPYLHYGVEVPEQKVGNFDTSLAKEFLRAFSLHGGLTLHVELAHGDNS
FT                   HHIIEAIFKALGRALNQAVTVDPRLSGPLSSKGML"
FT   gene            410029..410103
FT                   /locus_tag="DaAHT2_R0007"
FT                   /note="tRNA-Gly1"
FT   tRNA            410029..410103
FT                   /locus_tag="DaAHT2_R0007"
FT                   /product="tRNA-Gly"
FT   gene            410236..410664
FT                   /locus_tag="DaAHT2_0352"
FT   CDS             410236..410664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0352"
FT                   /product="ribosomal protein L13"
FT                   /note="KEGG: dps:DP1327 50S ribosomal protein L13; TIGRFAM:
FT                   ribosomal protein L13; PFAM: ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85058"
FT                   /db_xref="GOA:D6YZQ1"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR023564"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZQ1"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ADH85058.1"
FT                   /translation="MKTHLAPVKDIDRKWYVVDAEDLILGRLASEVATRLRGKHKPIYS
FT                   TFMDTGDFVVVLNADKVKLTGNKWADKVYYRHTGYIGGIKAETAEKLRDRKPEELVYRA
FT                   VKGMLPKNPLGRKQLKKLKVYAGSEHPHQAQQPETLKF"
FT   gene            410757..411152
FT                   /locus_tag="DaAHT2_0353"
FT   CDS             410757..411152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0353"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: dps:DP1326 30S
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85059"
FT                   /db_xref="GOA:D6YZQ2"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZQ2"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ADH85059.1"
FT                   /translation="MADNGIYATGKRKTAVARVWLKPGSGKILVNKQAVEEYFDGGAFS
FT                   RAVVEKPLLLTETQAKFDVMATLKGGGKNAQAEALRHGISRALTEADPELRQALKRAGL
FT                   LTRDPRSKERKKYGQRAARASFQFSKR"
FT   gene            411293..412330
FT                   /locus_tag="DaAHT2_0354"
FT   CDS             411293..412330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0354"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; KEGG: dps:DP1325
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85060"
FT                   /db_xref="GOA:D6YZQ3"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZQ3"
FT                   /inference="protein motif:TFAM:TIGR01850"
FT                   /protein_id="ADH85060.1"
FT                   /translation="MIRVGIIGASGYTGAELVRLLANHPGVELTLVTSRQYAGKPLAAV
FT                   FPHLTGSTELVCEDPTGLKTAGRADVFFTAVPHQTAMAVVPELLASGAKVVDLSADFRL
FT                   HQQQVYEQWYQTHSAPELLAEAVYGLPELHRAAIAQARLVANPGCYPTSVLLALAPLLK
FT                   AGCLDPGSLIIDAKSGTSGAGRAAQTGTLYCEVTDGFKAYKVAEHRHTPEIEQELGKLC
FT                   GQELTVSFTPHLVPMSRGMLSTIYATLAGDYGQGELETILRDYYREEPFVRVLPAGQLP
FT                   ATQYVRGSNFCDLALRVDRRNGRVIVLSAIDNLVKGAAGQAVQNLNLLCGLPEAQGLGI
FT                   VPLFP"
FT   gene            412481..413239
FT                   /locus_tag="DaAHT2_0355"
FT   CDS             412481..413239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0355"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="TIGRFAM: tRNA pseudouridine synthase A; KEGG:
FT                   dps:DP1324 tRNA pseudouridine synthase A; PFAM:
FT                   Pseudouridine synthase I, TruA, alpha/beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85061"
FT                   /db_xref="GOA:D6YZQ4"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZQ4"
FT                   /inference="protein motif:TFAM:TIGR00071"
FT                   /protein_id="ADH85061.1"
FT                   /translation="MVKVKLTIAYDGTDFAGWQRQLNRPTIQAVVEEALARMLGEQVVL
FT                   HGAGRTDAGVHALGMVASFNAPRRLPLAAYRLGLNSMLPPAIRIMAADEAADDFHARFS
FT                   AKGKLYRYCFSTAAVMPPCRRLYRAHLPGPFAAERVRQLLPQMLGEHDFSTFEAAGSRD
FT                   RDRAGGRGGVRRLNLLQLEQEDPAGQEFCFELGGDGFLRHMVRNIVGTLVAIGQGRPLA
FT                   EPVALLVGRDRARAGPTAPACGLTLVKVIY"
FT   gene            413320..414531
FT                   /locus_tag="DaAHT2_0356"
FT   CDS             413320..414531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0356"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   gur:Gura_2501 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85062"
FT                   /db_xref="GOA:D6YZQ5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZQ5"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADH85062.1"
FT                   /translation="MDAPIIELAARVKEIKASPTLAVDAKAKALKAEGADVLNFSVGEP
FT                   DFDTPPHVCEAGKAAIDEGFTRYTPVPGILPLREAVCHRLATDHGWRYQPDQIQVSCGG
FT                   KHGLYNMAQALFGPGDEVLIPAPYWVSYPPIVQLAGATPVIVPLDEASDFDLDPAVLQQ
FT                   YATPRTRGIILNSPSNPTGSVLSARALEAIGKMALENSWVVISDDIYDTIVYGDDKLPH
FT                   ILEVDPRLSEQTLILNGVSKSFAMTGWRIGYTAGPKHIIAAMNKIQSQSTSNPSSVAQK
FT                   AALAALNGPQDFPRQMRDAFVPRLNFIMEALTAIEGVTCVRPRGSFYVFPNLSAYFGRQ
FT                   SQDGRVIGDSVALADYLLEEALLATVPGAAFGADQFVRFSFATSMGVLEEGMKRLADAL
FT                   AGLR"
FT   gene            complement(414738..414941)
FT                   /locus_tag="DaAHT2_0357"
FT   CDS             complement(414738..414941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85063"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZQ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85063.1"
FT                   /translation="MEGTFQEGWYTHPTLGLIRVFTSGSEWVYVCYTSNGRKALSRERP
FT                   LDGWTWALSEPSHTSPSGFADQ"
FT   gene            complement(414995..415489)
FT                   /locus_tag="DaAHT2_0358"
FT   CDS             complement(414995..415489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0358"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="KEGG: dps:DP2966 iron-dependent repressor; PFAM:
FT                   iron dependent repressor; SMART: iron dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85064"
FT                   /db_xref="GOA:D6YZQ7"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZQ7"
FT                   /inference="protein motif:PFAM:PF01325"
FT                   /protein_id="ADH85064.1"
FT                   /translation="MPRSGKRLSASLEDYLETIHHIVEEKQVARAKEIATRLKVSRSSV
FT                   TEAFRSLSQKGLINYAPYEVITLTPAGTKVARDVIRRHQALKDFFLRVLAVEEELAEEG
FT                   ACQIEHTAPRPIIERLSLLMNYLDECPQGGADWIKNFNRYCQTGKTPDKCRECQNTNDN
FT                   Q"
FT   gene            complement(415570..417852)
FT                   /locus_tag="DaAHT2_0359"
FT   CDS             complement(415570..417852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0359"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: mpl:Mpal_0921 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85065"
FT                   /db_xref="GOA:D6YZQ8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZQ8"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ADH85065.1"
FT                   /translation="MDIEQNKQTASAAPASKLLLLGSKVQITNLPVKEVSLLREGSLPA
FT                   YGYNPGDQIELLAGRISIEEGRLEQTGTWLSTYLGRVGLNPAIDSHTYGEQKEIFQIFR
FT                   NRRADRETDPADGWFMFQQFLPPEGRKASTRQLEITPDNRPQLAGNQGIMVIDDSGRPP
FT                   AASDEFKQLNPNAWVIALGIGVAHWQSWAKQFGDKFCLFCRLSDLETTRMEMDSSVIWE
FT                   TIVAMTLRALKTSEVGLWKNGRFTCHIIVEMFPHGIMYLGPDGGYFRHRPGCLPEKSSP
FT                   RHKGSAPCYDTLATSLLASDWLQAGGPYFCRNAFFDYSTRLLNNWQLLHQSGYAFDGGL
FT                   RFPELDFSSTFPDGTPCSFVETKSDSCFIDLAQLTPEFEQELDVVSCQQWHETKKEAVR
FT                   GLFPWPVSSYVKEQMGSMANDCIGVIAEVLHYLKNEVSWKNGFADLRMFSVGNLRTTDP
FT                   AEIEPVVTLQNVMDSYVSREQVQRPLCVGVFGPPGSGKSFAVKEVAKVIGRRFDISPFD
FT                   FFEFNLTQFDGPEEINSAIDAIRASVAKGKVPIVFWDEFDCRYDNHEFGYLRYFLPSMQ
FT                   DGITYVHGVPYNIGRSIFVFAGGVKSSYDGMAALLESAEPATRQLVRTLKIPDFLSRLR
FT                   VVLDIDDIEIPRDLLCNQAGPQELAKLRRILIKRAFIIAHQMDTHWKKAARKTSGLLLR
FT                   LLLAEYKFGARSIEAVIEASGASDRLVYGLPELIAPSAARVHASWQVELERLVDLARKQ
FT                   QGLREIW"
FT   gene            complement(417924..418892)
FT                   /locus_tag="DaAHT2_0360"
FT   CDS             complement(417924..418892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0360"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   set:SEN2104 GDP-fucose synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85066"
FT                   /db_xref="GOA:D6YZQ9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZQ9"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADH85066.1"
FT                   /translation="MTTKQRVYVAGHRGMVGSAIVRQLAPCKHIELITRDRSELDLQDQ
FT                   KQVSDFFRATAIDQIYLAAAKAGGILANNSYPAEFIYENLMIACNIIHAAHTAEVNKLL
FT                   FLGSSCIYPKLAPQPMREEALLDGFLESTNEPYAVAKIAGIKLCESYNRQHCRDYRSII
FT                   PTNLYGPNDNFHPLHSHVIPALLRRIHQARETGADEVVIWGSGSPRREFLHVDDLATAA
FT                   VFLMNLPREDWAAQTRPMRSYVNVGTGLDCTIAELAATIANITGFTGRLVFDRNQPDGT
FT                   PRKLLDISRIKALGWQPQIPLERGLRETYHWLLAHQESALG"
FT   gene            complement(418935..420017)
FT                   /locus_tag="DaAHT2_0361"
FT   CDS             complement(418935..420017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0361"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="KEGG: tbd:Tbd_1776 GDP-mannose 4,6-dehydratase;
FT                   TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM: NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85067"
FT                   /db_xref="GOA:D6YZR0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZR0"
FT                   /inference="protein motif:TFAM:TIGR01472"
FT                   /protein_id="ADH85067.1"
FT                   /translation="MKKAFITGVTGQDGAYLAELLLQKGYEVHGLKRRTSLFNTDRIDH
FT                   LYEGPEIKNRRFILHHGDMTDSSSLIRIIQQVQPDEIYNLAAQSHVAVSFEEPEYTANS
FT                   DALGVLRLLEAIRILGLENKTRFYQASTSELYGLVQETPQRENTPFYPRSPYAVAKLYA
FT                   HWIVVNYREAYGMYACNGILFNHESPVRGETFVTRKITRALARIKLGLQERLYLGNLNA
FT                   SRDWGHARDYVEMQWLMLQQQQPEDFVIASGRHYSVRDFVNTAAAELGISLNWQGEGVA
FT                   EKGYDADGHCIVAIDPRYFRPTEVDTLLGDAGKAREKLGWTPKTSFKELVAEMVREDLK
FT                   TAERDDLVKRHGYDTCNYHE"
FT   gene            complement(420275..420742)
FT                   /locus_tag="DaAHT2_0362"
FT   CDS             complement(420275..420742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0362"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /note="PFAM: phosphatidylglycerophosphatase A; KEGG:
FT                   dps:DP0749 phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85068"
FT                   /db_xref="GOA:D6YZR1"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZR1"
FT                   /inference="protein motif:PFAM:PF04608"
FT                   /protein_id="ADH85068.1"
FT                   /translation="MDKLIMLLATGFGLGRLPKAPGTWGTLAAFPVHWAIMGLSWQLYA
FT                   LSLAGIIVLAVIISGMAEKILDRPDPGMVVIDEVAGMLIALIAVPATFTAWLLAFVLFR
FT                   FFDILKPFPIRFIDRRCHGGLGIVLDDLLAGLYALGCIHLLLYFFPAIGGA"
FT   gene            complement(420735..421958)
FT                   /locus_tag="DaAHT2_0363"
FT   CDS             complement(420735..421958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0363"
FT                   /product="protein of unknown function DUF111"
FT                   /note="PFAM: protein of unknown function DUF111; KEGG:
FT                   dps:DP0748 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85069"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZR2"
FT                   /inference="protein motif:PFAM:PF01969"
FT                   /protein_id="ADH85069.1"
FT                   /translation="MTGNIAYLDCFSGVAGDMLLAALLDAGLPRAYLDEQLAGLGLRGY
FT                   RLEFTRVQRGALQSGRLQVVQDDTAVQPRRDWQSIRALLEGARLDAGVRDHALAVFAAL
FT                   AAAEGKVHGQPPEKVHFHEVGAIDSLVDIVGVAAGLHYFGLERLVCSPLPLARGWVESS
FT                   HGPLPLPAPATLELLREVPVYGLDLEMELVTPTGAAVIKALADDFGPPPPMSIEQVGYG
FT                   AGGRERPDGKPNLLRLLLGRSEPVAEAQAVEVIETQLDDWAAEGFPHLCDRLFSLGALD
FT                   VSLTPLLMKKGRPGYLLRVLGEPAAAPALKECLLSETTAIGLRFHRQQRQTLPRQTGVV
FT                   TTPWGEIAVKKVKAPGGERLYPEYESCRAAALRHKVPLLQVHTLVAAMPPEQCRPCPAP
FT                   GQEEKPNG"
FT   gene            complement(422113..423069)
FT                   /locus_tag="DaAHT2_0364"
FT   CDS             complement(422113..423069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0364"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="KEGG: dps:DP0747 methionyl-tRNA formyltransferase;
FT                   TIGRFAM: methionyl-tRNA formyltransferase; PFAM: formyl
FT                   transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85070"
FT                   /db_xref="GOA:D6YZR3"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR015518"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZR3"
FT                   /inference="protein motif:TFAM:TIGR00460"
FT                   /protein_id="ADH85070.1"
FT                   /translation="MSRSRPYRIIYMGTPEFAVAPLQALLDHGEEVAAVVCQPDRPKGR
FT                   GKKLSPPPTKELAEHKGIPVLQPSKIRTDEFLDEIRSYQPDLLVVAAYGRILPGPLLNL
FT                   PPLGTINIHGSLLPAYRGAAPIQWAIINGEAETGVTIMQMDEGMDTGDILLQRRMPIHD
FT                   DDTSGSLAARMSALGGQALVEALELLKADQLPPIKQDDTQATMAPLLCKTMADIDWKLP
FT                   ATKISCLIRGLDPWPLARTTLEGQILRLFKPATASEPAGAPPGTITMLQPENNLLGIAT
FT                   GEGCLLVEEIQREGGKRLPIGAFHRGHPLKLGQKLGT"
FT   gene            complement(423066..423668)
FT                   /locus_tag="DaAHT2_0365"
FT   CDS             complement(423066..423668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0365"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="TIGRFAM: peptide deformylase; KEGG: geo:Geob_0951
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85071"
FT                   /db_xref="GOA:D6YZR4"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZR4"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ADH85071.1"
FT                   /translation="MAIQPIVQFPVPSLKSRAKPVSEFNDELRRLALDMIETMHAAPGV
FT                   GLAAPQIGVPLRVVVIAGRVTLDEEQRAALAQEHGEAGEAAPSPPSPPSEEELAPSLVL
FT                   INPEIVEAEGQQVDEEGCLSVREYATNVKRFARIRVKAQDLSGQPLDFVAEDFFARVIQ
FT                   HELDHLDGTLFIDRISPLKRTLYRKKLKKIMQAEEKP"
FT   gene            complement(423675..426245)
FT                   /locus_tag="DaAHT2_0366"
FT   CDS             complement(423675..426245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0366"
FT                   /product="primosomal protein N'"
FT                   /note="TIGRFAM: primosomal protein N'; PFAM: DEAD/DEAH box
FT                   helicase domain protein; helicase domain protein; KEGG:
FT                   dps:DP2206 primosomal protein N' (PriA); SMART: DEAD-like
FT                   helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85072"
FT                   /db_xref="GOA:D6YZR5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZR5"
FT                   /inference="protein motif:TFAM:TIGR00595"
FT                   /protein_id="ADH85072.1"
FT                   /translation="MSKQTPVYFEVAVAAPIHQTLTYAPPAGVAQLPPGHRLLVPLGRR
FT                   QVTGYLLDCAAQPPALKDGGNDRQPGGKIRAALEVLDDEPLFPAAMVPFFRWIADYYHH
FT                   PIGEVIQNALPAGLSRRSTRIIKLTDRGAEKLPSLAQSTASKRNSPLPLSDWLPELLAR
FT                   GELSATKSATVIRRRPPELKRWQDEGLIEIDNRLRRESVRAQTETIIFLPALPPAKLPP
FT                   DAAANIKKHTTKKGSDPFSSSVALKPSEDKTLALLTELAANNPNGVPRRELLKRYPGAG
FT                   RALKGLLARNQISTFEQRRYRDPFGEAPPFFPRPERLTDEQSAVMARLTPAIEGRQYTP
FT                   FLLHGITGSGKTEIYLRAAEAALAAGRQVLVLVPEIALATQLEGHFCSRFGNAVALLHS
FT                   GLSGGQRYDQWSLLLSGEAQIAIGARSAIFAPLADPGLIIVDEEHDPAYKQEDGLRYNA
FT                   RDLALLRGVKQQATVLLGSATPAVSSYHAARQGKFELLQMTRRVEDRPLPAVEIVDLKA
FT                   VRTVSGLPPLFSPQLIRALRENLAAGQQSLVFLNRRGFANLVLCKDCGRPVQCRHCQVT
FT                   LTYHKKADLLLCHHCGYRQPRASLCGHCHSGTLVPAGFGTERLEEELRRHFPAARLARL
FT                   DQDTSRDRKEFLKVLKAVRDHEVDILIGTQMITKGHHFPRVTLVGIVWADAGLGIPDYK
FT                   AAERTFQLLTQVTGRAGRGEQPGRVLVQTLQSEHYSIALARAHDYQGLYEQEIALRQRL
FT                   GFPPWGRLINLRFDGEKEEKVRELALRLGEIARGRADSGIKVLGPAPAPLSRLKDRFRW
FT                   QLLLKGRGVAPLHRLCQALLGEYARLAGASTVKLSLDVDPENML"
FT   gene            complement(426255..427127)
FT                   /locus_tag="DaAHT2_0367"
FT   CDS             complement(426255..427127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0367"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /note="TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; KEGG: adg:Adeg_1970
FT                   UTP-glucose-1-phosphate uridylyltransferase; PFAM:
FT                   Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85073"
FT                   /db_xref="GOA:D6YZR6"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZR6"
FT                   /inference="protein motif:TFAM:TIGR01099"
FT                   /protein_id="ADH85073.1"
FT                   /translation="MKVRKAVIPVAGLGTRFLPASKAIPKEMLTIVDRPTIQYIVEEVV
FT                   NSGIEVIIFVTSEGKSAIENHFDYDFELDTMLRQKNKPELYEEVRHISNLIDIIAVRQK
FT                   KPLGLGHAIWSARNVVGHEPFLVLLGDDLVLSDNLPCCRQMLNLYDEVQESIVAIQRVA
FT                   PEETGQYGIVEGEPVRDRVHKVQRMVEKPPPGTTDSDLAIIGRYLLQPDIFDLLQTTTP
FT                   GHGGEIQLTDALMALARKRPLYAYEFEGTRFDAGDKLGYLKAIIAFARCHPTLGPEFRQ
FT                   HLKEVCAAL"
FT   gene            427441..428484
FT                   /locus_tag="DaAHT2_0368"
FT   CDS             427441..428484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0368"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="KEGG: dps:DP2932 cell cycle protein MesJ; TIGRFAM:
FT                   tRNA(Ile)-lysidine synthetase; PFAM: PP-loop domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85074"
FT                   /db_xref="GOA:D6YZR7"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZR7"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ADH85074.1"
FT                   /translation="MHPLEKKVKKSIAGHRLIAAGELVVVGTSGGPDSMALLYALKTLS
FT                   AAMHFNLLAVYVDHGLRPEESREEEQLMAAVAAALEIPWRGGRVAVRDYARQQGLSLEH
FT                   AARELRYRFFAQVAAETGAAKIAVAHTADDQAEELLLRLLRGTARGGLSGMAPLARGRI
FT                   IRPLLAVSKAEVLAYLAQRNIAFARDSSNQDLRFVRNRVRLELVPWLKQRFNPRLRETL
FT                   CHTATVLQDEEELLAAMADEAYRQARVAGEPAKAALTLSLPFFAAQPRALQRRLLEMAL
FT                   LELQLKPAGRQIEQLLHGADRGGKGVIGHLAGGVTVYKDAKSLRFHREAPGPRRRPPAS
FT                   GKSTNQP"
FT   gene            428588..428664
FT                   /locus_tag="DaAHT2_R0008"
FT                   /note="tRNA-Arg1"
FT   tRNA            428588..428664
FT                   /locus_tag="DaAHT2_R0008"
FT                   /product="tRNA-Arg"
FT   gene            complement(428773..429843)
FT                   /locus_tag="DaAHT2_0369"
FT   CDS             complement(428773..429843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0369"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   sun:SUN_1537 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85075"
FT                   /db_xref="GOA:D6YZR8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZR8"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADH85075.1"
FT                   /translation="MSELFVFDRIQFVSIIFSLFILGFIFNLVKKRRMKEEYSLLWFFM
FT                   SLFLLYMSVDRYAIDRLGALVGVAYPPSVLMLLTTGFTFLVLVHLSVVVTRLSEQNNEL
FT                   IQEMGLGKLEEAKKNADILVIVPAYNEGNNIVEVITDLLNNAGLPLDVLVINDGSIDHT
FT                   GPAARATGRALVIDLPKNLGIGGAVQTGFKYAARHNYQIAVQFDGDGQHLASELPKLVQ
FT                   AIQARHADLVIGSRFVHKHAGFRSTFVRRLGIRTFQLLNSLLIGQKITDNTSGFRAYSQ
FT                   PAIRFLAKHYPTDYPEPEAVILLGRNGFKITEEATEMRERQGGDSSISGLLGIYYMLKV
FT                   TLGIIMTALRKPLTRD"
FT   gene            430107..430235
FT                   /locus_tag="DaAHT2_0370"
FT   CDS             430107..430235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85076"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZR9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85076.1"
FT                   /translation="MNPRQAISILLLSPFYLRLPPTARLALVREFCANFASSESNS"
FT   gene            complement(430313..431128)
FT                   /locus_tag="DaAHT2_0371"
FT   CDS             complement(430313..431128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0371"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   geo:Geob_1466 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85077"
FT                   /db_xref="GOA:D6YZS0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZS0"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADH85077.1"
FT                   /translation="MNPEKILAKPLISITMPSYQQATFLEEAVRSVLDQAGVEVELLVM
FT                   DPGSTDGSRELLLKLREEYGEKLRLYFEPDQGQSDAINRGFDLAHGRILAWLNSDDRLQ
FT                   PGALAKISGWLASEEPRWLYGRAGMIDELSRPHGSLIVWYKNWRGRRFSRLKLLTEDFI
FT                   PQMAVFWNRPLWELAGPLDINRHLDMDYDLWLRFARITDPQVLTEYLADFRVHGAAKGS
FT                   RQTGAQLDAALVTAREHAAELGLKGKLAVGLAHILSWRTRLAYRWLKPS"
FT   gene            complement(431161..432294)
FT                   /locus_tag="DaAHT2_0372"
FT   CDS             complement(431161..432294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0372"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mae:Maeo_0394 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85078"
FT                   /db_xref="GOA:D6YZS1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZS1"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADH85078.1"
FT                   /translation="MKIGFFTYGIHGERMTGIARYTVELTRALSKIEPDLEIILLNPYP
FT                   ESDHPWYQEFPSHPLPHLRKLPLAATLGNLELHRAATRLRLDILHDPCGIAPFLAPKGG
FT                   YLRVTTIHDALPAVYPQIQQLLTRMVFATLVKRAGSNSDAIFTVSQASAADLIKFYKFP
FT                   AAKVHVTLEGVAPPNDLSRKQVEKAMERLGVVPPFLMSVGALHPRKNIQRILKAFAIVH
FT                   RTHPEAKLVIAGPPSWGENEEFLSVRDAVVGDSGVVFTGYIGDLELGALYQRTHGLVFP
FT                   ALYEGFGLPVLEAMSHGAPVLTSNVSSLPEVAGDAAILVDPTSVDEIAKGMRRLLEDED
FT                   LRIELSHKGRSRSQTFSWQATAMETLRVYHLLLDQAG"
FT   gene            complement(432291..433514)
FT                   /locus_tag="DaAHT2_0373"
FT   CDS             complement(432291..433514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0373"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mpl:Mpal_0354 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85079"
FT                   /db_xref="GOA:D6YZS2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZS2"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADH85079.1"
FT                   /translation="MKILLVIPYFMPAISYGGPVKVAYEIARGLVARGYEVTVATTDAL
FT                   DATSRVGRTTEVMEGISVLRFRNISNKLAKKCNGYLPVLLIPWLARNCRRFDVIYCHDF
FT                   FSLPTVAAGWLSRYYQIPLLLQPHGSLSALRRSARFAAVKRLLIFFFLGILRGARNIIA
FT                   LTVEEKKGIETLDPSLAAKVVVIPNGLNPAEFADIPGTDLHRRYNIPQNHKIIGFIGRL
FT                   AYIKGLDISLTVLETLKDRLAFSFLVIGPDEGEMSRLKQQVQTSGLEDRVIFAGILEGE
FT                   EKMRVMKSCDFFLFTSRDEGLPLTILEVAALGRPQIASEECHVPELAEYQAGLLHPLND
FT                   LAGFARSIETLIDQEPERQVMGVNARKMVRERFSTGAMLDRIDQLLKIGPGSENKSAAT
FT                   TTGKEQVP"
FT   gene            complement(433511..434731)
FT                   /locus_tag="DaAHT2_0374"
FT   CDS             complement(433511..434731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0374"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   sat:SYN_00820 mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85080"
FT                   /db_xref="GOA:D6YZS3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZS3"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADH85080.1"
FT                   /translation="MKKIGIFLEVPPHFGGTFQYTQTMLDAVAALPRDRFTVVAGYVDT
FT                   VWRDYLEPYTSVKKIHIPRGFWGRALGLAWLLLRLPMGPWRRLCPWFHPMAKAMLKEQC
FT                   DLWIFPAQDARSFQMPVPALVTVLDVAHLYDGQRFPEAASRWELLYRIPLYANICRWAK
FT                   GVIVLSPIDKQQVMESFHLAEERIHIMPMVVPRYIEVAKTPPDFELRYQLPAKYLFYPA
FT                   QFWEHKNHKKMLRALATLKPELPDLKLVLVGSPKNAWDSVLQLIKELDLAEHVLILGYV
FT                   PDADMPELYRRARALIYASCYGPTNLPPLEAMALGCPMALAKVTCMPDRVGDAALVFHQ
FT                   DSVAEMADCIRRLWTDDGLCADLSERGKARAAQWKQPQFNQRLEEIVAGLTTDKGGKKP
FT                   IRPAAAT"
FT   gene            complement(434728..435501)
FT                   /locus_tag="DaAHT2_0375"
FT   CDS             complement(434728..435501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0375"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG:
FT                   rlt:Rleg2_4222 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85081"
FT                   /db_xref="GOA:D6YZS4"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZS4"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADH85081.1"
FT                   /translation="MPDIFADYSEFYDLLYEDKPYPDEARFIADLLNRYADPAGSVRTV
FT                   LDLACGTGRHCFELEAMGYQVAGSDISAPMIARAQAAAAARASQATFYNHSFQEAAKIG
FT                   KRFDAVISMFSAIDYLTGHHDLTTALENVSQLLPPGGLFVFDYWNGNAVINNYSPVREL
FT                   RKRRGNLEVHRTSTTRLDLVEQIAEVNFQFRCLVAGQSEHEFREQHRVRYFFFREIETY
FT                   LELGGFDLIHRGTFMAEDFSPTSWNIAVVARKRAT"
FT   gene            complement(435507..436628)
FT                   /locus_tag="DaAHT2_0376"
FT   CDS             complement(435507..436628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0376"
FT                   /product="Glutamine--scyllo-inositol transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="KEGG: rlt:Rleg2_4223 glutamine--scyllo-inositol
FT                   transaminase; PFAM: DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85082"
FT                   /db_xref="GOA:D6YZS5"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZS5"
FT                   /inference="protein motif:PRIAM:2.6.1.50"
FT                   /protein_id="ADH85082.1"
FT                   /translation="MKTIPVAQPVLGEEERANVLAALEAGAISGFFGDYLGRFEREFAA
FT                   WCGCSHGIAVSSGTAALHVALAALEVGPGDEVLVPTLTNMATFFAVHYQGATPVPIDIE
FT                   TDTLNLDPALLEEKITPRTKAIMVVHLFGHPVDMDPVLALADRHSLAVIEDCAEAHGAE
FT                   YRGNRVGGLGSIGCFSFYANKIITTGEGGMCTTNDDALAEKIRTLKSLAFGSENKFMHS
FT                   AVGFNYRMTNLQAALGCAQMAKISQLIQLKREVAQEYNRLLTDCPELQLPVEKGYAHNV
FT                   YWMYHVVLAGHAAGRRAEVMAKLAAAGIETRETFIPYNLQQHLPLAAHIGREDCPRANA
FT                   VAQRGFYLPSGPVLAQEQIAHIAEQLLTAVAAT"
FT   gene            complement(436625..437023)
FT                   /locus_tag="DaAHT2_0377"
FT   CDS             complement(436625..437023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0377"
FT                   /product="cupin 2 conserved barrel domain protein"
FT                   /note="KEGG: rlt:Rleg2_4224 cupin 2 conserved barrel domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85083"
FT                   /db_xref="InterPro:IPR008894"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZS6"
FT                   /inference="similar to AA sequence:KEGG:Rleg2_4224"
FT                   /protein_id="ADH85083.1"
FT                   /translation="MQLTSKKPAFADARGEIVDIVEKIPFDSLTVITSRQGAVRGNHYH
FT                   RETTQYTFILAGKCRYRSQKPDQPAEEAIMVKGDLAVSPPLESHAFEALEDSVLLAFCQ
FT                   GPRSGSQYETDTFRLVEPLIPSNEDEGA"
FT   gene            complement(437063..438283)
FT                   /locus_tag="DaAHT2_0378"
FT   CDS             complement(437063..438283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0378"
FT                   /product="C-methyltransferase"
FT                   /note="PFAM: C-methyltransferase; Methyltransferase domain
FT                   protein; Methyltransferase type 12; KEGG: rlt:Rleg2_4225
FT                   C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85084"
FT                   /db_xref="GOA:D6YZS7"
FT                   /db_xref="InterPro:IPR013630"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZS7"
FT                   /inference="protein motif:PFAM:PF08484"
FT                   /protein_id="ADH85084.1"
FT                   /translation="MACRLCGSTNLAKFLDLGFTPPADGFLRREQLQEPETWYPLEVML
FT                   CRACGFIQLSYVVSPEVLYRHDYPYESSTTRAGRLHWEEFATTASRRLGLNPDDLVVDI
FT                   GSNVGILLEAFRNHGTRILGVDPASNIVRIAEKRGIETLNEFFGHEVAREIVAAKGHAA
FT                   VVTATNVFAHVNDLRSFMHAINFLLHQQGVFIFEAPYFVNLLNHLEYDTIYHEHLSYLS
FT                   LKPLVNFFGEFGMEIFDVEERDIHGGSFRVYIGRRGQHPVAPVVGKMIQAEEDQGIYDL
FT                   AVLNRFAAAVADNRRELRLLLHQLKHQGKRLAAVSAPAKGMTLLNYCRIGTETLDFVTE
FT                   KSTLKIGRFTPGTHIPVQADAALLEQMPDYALLLAWNFAAEIMDNLAEYRERGGKFIIP
FT                   IPTPTIV"
FT   gene            complement(438345..439679)
FT                   /locus_tag="DaAHT2_0379"
FT   CDS             complement(438345..439679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0379"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   gbm:Gbem_3446 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85085"
FT                   /db_xref="GOA:D6YZS8"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZS8"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADH85085.1"
FT                   /translation="MNKFWTRFLPTFIKRQVEGRAYLQNVVGNTGWQFGDHLVRMTVGL
FT                   VVGIWLARYLGPEQFGLFSYALALVGLFAALGSLGLDDIMVREIVRRPEARNEILGTSL
FT                   LLRLFGGAVSLLAALGTVMVLRPDDDLSHWLVGIIAAGALFQAFHVIEFWFHSQVQAKY
FT                   AVLARNSAFLFCSLLKIGLIVAGAQLIYFAWVALLEVMLGAAGLIIAYTLKSGSLRQWQ
FT                   ARLKKAKKLLYDSWPLMLAGLVVMVYLRIDQVMLGEMAGHQEVGIYSVAVRMAEVWLFI
FT                   PTALYWSVFPAIVEARATSEELFYERLQKFYNLTALTMYAVAVPVALLAHWLVPLLFGA
FT                   DYASGGLLLAVLIWANVFAGLEMARSSFLTVMNWTRIYLVTVTLGCLLNVGLNYWLIPI
FT                   YGGMGAVIASLAAYWFAAHGSCFLFKPLHRTGGMLTRALFYPKIW"
FT   gene            complement(439713..440867)
FT                   /locus_tag="DaAHT2_0380"
FT   CDS             complement(439713..440867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0380"
FT                   /product="conserved hypothetical ATPase"
FT                   /note="KEGG: cbc:CbuK_0058 hypothetical ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85086"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZS9"
FT                   /inference="similar to AA sequence:KEGG:CbuK_0058"
FT                   /protein_id="ADH85086.1"
FT                   /translation="MEIIRRFFQSPNGSFFLFGPRGTGKSTWLQTILPGAIRVDLLDPE
FT                   TQRLYQARPERLRELVAGRPKAREVVIDEVQKVPTLLDVVHQLVESDRRLRFVLTGSSA
FT                   RKLRRGGYNLLAGRLVEAGMHPFMAAELEDSFNLSKALEIGLVPLVWSSPDSAATLRAY
FT                   ASLYLREEVQAEALVRDIGAFSRFLEAISFSHGNQLNLAEVARECQVGRKTAEGYLVIL
FT                   EDLLLAFRVPVFTRRAKRHLVAHSKFYYFDAGVFRSLRPTGPLDRPSEIAGPALEGLVA
FT                   QHLRAWIAYRQSDARLYYWRTKSGNEVDFVLYGQDVFTAIEVKHAAHVHGKDLRGLQAF
FT                   REDYPEASVLLLHLGQERLEIKGIPCLPCEEFLKGMHPDRPLLV"
FT   gene            complement(441065..441469)
FT                   /locus_tag="DaAHT2_0381"
FT   CDS             complement(441065..441469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0381"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyc:PCC7424_1593 ComEC/Rec2-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85087"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZT0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85087.1"
FT                   /translation="MIIGLPNIPYRFGGHNLGRDTVLIAAWSMSLWFGAVILSCWRDRK
FT                   LIWLAPVVSFILITNALSFFSFPYYGYRADQKIILEKIHDWNRSEPVEVALVLSWRGLA
FT                   FSQNTCIDHTIPMLKMVGIISPQREVIVVQ"
FT   gene            complement(441531..442781)
FT                   /locus_tag="DaAHT2_0382"
FT   CDS             complement(441531..442781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0382"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: maq:Maqu_1721
FT                   transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85088"
FT                   /db_xref="GOA:D6YZT1"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZT1"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADH85088.1"
FT                   /translation="MTKSTPTALSQQGNNVADPLTDLLRDGARMLIAQAVEAELQAFMA
FT                   QYSSRLEDGRRTVVRNGYLPGRTIQTGIGDVEVKVPKVRDRSGQGLKFNSSLLPPYLKR
FT                   ARSVDELLPWLYLRGISTGDYQEALAALLGEQAKGLSANTISRLKAKWLAEHTKWRQRD
FT                   LNGKRYVYWWVDGIYSNVRMDDKLCLLVIIGVTDQGHKELIAVEDGYRESSDSWYELLA
FT                   GLRARGLTTGPELAVGDGSLGFWNALGRVYPKTRHQRCWVHKTANVLNKMPKKLQLKAK
FT                   ADLHDIWMAETKEDASQAFDRMLARFEDKYPKAMECLAKDRDELLAFYDFPAEHWVHIR
FT                   TTNPIESAFATVRLRSKRSRNCGSRDTTLTMVFKLLQSAEKRWKKIKGFRRLAEVVTGI
FT                   QFKNGIKVSDQPMRMAA"
FT   gene            complement(442850..443023)
FT                   /locus_tag="DaAHT2_0383"
FT   CDS             complement(442850..443023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85089"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZT2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85089.1"
FT                   /translation="MITNKLLRTGALIAIALITFTVFFADGYLQWVNSDTAGEAYGLSQ
FT                   DRVIVKSGVWDN"
FT   sig_peptide     complement(442940..443023)
FT                   /locus_tag="DaAHT2_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.961 at
FT                   residue 28"
FT   gene            complement(443036..444055)
FT                   /locus_tag="DaAHT2_0384"
FT   CDS             complement(443036..444055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0384"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   cti:RALTA_B1309 prophage-derived bactoprenol glucosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85090"
FT                   /db_xref="GOA:D6YZT3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZT3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADH85090.1"
FT                   /translation="MEDQTFTLTVVVPVYNEAEVLPTLQHRLITVLDGLLKAAWEIIYV
FT                   NDGSTDNSLEIISNFNDPRVAIIDLSRNFGKEIAMSAGLDHAHGDAVVVIDADLQDPPE
FT                   LIPELIQKWQDGYDVVFAQRIARDGETWLKKTTARLFYRAIHTLSRVKIPENTGDFRLL
FT                   SRRAVEALRLLRERHRFMKGLFAWVGFTQVAVPYQREPRFAGKSKWSYWRLWNFALEGF
FT                   TSFSIAPLKLATYVGLLTAFGAFIGAILVFYKTLIFGDPVRGYPSLMVVILFLGGVQLM
FT                   ALGMIGEYLGRLFNEAKQRPLYLINRLTPSILQGKAEEPGPGTLAKPRNAAFSNNGDN"
FT   gene            complement(444217..444642)
FT                   /locus_tag="DaAHT2_0385"
FT   CDS             complement(444217..444642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0385"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: sde:Sde_0136
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85091"
FT                   /db_xref="GOA:D6YZT4"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZT4"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ADH85091.1"
FT                   /translation="MNGIGKLMAGVDNKQVISQFVLFSSVGIIGTSVHFFILIVLVQLL
FT                   AVSPVTASMAGFTGGALTNYFLNYHVTFRCRNPHLEALPKFLSVSLVGLCLNTLIMALA
FT                   VIWMHYLISQVLATACVLVWNFFCNRHWTFRKSVVEP"
FT   gene            complement(444714..446732)
FT                   /locus_tag="DaAHT2_0386"
FT   CDS             complement(444714..446732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0386"
FT                   /product="membrane protein required for N-linked
FT                   glycosylation-like protein"
FT                   /note="KEGG: cjd:JJD26997_0595 general glycosylation
FT                   pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85092"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZT5"
FT                   /inference="protein motif:COG:COG1287"
FT                   /protein_id="ADH85092.1"
FT                   /translation="MTNLRLFIRNHQLALLLLLCAIAVYGLSVYQKEADYRLWQAQHDE
FT                   YFVESVPPMASRDAYYWLKMARDLDDGQLGRGLSNPTRGYPDLPEYHDPNLLAWLISKG
FT                   AKLTGGDYYRSGLLLVSVLGGLFIFPLVIYFNRLDFGLAAIFGGLVGTFSLAYYQRSLM
FT                   GYLDTDLLNLFFPLAVACFIMPMSRDRSLATNLGLAVGGGMMMYLYNWWYEQPALMLVH
FT                   LVFILFYLLLSRLSLRQILLITAVFILASGPIYALHSVGSLLNFLQAYFLPPPTGQIAW
FT                   PDIMGEIAEAQVKDPWLVLKRIHGFAPVIIAGLAGLIYLYVREFRRMVLVTPMILIGLW
FT                   SLFGPVRFAMYLAPFIGVGAGVMIELAARKAGERLHLPPPAVNLAAVALMFGIFFATAA
FT                   HTGFYRQPTPTIPLETTRSLLEIKKLVPRHSAMLTWWDIGYPLMEIGNFATYHDGSLHG
FT                   GLRSALIAKALTSSSQEELTALLAYLEDHGFATLEELIVQEDISASALKELVFTYPGEF
FT                   RGESVHILYTDDMIRKFGSISLFGTWDYHRQTGDILWYERWNCTSRVGNIYKCAEGIAD
FT                   LDRGVISDGVVDVPLVAVLFINNGQVLNRRDYHPDARYYLQIVMHDHQIYQVQVVEDRL
FT                   FASNFNQQYLLGNYDRRYFEEIYNNFPTARVFRVLPQ"
FT   sig_peptide     complement(446637..446732)
FT                   /locus_tag="DaAHT2_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.714) with cleavage site probability 0.669 at
FT                   residue 32"
FT   gene            complement(446820..449393)
FT                   /locus_tag="DaAHT2_0387"
FT   CDS             complement(446820..449393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0387"
FT                   /product="protein of unknown function DUF1566"
FT                   /note="PFAM: protein of unknown function DUF1566; KEGG:
FT                   shw:Sputw3181_0674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85093"
FT                   /db_xref="InterPro:IPR011460"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZT6"
FT                   /inference="protein motif:PFAM:PF07603"
FT                   /protein_id="ADH85093.1"
FT                   /translation="MLLLLLLAGGCDQREEKVPAPEVPAETALEAEVALEEQTALETEP
FT                   APPPIPVEPVEFLLTYQAGEHGAIEGRARQQVPQGGSGSAVKAVADPGYHFTGWSDGLT
FT                   TAARQEQEVTADLTVTAAFAPNRYPLQYEVEGAGEIVGESRQVVEYGQAGEAVRAVAAE
FT                   DHHFVGWSDGVTAAGRQDIARGELTVRAVFAPNTYRIGGRVDGLVEGTELRLQNQDEQL
FT                   IITTGGPFFFAEPHPTGTPYQITISRQPAAPSQTCTVREGHGVINRQEVNDIEVACVID
FT                   TFRIGGRLTGLPPGQKIVLHNNEADPLTLAGDGDFLFPTPLEDGSAYLISLQGPAPGDN
FT                   WRCEVENASGVLAGRDVGEVEISCAIIPVLQARIGRNNIELTWNHEDFPGAAFNLCRAR
FT                   EEIPAAGAADCRAFAAGLAEPAVTSPHRAEALINDLTYWFQLAVRPVNGRTEYSDPISA
FT                   APFGGLNDTGIDWCADERNNHGREGIRADRVAGCEQLAAGHPDQDGHLGRDAAAQARLL
FT                   PKRGSGSGGFDFTRVCASGEKAGEGRCPPNPALGDGPDNWACVRDNVTGLLWEVKNIGG
FT                   RRGAGHTYSWYQPDGNGTQGYVGLADGGHCTGSDCDTAAYVELLNETGLCGTRQWRLPT
FT                   RRELLSIVNNSRHDPAAETTFFPHTQADHYWTATTFADQPGSAWQVYFRYGESYPAAKE
FT                   QSYHLRLVQGRTVTFGGAHPEFAPGAAQEFTYYDDGTVRHNITGLQWLRCSLGQTWDGQ
FT                   ECTGQATALTWQEALQAAAAFEFAGHNDWRLPNKNELEALVATQRSLPAIRQEAFPGTP
FT                   AQYFWTSSPYAVLGHAAWSVDFGSGTVNASIKSGKLPLRLVRDDW"
FT   gene            complement(449503..450042)
FT                   /locus_tag="DaAHT2_0388"
FT   CDS             complement(449503..450042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0388"
FT                   /product="putative methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   KEGG: dal:Dalk_0432 putative methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85094"
FT                   /db_xref="GOA:D6YZT7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZT7"
FT                   /inference="protein motif:PFAM:PF00672"
FT                   /protein_id="ADH85094.1"
FT                   /translation="MPTKKRKKLNLAVKRQFQYWLLTRIFGVIVLSATVAVLILYFYAR
FT                   QEISESFYTAHIQLRRVSDLLLPVIFAGALISLVSGMVLAFFLPQKIAGPIYRIQQGLH
FT                   AIHGGDLTTQITLRRNDILTDVATQVNETAAELRLQLAEIKQHQRQLERIINTLENEEA
FT                   AAAAARQKAVLNRLRT"
FT   sig_peptide     complement(449902..450042)
FT                   /locus_tag="DaAHT2_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.671) with cleavage site probability 0.347 at
FT                   residue 47"
FT   gene            complement(450110..451315)
FT                   /locus_tag="DaAHT2_0389"
FT   CDS             complement(450110..451315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0389"
FT                   /product="doubled CXXCH domain protein"
FT                   /note="PFAM: doubled CXXCH domain protein; KEGG:
FT                   sus:Acid_6877 fibronectin, type III domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85095"
FT                   /db_xref="GOA:D6YZT8"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZT8"
FT                   /inference="protein motif:PFAM:PF09699"
FT                   /protein_id="ADH85095.1"
FT                   /translation="MNRLPQAKKLPPLLLVIVVLVFLPPASAADPDFKQCRNCHNSALE
FT                   RDTFRLYQHPVFNRGQCTSCHSPSSLKEVLPAAPQQAAAPENETVQWLGDSLLADTNHW
FT                   FLVGGEDLKSRLVVETRGNRRLPARWELLVPPLAGIDSVADRGRAPVITELQVLEIRRG
FT                   LFLTATIGWQTDSISDARVRYGSTELNRTSPAHNRLGRRHQVVLRDLQPNQTYHFAAVS
FT                   RDLFGRRQESETLTFTTTSPRLGSQPSTSLSPAETDSRQAEPEIIYQRHGDNFLLQLTF
FT                   EQPAMVAVGSSGPPRQETALITDQQTMEPEEKADHSMLNSQADTTITACIQCHQGRLGT
FT                   ATHPVNVYPPPGMVIPPTYPTLPDGRITCISCHRRHGSSNAYILIRSGQRELCLGCHQN
FT                   MR"
FT   sig_peptide     complement(451229..451315)
FT                   /locus_tag="DaAHT2_0389"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 29"
FT   gene            complement(451371..452696)
FT                   /locus_tag="DaAHT2_0390"
FT   CDS             complement(451371..452696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0390"
FT                   /product="cytochrome C family protein"
FT                   /note="TIGRFAM: cytochrome C family protein; KEGG:
FT                   gbm:Gbem_3057 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85096"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZT9"
FT                   /inference="protein motif:TFAM:TIGR01905"
FT                   /protein_id="ADH85096.1"
FT                   /translation="MKSFSKQHWQRRGMVLATIGTACLTFAAVAVGGSYRDSAHGNSDY
FT                   GVNRSAIDPALANYATGNCAHCHESHASIEGREPEPSHGAAPKLLFARSFNRERTANPY
FT                   LETDNFCFYCHNEESGPRVRNEDYSATFGGALSGSGPQSILAAFNQTSYHNLYDIRNFL
FT                   RGTPGFGHFTAHSNPCSACHNPHLTKRNHDPGLPGFPLLSAITRPNEPGRLWGESETMA
FT                   DLLDHYEAPFAFADNREPAGVGQEDGTNTPDYVTFCTTCHNPDHYLWSTAHGRYLKKIN
FT                   WGNSGLRQDKHGALGRDGADHFREPYASPASHQNNFLLSCLDCHEPHGSENIRLLRRRV
FT                   NGEDLEMNISALDETMSHLCRRCHTDDQAAGAGTGEANRWEYVHHLAPGAPYVQNMCGQ
FT                   CHDGHEGGGSGSIKSPIACGHCHGHGMNDSWAGDLQTGRRTF"
FT   sig_peptide     complement(452604..452696)
FT                   /locus_tag="DaAHT2_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.881 at
FT                   residue 31"
FT   gene            complement(452680..454179)
FT                   /locus_tag="DaAHT2_0391"
FT   CDS             complement(452680..454179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0391"
FT                   /product="NHL repeat containing protein"
FT                   /note="PFAM: NHL repeat containing protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85097"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZU0"
FT                   /inference="protein motif:PFAM:PF01436"
FT                   /protein_id="ADH85097.1"
FT                   /translation="MSAMMGLPQNSKPAPDNREAAAGHCSTAGKITFRRLFQAALLLPI
FT                   VLVLLAVAGVPAAPASQPRGIDSITTITADQDGANLRHPSSLFYDHHAQELYLINGGAG
FT                   RVVVYGADFFPVATIGPGRGVDAPRGVFVTPDGMVYIVQSNSRQNPYNRITILNGAFFV
FT                   EREIILNEIPEAAEFAPSQVAVSRDGLIYLSGSTKRGVLVLDNEGNFLRRLEPMDMISD
FT                   QEAIAAAAAKREESDQWPASVVPIAPPATEIDDLDQPRSRRPEEAAQREKEFARLTEEL
FT                   ETARDIWADIPEEFRPRTEEEREEARVRRGLGPPRINRVVIDREGNLFLVSAETGRIYV
FT                   YSPEETFLYAFGEKGGTPGKMSQPRGVAVDERRNLIFVNDYMRHTILAYDFNGRFRFEA
FT                   GGYGNAPGWFNFPADIAITRQNQFVIADLFNRRVQVLEIRDRQSTADQQEKTEPPAAAI
FT                   VITDEQNLLTDTPARPAFAGDESKQEATNGGQGESSDEKLQ"
FT   gene            complement(454130..454825)
FT                   /locus_tag="DaAHT2_0392"
FT   CDS             complement(454130..454825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0392"
FT                   /product="cytochrome C family protein"
FT                   /note="KEGG: gur:Gura_3839 cytochrome c family protein;
FT                   TIGRFAM: cytochrome C family protein; PFAM: doubled CXXCH
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85098"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZU1"
FT                   /inference="protein motif:TFAM:TIGR01905"
FT                   /protein_id="ADH85098.1"
FT                   /translation="MKTFAIFNMQPLRTWPRSAGLRSLEGLAVILLALGLSFTMVGQAA
FT                   GSQAENCLSCHHSKKEWQNRPHIHPPMNEGCGSCHGEPHSDEHRRQLRGEGARQLCIDC
FT                   HPEMAASDPDRHDSVRFVHGIIGGAGCTGCHDPHTSDHPFLLVQPINRLCLSCHPRLRG
FT                   VSRGHPISGHPVAGHEEGRRPGRQLSCSSCHDPHGSPFRHLLFETPLGGYFCHECHDGL
FT                   APKQQTSAR"
FT   sig_peptide     complement(454691..454825)
FT                   /locus_tag="DaAHT2_0392"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.787 at
FT                   residue 45"
FT   gene            complement(454822..456285)
FT                   /locus_tag="DaAHT2_0393"
FT   CDS             complement(454822..456285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mac:MA1904 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85099"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZU2"
FT                   /inference="protein motif:COG:COG3391"
FT                   /protein_id="ADH85099.1"
FT                   /translation="MMDHLFPSPLCYRAAGHRLLLLALLIMLLPGQGCRPEAPPLPRLP
FT                   EAVERHPSETARLSFFLTLADSTGPSVRVVISELAILADQHWVTVTDQTLTLESAQIAA
FT                   GQLFLGARAAVPGRYQRLRFTVERVEKKGPDGSYQVLAAETFPVEQPLPAPLTLESKDS
FT                   RSLFISWDVEATLQQENFAPVFTLAEQVTPLLADLAYVACPDIDTIFVIRTDRGWVADS
FT                   FGLPGSPSHLALDNATDQERLLVLAPGEMAVKLVDLSSQRVIDQFHLPLTSPPTFMTTS
FT                   PDGRWAYILEEQSGYLSRLDLETGHVAARVRLEHQPLYAAWLPDQQWLAVAVARSQAVL
FT                   LLTPRELNPVRTIPTGNAPQGLLAAAGQLYITERRDHTVLVYDLNTNQPLARLEAGLEP
FT                   RRLLATDNHVYVSNHRDGTITVIAPGLPGVIREIRGLGRPLEMIYDPSRRQVLVGEEET
FT                   GGVAVIDAANRLRDRIIFGARPAGMVMMP"
FT   gene            complement(456289..457401)
FT                   /locus_tag="DaAHT2_0394"
FT   CDS             complement(456289..457401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0394"
FT                   /product="doubled CXXCH domain protein"
FT                   /note="PFAM: doubled CXXCH domain protein; KEGG:
FT                   ank:AnaeK_3172 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85100"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZU3"
FT                   /inference="protein motif:PFAM:PF09699"
FT                   /protein_id="ADH85100.1"
FT                   /translation="MGMRKVLTLLFFLGCCGLGAELLLPNETPAAVTGICSNCHTMHNS
FT                   QQGLPVAYTLDGSGQPILRETPFPQLLKTDCVGCHTNAGPETIVLEGTTRIPIVYNLTQ
FT                   PTYPPDGSSASTLAGGNFHWLSQGDSFGHNVHGITGPDPRFSFAPGGKSRPEGCMHCHG
FT                   TLATPQSGCQGCHVPHHHAGGPGEVAKRQAGWYRFLGSVMQAADAKPNPPPEGVIGIED
FT                   PDWEQNPAADRHNTYQGHGGGYVNYLESGSISQKCAGCHGIFHAGTAADSAWIRHPVDH
FT                   TIPDTGEFADFTLYNPMVPVARPGVEAIDANFSAVDHNSDMVSCVSCHRPHGSPYPALL
FT                   RWGYRDWPGTDSHTGEAAFNGCAVCHTAKD"
FT   gene            complement(457427..458323)
FT                   /locus_tag="DaAHT2_0395"
FT   CDS             complement(457427..458323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0395"
FT                   /product="NHL repeat containing protein"
FT                   /note="PFAM: NHL repeat containing protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85101"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZU4"
FT                   /inference="protein motif:PFAM:PF01436"
FT                   /protein_id="ADH85101.1"
FT                   /translation="MRSTKMIKLVKILPLLAALAFLPGAAAAQEGSPWQWQLSLLIDTP
FT                   GNAMYMPAAVAFDRESERYYAVDTGRNRLVSFNRQGELLRAFTADDRLQAPFDMVRLDD
FT                   GRLWVVEKGRNSLTLIDIGARKVTPHTLHDGDRLVFPHRIALGEGKLHVLDRASGQILR
FT                   LNADLGVEQRFRCRDCLGGISDFVISNGEIWALETRDRKIYRFADDGAISQTISLDQEA
FT                   SFPVSLALDGGGFVYVLDRQRNSILTYDENGRFRYRFLGPGHARGQLHFPRQLRFDPWG
FT                   RLCVVDEGNGRVEIYSR"
FT   sig_peptide     complement(458237..458323)
FT                   /locus_tag="DaAHT2_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.958 at
FT                   residue 29"
FT   gene            complement(458346..459551)
FT                   /locus_tag="DaAHT2_0396"
FT   CDS             complement(458346..459551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0396"
FT                   /product="cytochrome C family protein"
FT                   /note="KEGG: gur:Gura_1996 cytochrome c family protein;
FT                   TIGRFAM: cytochrome C family protein; PFAM: doubled CXXCH
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85102"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZU5"
FT                   /inference="protein motif:TFAM:TIGR01905"
FT                   /protein_id="ADH85102.1"
FT                   /translation="MHRLRLLSLILLPVTALLLLPAAVGASPGVAAKDCFACHDRAAFE
FT                   QRVQHQPVAQRECSSCHNPHVARFPGLLQQQVHLLCYQCHRDTADEHRQSGILHGPVRN
FT                   GDCLSCHDPHAARHDSLLKEQGAANCFSCHNELPRSFPYTHPPYRDGQCASCHQSHRAE
FT                   HPYLLVREQSELCLNCHQPQEIQAQHPNYPVPVSGCVSCHSPHGSQRQALIRNVLHRSY
FT                   ASNCADCHQGNRPVTIHRCLECHQDVGREMSSSHNHLVRYGDNSCVACHSPHAGDRPGL
FT                   LKGKERYTCGSCHQGTIHRAEQAEYAHPLSRPDANACSNCHNLHGSNHPAMLKAPVNTV
FT                   CIDCHTDHEQFTHPIGETVFDPRTGQMMTCASCHSSMGTAYRNHLRYSGTRDLCVQCHR
FT                   DH"
FT   sig_peptide     complement(459471..459551)
FT                   /locus_tag="DaAHT2_0396"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.507 at
FT                   residue 27"
FT   gene            complement(459551..461497)
FT                   /locus_tag="DaAHT2_0397"
FT   CDS             complement(459551..461497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0397"
FT                   /product="cytochrome C family protein"
FT                   /note="KEGG: gbm:Gbem_1124 cytochrome c family protein;
FT                   TIGRFAM: cytochrome C family protein; PFAM: doubled CXXCH
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85103"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZU6"
FT                   /inference="protein motif:TFAM:TIGR01905"
FT                   /protein_id="ADH85103.1"
FT                   /translation="MKLQLMRELAGPALAVLLLLGLAWSCVPSAPPPAAEVRRDCADCH
FT                   ADMAAAYQTGLVHTPVQQENCRACHLPHGLVGTVLMRHNEPALCLRCHDELRVERGQHV
FT                   HQPVDQGRCSDCHLPHNSPFAMLLKADGAESCYACHDQQIFTGKLVHQPVSDGCMTCHD
FT                   PHVADYPGLLSQERDLLCASCHDPAAAGFRSAHRDYPVNTHCIDCHSHHSSDHPGLLKA
FT                   VIHQPVTAGDCNACHQVEAGSIISPAPEVQLCLDCHAELPEQSPHQPVMSGDCRACHTV
FT                   HASDHAALLATTPATVCLECHDQGTPPRARSIHQPAAEGECMACHQGHTAPERALLVQD
FT                   SPQLCFSCHDRQRYAAEVKSHAPAREGQCLTCHDAHHAGQANLLPAREAELCFSCHRQT
FT                   QGERGLFSLHRPFGRGECSSCHNPHGGQQDGLLKAQTAGGELCLTCHQQLTGEQAREAA
FT                   HPPFADGDCITCHAPHGAGQSRLIRQQPGQLCLTCHQETGATIARYPVAHQPAAEQQCT
FT                   ACHSGHGSSHAGQLLRGQPALCLNCHGEVARHWRDGALHPPAAGSCTTCHDPHGGNHTS
FT                   LISGGGTALCARCHDQETGRFSEAHWGLTPGPDSCVSCHDPHGGPEKNLLYPVSHGPFA
FT                   PGNCTPCHEGRTR"
FT   gene            complement(461494..463173)
FT                   /locus_tag="DaAHT2_0398"
FT   CDS             complement(461494..463173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0398"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tye:THEYE_A1221 foldase protein PrsA 1,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85104"
FT                   /db_xref="GOA:D6YZU7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZU7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85104.1"
FT                   /translation="MRCFTSILTFSSRPAEAPVKWLLLLLLLTALLLPARPAAAWWWPF
FT                   GGDTLLTIDGVEYSTEDFKGWWQYWNDEGLAVPPTPDLYIDWLLLVREAERMELAGDPS
FT                   FQRQTRVFLTSRALLMLKNEAVNSRIKVTEADLKAQYEKEYLPRWQVERLHFRNAEEAV
FT                   AAWEELQAGNLTVAELLAREPDEGGPVTRQVNWHRPQGIAPGWAEIFNNMEKGEVADPE
FT                   KHHGGLMLFHLKEVKGGDAEDFQRMRESLHRDVWKEQEAALTRQLLAELRRKYQVEINE
FT                   QRLAELDINAPDDAFGDEVLVATSRQNLTERDFIAMVRRDMTMRPDAAHAAFDEEKAAE
FT                   IKDRVVDGFIAQSLTNWESLARGYEKREPFKGEYDFHVNHRLSVTLERRLFADQVKVDD
FT                   DMVRRHYEENLAHFSRPAHVRLNIITNDEGPVNQVWAEVVAGKEFSRAVQEHFGRRIPG
FT                   QEVPINHLDPRVRGVVEKLAPGETSAPFDAQGSRVVVHLIDRVPENPLPFERVAGNIRD
FT                   RLVREKTAQLRQSYLDQLRARSRIEINDRNWRNVRNELGGAR"
FT   sig_peptide     complement(463051..463173)
FT                   /locus_tag="DaAHT2_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.935 at
FT                   residue 41"
FT   gene            complement(463149..463796)
FT                   /locus_tag="DaAHT2_0399"
FT   CDS             complement(463149..463796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0399"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU2497 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85105"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZU8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85105.1"
FT                   /translation="MSAGLPRITGTGRRRSLLLLLFLLLLPPITGCGGPRPYSQQLRAL
FT                   PPEPICRVAVLPFANHSDYPLAGAVAHQVFSAQLQQTAGYQVAQEGDVRKAYQQLRIFP
FT                   GQQPTPEQMRILADRLRVQLLFTGTVVEMRETPGNNAPANPVLELELQIRDGRDAVALW
FT                   HTHHRRQGTDYRTAMHFGTVHTVTGLSRQVAREIINLWLKEGLTPCDASPQY"
FT   gene            complement(463793..465382)
FT                   /locus_tag="DaAHT2_0400"
FT   CDS             complement(463793..465382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_3168 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85106"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZU9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85106.1"
FT                   /translation="MVTGMSVNPAITASSRKHRRPWLLCGGVLTISLMLVLSWPAPPPA
FT                   AAAPLPPVAVFPLQELKRDGSDVNLEFTNWLAQTLAAAGNEIIDQRTVINFMAFNRIRT
FT                   AGYLESFYLHRAGEELGVPLVLLGTVSQLREQPLPSLGLTLQLVRTSDARTIWSYVGHL
FT                   SAADVRRPLAVGEPGSVAELRALLARDLLEQWPWAQIRELRRASMIHLDSVLLQPQYVR
FT                   PGEEVQVQVRLRSEWLPHSAPRIFFLADDQVHAAVRHQDGSYRASWPAGDKDGRFPVNL
FT                   MLEWTHYNRRETAALGAYLVDGSPPLLTLELKGEINGDETPMFRNRLLIQPRLLVPKPL
FT                   AKWRLSFEDESGHTVGSMEQPGNLPEVLVWQGMGNEGRLYSGTYQVVVEVQDLAGNRQR
FT                   VSQPVELQRSTPGVALSAAREEQEIMVDLRQHDGRVPLDFWRLETWTREGRLLKTAEGR
FT                   ELPARVELALPSAEAGEAGAEIQGRLVVRDVLGNQSRRDLNDFFRTAAGRPPAQEAEEQ
FT                   PAGMSESWVDEF"
FT   sig_peptide     complement(465239..465382)
FT                   /locus_tag="DaAHT2_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.917) with cleavage site probability 0.909 at
FT                   residue 48"
FT   gene            complement(465389..465955)
FT                   /locus_tag="DaAHT2_0401"
FT   CDS             complement(465389..465955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0401"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: geo:Geob_3163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85107"
FT                   /db_xref="InterPro:IPR014094"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZV0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85107.1"
FT                   /translation="MRTKLAVLLILLLVTAGCGSRQISHESFMREGVSLAYVQRVAVLP
FT                   LENLGGGAGQAERVREIVITQVLASGLFDVADKGRVDSVLREEAIAPGAAIEDATLRRL
FT                   GQTLGTEAFILGSVEQGTESRGGAAYPEINLTLRLVDSESGLILWQASGRGSGYSVSDR
FT                   LFGTTPKSAFQVTLELVNSLLRSMH"
FT   sig_peptide     complement(465881..465955)
FT                   /locus_tag="DaAHT2_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.342 at
FT                   residue 25"
FT   gene            complement(466054..468174)
FT                   /locus_tag="DaAHT2_0402"
FT   CDS             complement(466054..468174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0402"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU2499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85108"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZV1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85108.1"
FT                   /translation="MPIPHPRPRTSERHRRCNRRTAVLLFLLAAIAWPQPVEAVDFTAY
FT                   WEHRARGGEELETQHSYVQRYTLGAGTGLTLQPTHAISAGANVSYSRRDHDTSDGMTSQ
FT                   EQITPSASLYLSNDIFRTGLTATATESRGDAVSTSRSDSWDASLASNWREPYWPRLNFT
FT                   YGESTGEQQSREDAKDKTRRYGFNLDWDLQAAELFYGYTATRSSGLALDDSRSESHLLR
FT                   LETGAALWHNRLNFQVSQQFQQTDTSLAIRADADDSFALPLDPGNLLGRTDPDEPPTIQ
FT                   EIEWRSQLPLTLETEHWGHFGVGFDFSRQVDRLIIELDEEMELVPSGINEMAWTLYTAG
FT                   PGDAFWTAVGPVPAVFDQERLLLELEVEREVYAMKVVARNTTGGELEITAVRAVELITE
FT                   DSDLDTRSTSHRTELGLRARLTPTLIATTRLSLDQAESTSDGTSRDTTRRRVSGNLNWS
FT                   PHRYLRPSMGFSETRQEQSGTPDAISRSYSLVLASTPLPTLNVSLGARFTDNYLDNRLI
FT                   STSDNYSLNTSAQLYPDLTAGLNAGFTRNVREQLDGSAAALTDSYHTRLTLNARLRPSL
FT                   TADFTGSYRESETTTITSPRRETSRSSSTGSTVNLGWRPSDLLNIRLGHARDWDQHQDT
FT                   YNGTLNMALVRTPVTRLNLRYAATRSDRTSQRYGLDGSWDISRNLVLRSRFNYQVAEHH
FT                   LWNIQSSLSLRL"
FT   sig_peptide     complement(468055..468174)
FT                   /locus_tag="DaAHT2_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.896) with cleavage site probability 0.895 at
FT                   residue 40"
FT   gene            complement(468410..469705)
FT                   /locus_tag="DaAHT2_0403"
FT   CDS             complement(468410..469705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0403"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acp:A2cp1_3267 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85109"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZV2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85109.1"
FT                   /translation="MKKNLLKSAVLAGAALLLLPAAAAATGIIGQCADCHTMHNSEQGQ
FT                   QVAVRGLGGEETGGGAIMNLLRMDCIACHAQDPSGPKIAVLDGGSAVPQVYHGDTTDLA
FT                   GGNFRHLAEGGARKGHNVVDLFDTDPQNSGNAPGDLRNMTQGHNFEMLTCAGAKGCHGT
FT                   RSQALQSYQDGEDNITIERVGIAAVSGAHHQSFDGAKEPEQIGAGEGFHDGTHLASSYR
FT                   FLRGLKGYGNETDRWQNVNAGSHNEYYGSTNTIGSDTATGCNRCHVPQAGYDGSQGRSA
FT                   RFALESTIAIPNQSMSGLCITCHGNFHSSGGGDIASNGASGAFLRHPSDYVIPNRGEYA
FT                   AYTEYNITAPVARPTLYTEASSNVTAGTDMVMCLSCHQAHATPYDGMLRFDYADMVAGD
FT                   FDSSGGLVGCMACHTTKGDAGGLKAHTPGDGF"
FT   sig_peptide     complement(469631..469705)
FT                   /locus_tag="DaAHT2_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.443 at
FT                   residue 25"
FT   gene            complement(470176..471483)
FT                   /locus_tag="DaAHT2_0404"
FT   CDS             complement(470176..471483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0404"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU2503 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85110"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZV3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85110.1"
FT                   /translation="MTIRHFKLTLLSIILLGWALPAAGGGLVGQCADCHTMHNSEQGAP
FT                   VARVGTEGAISDTPLQNLLRMDCIACHAQGSGERIVSLPGGSKVPQVYHNDPAGDLAAG
FT                   NFAYISGTKDGHQGSFGNRKGHNVVDVVNADSELAYPPGFRHAGSGGIGAFSVEAFTCA
FT                   GSMGCHGFRGQLLAVEEQDCDPVDPDCVSSLNIYRTGLNALSGYEGEGNLKRGAHHSNF
FT                   EGLKMGQTSPEFEENPLAGSYRFLHSVRGLGNEQDRWQNIDENSHNEYFGIEERTTNFN
FT                   TSNCNACHFGGTVSATYSRIYSPWRTTTGFCLTCHGNFHSTGMAGPGNGSSGAFLRHPS
FT                   DYVIPDAGEYAVYTAYNVTAPVARPLAFFTEGTGPSAEVSPGEDMVMCLSCHQAHATPY
FT                   DGMLRFDYNAMVAGGNTEQVGCLACHTVKGVPVAER"
FT   sig_peptide     complement(471409..471483)
FT                   /locus_tag="DaAHT2_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.927 at
FT                   residue 25"
FT   gene            471994..472938
FT                   /locus_tag="DaAHT2_0405"
FT   CDS             471994..472938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0405"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; KEGG: asa:ASA_0112 ABC-type
FT                   phosphate/phosphonate transporter, periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85111"
FT                   /db_xref="GOA:D6YZV4"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZV4"
FT                   /inference="protein motif:TFAM:TIGR01098"
FT                   /protein_id="ADH85111.1"
FT                   /translation="MERFFERLCRYQIVPLLVLLALLAACGDDRRGGTTDAPTPVAPAG
FT                   PVRLSIGLLPEQDVFVQRRRYTPIAEYLAAATGTEIELKIIRRYGNVMEHFRRKQLDGA
FT                   FLGSFTGAWAIETLGVVPLARPQYPDGVSTYYGMIFVRKDSGIRSAADTKGKVCVFVDP
FT                   ATTAGWLLPLHYFHDHGIPFEDDWFKEAYFSGSHEDSIRDVLEGRADIGAAKDLVFDMV
FT                   AQQEPRVREELEILAVSPPVPSNTLSVRGDLDQELQERLKQALLTMHETPAGIKALEEF
FT                   GAVRFLATGREDYQPVFVYARAVGLNLADYQEK"
FT   gene            472935..474794
FT                   /locus_tag="DaAHT2_0406"
FT   CDS             472935..474794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0406"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein; PAS fold-4 domain protein; histidine kinase
FT                   A domain protein; KEGG: eic:NT01EI_2203 signal transduction
FT                   histidine-protein kinase AtoS; SMART: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85112"
FT                   /db_xref="GOA:D6YZV5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZV5"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH85112.1"
FT                   /translation="MRNKAIIGFILLALFFAGGGAHIISSHNRVIWNLEEIFKLSEATH
FT                   RRTDLLNKVKLVQAHLLLAESPHVGEIHSIIIHGEAIRTAAENCVNCHHPPRVGAGFYI
FT                   LRDQIDDYLKKLSRVYTIRANPDRIRVAVGDAFASGEELYEMVGRMASETGHRIPGQLA
FT                   ETRKEIGQAKKLLQGMVIVGPLAALLVIFFFLRRFTSSISALTRATGRIREGDLAYTIA
FT                   EPLPDEFGELAEAFNGMTVSLQQQREQVVAAESRYKILFESAADAIFILQADDDKRNCI
FT                   VAANQAAAAMYGYAAAEMAGLHFPGLAASPDKAVETKEDFFERLLAGERVEARSEHRRQ
FT                   DDTVFSVEFSAGLVALRDNRFGLVFVRDITHRVQTEEALLRSRQLAVVGQMAAGLAHEI
FT                   KNPLAGIKVSMEVLSNELDISQQDKEIFHRIVSEVQRIENLLRNLLNYARPPKPEFAPV
FT                   DLNAQLESCLKNSEMLLKAPEHKVNGRRRVRFERHLADGLPLIRADASQVQQIFLNLLL
FT                   NAIEAISDEGVVAVTSKTSEDGKVVVEVSDNGKGMTAETCARIFQPFYSNKHRGSGLGL
FT                   AICKRLVELHGGEIQVVSSPGEGSTFIVAFPVHHQEQPEEAAA"
FT   gene            474791..476185
FT                   /locus_tag="DaAHT2_0407"
FT   CDS             474791..476185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0407"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: gme:Gmet_0555 two component, sigma54 specific,
FT                   Fis family transcriptional regulator; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; response regulator
FT                   receiver; helix-turn-helix Fis-type; SMART: response
FT                   regulator receiver; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85113"
FT                   /db_xref="GOA:D6YZV6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZV6"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADH85113.1"
FT                   /translation="MKTRGRIFAVDDDELILTMLARALKNEGYEVNCQTSSEDVVANIA
FT                   RWHPDVIFLDIDIDDQMSGLDILQAVKGEGLSGEVVMLTADDSAESAIRAMKLGAADYF
FT                   TKPFNIDEVKITTSKIIEAIRLREEVDYLRDRGRSPEKQFVGESPVILEILEKARKLAQ
FT                   AGAETILITGESGTGKEVLARQIHAWKEGLDEGGGGPFLAVNCTALPENLIESELFGYA
FT                   RGAFTDARSDKKGVFELAAGGTLLLDEIGDMRLDLQTKLLRVLEERKVRRLGGSVDLPV
FT                   DTTVIATTNKDIKAAVDEGGFRGDLFFRLSTFRIHLPPLRERQGDALLLARFFLGFFAH
FT                   KYMKKEIKGFSPAAEKAILQYSWPGNVRELRNVIEHCVVLENVAEVEPRHLHLDDAAKA
FT                   GRPQVERRKNAAIILPESGISLEEVEKTLIRQALERTNNNQTQAARLLQVSYDTLRYQV
FT                   KKYGLL"
FT   gene            complement(476189..476887)
FT                   /locus_tag="DaAHT2_0408"
FT   CDS             complement(476189..476887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0408"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: gem:GM21_0268 two component, sigma54 specific,
FT                   transcriptional regulator, Fis family; PFAM: response
FT                   regulator receiver; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85114"
FT                   /db_xref="GOA:D6YZV7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZV7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH85114.1"
FT                   /translation="MRKKILVVDDDELIRYGLQRALQAEKIEVITAGTSTEAVLQLSSC
FT                   RYDLSLIDVHLPDFNGMLLLRIIKDICPEMRVIMMSASHLNNQDLEAEVERAQAGGACK
FT                   FISKPFNLHELKEVVLQALHGSDEFQTGFHYCDNRFLNRRVRKKNRKPFEEELRYAINV
FT                   IEGGGERRLLLQARGVDISEYGMGIVTEYPLRPSQVISLQYSNLNRIGTVVWSSLCDDQ
FT                   QTCRAGLHFA"
FT   gene            complement(477208..478557)
FT                   /locus_tag="DaAHT2_0409"
FT   CDS             complement(477208..478557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0409"
FT                   /product="ResB family protein"
FT                   /note="PFAM: ResB family protein; KEGG: dps:DP1682
FT                   cytochrome c-type forming protein Ccs1"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85115"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZV8"
FT                   /inference="protein motif:PFAM:PF05140"
FT                   /protein_id="ADH85115.1"
FT                   /translation="MNEKQNRIWRFLASVQLALWVIGLLAATSIIGTFIQQNKQLEHYL
FT                   ENYGPEMTRLLQTLDIIPNMYSSWWFITLLIIFVVNLIICSLDRLPATWRLINQDNLNV
FT                   TPQRLAKMPLQREMNFAEEPPAAAERLEQRLTAIGWQPGSRNGEEGTLLFAQKGAWSRL
FT                   GAYLVHLGILITLGGALIGGIWGFKGTIMFPEGETVDFIFDGTTAELLPLDFSIYLDEF
FT                   EISFYPDGTPREFRSDVIISDPASNSRRRDSILVNHPLRHRGITFYQASYRALEQYLVH
FT                   LRNQTTGAEIYLLALPDQELHWPEENLTLQVAAARSDQLQRVLTYQVSLQSPEAPPSVF
FT                   TMADRQTVTVDRPEHPYNLYLQQRYSTGLQVARDPGVWVVYSGFALICLGLYLTFMVSH
FT                   RRLWLLLTPAGKGSTRLLLCGGSNRNRASFDQQFDLLAAQLSRDETRNKD"
FT   gene            complement(478628..480988)
FT                   /locus_tag="DaAHT2_0410"
FT   CDS             complement(478628..480988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_3279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85116"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZV9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85116.1"
FT                   /translation="MENRHYERTCTMNPYRPLKSLLIVALLALMLILPGCNREVEITVP
FT                   PDPPGVDEQLPEPEPDPTPVDEAELEPPELSATRYLVSHPPPTPRAADWKVTEITATNG
FT                   GEGVVITAEVSSQQSPLAGLSQVEQAWAFYRDQDGDYQRREITDYTQVADHNDGDYTLT
FT                   IAGLSDRPWWGEEISWLVQLRNPAIQWPQALIVAHDTADGQPVKDLVTDQGCINCHGQR
FT                   VFIDARGTYRSVAVTPEGDSLAMTQDHHFAAIGVEACVICHGDGDELTAFVHGIHNSSQ
FT                   VNRNTGGGLEVSAERFYSVRYPGDLKVCSACHQSQASLQYLRAQPVEHDFCASCHGATH
FT                   AAGSTGQYTMDWPSYNPAASSLHGPGDENCIECHNGVDFFAFTGDVHPGNTPELQRAEQ
FT                   LALALEISKVEAAGPGSQIKIHWRAFNHDNDENYNLCHTGADLPVFFDHFTVRLSSLQA
FT                   DDPVNHIGGSTTAPGQPAPGLLPGPDNTVCNGDGSAVTTLQQTAPASYRAMLSFDGRPR
FT                   LNDQPLRLPMPTYVFRVENGAEEPRRQPVETEKCLACHRGALYRHDNAGGGRSDNAELC
FT                   ITCHNPAATDQHHRREHYEITANQAYDRKGAESISFAWMMHAIHGAGANNAFYAIYRPG
FT                   TITAYGGPTTAPPGWQLDEEGRARSSYLGQHGEAEEVRHTLKKVNYPRPLTECQACHSQ
FT                   PEVALPDPGAALAMSIDSGVSMGNHNDDTLIGPATAACMSCHRGDTATASKVLLNHAYL
FT                   NSWPPQIFARGKRSLLEGKELEACLACHGRPAY"
FT   gene            complement(480969..483386)
FT                   /locus_tag="DaAHT2_0411"
FT   CDS             complement(480969..483386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85117"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZW0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85117.1"
FT                   /translation="MGRSTGRKRLWRLLGAVLLLGLAAMFSGGCDGGVKVTVAEEKEDP
FT                   PETTPETPTEPQDPQDITTTPVDQAELEPPELSATRYLVSHPPPTPRAADWKVTEISAT
FT                   NGGEGIVITAEVSSQQSPLAGLSQVEQAWAFYRDQEGNYRRSEITDYTQVADHNNGGYT
FT                   LKIAGLSDQPWWGDEISWLVQLRNPAIQWPQALIVAHDTADGQPVKDLVTDQGCINCHG
FT                   QRVFIDARGKYRSVAVTSEGAPLAMSQDHHFAAIGVEACVICHGNGDELTAFIHGIHNS
FT                   SRVNQDIGGGLEVSAGRHYSVRYPGDLKVCSACHQSQASLEHIRTQPIEHDFCAGCHGA
FT                   THAAGATGQYSMDWHSYPWRDTETWQAEDLEKLHAVTLDEWDLDPQEYPCTVCHNGSLA
FT                   ARYVEQFHPGNAPELQRTEQLALALEISKVEAAGPGSQVKIHWRAFNRDNDENYNLCHT
FT                   GADLPVFFDHFTVRLSSLQADDPVNHIGGSTTAPGQPAPGLLLGPDNTVCNGDGSAVTT
FT                   LQQTAPASYRAMLSFDGRPRLNDQPLRLPMPTYVFRVENGAEEPRRQPVETEKCLACHR
FT                   GALYRHDNAGGGRSDNAELCITCHNPAATDQHHRREHYEITANQAYDRKGAESISFAWM
FT                   MHAIHGAGANNAFYAIYRPGTITAYGGPTTAPPGWQLDEEGRARSSYLGQHGEAEEVRH
FT                   TLKKVNYPRPLTECQACHSQPEVALPDPGVALAMSMDSGVSMGNHNDDTLIGPATAACM
FT                   SCHHGDTTISKALLKHAYTNSWSPQIFARGKRSLLEGEAMETCLICHGKPAL"
FT   gene            483797..485152
FT                   /locus_tag="DaAHT2_0412"
FT   CDS             483797..485152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0412"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; type IV pilus assembly PilZ; KEGG:
FT                   lbf:LBF_2547 GGDEF domain receiver component of a
FT                   two-component response regulator; SMART: GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85118"
FT                   /db_xref="GOA:D6YZW1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZW1"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADH85118.1"
FT                   /translation="MAPGRPEEAMRVSQEPDNETYLKKVVLACLQQSAHEEQLVEELRL
FT                   LVRQEGDAACKVIMELLLNRTFSASEASKCWHGVLQHQQALAAVLGRRVTLTVAVGDYF
FT                   ALRGNTIGHAKLIAVQDFEALLAEKNIDFLTGLNNRHSLELALEQEFQRAARYGRKLSV
FT                   LFWDLDSFKEINDQLGHDVGDQVLQHFGRVLATGKRTVDFAARYGGDEFVMLLPDVDPE
FT                   GAMTMAERIRDQVCRQPVFIDKHRVEITLSGGIATYPEDASYARDLLVCADYAMLQAKG
FT                   RGKNSVMRYGVTEKRAAPRLDLAVPLTVSRLDEQAGSDLAAAMAKNISHSGMLLESRLP
FT                   VNRGARLEMEITLEDRKLTVKGEVVRVEKFAEQRFGVGVAFLKSEGMADDFLHDYLRRA
FT                   HGLRRGGPVDNSMEQPDRRVVWGNEIIQAGMLALMIFPVYGLQVLLKGVTAG"
FT   gene            complement(485139..485753)
FT                   /locus_tag="DaAHT2_0413"
FT   CDS             complement(485139..485753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0413"
FT                   /product="flavoprotein WrbA"
FT                   /note="KEGG: sfu:Sfum_3387 TrpR binding protein WrbA;
FT                   TIGRFAM: flavoprotein WrbA; PFAM: flavodoxin/nitric oxide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85119"
FT                   /db_xref="GOA:D6YZW2"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZW2"
FT                   /inference="protein motif:TFAM:TIGR01755"
FT                   /protein_id="ADH85119.1"
FT                   /translation="MKVLIVYYSMYGHIQQLAQAVAEGAGKVEGAEVVLRRVPETLPAE
FT                   VLAKMGATEAQQQQKSIPICTIEELAAADAVIFGTPTRFGNMCGQMRQFLDATGQLWAQ
FT                   GSLVGKAGSVFTSSNTQHGGQESTILSFHTTLLHHGMVIVGLPYSFSGQMEAAEISGCS
FT                   PYGASTIAGADGSRQPSANELAGARFQGEHVAKIAQKLSRP"
FT   gene            complement(485750..488107)
FT                   /locus_tag="DaAHT2_0414"
FT   CDS             complement(485750..488107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0414"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold domain protein;
FT                   histidine kinase A domain protein; response regulator
FT                   receiver; KEGG: ppd:Ppro_3008 multi-sensor hybrid histidine
FT                   kinase; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS domain containing
FT                   protein; PAC repeat-containing protein; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85120"
FT                   /db_xref="GOA:D6YZW3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZW3"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH85120.1"
FT                   /translation="MTNEQQTNRPAAGFSIRTFFLGAMLLLIATLSLPLLLAGSHLMDR
FT                   NIKEMGGELLHSKLLALLEPVERRYETLYRVGLEDSLVHRKEIKEMALAEFSAYRFRDS
FT                   GSVFVLTPTGDILLSQLLSDSTDPHFLNLLARLNSADPDERIVAYSNEIGQQLAAFEYY
FT                   QPWDSYVGLSIDHDELFAPKYLFLKINLMVLGAVLLVAALFVYGLQRLLIKPIIQLNHY
FT                   AGHGFDDEQAKPPQAGFIMELATLRDSLVNMVATLQHRAREAAEQVKIISRREAELAAE
FT                   REQLAVTLRSIGDGVITTDTTGRVILLNLVAERLTGWSQQEAQDRPLPEIFHIINDRTG
FT                   EKHPNPVDKVLQTGLNVELENHTVLISRHGSRYHIADSGSPIRNFNSEIIGVVLVFRDV
FT                   SEAIHTEAELLKAKKLESLGVLAAGIAHDFNNILTAIMGNLELARYLLGPQHQASNLIE
FT                   EGTKASQRAQGLTQQLLTFARGGAPIRQAASIAGIIRDSADFVLRGSEVSCRYEIPHDL
FT                   KLVNVDSGQISQVIQNIIINAREAISGSGTITVSCRNLGPVKKMPADEYVEIKISDSGS
FT                   GISREEQGKIFDPYFTTKEKGSGLGLAVCHSIIAKHHGKISVESAPGQGCTFTILLPVA
FT                   NSAGIPAEADDRPAPAHNLSRRILLMDDEEMVRRVAARILQQLGCQVQETTDGEAAISA
FT                   YRQAREEGQPFDLVIMDLTIPGGMGGKEAVKEIRRLDPQARVIVSSGYANDPIMAEPEK
FT                   YGFDGVISKPYLLKDLEQVLANSKPKPQEQQP"
FT   gene            complement(488107..489156)
FT                   /locus_tag="DaAHT2_0415"
FT   CDS             complement(488107..489156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0415"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: maq:Maqu_1089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85121"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZW4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85121.1"
FT                   /translation="MPAVRKHGSSSTHPPRPVLRLAVLALFALALLLPSTVAAATEPKK
FT                   VVIIRYPIEPNHFTPLVEAYQETMAQRGYRSGREVIYIDILTTTAEQNSIPEVIAAVEQ
FT                   YREQADLFITSGWVSMAARNILQHSEVPQLFVPVLDSVALHMLPSLHEPPNTNLSGLYL
FT                   MYPPEKILRLARLLMPELTDYAFVYDSRIPADKSFFQAYRQLPAEARYGINIHYLDLAQ
FT                   GLEPVMNTLQQGTIGAYGGIVGYLPHRRRLAASELPVITAFTPDIEVEDISDFTAIDNT
FT                   LAGLFNPFSYTGRQAAEISADLFDGQTDITAVIPRPARQMAFIDFRNAEKLAISIPFAA
FT                   LEAVDMVVR"
FT   sig_peptide     complement(489037..489156)
FT                   /locus_tag="DaAHT2_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.870 at
FT                   residue 40"
FT   gene            complement(489444..490607)
FT                   /locus_tag="DaAHT2_0416"
FT   CDS             complement(489444..490607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0416"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gem:GM21_1900 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85122"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR026352"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZW5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85122.1"
FT                   /translation="MKKLVSKIKGFVNERPKTSIVILIAFIAVFSYVNLQAMHITSEPG
FT                   FCEMCHPGTGTGALSEVHTWRQNIHAEAGVKCLDCHGEPGIFGYKKAKIGGLYDTYVEI
FT                   FRSEEYKLKILNKSVEDPQYAANLVPSTTCLFCHTDSVNQKIRSERLMSIGHKFRLLDT
FT                   VENPEFRKERGMRDIFTDELKSEIDPNHKRHIDAGLTCMDCHHRMVHGGEYRAAVDLNQ
FT                   CSQCHSERAGEISMSDVVMGEGDSAVSFSHDFHGMMFSCDHCHTDLFPMKAGGSAISFD
FT                   YHTTDQYCFSCHNGQAASYDCASCHGQVPMPMEPITYTMEGFAPVDFNHTFHGNAFSCE
FT                   TCHDTPWIMEAHATPMTMNEMYRGQFCGQCHNGQAAFPATACARCHQ"
FT   gene            complement(490857..492056)
FT                   /locus_tag="DaAHT2_0417"
FT   CDS             complement(490857..492056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:491676..491678,aa:Sec)
FT                   /locus_tag="DaAHT2_0417"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: dde:Dde_0679 rhodanese-like protein; PFAM:
FT                   Rhodanese domain protein; Contains selenocysteine; SMART:
FT                   Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85123"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZW6"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADH85123.1"
FT                   /translation="MMKPRLLTSALAMLLLLFAAGCAATSGQAVPPSAAGHTQAVEQDP
FT                   KLRITTQEVMELFAQEYGDAPLIEETLKKNTSFLLIDTRPPVRFNEGTVPGSINIPTPR
FT                   FAQDIPKLPKDRTLIFYCGGLAUPFTGEAAVVAQEHGFTDIRAWYEGEPFWTKAGNYRI
FT                   TDTPHVQRLVEASDRENFVLIDSRPPRVHQAEHIPGSISIPWVLFEQKKGMLPADKDLP
FT                   LIFYCGGHHCDLSHKSAVAALEMGYTKVFVYSAGVPDWKKADLPLWGYEAAGVEMAEVD
FT                   PDALPETITAEEFVAAVQAGTVALIDVRSEREFAEGSIPGAINIPDGKFYEDLDAAVAK
FT                   LPNDRRVIIICATGARSGGVFFMVSDIMLDEPELYSNPHGVQYLNQGLEYAPDGTFTVK
FT                   "
FT   sig_peptide     complement(491967..492056)
FT                   /locus_tag="DaAHT2_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.622 at
FT                   residue 30"
FT   gene            complement(492138..493295)
FT                   /locus_tag="DaAHT2_0418"
FT   CDS             complement(492138..493295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0418"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG:
FT                   glo:Glov_3346 polysulphide reductase NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85124"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZW7"
FT                   /inference="protein motif:PFAM:PF03916"
FT                   /protein_id="ADH85124.1"
FT                   /translation="MNTMTMNNKLINTRGDMIWALMAGALCLVGLAGLGNYLLQGHDAY
FT                   NVYRQVPWGILISTYVFFAVCCTGLCLVSSLGHVFGFKNFEGIGKRAIAMAIIALVSGF
FT                   VVIGLELGRPLALIYNLLSPNPSAPIWWMGTLYSIYLGVLLVEFTLMVRGMHKYVGYAS
FT                   LAGFIGGVAANSNLGSVFGLLDARPFWQGPFLPISIIVTAAISGCAIVILLMAHRYARE
FT                   KMPEDIQRAVTATSKIFALLLGVLMFFEFWKVMSAIYGTVPGQYDAMMILLKGPLAFNY
FT                   WGLEILLGMVVPFVLLMSSGGRSLGTAVVAAISTLIGLFFMRYNMVVAGQLVPLRAEVD
FT                   AVGPSGLLSYTPSLTEIAITLGGFGLCLALYMAADRYFNLDEQGH"
FT   gene            complement(493308..493877)
FT                   /locus_tag="DaAHT2_0419"
FT   CDS             complement(493308..493877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0419"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: tth:TTC0154 NrfC protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85125"
FT                   /db_xref="GOA:D6YZW8"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZW8"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADH85125.1"
FT                   /translation="MSQERKKRWVMVVDPDKCIDCKACDVACKRENGMDAGTDQQVYRN
FT                   WITSKGVEGTYPYLKERFEPSQCQHCQNPPCVKVCPTSASYQTEDGLVAIDYKRCIVCA
FT                   SCILACPYDARYKSPQTKVIDKCTFCAHRIAEGKLPACVDTCPTKVRVFGDLNDPNSEV
FT                   ARLLATRHYRVLKPEQGTKPSLFYLS"
FT   gene            complement(493881..496073)
FT                   /locus_tag="DaAHT2_0420"
FT   CDS             complement(493881..496073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0420"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molybdopterin
FT                   oxidoreductase Fe4S4 region; molydopterin
FT                   dinucleotide-binding region; KEGG: wsu:WS0709 thiosulfate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85126"
FT                   /db_xref="GOA:D6YZW9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZW9"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ADH85126.1"
FT                   /translation="MKVSRRKFLAGSVAGLGALGAGSAGLRFVRKAEAQGRAGEVKYVN
FT                   SSCAICTSKCVFRGQVVNGIIRRLEPEPDFPKSRGMMCARGNAGAWTPYDPDRVKYPLI
FT                   RTGRRGEGKWRKATWEEAYKYIADKTNQVVEEEGGHRSCIGFASSEGTYQEMYWHQFRE
FT                   VFGSPNSLRHPTLCLSSVIRGFQSVFGTYPVTDLKNARYVIMAGANRAEAIFTPDTMDI
FT                   FSRPKGSYKLIYLDPRFTKTAAKADQWLPIKPGTDMAFALALAHVIIAENLYDRDFVAN
FT                   FCTGFDELVEHVKPYSPEWAAEETGIAAADIRQIARELATTPHSVFYPGRRSSWQGEEV
FT                   QTRRAIAIVNALIGAFDRPGGLLPAVGVPMRSYFYEPAWYTQTRPRLESDDVMFLGPRD
FT                   GSWVAWRDRALKADPYRIRGLFIYKQNVLEAVPDRDKSMKLFDQMDIIVCIDTFMSDTA
FT                   WYADVVLPESNYLERLDPPQSLGGIEPTAVFRQPLIDRLYDTKPGFEIVSELAAYFEDE
FT                   DGFKLSEYFEGSPEEHARNFVADHPGAWEQLREKAFITVPKVQFGAYRQEGRRINTATG
FT                   KVELYSEDFAGRGLDPLPVFRRCEEPGPDQFRFLVGRHAIHTNSMTAAFPELNWHQPEN
FT                   AVWLNPEPAARLGINDGDLVQMQNRSGAQVTVKAKVTAGIRPDCVYYAPGYGAISPGKP
FT                   LVYQRGASQAAILESHFEPISGNALMHETIVEIRRV"
FT   gene            complement(496136..496648)
FT                   /locus_tag="DaAHT2_0421"
FT   CDS             complement(496136..496648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0421"
FT                   /product="Uncharacterized component of anaerobic
FT                   dehydrogenase-like protein"
FT                   /note="KEGG: dde:Dde_0677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85127"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZX0"
FT                   /inference="protein motif:COG:COG3381"
FT                   /protein_id="ADH85127.1"
FT                   /translation="MEATMHPPGNSRQLLNLAGCFDYPSAELARQLNVQLEQLENIHVR
FT                   LFINDRGGTKTPPYAGCYLDRDDRRQFMIDFSGICCEQGIVISSGHPPDHIPAMLETLA
FT                   LLLAEAKESPELDIDSLLQRYYRGWPERFAAALEEHDEVGFYAAAAAELKETLATLHRH
FT                   SDKGLDH"
FT   gene            complement(496725..497069)
FT                   /locus_tag="DaAHT2_0422"
FT   CDS             complement(496725..497069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0422"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsa:Desal_0370 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85128"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZX1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85128.1"
FT                   /translation="MKRLLSLALITSFILATLPGLAMAWDLEGFENANKERGQWAWFTG
FT                   QARTCDEEIPVPGAHTRAEWREMFTTAKDKLPCGGAGINPRVVQHIFLFLYEHAADSDD
FT                   PMTQKPESCG"
FT   sig_peptide     complement(496995..497069)
FT                   /locus_tag="DaAHT2_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 25"
FT   gene            complement(497667..498293)
FT                   /locus_tag="DaAHT2_0423"
FT   CDS             complement(497667..498293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0423"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: tcx:Tcr_1702
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85129"
FT                   /db_xref="GOA:D6YZX2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZX2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADH85129.1"
FT                   /translation="MKKLNGSGTQMNTEKRKRTIDPEDKARRIFESARKLFVERGYYRV
FT                   SIPDIVRSSGVSTGAIYNLFGSKENLAKVLHKKTLGDFNEMFLQRLNGRETTQAKLLAF
FT                   TEVVFELTEKDPAMMEYLMFMKHAEFMEDAAPVCFTEPFQVIRRIIAEGMEKGDLKPGD
FT                   VFLNAVSFTGAILRPAQLRIQCVLQDPLTIHTNQLMANAWAAIKA"
FT   gene            498750..498962
FT                   /locus_tag="DaAHT2_0424"
FT   CDS             498750..498962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0424"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="KEGG: aeh:Mlg_2536 cold-shock DNA-binding protein
FT                   family protein; PFAM: Cold-shock protein DNA-binding;
FT                   SMART: Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85130"
FT                   /db_xref="GOA:D6YZX3"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZX3"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ADH85130.1"
FT                   /translation="MSERVNGRVKWFNAPKGFGFIERDNDSDVFVHYRGIRGEGYRSLQ
FT                   DGQSVSFAVVETPKGLQAEDVEVIG"
FT   gene            complement(499075..499446)
FT                   /locus_tag="DaAHT2_0425"
FT   CDS             complement(499075..499446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0425"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dba:Dbac_0956 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85131"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZX4"
FT                   /inference="similar to AA sequence:KEGG:Dbac_0956"
FT                   /protein_id="ADH85131.1"
FT                   /translation="MTVQLSFSKDENELLPDFRNKISKAESTEDVKKVFAQTTGQLLTR
FT                   IFGDKIKTEYEDIRLNPAEINGAPAFTVTSNLKDQPNFVEIWENSDLPHVVGRLAQTAK
FT                   NRYKHLEKHPEKTNAKIRM"
FT   gene            complement(499452..499718)
FT                   /locus_tag="DaAHT2_0426"
FT   CDS             complement(499452..499718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0426"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mca:MCA2737 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85132"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZX5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85132.1"
FT                   /translation="MSSDAEEPIEGNWYELPSGEIFTVVTVDEEEGMVEVQYDDDRVEE
FT                   LELETWEDLGADPIDPPEQWTGGYGTFDDEDDLDVEPSEIEEE"
FT   gene            complement(499937..500395)
FT                   /locus_tag="DaAHT2_0427"
FT   CDS             complement(499937..500395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0427"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: dde:Dde_1454
FT                   universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85133"
FT                   /db_xref="GOA:D6YZX6"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZX6"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADH85133.1"
FT                   /translation="MVNPEPEIKKILVPLDFSGNSIMLIKKASKVAKELGAELEIVHVV
FT                   ESLAPYMGFAVPHIPLDSMGKDLYGYAEKKMESFLAENLSDDIPHQAKIITGNDAAAEI
FT                   IRHAEENNCDLIIIATQGFKGLPKFLFGSVAERVLKQAHCPVMTVKPR"
FT   gene            complement(500522..502609)
FT                   /locus_tag="DaAHT2_0428"
FT   CDS             complement(500522..502609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0428"
FT                   /product="protein of unknown function DUF399"
FT                   /note="KEGG: pmx:PERMA_0605 putative peptidase M1, membrane
FT                   alanine aminopeptidase; PFAM: protein of unknown function
FT                   DUF399; PDZ/DHR/GLGF domain protein; SMART: PDZ/DHR/GLGF
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85134"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007314"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZX7"
FT                   /inference="protein motif:PFAM:PF04187"
FT                   /protein_id="ADH85134.1"
FT                   /translation="MPESPAKPWPTGKKNCNPTPSLSLTSTPGSWLPKPQRRPAAAWLL
FT                   FLLLFSLAWPTAGRAADEHQQAPWQELLQREFYPSYELARLAVTEARLQETKGRVELHF
FT                   TLVQQQDTPLPLDIPMLVSTPRQVYSTTLTSQRKKTAFTLELNDRPTEIRLDPYQELPR
FT                   HLSPNELPPSWAGFLAAEQRLAIIPAETPAAWEPLLDLLARLDIDALPLEQIEPAALAT
FT                   SSLLFVGSEQENPARGFFAAPLHPGSNHPITLEARENPINPEQTGILLSLHSQPAAADL
FT                   ETLLTTLDSPGLFSQLKIADNTLEQQIKAPHQQGILVRLDQPPDGIAAPARRSFHEIMA
FT                   ELADTRVIYVGEVHSRYEDHLLQLRVLRAMHQQHPKVAVAMEMFPAATQPVLDAYVAGE
FT                   LDEPEFLRQSDYFTNWSFDYRLYREIIDFARHHGLPIIALNLERGLTSKVYREGGTTAL
FT                   SPEELAQLPADRDLALPGFQQRIGAAFTMHDSDPETDPAGFSGFLQAQSIWDEQMAHRM
FT                   AKFLQENPEYRLLAVVGQGHSDKRNAIPPRLARRLAVEQKVILPVREQTASAPAADYFF
FT                   FVPSQSLPDQALLGVRVRDGEEESGALVVGLSPRGKARAAGIMEGDLIVAIDDWEITGT
FT                   NELRIAMLYQQPGQTVKVRVLRPIDTERDEETEELEELEELEELEETPKSFETQEFTLE
FT                   L"
FT   gene            complement(502560..503897)
FT                   /locus_tag="DaAHT2_0429"
FT   CDS             complement(502560..503897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0429"
FT                   /product="gid protein"
FT                   /EC_number="2.1.1.74"
FT                   /note="TIGRFAM: gid protein; KEGG: dps:DP1969 tRNA
FT                   (uracil-5-)-methyltransferase Gid; PFAM: glucose-inhibited
FT                   division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85135"
FT                   /db_xref="GOA:D6YZX8"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004417"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZX8"
FT                   /inference="protein motif:TFAM:TIGR00137"
FT                   /protein_id="ADH85135.1"
FT                   /translation="MTNGYEDNPVTIIGGGLAGAEAAWQVARRGCAVTLYEMKPGNCSP
FT                   AHQSPDLGELVCSNSLRAEDPHSAVGLLKEEMRRLGSLVMAAADATRVPAGRALAVDRS
FT                   LFARHITQALEQEPLVTIIRREVTEIPPAGGAPIIIAAGPLAAAGLAAALARLIGDKQL
FT                   AFYDAIAPIVYADSLNRDIIFSASRYEEGPGDYLNCPMDREQYQRFIKALLTAPQVPLH
FT                   DFEEPRYFEGCLPIEIMAARGEDTPRFGPMKPVGLIDPRTGREPYAVVQLRKENREGML
FT                   YNLVGFQTKLSHAGQKEVFRQIPGLEQAQFARLGSIHRNTFVCAPRVLQASLQLQARAD
FT                   ILLAGQISGVEGYVESAAGGLLAGINAAALLLGKPLSSPPPETALGALINHLIRTEADV
FT                   FQPSNINFGLFPPLMAANGKKIPKRLRGETRARIARQALADWQKKL"
FT   gene            complement(504029..504676)
FT                   /locus_tag="DaAHT2_0430"
FT   CDS             complement(504029..504676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0430"
FT                   /product="adenylate kinase"
FT                   /note="KEGG: sat:SYN_02538 adenylate kinase /
FT                   nucleoside-diphosphate kinase; TIGRFAM: adenylate kinase;
FT                   PFAM: adenylate kinase; adenylate kinase lid domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85136"
FT                   /db_xref="GOA:D6YZX9"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZX9"
FT                   /inference="protein motif:TFAM:TIGR01351"
FT                   /protein_id="ADH85136.1"
FT                   /translation="MKLILLGAPGAGKGTVAKMLTAIDGSVQISTGDILRGEVQAGSDL
FT                   GRQAEDYMNRGDLVPDSLIMGIMEKRLQQPDCAKGFLLDGFPRTIPQAEALKELLNKLG
FT                   ITLDMVVNIDVPREVLLDRLTTRRTCTNSECQAIYNVKSMPPKQEGICDKCGSPIVQRD
FT                   DETVEAITHRLETYNQKTAPLVGFYEKEGQLQTITGTSSDAVVNAIKSELGM"
FT   gene            504877..505338
FT                   /locus_tag="DaAHT2_0431"
FT   CDS             504877..505338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0431"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: sfu:Sfum_1742
FT                   heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85137"
FT                   /db_xref="GOA:D6YZY0"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZY0"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADH85137.1"
FT                   /translation="MAVMRFYDQPVFRNPWADFEKMRREFDTLFRNLGNEAARGGSTVF
FT                   PALNISEDEHNLYVRAELPGVAAGDLEVAVEGDTLTIKGERRGLEAAEAEKVACHRREI
FT                   ESGRFSRALTLPTRVNPERVTAVGKNGILLITLPKAEEVKPRRIEIKTA"
FT   gene            505373..505774
FT                   /locus_tag="DaAHT2_0432"
FT   CDS             505373..505774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0432"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: sfu:Sfum_2365
FT                   heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85138"
FT                   /db_xref="GOA:D6YZY1"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZY1"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADH85138.1"
FT                   /translation="MSDKEMKVQHKQEVQQAGEPTKPERYFVPAVDIYESEEAVHLRAE
FT                   MPGVDKDGVEINLENDTLTIRGVKAANGGENERVLLREFETGHYLRRFTIAETIDQEKI
FT                   EAGMADGLLKLTLPKVEPARPRRIEVKCA"
FT   gene            complement(506160..507743)
FT                   /locus_tag="DaAHT2_0433"
FT   CDS             complement(506160..507743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0433"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   pca:Pcar_0273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85139"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZY2"
FT                   /inference="protein motif:PFAM:PF04286"
FT                   /protein_id="ADH85139.1"
FT                   /translation="MSIVAYLSLPLVGALIGYLTNHIAIRMLFRPLRPWHLAGRRLPLT
FT                   PGVIPAARHRLAANIGKMVGEHLLTPQDIRRALGQDDFQHNLRLLIQTQTEAIMQTPFG
FT                   PVESLVPAAFRSYFRVGVKVVRWRFLKQLHQHLQSPEFAATLTAVSEEHFNEVMQRRLD
FT                   QVLPEEQRQELVNAVSEQLHQAMAAPAFQQGVADYLNRQFVQLLADGRSLAELLPAPLL
FT                   NALLERLEQQAPRLLEHLAELLARPEAQEKVATGLGEALHQFSRSLGPMGAVLGNLITP
FT                   ETVAGKIRSWLGRKGENAGHWLLDEEARRQLAAAMRREAEKFCHRPLGELLADIPPAQL
FT                   DQARRELAQALGRLLARPETATLLNGVLHEALNAHRELPLASLLQNFWGEDAAERGQRF
FT                   GQQELLRLLRSRRTKRMLDRLLIDLTETRLLAQPLGRPADLLPREIKTGINDYLQEQIN
FT                   LLLEREVPQLIDALNIREIVTRKVDRLDLLQLEGLLLSIMQDQFKYINFFGALIGFLIG
FT                   LFNLLILTVF"
FT   gene            complement(507740..509416)
FT                   /locus_tag="DaAHT2_0434"
FT   CDS             complement(507740..509416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0434"
FT                   /product="prephenate dehydratase"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; Prephenate dehydrogenase; KEGG: dps:DP2275
FT                   P-protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85140"
FT                   /db_xref="GOA:D6YZY3"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZY3"
FT                   /inference="protein motif:PFAM:PF00800"
FT                   /protein_id="ADH85140.1"
FT                   /translation="MATIATIGPEGSHAWQAARQYDPAAELLLLPSFTDVFAALAAGGA
FT                   TRALLPAHNTREGRNRDFFRLLSGHPRIHWQDNVILPVHLSLGAPSSDGTINTVVGRPQ
FT                   FLRQCEEYLAARHPAADLLAAHDLNRTVNDLLSSGRTDFGLIEAEEAIHHYGLVLRERE
FT                   ISPHNLTRFAILGDSLPAASGYDATAVITRPLKDRVGLLYAMLGEFARRGINLLDMDSE
FT                   IDPQSRKLSFFIEMEGHAEAGEIRQALKHVEEEVIQEPGSIRIIGTFPRVDIRTKIIRK
FT                   CGFIGSGEMSQWFARRLTGEGYEVMLSGRNSELRPEEMIPQVDLVAICVPISATAATIR
FT                   QYGHLLGKNQALILLAGEAEASLATALECTGPDVEVMLVHNLWGPKAASMKDKNVSLVR
FT                   TPRSGVLCREFEAFLYKHGAVISQDTAPRHNLLMGVSQKLPSATAMALALTLRQHELPP
FT                   EEIERHATLTSAYSMLAMARIHYQNPRTYAEILACPGEGRRIVRDFAANLVRVLDLAEA
FT                   ENITELCRLIEENRAALGEEFLGPTMEQALAVDNVLNSRRP"
FT   gene            509787..510914
FT                   /locus_tag="DaAHT2_0435"
FT   CDS             509787..510914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hha:Hhal_1657 DNA mismatch repair protein
FT                   MutS"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85141"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZY4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85141.1"
FT                   /translation="MKKKVMVTAVALTMLVGGYLSFTTVDEDAGKAVAGANTYEATFYV
FT                   AGMGGHFAKAEVTIDPNNTEQPIILKGMPGMVNIGRPNTHPTHDARIDANDRNIMFWST
FT                   YRPDPEGNLHVGKTDLSTGRVLVDKALPPDERATWTGANYCGSGQSNGYFMPVYMGNEG
FT                   YIDVFSKDDLTHKHRVFFDELGYESGTYTFAHGTNSPDMKHFLLSLNLTPDGHTQFTGN
FT                   TQLILLDMKALEQGKVKKVAEAKITGKPRDASGGTITFRQYYTEDGKYIFQSGGDRGYI
FT                   IDAKTLKVVQVAAPLPGEAHDFMPTPDGKYGVFAIRNRVFSAADEGDVTDGSLALYDVK
FT                   NRRMVGEVTSVCLSCHNAMGMKGSAILCGLDANYN"
FT   gene            511085..512275
FT                   /locus_tag="DaAHT2_0436"
FT   CDS             511085..512275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0436"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   sth:STH855 ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85142"
FT                   /db_xref="GOA:D6YZY5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZY5"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADH85142.1"
FT                   /translation="MQISFITLALKNLRRKVFRTAVLVFAIGLFVALLVFAVSFTISIT
FT                   STIDRVSQRLGADIIAVPIGARTEAQEYLLESRNTSFYMPAELIDEVKAIEGVKNVTHQ
FT                   TYVSSIDGLCCDVIPTMLVAFDPETDFIIKPWLNQAIGRGLRPGEAIAGAGTADNLGLG
FT                   LVVVEATLFNTPFSIVGDLEATGTGLDNALFMTQESFQLIIESGLSPVREDEISVIFIQ
FT                   LEDGLDPDYMGRVIEGQIYTVDVVTRSSMGVRWLTTLADINKIFLVTVSLSLLLTVFLV
FT                   WSIFSAIANERIREIGIMRAIGARQSHVVLLFFLEVNLLGFLGSLLGVAGGTWLSAHLA
FT                   ANFELLSSIEAGLEIWQQLLIGLLGMLVGAGVCLAGAMVPVNRIKKVEPLLAIKDA"
FT   sig_peptide     511085..511198
FT                   /locus_tag="DaAHT2_0436"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.987 at
FT                   residue 38"
FT   gene            512287..512964
FT                   /locus_tag="DaAHT2_0437"
FT   CDS             512287..512964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0437"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: afu:AF1819 ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85143"
FT                   /db_xref="GOA:D6YZY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZY6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH85143.1"
FT                   /translation="MAQLELQDVSKIYRVGDNQLTAMNRVSLRVEEGDFISIVGHSGSG
FT                   KTTLVSVIGGILRPSTGRVLFEQDDICAMDDAQLSAYRSRKIGFMFQFASLLPMLTARE
FT                   NVMLAALFGRERSTEEQQRADHLLELVGIGDRAGAYPGELSGGQQRRVAIARALMNSPR
FT                   LILADEPTGDLDEETEAEIMALLNKINREQRVTMLLITHNGALARTAGRMLRMRQGTLL
FT                   TVA"
FT   gene            complement(513315..514763)
FT                   /locus_tag="DaAHT2_0438"
FT   CDS             complement(513315..514763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0438"
FT                   /product="response regulator receiver sensor signal
FT                   transduction histidine kinase"
FT                   /note="KEGG: geo:Geob_2246 histidine kinase; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; SMART: response regulator receiver; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85144"
FT                   /db_xref="GOA:D6YZY7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZY7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH85144.1"
FT                   /translation="MSNRLKSQPPPATPTAFRRTKANQLRGRILAVDDEPLVLQLITLQ
FT                   AQKLHYRVSTAASGPAALEIMAGEHFDLLLTDILMPEMDGLSFMTEARRRQPDIEVIVI
FT                   SGQHEIKTAVAAMKQGAANYLQKPFSPQELEVALEKGMEHRRLRRLLREKQEELARSNR
FT                   ELDNHRRHLEQLVEARTAELAEANRQLKEDLKARQRAEREADQRRRQLIEADKLASLGI
FT                   LVAGVAHEINNPNNFITMNTPLLQRIWQDTSAILEGHLESRGDFTVAGLPYSELREYVP
FT                   ELLTGIIDGSERITRIVRNLNDYARQSAAEMSQLFDLNQVVRAALALLSSPLKKATHHL
FT                   RLELAADLPPIKGNFQRAEQVAINLLQNACQALTSAESAITVRTEYNPGQKQVILKIVD
FT                   KGCGIPARNIEKIQDPFFTTKRDCGGTGLGLSVSAGIMEEHGGRLHFTSARGQGTTASA
FT                   IFPAACRQPNAGGSDQDLLIINKN"
FT   gene            complement(514773..516185)
FT                   /locus_tag="DaAHT2_0439"
FT   CDS             complement(514773..516185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0439"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: dba:Dbac_2288 two component, sigma54 specific,
FT                   transcriptional regulator, fis family; PFAM: sigma-54
FT                   factor interaction domain-containing protein; response
FT                   regulator receiver; helix-turn-helix Fis-type; SMART:
FT                   response regulator receiver; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85145"
FT                   /db_xref="GOA:D6YZY8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZY8"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADH85145.1"
FT                   /translation="MGANTYPDQPILLVDDEEHALASFDIALKTHGITNTIRCPDGRRV
FT                   PEIVADTEVEVILLDLIMPGISGQELLSQLNESHPEIPVIVITGVNEVETAVDCMRRGA
FT                   FDYLVKPVKTDQMLPSVTRALEVRQLRRENSLLADRFFTNDLSHPEAFAGIITDHPKMQ
FT                   AVFQYCEAVAEGRQPVLITGETGVGKEEIAKALHRLSKRRGRFVTVNVAGLDDQLFTDT
FT                   LFGHAKGAFTGADQARPGLVEKAKGGTLFLDEIGDLSPTSQVKLLRFLETREYYPLGSD
FT                   QAKKTDARVLVATHKDPDQLRTEGALRNDLYYRLRTHHVHLPPLRERTEDIPLLLDHFL
FT                   GEAAREFRKKKPVYHQEIIPLLKNYYFPGNIRELRAMVFDAMSGHRARLLRTETFIKAV
FT                   QGKLGSPDQPRPAAPSYDTEWAQKLDRLPTLKAAAATLVEEALRRSGNNQRVAASLLGI
FT                   TPQALNQRLKRQ"
FT   gene            complement(516225..516725)
FT                   /locus_tag="DaAHT2_0440"
FT   CDS             complement(516225..516725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0440"
FT                   /product="protein of unknown function DUF1058"
FT                   /note="KEGG: dps:DP2276 hypothetical protein; PFAM: protein
FT                   of unknown function DUF1058; SMART: SH3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85146"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZY9"
FT                   /inference="protein motif:PFAM:PF06347"
FT                   /protein_id="ADH85146.1"
FT                   /translation="MVTHRLLTTLNRPLPLVPRRGLIVLIAALLLALPATALADYVSVQ
FT                   RDKINIRSGPGTDHEILWEVFRDFPLKVISRQGEWAQIEDFEKDRGWVYTPLVGNEKRV
FT                   IVQVEVANLRVGPGTNYEVKATVRYGVVFEPLERRRDWVKLQHSDGTTGWMSTNLLWPS
FT                   DII"
FT   sig_peptide     complement(516606..516725)
FT                   /locus_tag="DaAHT2_0440"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.897 at
FT                   residue 40"
FT   gene            complement(516997..518640)
FT                   /locus_tag="DaAHT2_0441"
FT   CDS             complement(516997..518640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0441"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: sfu:Sfum_2177 metal dependent
FT                   phosphohydrolase; PFAM: GAF domain protein; metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: GAF domain protein;
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85147"
FT                   /db_xref="GOA:D6YZZ0"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZZ0"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ADH85147.1"
FT                   /translation="MKTGKEPDAHKPTMGDNHDRQRLQNHLAQLAAIGIALSAEHDLPV
FT                   LLEKIVDEARAFANADAGTLYLLDDHGRHLEFAIIQNTTMGVRMGGSAGPITWPPVPLY
FT                   IDGAGNHTNVSSHTALTGEIVNIPDVYQAKGFDFSGTRQFDAGTGYRSVSMLLIPMQNK
FT                   EGEIIGVLQLINAQDQQRRPIPFPPEDVDLIASLASQAAVAITNVRLYRDLENLFDAFI
FT                   KTIAITIDEKSPHTAGHIRRVQALTMDIAQAMNEDRGRFRDFQLNTDELRELSIAAWLH
FT                   DIGKIVTPERLVSKATKLEALHDRIALVKARYEIHKRDRQIQALRQALARQQPNPAGPD
FT                   NGSGPVASAFEKLEVELTALDEEQRFLEQCNLPTEHLDEKKIARLQEIAARPCTEGNRE
FT                   CRLTADELDNLSIRKGTLNDKERKIIENHVLVTHKMLSELPFPKKLRQVPQYAAGHHEK
FT                   LDGSGYPFGLTADRIPLPTRIIAIADIFEALTAPDRPYKKPMPLSRALEIMESMQQAGH
FT                   IDPDILAFFIEHKVYRHYAKRELSPAQQDC"
FT   gene            complement(518651..519418)
FT                   /locus_tag="DaAHT2_0442"
FT   CDS             complement(518651..519418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0442"
FT                   /product="hemolysin A"
FT                   /note="KEGG: gem:GM21_1580 hemolysin A; TIGRFAM: hemolysin
FT                   A; PFAM: ribosomal RNA methyltransferase RrmJ/FtsJ;
FT                   RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85148"
FT                   /db_xref="GOA:D6YZZ1"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZZ1"
FT                   /inference="protein motif:TFAM:TIGR00478"
FT                   /protein_id="ADH85148.1"
FT                   /translation="MVTIQKMKQRLDKLLVTRGLAPSRQRAQALIAAGQVRGEHGQVLD
FT                   KAGTLLPPATPLQVKENPCPFVSRGGLKLAAALDYFAVDPANLVALDIGASTGGFTDCL
FT                   LQRGAARVYAVDVGYGQLAWKLRQDPRVVVMERTNARHLTTTDIPEAIDLAVMDASFIS
FT                   LELLLPPLLPLLKPAALIIPLIKPQFEVGKGKVGKGGVVRDQELHREVVSRLQNFTAEL
FT                   GLSWQGVITSPVPGPKGNLEFLALLQIGPPEKA"
FT   gene            complement(519568..520917)
FT                   /locus_tag="DaAHT2_0443"
FT   CDS             complement(519568..520917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0443"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="TIGRFAM: phosphoglucosamine mutase; KEGG: dps:DP1641
FT                   phosphoglucomutase/phosphomannomutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85149"
FT                   /db_xref="GOA:D6YZZ2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZZ2"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ADH85149.1"
FT                   /translation="MRRLFGTDGIRGMANLYPMTTEIAMQVGRGLAFLVKQQSHRHRIV
FT                   IGKDTRLSGYMIENALAAGICSMGVDILLVGPLPTPGIAFITTSMRADAGVVISASHNP
FT                   FADNGIKIFAADGYKLPDAEELAIEDLIFSQKMAALRPTAEEVGRATRIDDARGRYIVY
FT                   LKNAFPADLSLDDLHIVLDCANGAGYGVAPHVFSELGAKVTTIGAEPDGTNINRECGAL
FT                   CPEIMAAKVRETGADIGLALDGDADRLMVADETGTILNGDQIMAICAADLLAEKRLRHK
FT                   TLVATVMSNLGLEHFMRAHGGRLERTPVGDRYVVERMRTKGYNFGGEQSGHLIFLDHNT
FT                   TGDGILAALRLLAVMLKQNKRLSELAGLMTAVPQVLENVRLERPAAPDKIKGLKKLVNA
FT                   AEAELGREGRILIRPSGTEPLIRVMVEGADQARIGMIAKEICEHIKQQTT"
FT   gene            complement(520914..521672)
FT                   /locus_tag="DaAHT2_0444"
FT   CDS             complement(520914..521672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0444"
FT                   /product="YbbR family protein"
FT                   /note="PFAM: YbbR family protein; KEGG: dps:DP1640
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85150"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZZ3"
FT                   /inference="protein motif:PFAM:PF07949"
FT                   /protein_id="ADH85150.1"
FT                   /translation="MEKLVEQIKKAATTEVADYWPKDWVLRLLALLFAVLLWHFVVGED
FT                   KIDTHVLVPVELVNLPRDMVIVNQYKQQLEVTIAGPRGLIDGLRRQNVTRTINLAGAQP
FT                   GTMAIRNDPDSIPFPRGIEVLRVQPAHTTLHIDHLQEKNFPVEPKITGQPAPGYLLLQV
FT                   QADPATISIRGPATLLGQTDQLPTVPVDIEGLTETTSRQVALVMDEKLTELLGETTVKV
FT                   RLIIEPEEAENDENRRDTEPVPLLPEQPQP"
FT   gene            complement(521648..522439)
FT                   /locus_tag="DaAHT2_0445"
FT   CDS             complement(521648..522439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0445"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; KEGG:
FT                   dps:DP1639 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85151"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZZ4"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ADH85151.1"
FT                   /translation="MLTNLTSLRWQDVLDILIVAYLIYRIMLLIRGTRAVQMLVGIAVL
FT                   IVIYFAARELEFLTLYWLLGSFLSSLFLIIIIIFQRDIRRALTQFGRTPFSKSSEETLH
FT                   VLGETVKAAYALSRDRIGALIVIERRTGLKDFLESGQSLNAEVSHQLLYSLFLHNSPLH
FT                   DGAVIIVDDKIAAAGCFLPLTKNPYISKHLGTRHRAAIGVTEETDAVVIVVSEETGRVS
FT                   LAQHGALTLDLDEQALRSRLDNIFLPKEYISPKLWKNWLNK"
FT   gene            522797..523069
FT                   /locus_tag="DaAHT2_0446"
FT   CDS             522797..523069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0446"
FT                   /product="ribosomal protein S20"
FT                   /note="KEGG: dps:DP1618 30S ribosomal protein S20; TIGRFAM:
FT                   ribosomal protein S20; PFAM: ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85152"
FT                   /db_xref="GOA:D6YZZ5"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZZ5"
FT                   /inference="protein motif:TFAM:TIGR00029"
FT                   /protein_id="ADH85152.1"
FT                   /translation="MANHKSAMKRNRQNVVRRERNRSNRSRLKTLYRRIDEAIVANSPE
FT                   QARQALQNAVPMIAKAVNQGVLHRNTAARKISRLTRRVNAFAQNS"
FT   gene            523181..524716
FT                   /locus_tag="DaAHT2_0447"
FT   CDS             523181..524716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0447"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: anthranilate synthase component I; KEGG:
FT                   dps:DP1619 anthranilate synthase, component I; PFAM:
FT                   Chorismate binding-like; Anthranilate synthase component I
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85153"
FT                   /db_xref="GOA:D6YZZ6"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZZ6"
FT                   /inference="protein motif:TFAM:TIGR00564"
FT                   /protein_id="ADH85153.1"
FT                   /translation="MNGFEKFTQLAARHNLVPVTRELIIDLDTPLTIFSKVAADQSHAF
FT                   LFESLEGGEKWGRYSFIGFDPLVIFASRGDQVLIRRLTPEAAAEIDRPPVFSEERRCGD
FT                   PLQLLEQLLAELNPAVVDGSLPRFNGGAVGFLGYDMVRFMERLPDENPPLADCPDSSFL
FT                   VPRVVLVYDNLRQRLTVVNWVVTGGDNDLARLYDRARQRLDRLEEALRQPLAPELLTDC
FT                   QPDAAPPHNFTANMSPDQFKAMVEKAKEYIRAGDVIQVVLSQRFQATTSVAPLRLYRAL
FT                   RHINPSPYLFYLKLGDLVQIGSSPEILVRLEGEQIELRPIAGTRPRGRNAEEDLALEQE
FT                   LLADPKERAEHLMLVDLGRNDVGRVARYGSVEVRDLLVIERYSHVMHIVSGVHGRLAEG
FT                   RNQFDVVRACFPAGTVSGAPKVRAMEIIEELEPQRRGPYAGAVGYFGFTGNMDFCITIR
FT                   TFVLRGDELWVQAGAGIVADSDPESEYTETVNKSMGLRRALQLAEMDSGKQGR"
FT   gene            524742..525329
FT                   /locus_tag="DaAHT2_0448"
FT   CDS             524742..525329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0448"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="KEGG: dps:DP1620 para-aminobenzoate/anthranilate
FT                   synthase glutamine amidotransferase, component II; TIGRFAM:
FT                   glutamine amidotransferase of anthranilate synthase; PFAM:
FT                   glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85154"
FT                   /db_xref="GOA:D6YZZ7"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZZ7"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADH85154.1"
FT                   /translation="MLVVIDNYDSFTYNIVQTLGGMGAEMVIYRNDEVDIATVEACRPH
FT                   RLLISPGPCTPAQAGISVDLIRHFSGKIPVLGVCLGHQAIGEAFGGKIVRADRLMHGKT
FT                   SMISHDGKGVFRGLPDPFEAMRYHSLAVEEESLPGCLEITARSDHGELMGLRHRELVVE
FT                   GVQFHPESIMTPAGVGLLKNFIDPDYPSFLRG"
FT   gene            525359..526402
FT                   /locus_tag="DaAHT2_0449"
FT   CDS             525359..526402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0449"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /note="KEGG: dps:DP1621 anthranilate
FT                   phosphoribosyltransferase; TIGRFAM: anthranilate
FT                   phosphoribosyltransferase; PFAM: glycosyl transferase
FT                   family 3; Glycosyl transferase, family 3-like"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85155"
FT                   /db_xref="GOA:D6YZZ8"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZZ8"
FT                   /inference="protein motif:TFAM:TIGR01245"
FT                   /protein_id="ADH85155.1"
FT                   /translation="MIKEAIARVVAGHDLEETEMVGVMQEIMGGEATAAQIGAFITALR
FT                   IKGETAAEITGAVRVMREKATPITPFTAEELAAGQVLIDTCGTGGDSSGTFNVSTTTAF
FT                   VVAAAGLPVAKHGNRSITSSCGSADVLESLGVDLQLAPEQITAAIRQVGIGFMFAPALH
FT                   GAMKHAIGPRREIGIRTIFNILGPLTNPAGANVQVMGVYDRALVETLAGVLGRLGSRRV
FT                   MVVCGEGNVDEITVTGPTQIAEYHAGEVRSYTVSPEDFGLTRAGLAEISGGATAAEAAT
FT                   QLRAVLAGEPGPRRDMVLLNAAAVFIAAGRCPDWAAGVELARELIDNGAALAKLDALVA
FT                   FCRKQKS"
FT   gene            526557..527324
FT                   /locus_tag="DaAHT2_0450"
FT   CDS             526557..527324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0450"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="KEGG: dps:DP1622 indole-3-glycerol phosphate
FT                   synthase; PFAM: Indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85156"
FT                   /db_xref="GOA:D6YZZ9"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:D6YZZ9"
FT                   /inference="protein motif:PRIAM:4.1.1.48"
FT                   /protein_id="ADH85156.1"
FT                   /translation="MILDRIVARKKEEIAALKRRGLGAPADEPDPPRGFIAALTGCSEV
FT                   AVIAELKKASPSKGVIRPDFDPAAIAAAYQRGGAAALSILTDVDFFQGSLAYIPQVRRL
FT                   VPLPVLRKDFLLDPLQVEEASRYGADAILLIAAILTVPQMEELRLQAEELGMDVLVEIH
FT                   DEAEAEQALAAGARLIGVNNRDLRDFSMDLNTTFRLRKLIPPTIPLVSESGIRDHADIT
FT                   ALAAHGIAAALVGETLMRAEDPGQALLALRGAV"
FT   gene            527507..528142
FT                   /locus_tag="DaAHT2_0451"
FT   CDS             527507..528142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0451"
FT                   /product="Phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="KEGG: dps:DP1623 N-(5'-phosphoribosyl)anthranilate
FT                   isomerase; PFAM: N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI)"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85157"
FT                   /db_xref="GOA:D6Z000"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z000"
FT                   /inference="protein motif:PRIAM:5.3.1.24"
FT                   /protein_id="ADH85157.1"
FT                   /translation="MEGRTRIKVCGMTEPVRAREAVAAGVDALGFIFAPQSPRLVLPEQ
FT                   AREIIATLPPFVDAVGVFVNEEVEVVREIAQYCGLTMLQLHGDEEPEFCRAMPLRVIKA
FT                   IRVGEHSLPADLSPYRGCVSAFLLDTYQQGVAGGTGQSFDWQLVARLAPPAPVVLAGGL
FT                   TPDNVGEAIARVRPFAVDFNSGLETAPGLKDSRLLRRAVAAVGLADGQ"
FT   gene            528464..529903
FT                   /locus_tag="DaAHT2_0452"
FT   CDS             528464..529903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0452"
FT                   /product="protein of unknown function DUF342"
FT                   /note="PFAM: protein of unknown function DUF342; KEGG:
FT                   cth:Cthe_0498 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85158"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z001"
FT                   /inference="protein motif:PFAM:PF03961"
FT                   /protein_id="ADH85158.1"
FT                   /translation="MASDKLFKSGVEFQDGAFVLKVSKDRLCAVVRASDTEKAVDLDRE
FT                   VLQKLLAEEGIVYGLLPEPAVRSDGSLFVARGLAPQHGEDSRVKMHVKPSVVRVPKVKD
FT                   PGRDQVDFRELGSIVNVEKGRQLLEIIPPTPGTPGKDLFGAEVPPKPGKERKLRTGPGV
FT                   SVSDDGRKVYAACTGKFVMADGKPGVYEEHVVSGDVDMSVGNIAFGGKKLIVNGEVPMG
FT                   FSVKCRGDIVIAKGVYNSLVMAGGKLTVRGSAVGEETVLRARGDVEITFMENGPGVEAG
FT                   GDLIINDSAIQSHGLVGGAIYAKGQGVLVGGKYIVGGSVYVRDLGTDAEVQTILHVGVV
FT                   PSIQGRKQKIDEDLHLWAERLNEIIKNISALEKMKKEQGARFPEERAELLGKYKKAMPK
FT                   AMDRVNVLTEQANALEKELEQMVAESVYVYGTIYPGAVVSIGSATRYVTSEEQQCVVYF
FT                   DQSTRQILIRKMNQEEQALFK"
FT   gene            complement(529896..531092)
FT                   /locus_tag="DaAHT2_0453"
FT   CDS             complement(529896..531092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0453"
FT                   /product="pyridoxal phosphate biosynthetic protein PdxJ"
FT                   /EC_number="2.6.99.2"
FT                   /note="TIGRFAM: pyridoxal phosphate biosynthetic protein
FT                   PdxJ; KEGG: dps:DP1605 pyridoxal phosphate biosynthetic
FT                   protein; PFAM: Pyridoxal phosphate biosynthetic protein
FT                   PdxJ; protein of unknown function UPF0054"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85159"
FT                   /db_xref="GOA:D6Z002"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z002"
FT                   /inference="protein motif:TFAM:TIGR00559"
FT                   /protein_id="ADH85159.1"
FT                   /translation="MPVLLKHQGGDIGSNELARLKKQAAILLHLTGQPRSELSLLLVDD
FT                   RQMQEFNHLFRQRNRPTNVLAFAQREAPEIPGGLGDEMLGDVVISLDTARREARAAGVS
FT                   PGHRLAWLLTHGLLHLLGYDHEQSSAEAERMAEAEEALLHKLQEHERKSKMTQLAVNVD
FT                   HVATLRQARGINEPDPVLAAGICELAGAEGIVVHLREDRRHIQDRDVLLLRQTVKSKLN
FT                   LEMAAAAEIIDFALRLKPDMVTLVPEKRRELTTEGGLNVKGQQKKLAKVIKEMNQAQIP
FT                   VSLFVDPDPGQIAAAAAIGASFVEIHTGRYCDAPSEEEREREFALVAQAAEEALAAGLR
FT                   VNAGHGLNYLTTARVAALGTIEELSIGHAIMARAILVGLEKAVAEMRAIIKQASPAFT"
FT   gene            complement(531094..532140)
FT                   /locus_tag="DaAHT2_0454"
FT   CDS             complement(531094..532140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0454"
FT                   /product="PhoH family protein"
FT                   /note="KEGG: dps:DP1606 phosphate starvation-induced
FT                   protein; PFAM: PhoH family protein; SMART: KH domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85160"
FT                   /db_xref="GOA:D6Z003"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z003"
FT                   /inference="protein motif:PFAM:PF02562"
FT                   /protein_id="ADH85160.1"
FT                   /translation="MMTETTEELSFNDNALVGQLYGELNRNLAIIEETSGVGIQVRGTT
FT                   VTLKGSEAEVALAASALRKLYELLRSGYPVYPADVAYALRVLAASPKAVLTDIFLDKVY
FT                   ITAEQKVISPKSLNQKTYIDAIRRHDVVFAIGPAGTGKTYLAVAMAVAAYVNRRVKSII
FT                   LARPAVEAGERLGFLPGDLAEKVNPYLRPLHDALNDLLGPGKVAQLLDEGVIEIAPLAF
FT                   MRGRTLNDAFVILDEAQNTTSEQMKMFLTRLGFNSQAVITGDVTQVDLPPEKKSGLVEA
FT                   QRILKQVKGISFCEFSDADVVRHPLVQKIIVAYQQATGSKKRPATRPASASRRKSGQDA
FT                   TTATRQES"
FT   gene            complement(532137..532997)
FT                   /locus_tag="DaAHT2_0455"
FT   CDS             complement(532137..532997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0455"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: dps:DP1607 27kDa
FT                   outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85161"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z004"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADH85161.1"
FT                   /translation="MSFRTIASLTAIIACALLLLGGPALAGVSWQAGVAITPEEKPLDV
FT                   AYSLDGSRIYILVEGGKVLIYDEQGELTGTIPVDPEMDRISAVGLQRAGIPEKIVVTGS
FT                   ASGVVQELSLRFALQINTEGAPFLGRADAPVEIVEFSDFQCPHCARVKPLIEQIMLQFP
FT                   DQVKVVFKHFPLSFHEYAKPAALATMAAQNQGKFWEFHDKLFAAQSEISPQRIRAIARE
FT                   LELDMERFNRDLQSRELHSRLEQDIQDGQQAGVRGTPTIFVNGMLLEQRSPENLRQMVE
FT                   EALAR"
FT   sig_peptide     complement(532917..532997)
FT                   /locus_tag="DaAHT2_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 27"
FT   gene            complement(533263..534510)
FT                   /locus_tag="DaAHT2_0456"
FT   CDS             complement(533263..534510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0456"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: dps:DP1808
FT                   glycolate oxidase, iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85162"
FT                   /db_xref="GOA:D6Z005"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z005"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADH85162.1"
FT                   /translation="MSAGVRPEQNCAKCGACSTVCPVYRQTGREYHTGRGKLHLLSRLD
FT                   PTAASTVYAEILSHCLLCGACSQVCSRRLPVAEMLAEARGELTRRAGQHAMLRALSNGL
FT                   LSRPRLLQALAPLARRLKELNLPADSGLNLRLGILPDHQPAATSEPPRPPEKTAPATSE
FT                   PYIFSGCFATYLEPEITRALSNLLTRAGQPPAAPHPARGCCGLAAYSCGQKEEARRMAR
FT                   VNIAAHPGQSPIVVACASCASHLLRYPELLADDPQWAGRAEDFAARVREFSHFLYQQPP
FT                   QPPPTPASGESEGPADAAAGSPKTLKVLYHDPCHLRFGCQITREPRQLLNRLPGLELLE
FT                   LPDGPQCCGHGGHFHLAHPESAEGILRRLSEAAQTVAPEVITTACTGCLLHWRHAARQG
FT                   YHQARVIHLAVLLDKL"
FT   gene            complement(534507..535614)
FT                   /locus_tag="DaAHT2_0457"
FT   CDS             complement(join(534507..535532,535534..535614))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="DaAHT2_0457"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpm:BURPS1710b_3602 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85163"
FT                   /db_xref="GOA:D6Z006"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR020853"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z006"
FT                   /inference="similar to AA sequence:KEGG:BURPS1710b_3602"
FT                   /protein_id="ADH85163.1"
FT                   /translation="MSFSIAPELKEKAENLQGRLQTLRSHLDLDNKLLRIQELEHRSAA
FT                   PNFWDNPEAAAGVQKEQSDLQDTIDNWQQVIDSFEDAEVLLELAIAENDHETEQEVSRA
FT                   LNSVEQRLAAMELECMFNGEHDASNAMLTIHAGAGGTEAQDWTDILLRMYLRWAEKKGF
FT                   STEILDHLPGDEAGTKSVTVLVKGRWAYGYLRSEMGIHRLVRISPFDTGGRRHTSFASV
FT                   FIFPELDDNIEVEINDKDLRIDTYRASGAGGQHVNKTSSAIRITHLPSGIVVQCQNERS
FT                   QHRNKDTAMKMLKAQLYERERANRKEEQQHLHGDKKEIAWGSQIRSYVLQPYRLVKDHR
FT                   TNHETGNVDNVLDGDLDPFIISYLLWQP"
FT   gene            complement(535827..537560)
FT                   /locus_tag="DaAHT2_0458"
FT   CDS             complement(535827..537560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0458"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="KEGG: dps:DP1810 apolipoprotein N-acyltransferase;
FT                   TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85164"
FT                   /db_xref="GOA:D6Z007"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z007"
FT                   /inference="protein motif:TFAM:TIGR00546"
FT                   /protein_id="ADH85164.1"
FT                   /translation="MGMGGMGKISLAALSGLLLFFSSPGSGGHALLAWMALAPLLLAIQ
FT                   QLDWRRAAGLGLLAGVVYHLPLLHWITIVLGDYGGVHPLVAALALGLLVIYMSLYPAVF
FT                   AALLVTLTGWGGNDNRHRGLVLWAPAVIWVGLDVLRARLFTGFPWQDLGYSQYQLPLLT
FT                   QVADLGGHHAITFLIVLSSTLLALLVIVQQHRIFGRSAKLTYRGYAALDCLPEPAALLN
FT                   DYGTSDRQVGTPGERFPYRRTVALPGRWSLALAVLLLISSVAYGSLRLQQFDKILATAP
FT                   VLETAVVQGNIPQEEKWDQQLRFATVQRYLELSEATAAGPEKPPTLIVWPETALPFYPL
FT                   EHHLFYDIIDFAAQHGSCLLVGAPHRELDNDRQLQYYNSAMLISPDPAVQQPAGIYRKQ
FT                   HLVPFGEYIPLRRLLPFFAPVVETLGDFTPGPEPALLTCADRKIGTLICFEAIFPRLAR
FT                   QMTAGGAELLVNITNDAWFGLSNAPHQHLSMAALRAVENRRSLARAANTGISVMITPDG
FT                   RLHQATQLFVPDARHAALPLPAPAGKMNSLFTAGGYLFGLLCLLLLSAGIVRHIYVIKR
FT                   V"
FT   gene            complement(537573..538451)
FT                   /locus_tag="DaAHT2_0459"
FT   CDS             complement(537573..538451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0459"
FT                   /product="CBS domain containing protein"
FT                   /note="KEGG: dps:DP1811 hypothetical protein; PFAM: CBS
FT                   domain containing protein; transporter-associated region;
FT                   SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85165"
FT                   /db_xref="GOA:D6Z008"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z008"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADH85165.1"
FT                   /translation="MDPSPEPAPAEPPTSPRAAESPFRRLLNLLGISKNPDTAEEIEKE
FT                   IQEILDEGEEQGLITPEEGEMIAGIMELKDTQAYEVMTPRAEMVMAEAATPLADLLQLI
FT                   IDRGFSRIPVYRDSPDQIIGILHAKDLLPYCLNGSEPPTAGMLAKPAVFVQEKSKVIKL
FT                   LKSFQQQKNHMAVVNDEFGGVRGLITLEDIVEEIVGDIVDEHDRTTRRWKVVDPNTVLA
FT                   DAKVDIEEVEDFFGTELPEGPYESLGGLILHHLDQVPPPGVTLSIESLVFEVIAADKRR
FT                   VLTVKIQKKIT"
FT   gene            538809..540215
FT                   /locus_tag="DaAHT2_0460"
FT   CDS             538809..540215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0460"
FT                   /product="Pyruvate carboxylase"
FT                   /EC_number="6.4.1.1"
FT                   /note="KEGG: dps:DP1812 biotin carboxylase; PFAM:
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   Carbamoyl-phosphate synthase L chain ATP-binding; biotin
FT                   carboxylase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85166"
FT                   /db_xref="GOA:D6Z009"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z009"
FT                   /inference="protein motif:PRIAM:6.4.1.1"
FT                   /protein_id="ADH85166.1"
FT                   /translation="MKDKVLIANRGEIALRIMQACRDLGLDYVVVYTEADEQSEHVQRN
FT                   LDSKSNQRRAWRVASYTDPNDILAVADHTKCTAIHPGYGFFSEDYRFARRVTVRDQPLT
FT                   FIGPKWEVIKDLGDKINTKRVANQLGIPTIPGTDGPIYNEIDAEEIARRLLEDQAEREI
FT                   RQPSVLVKAAAGGGGMGIEEVHEIEQFRRVYRQVQNYAKRQFGDSGVLIEQCLRDYNHL
FT                   EVQLLCSRHGERVHFGTRNCTIQSTGRQKRLEAAPGFDTSCFPYEFDAPAVLDEIVENS
FT                   LKLASHVRYDNVGTWEWIVSRSGQPYLLEVNTRIQVENDVSARISYLDGKHPNLIREQI
FT                   RLALGDKLGYSQADIEFRGASIELRIVAEDPQRGFAPWIGTISQFSYPRHEWSVVYSHV
FT                   PIDRPYAIPSDYDPNLALALVWGESMAEAKQRARRFLDEMVIEGSNSAGAPINTNLQYL
FT                   ADNMDRLLTF"
FT   gene            540233..542482
FT                   /locus_tag="DaAHT2_0461"
FT   CDS             540233..542482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0461"
FT                   /product="Acetyl-CoA carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /note="KEGG: dps:DP1813 acetyl-coenzyme A carboxylase
FT                   subunits alpha/beta; PFAM: Acetyl-CoA carboxylase, alpha
FT                   subunit, conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85167"
FT                   /db_xref="GOA:D6Z010"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z010"
FT                   /inference="protein motif:PRIAM:6.4.1.2"
FT                   /protein_id="ADH85167.1"
FT                   /translation="MEDLRKRLLKAEERISYLGWIKEGSEWANLPALQEKLQSLRDAFY
FT                   EHSHEHLAEKIGALEESLTFLESRCEETLSPMERVRIVRSPLRFSLKDILENVYEEYTE
FT                   LGGEEDANIDPALVAARASIARRVKNKVVMQQVMVIGHEKGHGEEYRNGGSTKPWGNEK
FT                   ALRYMRVAETEGIPIHFYVFTPGAFPVEEYPGAGQQIARNLYAMAKLRVPMVAVTSEGG
FT                   SGGAEAVGMGDFRLMFSHGYYSVISPEGAAAIEGKIREGVKVPKDLLENCAERLAITAE
FT                   DNLRHGTIDRIIQEPLLGARRDDFTFFRRVKDEMIRATDEVVLKTKSLRAFRAYELKME
FT                   KAGPDDDLRVYVSWELADDEIGRLLQHRSRKYRQMATKAYREHLTTGAALYRRVGRGLA
FT                   KFYYTIRYDVLKSRHKQVKKVMQDVSGEGSVLIKQMSAPFTAAYDFITRKPGSRATRGS
FT                   AGWGTSSPEQIEYGEIYTSSLANEDRTVSCPNAERHGCKDLWVPDLYGEFCGVCENCGH
FT                   HFPLEYQWYMKHLFEPDSIREFNADLASINPLSFPGFDKKLEAARKKTGRPCAMITFDA
FT                   RVMGIDIVVAMLYSDFRNGTVGAAEGEKFARACEIARIKRRPLLSYVHTTGGIRIHEGT
FT                   MGVIQMPKCTMAVREYIDSGGLYIVVYDNNSYAGPVASFLGCSPYQFAIRSSRLGFAGP
FT                   RVIRDTTGEDVPPDYHGARSALKRGHIQGIWDRRDFRRNLHKSLMTMGGGNLYYR"
FT   gene            542632..543282
FT                   /locus_tag="DaAHT2_0462"
FT   CDS             542632..543282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP3087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85168"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z011"
FT                   /inference="similar to AA sequence:KEGG:DP3087"
FT                   /protein_id="ADH85168.1"
FT                   /translation="MQEHDIDFDAILSRYRADPFAYREVRTAHTGRLRCKVREGDEVVG
FT                   PSGKFRHIPGTLLYELERERNLKPITSLINGQVAMLRSDLEGSFVESGEHVLTIRHPLK
FT                   KREIVEDILRQVLTPYTAPEKAKYFFSLELQSRIDKYGQRSVSIKPGDEILTMSLMKRD
FT                   TPVYYDGEPGIIHSVYFKPGVSVDQGEPLFGVCPKEKLPLIEKIITRVKAEWE"
FT   gene            complement(543449..544075)
FT                   /locus_tag="DaAHT2_0463"
FT   CDS             complement(543449..544075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: avn:Avin_22870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85169"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z012"
FT                   /inference="similar to AA sequence:KEGG:Avin_22870"
FT                   /protein_id="ADH85169.1"
FT                   /translation="MSYILEALKKSQRERDLGKVPSLETQQESPTTAGKPARSRLVPIL
FT                   LLNALLLLGVLGYLVLTQPGPGLLERKSEQHAAADDPAPPKNQEQPAAPAPEAAAKPPA
FT                   ATANEVAEATTAADPAPAPATAPPPQPDAAPPKFSDLPAAVRQQISPPTLQVHVYSENH
FT                   QRRFIVVGGRQYQEGDRLPGNLKLDKITPDGVELSHQDQPFHLPR"
FT   gene            complement(544099..545427)
FT                   /locus_tag="DaAHT2_0464"
FT   CDS             complement(544099..545427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0464"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="KEGG: mca:MCA0061 general secretion pathway protein
FT                   A; PFAM: Peptidoglycan-binding domain 1 protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85170"
FT                   /db_xref="GOA:D6Z013"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z013"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ADH85170.1"
FT                   /translation="MYERHFGFNHKPFSITPDPRFLYLSARHREALAHLLYGVSEGGGF
FT                   VLLTGEVGTGKTTLCRSLLEQLPPEVDLALILNPRLDAVELVAAVCDELQISYPAGCTS
FT                   LRTLVGALNDHLLQSHAAGRRTVLVIDEAQNLSPEVLEQIRLLTNLETSESKLLEITLL
FT                   GQPELREILTRPELRQLAQRITARYHLGPLSPEETVAYVRHRLLVAGVSRSLFTAGALK
FT                   TLCRLSGGIPRLINVICDRALLGAYVEERNEVDAAILRRAAREVQHESNLPERWRRLLA
FT                   APTLRRRLLAAILLLALLPAGLLTYRLLPEQLPLAPPKQPGETTIPQEILWPPLLPGEL
FT                   LQEGDQGPEVRQLRFLLQQLAAELSGHEEERAAATLAATASGADYFDAELAELVGNFQA
FT                   AHGLEADGIVGPQTWRQLRRSLVDLPPPGTADFNRQAPNKKTE"
FT   gene            545512..546474
FT                   /locus_tag="DaAHT2_0465"
FT   CDS             545512..546474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0465"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /note="KEGG: dps:DP3086 biotin acetyl-CoA carboxylase
FT                   ligase; TIGRFAM: biotin/acetyl-CoA-carboxylase ligase;
FT                   PFAM: biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85171"
FT                   /db_xref="GOA:D6Z014"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z014"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ADH85171.1"
FT                   /translation="MTDTVTAATPAATALPPPSLVALVEQMSAGEKECRRDFAEAAADE
FT                   ILAYGAVVGAAVELFQRRDRCMDYARALIREYEQAGRAFPSGQVFIARELAAGKGRFDR
FT                   SWHAPAGGLWLTLVLVNTLLPQHGRFYSLAVGVACAETLHSFGVPAKIKWVNDILLDNR
FT                   KLAGTLIETDRGLHGAEEYVLIGIGINVNNDSFPPELHGLAGAMKDYLGREIPLEVVAA
FT                   RLLSKLRWNIGLLHYAEARQLAEEGDTGEPPLNHPLLQSWRQLSDTIGRRVMFGFDIQR
FT                   RPQYEAVVEDIEPSGGLVLRHLADGAQIIEHAGEIIYLD"
FT   gene            546474..547403
FT                   /locus_tag="DaAHT2_0466"
FT   CDS             546474..547403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0466"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   dps:DP2580 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85172"
FT                   /db_xref="GOA:D6Z015"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z015"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADH85172.1"
FT                   /translation="MNDEFPPVSVIIPTYNRADFLDGAMASVLAQNYPCFELLVVDDGS
FT                   RDQTAEVVAAWQRRLAAKTDEPADSSVDSRPGEAMTRLLPAPGSRPSLRYLRQENRGPA
FT                   AARNLGIKEARHDLLAFLDSDDRWRPGKLAAQAGAMAARPEFLLSHTEEIWWRNGRRLN
FT                   QKKRHRKQGGELFARSLELCVIGMSTVMARRRLFEAVGMFDENLPCCEDYDLWLRLTAR
FT                   HPVLYLEQPLTEKHGGRPDQVSVQYRVGMDRFRIQAIGKLLQDGALTREQTALAQQELQ
FT                   RKCLIYGEGCLKHGRQQEASHYLKLAKR"
FT   gene            complement(547425..548741)
FT                   /locus_tag="DaAHT2_0467"
FT   CDS             complement(547425..548741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0467"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sus:Acid_5839 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85173"
FT                   /db_xref="GOA:D6Z016"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z016"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADH85173.1"
FT                   /translation="MPTPEPTANAAAQNGPDLSRPHLPAGEWRSYVILFKGNKNYLRFW
FT                   LAGVVSQMGNWFNYIAVFVLLNELVGSGVAVSWFLIAKYLPTAILAPAAGVVADRFSRK
FT                   AIMIFCDVGRIFVVLGFLLVRDAELVWLVFVLALIQETLWSFYDPARRASVPNVCRPEE
FT                   LHLANALSGATWSVMLAVGAALGGLVTAAWGWQTAIVLDALTFAVSAALLASVVLPHVA
FT                   RKKTGKNTWRDYTGLNDLTAGIRYLAGHRQVAALLMVKSGWAISGGLLVMLAIFGEQVF
FT                   QVGGQGGGSGVLYSMRGIGAAIGPILAWRLLGESNRDMYRSIGLAFFMGCLSYLAFSLS
FT                   PTLAWAALFVLLGHIGGSVQWVFSTTLLQKAVEDQYRGRVFATEMALVTMILSISTYLT
FT                   GAALDHGIDPRRVTMVLALCFLVPGVFWTIHAKRRLREE"
FT   gene            548955..549989
FT                   /locus_tag="DaAHT2_0468"
FT   CDS             548955..549989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0468"
FT                   /product="Inositol phosphatase/fructose-16-bisphosphatase"
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-16-bisphosphatase; KEGG: dba:Dbac_1136
FT                   inositol phosphatase/fructose-16-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85174"
FT                   /db_xref="GOA:D6Z017"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z017"
FT                   /inference="protein motif:PFAM:PF00316"
FT                   /protein_id="ADH85174.1"
FT                   /translation="MSRPLGITVSRHIMDSQRLHPEATGDLTGLLNELIVAAKTISAEV
FT                   NMAGLADILGMSGKTNIQGEHVQKLDEFANNTIKRRMARCGYLCAMTSEEEADIIPVAE
FT                   GYEGKYTLAFDPLDGSSNIDVNVSIGTIFSIHRRFTPDGGPGEEVDLLQPGKKQVAAGY
FT                   IIYGSSTMLVFTTGDGVHGFTLDPSVGEFYLSHPDIRIPEKSKYFSINEGNWHYWQEPV
FT                   RRYLEYLKAEDKATGRPYSARYIGSMVADFHRNLIAGGIFLYPRDSKDQTKTYGKLRLL
FT                   YEAAPLAMVVEQAGGKAVTDDGRSILDMAPEDLHQRVPVVIGSARDVDTFLQFMNDTPV
FT                   KPAG"
FT   gene            complement(550018..550959)
FT                   /locus_tag="DaAHT2_0469"
FT   CDS             complement(550018..550959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0469"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="KEGG: dps:DP2602 tRNA-dihydrouridine synthase;
FT                   TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85175"
FT                   /db_xref="GOA:D6Z018"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z018"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ADH85175.1"
FT                   /translation="MNEQTLQIGPIAPASPLIAAPLAGFSDLAFRLLCREYGAGLCYSE
FT                   MISCHGLVRQQPSTLELLATVPAERPVIMQLFGAEPEVMGQAAAILSRLPIDGIDINMG
FT                   CPVKKVVKKGAGAALMRQPELAAAIVTAVVKATELPVTVKIRTGWNHQRITAPEFARRC
FT                   EDCGAAAITVHGRTWSDGFSGRADQRLIAAVKQAVKVPVIGNGDVTCHQEAVAMMANTG
FT                   CDGVMIGRGAIGAPWVFSPDFPTSPTLPRRLAAARRHLELLQQYHPHHHPSRINNQIGR
FT                   YFKGVPGGAAIRKEIYEAVNPAALAGLLQRLG"
FT   gene            complement(550968..552959)
FT                   /locus_tag="DaAHT2_0470"
FT   CDS             complement(550968..552959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0470"
FT                   /product="transketolase"
FT                   /note="KEGG: tgr:Tgr7_2893 transketolase; TIGRFAM:
FT                   transketolase; PFAM: Transketolase domain protein;
FT                   Transketolase central region"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85176"
FT                   /db_xref="GOA:D6Z019"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z019"
FT                   /inference="protein motif:TFAM:TIGR00232"
FT                   /protein_id="ADH85176.1"
FT                   /translation="MAPTRHQLANAVRALSMDAVQKANSGHPGAPMGMADIAEVLWNDF
FT                   LKHNPGNPAWPDRDRFVFSNGHGSMLLYSVLHLSGYDLGIEEIKNFRQLHSKTPGHPEY
FT                   GYTPGVETTSGPLGQGIANAVGMAIAERTLAAQFNRPGHEIVDHHTYVFLGDGCMMEGI
FT                   SHEACSLAGTLGLNKLIAIYDDNGISIDGEVEGWFTEDIPGRFAAYGWKVIAEVDGHDP
FT                   EAIKAAINEARAEQAKPTLICCKTIIGCCSPNKQGKEICHGAPLGEEEIALTRAEMDWP
FT                   HGPFEIPAEIYAGWNARERGGQAEAAWQEKLAAYQQAHPEAAAELKRRLAGELPADWAA
FT                   KSQAFIAESEAKAAKVASRKASQLALEGYGPLLPELIGGSADLAGSNLTIWSGSKDIKQ
FT                   DQAGNYIYFGVREFAMVAIGNGLALHGGFIPYTATFLIFSDYARNAIRMAALMKQRALF
FT                   VLTHDSIGLGEDGPTHQPIEQTSSLRLIPNLNVWRPCDAVETAVAWQQAVERKEGPSAL
FT                   LLSRQGLPHQERSAEQSAAIARGGYVLRDCDTTPELIIMATGSEVELAVAAAEQLNQQG
FT                   RPTRVVSLPCVEVFEAQDEAYQQQVLPDAVSKRIAIEAGCTTGWYKYVGRKGQVIGLDR
FT                   FGESAPAGELFKLFGFTVEKVAEAAARL"
FT   gene            complement(552978..553520)
FT                   /locus_tag="DaAHT2_0471"
FT   CDS             complement(552978..553520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0471"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP2601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85177"
FT                   /db_xref="GOA:D6Z020"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z020"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85177.1"
FT                   /translation="MHILKISTLTACLALLLGLTACGYHNPNVLPEVRDLPPVPIYAPM
FT                   WRNATSELALEVQAHNAINDWLAQSARIILVADEDAADYVLEGRINSVRYPGFSYDTTS
FT                   AARSLTAIMDAGATLTERASGRIVWQNPSIKLEETYNLSDSISQNDANKRQALHNLVDN
FT                   LAEQVYLRVLRSLTRNQ"
FT   sig_peptide     complement(553449..553520)
FT                   /locus_tag="DaAHT2_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.775 at
FT                   residue 24"
FT   gene            complement(553521..556010)
FT                   /locus_tag="DaAHT2_0472"
FT   CDS             complement(553521..556010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0472"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="KEGG: dps:DP2600 leucyl-tRNA synthetase; TIGRFAM:
FT                   leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85178"
FT                   /db_xref="GOA:D6Z021"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z021"
FT                   /inference="protein motif:TFAM:TIGR00396"
FT                   /protein_id="ADH85178.1"
FT                   /translation="MSTPQNRYDFAVIEEKWRDRWLAGKTWQVEADGSRKKYYVLEMFP
FT                   YPSGRIHMGHVRNYTIGDVVARYRRMCGDNVIHPMGWDAFGMPAENAAIKHGTHPAKWT
FT                   FENIDYMRGQLQRLGLSYDWDRELATCDPKYYRWEQLFFLKMLNKGLAYRKLTTVNWCE
FT                   TCQTVLANEQVINGACWRCDQAVTPRQMQGWFLKITAYAEELLAGCDRLPGWPEKVLTM
FT                   QRNWIGKSTGAELEFSIEGSDDKLTIFTTRPDTVFGATFMSVAPEHPLVAELSRGSERE
FT                   TEINDFVQRTQAARRRLAAGEEPPKEGIFTGGYCLNPFTGARLPIYAANFVLMEYGTGA
FT                   VMAVPAHDQRDFEFARQYDLPVVPVVHPDGEKLDGATMTAAHEGPGVLADSGDFSGLDH
FT                   EAAKAAITARAEELGVGRSRITYRLRDWGISRQRYWGAPIPIIHCEKCGVQPVPEEQLP
FT                   VVLPTDVNFDQAGKSPLHILESFINTACPACGGAARRETDTMDTFMESSWYFARYTCPD
FT                   SHDAPLHKPAADYWLPVDQYIGGVEHAILHLLYSRFFTKVLRDLGYLSIDEPFTNLLTQ
FT                   GMVIKDGAKMSKSKGNVVDPNELIEQYGADTVRLFSLFAAPPERDLEWNHQGVEGAFRF
FT                   LSRIHRFVLDNREMLRAAGEELPADLGEADRTLHRKTHQTIRKVSQDIDNSFQFNTAIS
FT                   AVMELSNTLFSLNAAQADKQPQPAVNRQAVQTMLTLLFPMVPHLCAELWEELGQAEALD
FT                   RQGWPQFDPEAAKEEEITVVVQVRGKVRGRLQVTPGTPEEQLKEMALADDKVQSFVGDT
FT                   PVRKIIVVPDKLVNIVI"
FT   gene            556246..556953
FT                   /locus_tag="DaAHT2_0473"
FT   CDS             556246..556953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afr:AFE_2084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85179"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z022"
FT                   /inference="similar to AA sequence:KEGG:AFE_2084"
FT                   /protein_id="ADH85179.1"
FT                   /translation="MVASVTPQVSASRQPFALKDCSLIAIATGRKAFTLAELRDHLKDV
FT                   TLDSVYHHFWGGLLGARFEEREFNNDFAAWCRHHLYELELAEQLAVVDPGEHRELEGLR
FT                   REVLDIIDERLDSSELAHWRRAPRPFEFIRSQLVIFATGKTLQQPTDLAAVLPEISTGS
FT                   VFYHFIDSRRRLEDGGDDFSFWLAGFGDEYQELRNSLDNIDPFFASLSQVRDDLARLCR
FT                   EHCGINAHDRSKG"
FT   gene            556953..558191
FT                   /locus_tag="DaAHT2_0474"
FT   CDS             556953..558191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0474"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   sfu:Sfum_2348 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85180"
FT                   /db_xref="GOA:D6Z0F1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0F1"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADH85180.1"
FT                   /translation="MKEMLAAYAEVVGQDVIAHLQQLSRPLQGMKVVHVNSTRVGGGVA
FT                   EILEKLVPLSNELGIDTSWEVISGNEEFYRCTKAMHNGLQGHRAPIADSLLQAYEEANR
FT                   ENADQLREQLEAADFVFIHDPQPAPLLGLCPNRRGRWIWRCHIDASRPYRPLWRYLRNH
FT                   IAPYDASVFSLPDFTQALPHPEYIIPPSIDPLSDKNIELPEAEIDRVRREFALDPDRPM
FT                   VLQVSRFDRFKDPVGVIEAHRLARKFVPDLQLVLAGGTATDDPEGEAVLQEVRQAAGDD
FT                   PDVKVLLLAPDAHRTINALQRAADIVIQKSTKEGFGLTVTEGLWKGKPVIGGDTGGIRL
FT                   QVVNYHTGFLVGTPQGAALRIRYLLYRRDRMAEMGEKARQFVRENFLLTRHLREYLALI
FT                   VGLLHQAEYRIEL"
FT   gene            558233..560494
FT                   /locus_tag="DaAHT2_0475"
FT   CDS             558233..560494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0475"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="TIGRFAM: glycogen debranching enzyme GlgX; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; KEGG: rxy:Rxyl_0317 glycogen debranching
FT                   protein GlgX; SMART: alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85181"
FT                   /db_xref="GOA:D6Z0F2"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0F2"
FT                   /inference="protein motif:TFAM:TIGR02100"
FT                   /protein_id="ADH85181.1"
FT                   /translation="MNNQQVAVWPGQPYPLGATWDGLGVNFALFSENATKVELCLFDQR
FT                   GRQTACLELKEQTDQIWHCYLPQARPGWLYAYRAHGPYAPEEGHRFNPAKLLLDPYAKD
FT                   LAGDLRWHDALFGYRIGGRKEDLAPDRRDSARYLPKCRVIDPAFTWGDDRPPATPWHDT
FT                   VIYELHVKGFTKLLPQIPEQLRGTYAGLASEPAIDYLRRLGVTAVELMPVHALVDERHL
FT                   VDRGLRNYWGYNTIGFFAPDKRYSAAAGVNEFKSMVKALHAAGIEVILDVVYNHTAEGN
FT                   QLGPTLAFRGIDNRAYYRLEPDNLRYYRDYTGCGNTLNMQHPRVLQLIMDSLRYWVLEM
FT                   HVDGFRFDLASALARELHEVDRLGAFFDIIHQDPVLSQVKLIAEPWDLGEGGYQVGNFP
FT                   VGWTEWNGRYRDEVRSFWKGEGGAIGDLAYRLTGSSDLYERGGRRPYASINFITCHDGF
FT                   TLRDLVSYNDKHNEANGEDNRDGESHNRSWNCGAEGPTDDAEINALRVRQQRNMLATLL
FT                   LSQGVPMLCAGDEFGRSQQGNNNAYCQDNEISWLNWELDEEQQGLLAFTRRLLQLHRRH
FT                   RVFRRQHFFQGRSLKGSEVKDIVWLTPGGSEMSDEEWSQDFARCLGLFLAGQVMVEEDE
FT                   RGRPMYDDSFLLLINAHHEEIPFTIPDLPPAKLWQVELDTFWPGGEEPASGRFLRPGEQ
FT                   FPLAARSLALLVAQPRYVNVQQHHIFGRSAKLAYPGYAAPGRLPESAALLNVHGDLRKK
FT                   "
FT   gene            560491..562449
FT                   /locus_tag="DaAHT2_0476"
FT   CDS             560491..562449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0476"
FT                   /product="malto-oligosyltrehalose trehalohydrolase"
FT                   /note="TIGRFAM: malto-oligosyltrehalose trehalohydrolase;
FT                   PFAM: alpha amylase catalytic region; glycoside hydrolase
FT                   family 13 domain protein; KEGG: noc:Noc_1681 alpha amylase;
FT                   SMART: alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85182"
FT                   /db_xref="GOA:D6Z0F3"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0F3"
FT                   /inference="protein motif:TFAM:TIGR02402"
FT                   /protein_id="ADH85182.1"
FT                   /translation="MMQRCYDTPFGAACLPGGGVRFRLWAPAAKKVELCRLAGPTTAAA
FT                   HSEEMFNLHSAWWRESIAGGDLVEVAVMQTVGEGWFELVAPRAAAGDFYCYQIDGDLLV
FT                   PDPASRCQPGGVHGPSLVIDPAAWPWQDRQWPGRPWEEAVLYELHVGCFTPEGTWAAVE
FT                   PRLDYLAELGVTALSLMPLATFPGQRNWGYDGVLPFAPASPYGEPAALKSLVQSAHARG
FT                   LMVLLDVVYNHFGPEGNYLHAYAPQFFTRRHRTPWGEAINFDGRESHWVRRFFIDNALY
FT                   WLLEYNFDGLRLDAVHAIYDDSQPHFLQELAAEVARCCEPPAVDDKSASYRPRHLILEN
FT                   DANQARFLAPAAARSPLAAPPGERSPCHYTAQWNDDWHHAAHVLLTGEKEGYYVDYADQ
FT                   PLAHLGRCLSEGFAYQGEPSPFRVGLRRGEPSRALPATALVNFLQNHDQIGNRALGERL
FT                   TALAPPAPLRALTAILLLAPSPPLLFMGQEWGAATPFLFFADFGPELAQQVTEGRRHEF
FT                   AAFPAFATPEQQHLIPDPADPATFTASKLAWEEQQNPDHQAWLTLHRNLLALRHREIIP
FT                   LLPHLAPGAAEYKIFGASALQVSWPLVGKQNLLVLQANLGDVTAGVPEMAGRQLFNLAD
FT                   CGEPGRLPTWSVCWLVV"
FT   gene            562698..564122
FT                   /locus_tag="DaAHT2_0477"
FT   CDS             562698..564122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0477"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="KEGG: shw:Sputw3181_0674 hypothetical protein; PFAM:
FT                   Fibronectin type III domain protein; protein of unknown
FT                   function DUF1566; SMART: Fibronectin type III domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85183"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR011460"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0F4"
FT                   /inference="protein motif:PFAM:PF00041"
FT                   /protein_id="ADH85183.1"
FT                   /translation="MACLLRPINQSASSYADHLKSALLLLLLILSLAGCSGGGGGGSTK
FT                   KYTVSATAGDGGSISPGSQSVARGTTASFTVTHESGYSIDSVSGCGGSLSGNIYTTGAI
FT                   SAACTVTATFAPGGPAPAPAPAPAPDPAPAPAPALAAPEDVVATAGYRLGLGTIEISWS
FT                   AVTNATGYRVYWGEESGVHPETATVTETSHQLTNLTPDQTYYLVVAATAPGGTGPASVE
FT                   VSATPETPVVTQNILNDTGIYWWADGSTNFLEEPQADYPGQDADFGRDAEAREGALAKV
FT                   GGGAAGFDFTRLGANGEPLAIQDATWSDAGDEASGTRWSCVRDNRTGLIWEIKVNDASH
FT                   LRHKGHTYTWYNSDGTVNGGSTGTANGGSCIDEANCDTEKFIAAVNSTGLCGADDWRLP
FT                   NRQELMSIVHNGRYSPAIDPDYFPNTPLIWLWSSSTRAKAAGDHDNAWKVEFKNGDVYW
FT                   DNKGSDLGVRLVRAGQ"
FT   gene            564232..564789
FT                   /locus_tag="DaAHT2_0478"
FT   CDS             564232..564789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0478"
FT                   /product="protein of unknown function DUF1566"
FT                   /note="PFAM: protein of unknown function DUF1566; KEGG:
FT                   shw:Sputw3181_0675 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85184"
FT                   /db_xref="InterPro:IPR011460"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0F5"
FT                   /inference="protein motif:PFAM:PF07603"
FT                   /protein_id="ADH85184.1"
FT                   /translation="MKRKMVLLFALILIAPPATWAGAVANCTDENSAVTTTPTADFHDN
FT                   EDGTVTHKPTGLVWMRCSLGQSWDSNAGICADTANSYNWQQALAAAQSLNSEGYAGQSD
FT                   WRLPNKNELASIVEERCWSPAINFVIFPNTPAAGFWSSSPDAEPSSDGWYRSGWGVNFD
FT                   DGSVIWNFKAASGKVRLVRSEP"
FT   sig_peptide     564232..564297
FT                   /locus_tag="DaAHT2_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 22"
FT   gene            complement(564816..565397)
FT                   /locus_tag="DaAHT2_0479"
FT   CDS             complement(564816..565397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0479"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: sfu:Sfum_2860
FT                   heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85185"
FT                   /db_xref="GOA:D6Z0F6"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0F6"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADH85185.1"
FT                   /translation="MDIKKFSPWNWFKKENEESGSVVPVRRRGGEQQPTRLPAGRLQDP
FT                   ITQLHREMDRLFENAFRGFGLSPLMREGLTTPVAAGGLLRPSVDITAGDQEYTITVEVP
FT                   GVVDEDVKVEISGDTMTISGEKKQEKEEKEKDYYRMERSYGSFQRVLSLPDDADADGVA
FT                   ANFKNGVLTITVPRRPTSDKDVKQIEIKSS"
FT   gene            565603..568707
FT                   /locus_tag="DaAHT2_0480"
FT   CDS             565603..568707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0480"
FT                   /product="malto-oligosyltrehalose synthase"
FT                   /EC_number="5.4.99.15"
FT                   /note="SMART: alpha amylase catalytic sub domain; TIGRFAM:
FT                   malto-oligosyltrehalose synthase; KEGG: afr:AFE_2081
FT                   alpha-amylase family protein; PFAM: alpha amylase catalytic
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85186"
FT                   /db_xref="GOA:D6Z0F7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013797"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0F7"
FT                   /inference="protein motif:TFAM:TIGR02401"
FT                   /protein_id="ADH85186.1"
FT                   /translation="MSSRSRRFPLSTYRLQFHRDFTFADAAALVPYLHRLGVSHCYASP
FT                   LLKARPGSSHGYDIVDHGQLNPDLGERADFEHLVECLHRHGMGLIVDIVPNHMGVGGAD
FT                   NAWWRDVLENGPAAEYAEFFDIDWRPAHETLRGKILLPLLGEPYGEVLDKGEIKLVFEP
FT                   TAGAFHFAYYEHHLPLDPVTYPEVAAPKLADLHRQLPPDDPGLAELENLLAALTHLPGR
FT                   ESREAEQCQERRRDKEITKQRLSDLCRRDARIATFWRQCLDFFNLPGDQGPEAAARRGE
FT                   RLHQLLELQAYRLAHWVVAGDEINYRRFFDINSLAGLQAEREEVFAATHGLLLQLVAAG
FT                   QIDGLRVDHPDGLSDPAGYFSRLQAAVAAGRGGASDDDDSRDTGDRAESIYLVVEKILA
FT                   AHEYLPEEWQVHGTTGYDFANQVNGLLVKPDHEAALTGIYHRFIGRRQDFDDLLYRCKK
FT                   KIITGQLASELTVLARLLKDIAESDRHTRDYTLNGLREALIEVVAAFPVYRTYIVPTAP
FT                   VASIGAARHSYKVSPEDRRQVEWALAQAGKRSGTRDGGLYDFIRALLLDSEPPPPGWQP
FT                   DQPADRLRARFIRKFQQYTAPVMAKALEDTAFYVANRLVSLNEVGGDPRRFYLTPAAFH
FT                   HAAQERLRRWPLAMLATSTHDSKRSEDVRARINVLSEVPALWRRHLKRWRRLNRSRKSR
FT                   VNSLLAPTPNDEYLLYQTLLGSWPLHGAEPNGPNTDFWAAYRRRIQQYMGKAIREAKER
FT                   TSWLHPDQEYEAAVDRFVEAILSPAGTASPGEAAAGGDLAGANPFLADFIPLANKLAPY
FT                   GLLNALAQLLLKLTSPGVPDIYQGTETWDFSLVDPDNRRPVDYHHRRRLLAALPPPDQP
FT                   LPPALLRELADSIEDGRLKLLLTSRLLHFRRQNQELLRRGSYLPLTASGERGEYLCAFV
FT                   RQWQGQGMLVATGRWFATLATTDTTPAMPDSDPGPLWSQLNPQLWRNTRLLLPANTTAD
FT                   WQDLLTGTRLPIMQEPDGNYLTCSDLFANLPMAVLHYRAADHSKQ"
FT   gene            568726..569547
FT                   /locus_tag="DaAHT2_0481"
FT   CDS             568726..569547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0481"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: drt:Dret_0061 rhodanese domain protein; PFAM:
FT                   Rhodanese domain protein; Rubrerythrin; SMART: Rhodanese
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85187"
FT                   /db_xref="GOA:D6Z0F8"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0F8"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADH85187.1"
FT                   /translation="MNWKRLFSRTPSLSPAEARQYIEKHPAADFQLLDVRQPKEYEAEH
FT                   LPGAKLIPIKELPDRQAELDPDRPVLVYCAVGGRSRAAAQYLNGQGFKEVYNMAGGIKA
FT                   WQGGKAAGPLDAGLELLPATAEYDEAAALAYAMEDGLQRFYLKLAAGSEEAELATTYRH
FT                   LAGLEDFHKKRLAREYREQTGQTLAPAEADEQGEQGELMESGQAPSVFEAATPAEIMEQ
FT                   AMGLEFQAQDLYLRLAEQSRVAASREFFLAMAAEEKEHLAFLAKELEGLKE"
FT   gene            569552..570691
FT                   /locus_tag="DaAHT2_0482"
FT   CDS             569552..570691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0482"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   family protein"
FT                   /note="KEGG: dol:Dole_2262 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; TIGRFAM: pyridine
FT                   nucleotide-disulfide oxidoreductase family protein; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85188"
FT                   /db_xref="GOA:D6Z0F9"
FT                   /db_xref="InterPro:IPR017584"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0F9"
FT                   /inference="protein motif:TFAM:TIGR03169"
FT                   /protein_id="ADH85188.1"
FT                   /translation="MSLNRGKKLVLVGGGHAHMQTLAAIGNFVRRGHSVTVVAPSPYHY
FT                   YSGMGPGMLGGSYQPEEIRFATRQQVERLGGTFVLNRVTRIDAAAGEVELADGQRIAYD
FT                   VLSCNAGSQVPTSLPVSFTEGAAVPVFTVKPIEKLWEARRQLQALAAAGSPKVAVIGGG
FT                   PSAVEIAGNTWRLLREAGHQRPCIRIFAGRKLMGKASEEVRRRVNASLARRHIEVVEPG
FT                   RVQEIRDGRVVLEGRNNNCKADFIFLAQGIRTATIFADSGLPVGPDGGLLVNEYLQCPG
FT                   QPQIFGGGDCIHFEPQPLDKVGVYAVRQNPVLRHNLLAALEGDELRTFAPGGDYLLIYN
FT                   LGDGTGVLQKRWLIFGGRLAFRLKDYIDRRFMRRFQQTA"
FT   gene            571388..572749
FT                   /locus_tag="DaAHT2_0483"
FT   CDS             571388..572749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_1234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85189"
FT                   /db_xref="GOA:D6Z0G0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0G0"
FT                   /inference="similar to AA sequence:KEGG:Gura_1234"
FT                   /protein_id="ADH85189.1"
FT                   /translation="MNVHQLIRQKQLASRRQDKISQRKHLNFDALITTIREDFGKIADH
FT                   RAANASISLVDALTSGFAMFSLKHPSLLAFEDEWREDPTCLHGVYKVNDIPSDSQMRTI
FT                   CDEVDPRHLRRPFRSIFRQLQRGKVLEKMTWLDGHYLLALDGTGIYSSEKVSSPYCLKK
FT                   RKRNGQVEYYQQMLGAAIVHPEQREVIPLCPEMIVQQDGSKKQDCERKAARRFLTEFRR
FT                   EHPHLKCVVIEDGLSSNAPHIQDLHRDGHHFILGAKPGDHGHLFDQMDEALKAGRAVEL
FT                   SRADEQQPDILHTYRFVNDLALNKSNPEVRVNLLEYWQLDGKGKVIRFSWVTDLEITTA
FT                   NVYQIMRAGRARWRIENETFNTLKNQGYNLEHNYGLGQKHLSAVFVHLTVLAFLVDQVQ
FT                   QLCCPLFREALVFRKRKRRLWSGIRNRFELLDCPSMEAILLHIVGRGKPLPQLE"
FT   gene            573000..574274
FT                   /locus_tag="DaAHT2_0484"
FT   CDS             573000..574274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0484"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   neu:NE1093 IS4 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85190"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0G1"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADH85190.1"
FT                   /translation="MALSADTRPHFTTIAAFVSSLDREIVHLFRDVLLVCDEMGLIGKE
FT                   MFAIDGCKLPSNASKEWSGTRADFEKKAAKLEQVIGQMLSRHREQDQAQGDQNLATREE
FT                   QYVATLQKRARKIREWLKDHDDKPGKTGKPKKSNITDNESAKMKTSHGVIQGYDGVTTV
FT                   DGKHQVIVHAEAFGEAQEHDLLQPMVDATREHFRAIGKDEDVFRSAKLTADSGFHTEAN
FT                   MKMLASAEIDAYVADNRFRKRDPRFVDADRYKERHRQERAKLKGRSGLFSTADFVFPED
FT                   LSHCLCPAGKRLYRSGHNVEVRGFVATKFKGSKTNCLPCQLRRKCLRHPERTEIRQVAY
FT                   FHGRSAQGRDTFTERMKRKIDSKVGRALYSLRVAIAEPPFAHICRVMGRDRFTLRGRRK
FT                   VNAQWNLFCIVHNLQKVARYGPGFA"
FT   gene            574255..574392
FT                   /locus_tag="DaAHT2_0485"
FT   CDS             574255..574392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85191"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0G2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85191.1"
FT                   /translation="MGRDLPDVREGKAPVFPLAALCGKRKRIGTISRWLIHEKIRNIKP
FT                   "
FT   gene            574537..575262
FT                   /locus_tag="DaAHT2_0486"
FT   CDS             574537..575262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0486"
FT                   /product="Restriction endonuclease BglII"
FT                   /note="PFAM: Restriction endonuclease BglII; KEGG:
FT                   ajs:Ajs_0427 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85192"
FT                   /db_xref="GOA:D6Z0G3"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011338"
FT                   /db_xref="InterPro:IPR015278"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0G3"
FT                   /inference="protein motif:PFAM:PF09195"
FT                   /protein_id="ADH85192.1"
FT                   /translation="MLNSLVDRGFEVLALHHAEAILTHDMPEAVAEIEMVLGQIELPVE
FT                   ELVRGGGGEGQLTQRMRRALAECGWNKHNFEIKKIVDGEEKESISHEIDHIKRFSSGIF
FT                   ALEIEWNNKDPFFDRDLENFKRLHADGVISIGGIITRGASLQNSLRERIARFARDHGIS
FT                   STDSLSEYYSPTGRQLTNIERAVRTAGSFEEGWARAFVSDKFGKATTHWRKLEDRVRRG
FT                   VGNPCPLLLIGIPDSILVG"
FT   gene            575279..575968
FT                   /locus_tag="DaAHT2_0487"
FT   CDS             575279..575968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0487"
FT                   /product="MT-A70 family protein"
FT                   /note="PFAM: MT-A70 family protein; KEGG: cph:Cpha266_2137
FT                   MT-A70 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85193"
FT                   /db_xref="GOA:D6Z0G4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007757"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0G4"
FT                   /inference="protein motif:PFAM:PF05063"
FT                   /protein_id="ADH85193.1"
FT                   /translation="MVGKVYNIAEPSPSKDLIEKVSGQYSTILADPPWQFQNRTGKVAP
FT                   EHRRLLRYPTMELKEIMDLPVSRLAAAKSHLYLWVPNALLMEGLKVMEAWGFTYKTNLV
FT                   WYKIRKDGGPDGRGVGFYFRNVTELILFGVRGSMRTLPAGRTQVNLFATRKREHSRKPD
FT                   EIYQLIEACSPGPYLELFARFNQPGWHQWGNEDVEENSLYGVAKRNGHTGRQQLRLMES
FT                   PKGYKAE"
FT   gene            576068..576415
FT                   /locus_tag="DaAHT2_0488"
FT   CDS             576068..576415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mar:MAE_16400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85194"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0G5"
FT                   /inference="similar to AA sequence:KEGG:MAE_16400"
FT                   /protein_id="ADH85194.1"
FT                   /translation="MKTVTLDVRSPSDAMADFTQARKTGKPQSSARISFATPELLWKVL
FT                   TEKRWEILKALCGAGPVSIRETARRVGRDVKDVHGDVTALLNAGVLDRIEDGRIVFPFE
FT                   AVKVEFFLRAA"
FT   gene            complement(576467..577201)
FT                   /locus_tag="DaAHT2_0489"
FT   CDS             complement(576467..577201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0489"
FT                   /product="protein of unknown function DUF198"
FT                   /note="PFAM: protein of unknown function DUF198; KEGG:
FT                   gsu:GSU0484 putative GTP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85195"
FT                   /db_xref="GOA:D6Z0G6"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0G6"
FT                   /inference="protein motif:PFAM:PF02649"
FT                   /protein_id="ADH85195.1"
FT                   /translation="MELQSVGIKDISYPITVREKSGGLQPTVATIDLRANLPRQYRDTC
FT                   VTTFIEVLNRYQEEMSNRIFRKLLAEVKDKLRADSAHVEMTFPYFLEKKAPVSGTTSLM
FT                   EYTCRFTGGVGPDEDFLLTVQVPATTLCPCSREISACGAHNQRAEITLSVKYREFIWLE
FT                   ELIEMAEAGSSCEVFALLKRPDEKYVTEAAYQNPMFVEDVVRKVAELAAGHPAISWFGV
FT                   GAESFESIHKHSAYAYVDSNDL"
FT   gene            577314..579146
FT                   /locus_tag="DaAHT2_0490"
FT   CDS             577314..579146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0490"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: dba:Dbac_1550 ABC transporter related; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85196"
FT                   /db_xref="GOA:D6Z0G7"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0G7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH85196.1"
FT                   /translation="MSPATPPSSTPETEAAADQSSSLGTYLWRIFPFVAPYKKRVGVGL
FT                   VLNALARLFDLLPLVLIGWVVDLISTQGAAAAEPGLFAWFGLAVLGTFLALAVFQSISD
FT                   YCLDSMAQKVRHDLRLAVYQRMQGLDASFFEDRQTGDLLAVASNDVDNLEHFFSDVTTN
FT                   VVRLVITFVGVYGFLFWLDWRLALLLIAPLPFAIIAVRFFAVRVQPQYRKARRAVGEIN
FT                   SILENNIRGIGVIQAFTAEAEQLRLVAGRSSSYVEAAIAAARERARFIPLIYLVTGLAF
FT                   ALLITGGAWLTATEHGPTIGSFTTFVLFAVRLVFPLFIFGMLINQIQRAEASARRIANL
FT                   LATEPRVKDHHQAVALAEPPAKIVLREVGFAYRATRPVLRQIGFELRRGRVLGIVGPTG
FT                   AGKSTLVKLLLRYYDPHEGEILVNDQPLPRLKLADYRRHVGYVSQDAFLFYGTVAENIR
FT                   LGSPEADPAAVRQAAEIAGAAEFIEQLPEQYDTMIGERGLKLSGGQQQRISLARAVLRD
FT                   PALLVLDEATSAVDTRTEELIQQNLQRMKDGRMTVAVAHRLSTIRQCDEILVLVEGTIA
FT                   ERGTHEQLLAQGGVYAGLWRVQSGALGQTEPGQP"
FT   gene            579240..580136
FT                   /locus_tag="DaAHT2_0491"
FT   CDS             579240..580136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0491"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cja:CJA_1812 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85197"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0G8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85197.1"
FT                   /translation="MNCCLPAGKALSASAAPLATNHQQQVAYREFAAFSRQASISLTTA
FT                   EGDVVTIRSSQQQAHALAYGQQVSAGGHVQSLTMSGLEKQAFSISVQGDLNEEELRDIE
FT                   RLLGELSTIAADFFNGDYEQAMVGALSLGDMGSIAELQATFIQTSMISQQAAYSERGPA
FT                   LPAHAGWSREPEQLPAADQFNYGNVLQARWQQLQEWLDERTAEAAEARQQAEKTGNNGR
FT                   KLGHLPPSQRMLEQIQATMTKHPRLSPLSGSLANLAIDRAAAEHLEKHPALVERTNQAA
FT                   EDLKGRFAQRLNDWLLA"
FT   gene            580336..582090
FT                   /locus_tag="DaAHT2_0492"
FT   CDS             580336..582090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0492"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))"
FT                   /EC_number="1.1.1.40"
FT                   /note="KEGG: dat:HRM2_13730 Mae; PFAM: malic protein
FT                   NAD-binding; malic protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85198"
FT                   /db_xref="GOA:D6Z0G9"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0G9"
FT                   /inference="protein motif:PRIAM:1.1.1.40"
FT                   /protein_id="ADH85198.1"
FT                   /translation="MPFHSSYRLHYNEFGNTREIEILARGIDVYDNSFINKGTAFTQEE
FT                   RELFALHGTLPPSIRSLANQMANSRQTCAQKSSDLEKFIYLRSLFDRNVALAHALIASD
FT                   LERYLPIIYTPTVGEACRHYSSMFRKANGLFFYPGNIDRAEEILRRFVPRQIRVAVVTD
FT                   NQGILGIGDQGVGGIAICLGKLMLYTQGAGIAPWHCLPISLDVGTDNPELLNDDNYLGW
FT                   RHPRLRDDDYVAFVQRFALAFKAVFPHALCQWEDFSKQNAFAIRDAYLHRLISFNDDIQ
FT                   GTGAVALAAILAALRSKGEKLGDQVFLVHGAGAGGIGIAEQLAVALQEEGLDETAARAR
FT                   IFTVDRRGLVTTDRSLEPYKKKFAHDPATLPWLRETGAGSLAELVRKAGVTVLIGTSGQ
FT                   ADAFGRELVQAMLANTARPVILPLSNPTGQSEARPAELAQWSQGRALVATGSPFPPLLS
FT                   QGRMVRVGQCNNVFIFPGVGLGVLASGAAEVRPEFFTAAARAVADRVAPADLAAGVLLP
FT                   EVGELREVSRAVAVAVGESAIKAGVAGPCAVSTYQHHNDPTRLARLIDGMRWRPGYLPL
FT                   VNGYAEQL"
FT   gene            complement(582103..583131)
FT                   /locus_tag="DaAHT2_0493"
FT   CDS             complement(582103..583131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ttj:TTHA1709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85199"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0H0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85199.1"
FT                   /translation="MVALAVGGVFAVLMLAGCGAKGIETGLGLEDGEYRDYHGVQEAGF
FT                   WKQQHYAFEGNLTYQGVVGDCEGNKLPEETMEATIATKLFLSDDGRIEGSRMLVRANGM
FT                   IWAIDTEFGDGEIVVTQDWTSGGEHVHDIHNFEIAFNPKKLSVEAALNEKYDDQEDEIQ
FT                   RCYFRHYQILATGQGESVESFGRYRFENMDLIFNYRTELADIQRRWPSMAKHIHDRIGR
FT                   IGRATDRQEKISAIEDTLALVRLHLGPESATYLSLLFALHDTLSEEPIAYEDLPRTMEL
FT                   ARLLVLEAQKRYGEESVRAKLVKGWYDQYRLKMGLLGEISNTMPGSAADRREDTDRAKK
FT                   QR"
FT   gene            583643..584269
FT                   /locus_tag="DaAHT2_0494"
FT   CDS             583643..584269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ftn:FTN_0067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85200"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0H1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85200.1"
FT                   /translation="MAAFFVLMLILFLAACAPRYPLGIPEAEWLEMSPEQRLQAREKQV
FT                   ALDRAAAERRAAAERARAEEAARFQAELLEKRRQAAYGERVQCVLDPVEARIFGNWRQV
FT                   EPVAMDLVVGMELEVPLRERSGSTVRRRTTSYASFDGQTVAVCREPLAPAAASGRDNCL
FT                   RLLGTFEDYRRGMVQQLEAPDFLRGRLRCNLVPAVGMPPRLIIER"
FT   gene            584316..584825
FT                   /locus_tag="DaAHT2_0495"
FT   CDS             584316..584825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dma:DMR_08180 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85201"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0H2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85201.1"
FT                   /translation="MPKHDGQERPPARHSGAAQGVVAGQWQWWRWFVVAAVSHPLQTFV
FT                   AWYLLLGLGMSWEVSTNTYQVWPVPFGGLLALITAARLGLFLALARYAFQIFDRGGLSG
FT                   AFLRNHRWSLPCLPITFLLGWPMELNVFGFVYFPVLLVAILIFGGLVLALNLRTLIQAR
FT                   RSVAAR"
FT   gene            584902..585492
FT                   /locus_tag="DaAHT2_0496"
FT   CDS             584902..585492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0496"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tmz:Tmz1t_0166 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85202"
FT                   /db_xref="GOA:D6Z0H3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0H3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH85202.1"
FT                   /translation="MLTIEGLRVREVTLDLVVAPGEIVCLGGPSGSGKSLLLRAAADLI
FT                   PHRGRVSFNGEECVTMPAHLWRRRVGLLPAESQWWATTVGEHFPRPEQADLSALGFGPE
FT                   VMGWQVSRCSTGERQRLAILRLLALAPAALLLDEPTASLDQESIGRVEGLIDRYRKQHR
FT                   APVLWVSHDPAQVARVADRRLQIKGERVIEVPA"
FT   gene            585489..586286
FT                   /locus_tag="DaAHT2_0497"
FT   CDS             585489..586286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   azo:azo1315 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85203"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0H4"
FT                   /inference="protein motif:PFAM:PF03649"
FT                   /protein_id="ADH85203.1"
FT                   /translation="MSLIELSYLDLLLASGLIVVLAALSLLLRLRVERQLLVAALRTTV
FT                   QLLLVGLVLKALFAHATLFLVGLMSLVMLLVAGYEVMARQKRPFGGAWGYVLGTGAMFV
FT                   SSFATTFFALLLIIGNDPWYYPQYAIPLLGMMLGNTMTGVSLALDRLTGFAWQQQAIIE
FT                   TRLALGQEWREAMRDNIRESVRIGLIPIINAMAAAGVVSLPGMMTGQILSGTPPMEAVK
FT                   YQILIMFMITAGTGFAILLATWIGGRRLFDERQRLRLDRLKPS"
FT   gene            586372..587340
FT                   /locus_tag="DaAHT2_0498"
FT   CDS             586372..587340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0498"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: nth:Nther_1748 nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85204"
FT                   /db_xref="GOA:D6Z0H5"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0H5"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ADH85204.1"
FT                   /translation="MLRLIERVFSDCEDCPSVLLANMHITSDVELNLKRMEEVVQQAHT
FT                   HGANILIFPELCVTGYVWEDQGRGEVEELLAAGENSRIAPTLKRIRDGLRDDGKGLEYV
FT                   FFNNVRRKDDGLYNSTFILHHSLDYNREEFIYDKIFLPPLEQLYFKQGTDRRLTIETKW
FT                   GSLGFLTCYDLCFVEMARKYALKDKVDAIVTMAHWRSEAVREYDRMNIMTDHYYGYLWN
FT                   LMNSSKAAYNQVWSLAANAVGPHQVTGDYFWGGSGVWAPSGMKLIQASNITAELILVRN
FT                   LDLRGQRRKEQDDFDYQIDFARFFKPIEEEGSCPQQLPLKS"
FT   gene            587361..587750
FT                   /locus_tag="DaAHT2_0499"
FT   CDS             587361..587750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0499"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="KEGG: noc:Noc_0870 RNA-binding S4; PFAM: RNA-binding
FT                   S4 domain protein; SMART: RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85205"
FT                   /db_xref="GOA:D6Z0H6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0H6"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ADH85205.1"
FT                   /translation="MEKVRIDKWLWAARFFKTRSMAAQAVNGGKVHLNGQRAKAARLLG
FT                   PGDRLEIHKGEYEFVLTVRQVASRRLSAPLAAELYEEDPASQAKRQELIEQRRLARKTA
FT                   PQPPAGRPGKRDRRLIKRFIRKSDE"
FT   gene            587912..588529
FT                   /locus_tag="DaAHT2_0500"
FT   CDS             587912..588529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0500"
FT                   /product="IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /note="KEGG: dps:DP1614 bifunctional purine biosynthesis
FT                   protein (PurH); PFAM: MGS domain protein; AICARFT/IMPCHase
FT                   bienzyme formylation region"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85206"
FT                   /db_xref="GOA:D6Z0H7"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0H7"
FT                   /inference="protein motif:PRIAM:3.5.4.10"
FT                   /protein_id="ADH85206.1"
FT                   /translation="MGKAQRALISLTDKSGIEEFAGELAKLGIEILSTGGTAKKMREHG
FT                   IAVKDVAEFTGFPEMLDGRVKTLHPKVHGGLLARRDNPEHVRQMQEHGLEPIDIVAVNL
FT                   YAFEKTVADPACTLDKAIENIDIGGPTMLRSSAKNFRDVTVIVDPADYPQVLAELKEHG
FT                   NTTLKTRFRLAVKVFELTGCYDTAITTWLKQVDADNEPSLQE"
FT   gene            588537..589103
FT                   /locus_tag="DaAHT2_0501"
FT   CDS             588537..589103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0501"
FT                   /product="formyl transferase domain protein"
FT                   /note="PFAM: formyl transferase domain protein; KEGG:
FT                   dps:DP1615 phosphoribosylglycinamide formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85207"
FT                   /db_xref="GOA:D6Z0H8"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0H8"
FT                   /inference="protein motif:PFAM:PF00551"
FT                   /protein_id="ADH85207.1"
FT                   /translation="MNLAVLLSGSGRTLDNFQQQISEGRMAGKIQVVVANTADALGLEK
FT                   ARNYGIPAFHGENNEAINRILADYPVDLVLLAGFLKLYTPPEHLRRSVLNIHPSLIPSF
FT                   CGDGMYGMRVHRAVKARGVKVSGCTVHFANEVYDEGPIVVQRCVALEDGDSPEDIAARV
FT                   FAAECQAYPEAVNLVAARGVEAFWL"
FT   gene            589133..589675
FT                   /locus_tag="DaAHT2_0502"
FT   CDS             589133..589675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0502"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="KEGG: dth:DICTH_1466 PyrR bifunctional protein;
FT                   PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85208"
FT                   /db_xref="GOA:D6Z0H9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0H9"
FT                   /inference="protein motif:PRIAM:2.4.2.9"
FT                   /protein_id="ADH85208.1"
FT                   /translation="MQKVKTRLLDGDDIDRTLSRMSMQIVEHNHGVENLAIIGIYTGGV
FT                   YLAQRIQALIQEQFGISLPAGSLDITLYRDDWSLAAQNPVVKKTAIDFSLQDKVVVLVD
FT                   DVVFTGRTIRAALDAIMDLGRPRCIQLASLVDRGGRELPIQADFVGLDVQVGLGEHVHV
FT                   LLREHDGVDEVVLVRQG"
FT   gene            589679..591055
FT                   /locus_tag="DaAHT2_0503"
FT   CDS             589679..591055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0503"
FT                   /product="histidine kinase"
FT                   /note="KEGG: sfu:Sfum_2709 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85209"
FT                   /db_xref="GOA:D6Z0I0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0I0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH85209.1"
FT                   /translation="MSAGEEQSALQMVLKRVEEKQRSYRRYNFSEAQNAVLRTFFDLAQ
FT                   EYDSMEDFYRVCVAVPRVMLGLKARLYLLNERRNTLQLICDSESGLVTPPEPVATTDLS
FT                   CRTRAKDDSLHVPIQRKPSPYDSSTEERSVADLVLGRLEIAGGAAMDKADRFFLRKYAN
FT                   RIGYNLHNRLIAQQNIRHLRFINNLVTDIEHNVITPNMYFRHLFNKLRKRLAELEEVSQ
FT                   EFSRMRQADLCDGQTCGLVQQRLELIYDELAANHREMQEHYNNYSLFLESLFRRDHFRK
FT                   GHLVLRPRACSIEKEVIAPQLEHYGNRLVRQGIKISQPRDMAEEEITLRVDVGLLSQVY
FT                   ANFFSNAVKYTSSVHDHNGETIKLMAYGREYLSDYFGPGKDGVKFNVFTTGEHLSEREA
FT                   QMLFSDGFRGEAGQGKPGTGHGLAFIKQVVEIHGGVVGYEPTAMGNNFYFILPLSPDEA
FT                   "
FT   gene            591087..593456
FT                   /locus_tag="DaAHT2_0504"
FT   CDS             591087..593456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0504"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: dps:DP1617 collagenase
FT                   (proteinase)"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85210"
FT                   /db_xref="GOA:D6Z0I1"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0I1"
FT                   /inference="protein motif:PFAM:PF01136"
FT                   /protein_id="ADH85210.1"
FT                   /translation="MELLAPAGNLETFAAAVEAGADAIYIGAPGANARALARDLPVAEI
FT                   AAMIDYAHGRGVRVYAAMNSLLKEDELVSAAATVEMLAGLKIDALIIQDLGLHRLCRRF
FT                   FPDLRLHASTLMGAHNSLAVHQLDALGFARVVLARELTLAEIADIGRQSRVGLEVFVHG
FT                   AMCFSYSGLCLFSSYLGGKSSMRGRCVQPCRRAYRWSAPQPGGPGKRRGAGRTGREEGG
FT                   KAAYLFSMNDLAALELLPELWRAGVGSIKIEGRMKSAQYVDRVVRAYRRVLDALQKPGE
FT                   PGEHGAATVERAMEEGYALLAEAMGRRTSTGFLQLPFKELVTPGHSGNIGHFLGKLSPG
FT                   GGRWARLKLRHSLRKGDRLRLHREQDGERTAFTLQEIRLCSDGGAGSGKRQTAGGEALA
FT                   AAREGQEVELRLPVAGGAGDSLYLVDLAQRRRMATRCALTVKQEHRRRAASWEKRLPSR
FT                   EMISFIGAGSGGGARTRAGAGAGGRSGKKPREKEKTGPPGRGKAPSLPLWLRLDDLKML
FT                   PRRLPPEVERVVLPLSPVFWPQLAAAGKLWRSLGERLIWALPPVMLENDLPFYRAKIAE
FT                   LRSKNCNAWQLGHLSQLQLFADAAGALPPAAKGGKKRRPRSPLLLYGDYTLNILNSLAG
FT                   ESYGQLGLASVQAAIETDRDNLLALLAGLRPKGAPKRAGGQALPLGLTLYGRPPLFTSR
FT                   LDSVHFRYQVPFLSPREERFVLLREHDLTLALAARPFSLLSRAEELAAAGLAFGVVDLR
FT                   YQKISRQELLPLLRQAGKTHRRSGDTDNFNFLAGLD"
FT   gene            593569..595479
FT                   /locus_tag="DaAHT2_0505"
FT   CDS             593569..595479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0505"
FT                   /product="fagellar hook-basal body protein"
FT                   /note="KEGG: dal:Dalk_1015 protein of unknown function
FT                   DUF1078 domain protein; TIGRFAM: fagellar hook-basal body
FT                   protein; PFAM: protein of unknown function DUF1078 domain
FT                   protein; flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85211"
FT                   /db_xref="GOA:D6Z0I2"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0I2"
FT                   /inference="protein motif:TFAM:TIGR03506"
FT                   /protein_id="ADH85211.1"
FT                   /translation="MSLHNMMFNGMSGINSMAGNMAVLGDNVANINTVSYKNSQTTFQN
FT                   VLTSSQDRFHEVGNGSQIQAISKNFRPGPLEQTTKATDMAIGGKGFFMVNDYNGETLYT
FT                   RDGQFDLKVEDYTPAGFYNLVTPAGYRVQGLNLDYGNGNGQPGDILVRRDSLPQATENV
FT                   TLALNLQSSAAPPTDTTSLYESWNGAATPPLAAGAYDYQTSIEAYDDQGQSFPLNIFFD
FT                   HTDNPQEREFLITHDPALDRRLMPDGSRYNSGPEPEKGAGALLYGKLIFSSVGELMDIQ
FT                   AWAVPPDGNLELWLPADGDDGEETGTGELLPSEYWQQPDAGSGLFSFDYNISGTGDNLS
FT                   STIDFGTTLSRQVATSSGMLKADGSGAAAPGAHVLTTWNQVYDSNGQQVQEGDTFIFQG
FT                   LNHQGEEVTSTYVVDYGERVEDLMLQLEADFNVTALLRNGRLELQANDPGESQMAITSV
FT                   TYLDAAGNSPADNPDLAQPFGEQGAEFALELGQDMELSPLRTTNYATSSSTIFQDQDGY
FT                   GAGVLQNVSVKPDGTIVGNYSNGQSHDQAQVMLADFANYHGLIPGSNNTYQASAQSGDP
FT                   VIGTPGSGVFGQVLGSSLEGSNVDLARQFADLTMTQRIFQANSKSITTADEIHQTLMRL
FT                   K"
FT   gene            complement(595594..597273)
FT                   /locus_tag="DaAHT2_0506"
FT   CDS             complement(595594..597273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0506"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /note="KEGG: dol:Dole_1595 glutaminyl-tRNA synthetase;
FT                   TIGRFAM: glutaminyl-tRNA synthetase; PFAM:
FT                   Glutamyl/glutaminyl-tRNA synthetase, class Ic, catalytic
FT                   domain; Glutamyl/glutaminyl-tRNA synthetase, class Ic,
FT                   anti-codon binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85212"
FT                   /db_xref="GOA:D6Z0I3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0I3"
FT                   /inference="protein motif:TFAM:TIGR00440"
FT                   /protein_id="ADH85212.1"
FT                   /translation="MSDQTKPVPADFIRAIITEDLAAGKHDEVVTRFPPEPNGYLHIGH
FT                   AKSICLNFGLAREFTPARCHLRFDDTNPSKEEHEYVEAIKEDVRWLGFDWQEHLYFASD
FT                   YFEQLYEYAEQLIKDGKAYVCELSAEEIRASRGTLTEPGTNSPHRERPREESLELFRRM
FT                   RAGEFPDGAKVLRAKIDMASGNLNLRDPVLYRIMHRAHHRTGEQWCIYPMYDFTHPISD
FT                   ALEGVTHSLCTLEFADHRPLYDWILDNLPVPCRPRQIEFARLNLAYTVVSKRKLLQLVN
FT                   EGFVQGWNDPRMPTLSGIRRRGYPPEAIRDFCRRIGLAKKDSLVDVGLLEHCVREQLNE
FT                   TAPRVMGVLEPLKVVITNYPEGQTEELTGQNHPQKPEFGTRPLPFSREIYIERRDFMEE
FT                   PVKKFFRLAPGREVRLRYAYFIKCEEVVKDEAGEVVELRCTYDPATLGGNAPDGRKVKG
FT                   TIHWVAAAQAVRAEVRLYDRLFTVESPEKAAADGADFKDFVNPDSLVALENCLLEPALA
FT                   EAQPDQPYQFERQGYFCLDAKDSTPERPVFNRTATLRDTWSR"
FT   gene            complement(597292..598770)
FT                   /locus_tag="DaAHT2_0507"
FT   CDS             complement(597292..598770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0507"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="KEGG: dps:DP2737 glutamyl-tRNA synthetase; TIGRFAM:
FT                   glutamyl-tRNA synthetase; PFAM: Glutamyl/glutaminyl-tRNA
FT                   synthetase, class Ic, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85213"
FT                   /db_xref="GOA:D6Z0I4"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR020752"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0I4"
FT                   /inference="protein motif:TFAM:TIGR00464"
FT                   /protein_id="ADH85213.1"
FT                   /translation="MSEVRVRFPPSPTGYLHIGGARTAIYNWLFAKKHGGKMVLRIEDT
FT                   DAERSTEESIRGIIDGMEWLGLDWDEGPYFQTDHADEHRAAAAKLLAGGQAYKCFCSKE
FT                   ELEARREAAVKAKADYRYNGACRDLSPEEAAAREAAGTPYVIRFKVPQEAGLVAFKDEV
FT                   YGGIERSYQDIEDFVIVRSNGQPLYLLCNVVDDIRDKISHVIRGQDGLANTPRQILLYR
FT                   ALGANPPTFAHMPLTLDLNKAKISKRSHGEVVAVQFYREQGFISWALVNFLVLLGWSPG
FT                   DDREIFSKEELIEAFSLAGISKANSIFNYRKDDPKFFTDPKAININAHYLRTIPVSELA
FT                   SLVRPFLEQEKIWDPAYQGEKKAWFEKTLEMTRERFHTLKDFTTLGRAWFADDFTVDDK
FT                   AREKNLLKHPQLQEWLPELADRLAALPEITPEEAERVARELAEAHGVKPGIPINGARAV
FT                   ITGQIKGPSMFEVFAHLERDKVIGRLREAGKYFA"
FT   gene            599151..599483
FT                   /locus_tag="DaAHT2_0508"
FT   CDS             599151..599483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcy:Bcer98_1573 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85214"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0I5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85214.1"
FT                   /translation="MILDVTSGVNQGQMRPERPEIAPVPNEANRAQPERNEAGQTSEFN
FT                   PGVVTEFSAAAMELARPVTDAEQPADTTRGDDAMEREDRGVAQANREEQARQAQEPQRR
FT                   TIDVMV"
FT   gene            complement(599646..600572)
FT                   /locus_tag="DaAHT2_0509"
FT   CDS             complement(599646..600572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0509"
FT                   /product="GTP-binding protein Era"
FT                   /note="KEGG: dps:DP1689 GTP-binding protein Era-like
FT                   protein; TIGRFAM: GTP-binding protein Era; small
FT                   GTP-binding protein; PFAM: GTP-binding protein
FT                   HSR1-related; KH type 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85215"
FT                   /db_xref="GOA:D6Z0I6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0I6"
FT                   /inference="protein motif:TFAM:TIGR00436"
FT                   /protein_id="ADH85215.1"
FT                   /translation="MNAAPSPDEITCGFVALVGPPNAGKSTLLNNLLGQKISIVSPKPQ
FT                   TTRNRVLGVFNQPTRQIVFLDTPGLHQGRSRLNSEMVKIARRTVSEVDAVAYMIDVSSP
FT                   EADSRPEQRRQAGQLLQRANLPALLLCNKIDQVGKEKLLPVIAAWQEVYPFAAIIPLSA
FT                   LSGEGQETLLDELTRLLPRGPRLFPEDIPTDASERFLCGEIIREKIMLLTRDELPYSTA
FT                   VLIDRFREESAPPLTTIDATIIVEKNSQKGIIIGNRGRMLQQIGRSARREIEAMLGTKV
FT                   LLKLWVKVQKNWTGNMRVLQELGIHEG"
FT   gene            600911..602959
FT                   /locus_tag="DaAHT2_0510"
FT   CDS             600911..602959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0510"
FT                   /product="Exoribonuclease II"
FT                   /EC_number="3.1.13.1"
FT                   /note="KEGG: dps:DP1688 ribonuclease R; PFAM: ribonuclease
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85216"
FT                   /db_xref="GOA:D6Z0I7"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0I7"
FT                   /inference="protein motif:PRIAM:3.1.13.1"
FT                   /protein_id="ADH85216.1"
FT                   /translation="MVSPGNIVEYVEQGKFICGVVVEVAANRLRIFNQNGRELNLPRAR
FT                   VVHCSGYSLPTGMSRDEQRRRLQEVDQQRRELTGRIEIETVWELAAAEADQFFTPLFLA
FT                   QLNFGGEADDDQVAAFLRAVFIDRLFFKYKDGQVMAHPAEVVEQLQNRLEQERQREALL
FT                   ADGARRLQALFVAKVPQVAPPAAIGGGDAAVATDVEAWPERERCLKLLQDYYLLANDAE
FT                   ESELARELLKRSGLTRPHDIYHLLVGVGVWQADENIPLLRAGVPVAFSEEEMAAAEACQ
FT                   ETEADTLLAQGRVDLRHLPVLTIDGKSTRDLDDALHLERQGENFVVGIHIADVAHYVKP
FT                   GSLLFKTAVERVTSLYFPEGQVPMLPPRLSEDLCSLVAGRDRPAMSFLVTLTPDGDIVS
FT                   SRIVASVIRVARRLDYEQVEQLLPADSDLQNLLTLSQALRRRRIEAGALLLPIPDVNIS
FT                   IDERGNPEVSLEDVDIPARLLVSEMMVLANMLAAEYVAQQQVPGLFRSQDDPHQRLVHG
FT                   YEQDIFTIWRQRKQLKPGQLLTRPERHSGVGAASYTTITSPIRRLLDLAMQHQVHGLIA
FT                   RQGAVLAEPDLMDLVAAINTTQGRLNQVKRERQRYWLLKYLQSKVGRWLDVLVVARGPR
FT                   RVTVVLTDCLLEGDLPPGRGVSVEPGDVVAVKIAKADPLDGTLRLEW"
FT   gene            complement(603206..603406)
FT                   /locus_tag="DaAHT2_0511"
FT   CDS             complement(603206..603406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0511"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dds:Ddes_1309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85217"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0I8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85217.1"
FT                   /translation="MFATGTATTMTCPQCDAGRLTILRSCGRVRMECGQCRRQFQIHEV
FT                   AHRLDAQTEAILERWNSIIYD"
FT   gene            complement(603408..603962)
FT                   /locus_tag="DaAHT2_0512"
FT   CDS             complement(603408..603962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0512"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="TIGRFAM: orotate phosphoribosyltransferase; KEGG:
FT                   dps:DP2916 orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85218"
FT                   /db_xref="GOA:D6Z0I9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0I9"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ADH85218.1"
FT                   /translation="MNDHQRLKQIIREKSYRQGTFKLSSGKESDFYIDGKQTTLDAEGG
FT                   YLCGKLLFEMISDHPEKIQAVGGMTLGADPIVTAVSVVSWLNQAPIPAFIVRKESKQHG
FT                   TEAYLEGESNLPPQAVVALVEDVVTTGGTLLKVIDRVEAQGYKVGLVATIVDREEGGAE
FT                   ALAARGHRLQAIFTRQTLLSD"
FT   gene            complement(604034..605488)
FT                   /locus_tag="DaAHT2_0513"
FT   CDS             complement(604034..605488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0513"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: dtu:Dtur_1217 metal dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85219"
FT                   /db_xref="GOA:D6Z0J0"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0J0"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADH85219.1"
FT                   /translation="MSSIQDHLFDTEFLDQSLQYLGEVLNLQVTIQDSDGQAVLTQGQP
FT                   GGRASRFYPFSFSQDIGGLTCTAADQEALAACEPHIAYCLAALNSQLAREEELRETSEE
FT                   MLALSSQLNFLSKVARKIIGVEDLEECYQIILQEISLAINADQSLIHTRGRWDDEVEVR
FT                   LNITREEEAALLECDCLRRRQDTGHPIICTLDNGKSLLYLPIREKDNRISGRMFFLRPA
FT                   NQRQFTAYEKKFVGIIENIISPTFETLRLYDSLQDLYLNTVKALAAAIDAKDEYTHGHS
FT                   FRVAKYAVTIGRQLMLSGKELNDLEIAAYMHDLGKIGISESILGKPGKLTNEEFFHIQQ
FT                   HPVFTDKILQPIHLANHIIQGAIQHHERLDGTGYPMGLSGPEISLFGRIIAVADVFDAL
FT                   TSKRPYRDAMPVETALKILCNDVDKQFDRNVVLALLQALQDNVPGSEFSEVSNTLKFDA
FT                   LQNLNLFLKELTEFVATPPAGRGRTV"
FT   gene            complement(605485..605868)
FT                   /locus_tag="DaAHT2_0514"
FT   CDS             complement(605485..605868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0514"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: lch:Lcho_2296 response regulator receiver
FT                   sensor signal transduction histidine kinase; PFAM: response
FT                   regulator receiver; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85220"
FT                   /db_xref="GOA:D6Z0J1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0J1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADH85220.1"
FT                   /translation="MSKTILIVDDSAMIRRIVSQLVQQLGHRAIAAENGQVGVETALAT
FT                   EPDMIIMDIEMPVLDGIAATRQLKADQRTTGIPVIFFTSLGSEENIREAKEAGGNGFLN
FT                   KPICKEELGLAINKILDPDAASP"
FT   gene            complement(606073..606954)
FT                   /locus_tag="DaAHT2_0515"
FT   CDS             complement(606073..606954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hor:Hore_08360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85221"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0J2"
FT                   /inference="similar to AA sequence:KEGG:Hore_08360"
FT                   /protein_id="ADH85221.1"
FT                   /translation="MLKINREQLVCQSVIGEITSPLGGINPYRVNPEGHPDIYPGVGGI
FT                   TYNLRIGDRACGLFADHVEPGVSISNFTQVQGQPGPNRALNLYSCAGNLATVVSGEAKG
FT                   EKGRVTGKHGGIEHVLLDFAPEVLEKLVIGDKIQIKAFGCGLQLTDYPGVKVINLDPDL
FT                   LALLPLKKGKKGKLQVPVTHLVPAAIMGSGLGSPHSHSGDYDIQLFDQPTVKKYKLHDL
FT                   RLGDFVAIIDADATYGRIYRSGGVVIGIVVHSDCVLAGHGPGVMVVMAAGGGEIEPVID
FT                   AQANLTSFLPAL"
FT   gene            complement(607040..608134)
FT                   /locus_tag="DaAHT2_0516"
FT   CDS             complement(607040..608134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0516"
FT                   /product="GTP-binding protein YchF"
FT                   /note="KEGG: dps:DP0782 GTP-dependent nucleic acid-binding
FT                   protein EngD; TIGRFAM: GTP-binding protein YchF; PFAM:
FT                   Protein of unknown function DUF933; GTP-binding protein
FT                   HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85222"
FT                   /db_xref="GOA:D6Z0J3"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0J3"
FT                   /inference="protein motif:TFAM:TIGR00092"
FT                   /protein_id="ADH85222.1"
FT                   /translation="MGFRCGIVGLPNVGKSTIFNALTAAGIESANYPFCTIEPNVGMVP
FT                   VPDERLDQLATMAKTRNKVNARMEFVDIAGLVSGASQGEGLGNQFLGHIRQVDAIAHVI
FT                   RCFADDNIVHVGGSIDPLRDREIINTELILADLETVRKRLDKTAAQVKSGQKGAKEQQA
FT                   FLQALADHLDQGQPARTMEPDDIGQEVLKELFLLSAKPVLYVANVAEEEIGSGNPWVEK
FT                   LKEVAAAEQASVVMISGAIEEELSHLEEEERRAFLDDLGQSEPGLNRLIRSGYQLLGLI
FT                   TYFTVGEKETRAWTIPQGWKAPQAAGVIHTDFERGFIRAEVISCQDLLACGSETKAREK
FT                   GLMRLEGKDYVVRDGDCINFRFNV"
FT   gene            608254..608751
FT                   /locus_tag="DaAHT2_0517"
FT   CDS             608254..608751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0517"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   pca:Pcar_2226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85223"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0J4"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ADH85223.1"
FT                   /translation="MKLQEKSQINPLGAMIGKLAASRNWRARLAQHQIFLIWPELVGEE
FT                   LAAVCRPEVIREGVLWVRVVDPVWGQQLQFEKNAILEAVNRRLPGEHKITGLRCRFDPA
FT                   LAHELDSELQNQPRPAPVPRKIEPVREAGFKKIIAGIDDPQAKANLLRLWRRSESRDRS
FT                   RQ"
FT   gene            complement(608740..610206)
FT                   /locus_tag="DaAHT2_0518"
FT   CDS             complement(608740..610206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0518"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: dat:HRM2_34390 CheT; PFAM: chemotaxis sensory
FT                   transducer; SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85224"
FT                   /db_xref="GOA:D6Z0J5"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0J5"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADH85224.1"
FT                   /translation="MPGKATNQNSVIARVMTAVLIVLAIALIGGTIFLHGFVKQRLSTN
FT                   YMDSVYTLFDSFEEGVKGSLERGQMKTFLELLYRQNEISGILDASLYDPAGRLNLSSTD
FT                   GNRAERELAPATLQDLEAMEIVEEHRGDYLRLYGPQPVVPDCIRCHTDWREGESGGTLA
FT                   LSYDLSRLNMTLRNLTLFLVFGCFTLLALVSASIALVMNRLVSRPVNAVIGDLQASAGE
FT                   VSRSAHQSAESGETVADRASQQAAALEQTSASIEELAAMTNQNADSADSANSLMSEANQ
FT                   VMTEANEAMGQLTEAMREITNANEETSKIIQTIDEIAFQTNLLALNAAVEAARAGEAGA
FT                   GFAVVADEVRNLAMRAAEAARQTTALLSTTNDRIERGSQLVGNTDESFKNAADKARKTA
FT                   EILMEIATASKEQSQGIRQISKAIQDLDKSTQDNAAEAEQQSQLAGSMEDQAAQLNHCV
FT                   NTLIELIQGSKTASRRSQQEGPDDSRKLLS"
FT   gene            complement(610233..611150)
FT                   /locus_tag="DaAHT2_0519"
FT   CDS             complement(610233..611150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0519"
FT                   /product="hydrogenase (NiFe) small subunit HydA"
FT                   /EC_number="1.12.99.6"
FT                   /note="TIGRFAM: hydrogenase (NiFe) small subunit HydA;
FT                   KEGG: dps:DP0160 periplasmic [NiFeSe] hydrogenase, small
FT                   subunit [precursor]; PFAM: NADH ubiquinone oxidoreductase
FT                   20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85225"
FT                   /db_xref="GOA:D6Z0J6"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0J6"
FT                   /inference="protein motif:TFAM:TIGR00391"
FT                   /protein_id="ADH85225.1"
FT                   /translation="MFDRRKFLKLAAALAAAFGTKGLSQPARAALNDIDPRTVPKLLYL
FT                   QGLSCTGCSISLLQADSPSPLSMITDYSQLVFHTDLSATSGAQAMELINSFIDGQAGDY
FT                   VLAIEGAIPAGMPEACIIDHKPFADYLERAARTMSGAVAIGSCACDGGIPAAEGNPTGA
FT                   VGLAEFYRNRNINQPVINIRGCPVHPDWVWHTITHLVLVGNPNLVNGSPRVFFERRLHE
FT                   LCPRYYDFQEEIFAEKLGDRGCLFRLGCLGPITFADCPTRWWNGGRTWCVDTNAPCIGC
FT                   ASPKFARQKDLPFYRLSEGKGRNS"
FT   sig_peptide     complement(611061..611150)
FT                   /locus_tag="DaAHT2_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.926 at
FT                   residue 30"
FT   gene            complement(611162..612673)
FT                   /locus_tag="DaAHT2_0520"
FT   CDS             complement(611162..612673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0520"
FT                   /product="nickel-dependent hydrogenase large subunit"
FT                   /note="PFAM: nickel-dependent hydrogenase large subunit;
FT                   KEGG: dps:DP0159 cytochrome-c3 hydrogenase (NiFeSe), large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85226"
FT                   /db_xref="GOA:D6Z0J7"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0J7"
FT                   /inference="protein motif:PFAM:PF00374"
FT                   /protein_id="ADH85226.1"
FT                   /translation="MQVDIGPITRIEGHLNVKTTVENGVVTDARCEGEMFRGFEIFLRG
FT                   RDPLDSQQITQRICGVCPYAHAIASSTAQENAYRLQVPPNGRILHNLIQGANHLYDYLL
FT                   HFYQLCALDYVDITAVLEYTGKDRELSKVRDWVKAEIDSGKRYPAAPFLPRLSGKYLDN
FT                   RDANLGAIKNYLEAMKMEQKANQAAAIFGGKFPHATAIFPGGCTQEARVDLIVPYQSLI
FT                   REVRDFIHHKYIPDVLAVAGAFPEYWDIGRSQGGFLSYGHLPLGPEPDSRRLLAPGVMF
FT                   DGQVEAVDFNQIRQDVGNAKYSSPSNLRVRDAAITPQPNKRDAYSWIMAPRYAGQVVEV
FT                   GPAARVMVDYAQGHNPEIKKLVDRFAGQAGIQPTQLNSVLGRHLSRAILAAVLADFLLA
FT                   ESQRLQPGQPTMASIDPPASAEGFGATEASRGALLHYIRIENYKIAKYECVVPTTWNAS
FT                   PRDDQGQPGAMESALIGTRVNNPEEQIESKRIVRSFDPCLACAVH"
FT   gene            complement(613082..613810)
FT                   /locus_tag="DaAHT2_0521"
FT   CDS             complement(613082..613810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0521"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   dat:HRM2_20880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85227"
FT                   /db_xref="GOA:D6Z0J8"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0J8"
FT                   /inference="protein motif:PFAM:PF04452"
FT                   /protein_id="ADH85227.1"
FT                   /translation="MRRFFIDPEAIQGREASLTGSDAHHLQHVLRLTPGERVELFDGRG
FT                   TVYQAAIDHIEPGLTRLTLLSSSDTPPDRLAIHLGQAMLKGKKMDLVVQKCTELGVRSL
FT                   RPYTSQHTTTPPPGAEKLARWQRIIHESCKQCNQPWPPSCHPPQTFAELLADAADFDLR
FT                   LICWEEPEAPPLSNIAEQLGAPASVLVLIGPEGGFSREEIDLARQAGFIVIGLGRRILR
FT                   AETASIVIIALLQYIFNDLY"
FT   gene            complement(613807..614727)
FT                   /locus_tag="DaAHT2_0522"
FT   CDS             complement(613807..614727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0522"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /note="KEGG: sat:SYN_02277 ribosomal protein L11
FT                   methyltransferase; TIGRFAM: ribosomal protein L11
FT                   methyltransferase; PFAM: ribosomal L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85228"
FT                   /db_xref="GOA:D6Z0J9"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR010456"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0J9"
FT                   /inference="protein motif:TFAM:TIGR00406"
FT                   /protein_id="ADH85228.1"
FT                   /translation="MTNTPRSWLKLTVQCPPEQADNVAAMLASCSAGGVEHGFTGFDHD
FT                   SPWEEISVYLEQDDSLNDCLQAINDYLEYLRSHHQAVEIPPPRTEVIVDRDWNATWKKE
FT                   FTPLAVAPGLIIKPTWETYEPAPGEQVIEMDPGQAFGTGHHASTRLALHLLNLLFSEAE
FT                   PPATVLDAGCGTGILAMAAALWGAEKVVAIDNDPLAVEATRFNSERNQLNSVIQTSQTP
FT                   LPELTSPFQAVLANITADVLLDLAPELVRLVAPGGHLILAGVLTGQQEAEIVRHFQELG
FT                   LLLRQQPHQDEWVAFLFRKPHDAQS"
FT   gene            615153..615908
FT                   /locus_tag="DaAHT2_0523"
FT   CDS             615153..615908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0523"
FT                   /product="1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate
FT                   (AIR) carboxylase"
FT                   /note="PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; KEGG: gem:GM21_3730
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85229"
FT                   /db_xref="GOA:D6Z0K0"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0K0"
FT                   /inference="protein motif:PFAM:PF00731"
FT                   /protein_id="ADH85229.1"
FT                   /translation="MEKQDLAQLLAEVAAGRCSVEQAVDALKHWPGEKLGCAHLDHQRR
FT                   LRTGIPEVVFGEGKSAEQVALIMQRMLAHRETVLATRVDAAKAAAVTDLLPELTYFPAA
FT                   RMLAANLPEINPQRCRGTILVVSAGTSDEPVAEEAALTATALAHPVSRLYDVGVAGIHR
FT                   LLGQRQVMEEASVLIVVAGMEGALPSVVGGLVSKPVIAVPTSVGYGTGFGGIAALLGML
FT                   NSCAPGVTVVNIDNGFGAACAAHAINGRG"
FT   gene            616282..617831
FT                   /locus_tag="DaAHT2_R0009"
FT   rRNA            616282..617831
FT                   /locus_tag="DaAHT2_R0009"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            617982..618060
FT                   /locus_tag="DaAHT2_R0010"
FT                   /note="tRNA-Ile1"
FT   tRNA            617982..618060
FT                   /locus_tag="DaAHT2_R0010"
FT                   /product="tRNA-Ile"
FT   gene            618071..618146
FT                   /locus_tag="DaAHT2_R0011"
FT                   /note="tRNA-Ala1"
FT   tRNA            618071..618146
FT                   /locus_tag="DaAHT2_R0011"
FT                   /product="tRNA-Ala"
FT   gene            618289..621243
FT                   /locus_tag="DaAHT2_R0012"
FT   rRNA            618289..621243
FT                   /locus_tag="DaAHT2_R0012"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            621323..621438
FT                   /locus_tag="DaAHT2_R0013"
FT   rRNA            621323..621438
FT                   /locus_tag="DaAHT2_R0013"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            621640..624204
FT                   /locus_tag="DaAHT2_0524"
FT   CDS             621640..624204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0524"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: hha:Hhal_1074 solute binding protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85230"
FT                   /db_xref="GOA:D6Z0K1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0K1"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADH85230.1"
FT                   /translation="MERLKFLPFIIAVLVVGAIAGVLWMGERHAGYDQGFAVQPGDPAQ
FT                   RRGALVDEVIFTVESDPGRIVALIERGAHHLYGQGLDSASLFRLIQASSQVDYHLSRGT
FT                   SVELTFNPARFEDGRLNPFRVPAIREAMNWLVDRRYVAEELFGGLAAPRYLPLNTAFPD
FT                   YARLAATARELELHYRHDPARAEAVIGQELLKLGAKRLDGSWFYNDQPLRLTVLIRTDD
FT                   NRERVGDYIANLLEDLGFAVQRLYRTAEEAARIWIAGDPALGQWHIYTGAWISPVINRD
FT                   VGNDFNFYYTPRGRPEPLWQAYQPDPEFDQVADRLDRRDYTSVEQRQALMKDALRLAMQ
FT                   DSARVWLVDKQSIWPHAENIAVAVDLAGGVTGSALWPYTLRFKDGLGGRLVIGTPSMLT
FT                   EPWNPVAGSNWIFDLMIMRALGDAAVLPDPFTGLFWPQRIQGATVTVAADAPVSRTLDW
FT                   VTLEKTRQALEVPPDAWIAWEADAGRIITVGEKHPDGLTARSRAIIKYEDDYLKRRWHD
FT                   GSRFSVADLVLPWILTFERADENSRLFDPGHLPRFLVYQRHFKGWRIIDTAPLTVEVYS
FT                   DQVFLDAENLVANRLPALQPWHVLGLGIEAERRGELAFSTAQADRLGVEQISYVSGPSL
FT                   EILRDYLAVAAKVGHLPFAKELAAWVEPEEITQRYTALTDWVAQRGHFWVDDGPFYLHS
FT                   VRPLEGSLVLRRNQDFPDYADKWLHFSEPRIPELEIDAPLVVVLGEAMEATLNITFAGR
FT                   PYPREEIDEVRYLLFDADDRLLNRGELEPLEPPEQGRWRLTLPVATLQRLGAGANSLEI
FT                   AVTTTNVALPGFASHAFATVPAHDYGVGEPGEEPPQHGGQHD"
FT   gene            624185..625306
FT                   /locus_tag="DaAHT2_0525"
FT   CDS             624185..625306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0525"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hha:Hhal_1075
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85231"
FT                   /db_xref="GOA:D6Z0K2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0K2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH85231.1"
FT                   /translation="MVASMTDSASGKKRGLGRDLRRLGLFVGKRLLALFVTVLAGVYLT
FT                   ILIANMGGQVDELRLVQIKTAAAEMVRADPAFHDLPSAEREALMASQVQLEVERLRLDE
FT                   PFIWRSFDYLYRAMVLDLGRAEEMHSDTGSRRVYNIIVERLPATILLFGTANLLVFFVS
FT                   VYAALKLSRRYGSALDRTVIGLAPTSAAPAWFYGIFLILLLAFIVPLFPTGGMVEVPPP
FT                   ENPWAYAASVLKHLALPVTAMFVAQIFISIYSWRTFFLIHASEDYVEMARAKGLPDRLI
FT                   EQRYILRPAMSPIITSFLLMLIGLWGGAIILEQVFNWPGLGTLLFQAIGHRDTPVIIGS
FT                   VVIFAYLLAATVFLLDFIYAALDPRVRIEGGGR"
FT   gene            625303..626649
FT                   /locus_tag="DaAHT2_0526"
FT   CDS             625303..626649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0526"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hha:Hhal_1076
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85232"
FT                   /db_xref="GOA:D6Z0K3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0K3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH85232.1"
FT                   /translation="MSPWREGFKRLRRYPSALAGLLIIVALLAMALYAVLAIPYADAQR
FT                   LWRGGEIWYDLPVNAAPQWLDRLTGGQAPPTLKVTSRDAAVQSRLFDQVRIQEQTLRVD
FT                   FYYQQFPSEINLFLAADFTRRQPFVRMLWRTPDGVEIPLGARRIGASERISISQDQALA
FT                   RRLGAPPQIGLFAEPAPPEGLAGGEPGVRQGSYQLVLETVHFEPDTTIEAELVVYGRVH
FT                   GLAGTDHQRRDLLVALLWGTPVALAFGLLAAVGTTVTTLIIAAVGVWYRGWVDAVIQRL
FT                   TEVNIILPLLPILVMVGTLYSTSIWLMLGVVVALGIFSAGIKMYRAMLLPIREAPYIEA
FT                   AQAYGAGSGRIVLRYMVPRILPVLIPTFVTLIPTYVFLEASLAVLGLGDPILPTWGKVL
FT                   HDAQAQSALYHGFYYWVIGPALLLMLTGLGFAMLGFALDRVFNPRLRNL"
FT   sig_peptide     625303..625407
FT                   /locus_tag="DaAHT2_0526"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.565 at
FT                   residue 35"
FT   gene            626649..627623
FT                   /locus_tag="DaAHT2_0527"
FT   CDS             626649..627623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0527"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: aeh:Mlg_2177 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85233"
FT                   /db_xref="GOA:D6Z0K4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0K4"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADH85233.1"
FT                   /translation="MPPDQLLKIQDLRMSYATERGMVRAVDGVDLEIRRNEALVVLGES
FT                   GCGKSSLAKALLRILPRNACPPTGQVLLDGVNILALPEERFRREVRWLRLALVMQAAMN
FT                   ALNPVVRIGEQVAEPLRIHRGWSRRQAAGKAAAAFEEVGISPDFLARYPHELSGGMRQR
FT                   AVLAMALIAEPDLVILDEPTSALDVLTQAAIMNVLKRIKRERGTSFVLITHDVATSSEL
FT                   ADRVALMYAGQVVEEASAEIFFSRPAHPYSQMLMAAVPKLHQREKPVGIPGRPPSLLEP
FT                   PAGCRFGGRCPHHSPACVEVPAMVELAGRHRVRCRLQLAGGAP"
FT   gene            627620..628597
FT                   /locus_tag="DaAHT2_0528"
FT   CDS             627620..628597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0528"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: hha:Hhal_1078 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85234"
FT                   /db_xref="GOA:D6Z0K5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0K5"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADH85234.1"
FT                   /translation="MKLPLLMVKGLQTHFELRQWGVWRLGVVRAVDGVDFTLAAGESAA
FT                   VVGESGCGKSTLARTLLGLYRPTGGEVLFAGRSLANMRGADMKEYRARVGYVQQDPYGA
FT                   LPPFMTVHRALAEPLIINGVRSRAERERRIAAALEEVGLGAAAEVRDSYPHQLSGGQQQ
FT                   RVVIARALLLRPQLIIADEPVSMLDASVRVEILELLTRVQTEHRIALLYITHDLSTVRH
FT                   YAQRVMVMYAGRMVEQAPVESLLDRPRHPYTEALLEALADPDAANARRERRVPKGEPPS
FT                   LLNPPAGCRFHPRCPKLVAGTCESKAPPTCRPAADHQVACWLYA"
FT   gene            complement(628594..629466)
FT                   /locus_tag="DaAHT2_0529"
FT   CDS             complement(628594..629466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ote:Oter_3080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85235"
FT                   /db_xref="GOA:D6Z0K6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0K6"
FT                   /inference="similar to AA sequence:KEGG:Oter_3080"
FT                   /protein_id="ADH85235.1"
FT                   /translation="MDAEHNNQHSTTPGQPDGKELLFGLTRSEYGHLPPRLEKLLADVA
FT                   DLYAGRWPSHEACEVEYHDFVHALDVALAVARIMAGWNRANPDDRIGVELYTWTVAAAL
FT                   FHDAGYIKDKGDRDGHGGKFTITHVRRGMTMAEEYLRRSGWPERAALFVATAIALTDYR
FT                   QPPTMDLGRLNAQERIAARMLPTADLIGQFGDKHYAAKIDGLFAEFQEMYAHQQQDQRP
FT                   TVNPVPMFRSAQEIRNTIDEFYNNFVSPRLAEFGHLERYLDVFYGQQANPYRTNITANL
FT                   NKYRNSKGS"
FT   gene            629807..631093
FT                   /locus_tag="DaAHT2_0530"
FT   CDS             629807..631093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0530"
FT                   /product="homoaconitate hydratase family protein"
FT                   /note="KEGG: dps:DP1957 3-isopropylmalate dehydratase large
FT                   subunit; TIGRFAM: homoaconitate hydratase family protein;
FT                   3-isopropylmalate dehydratase; PFAM: aconitate hydratase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85236"
FT                   /db_xref="GOA:D6Z0K7"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0K7"
FT                   /inference="protein motif:TFAM:TIGR01343"
FT                   /protein_id="ADH85236.1"
FT                   /translation="MGQTIVEKIFAAHRRDTPTPENIILDLDVVMCHEITTPIAVTDLE
FT                   ARGMDRVFDPDKIKVVIDHVTPAKDSKTATQGKILRDWARRQNIRDFFDIGRNGVCHAL
FT                   FPEKGFIRPGYTVIMGDSHTCTHGAFGAFAAGVGTTDLEVGILKGVCSFRLPRTIKVEI
FT                   NGKLPAGVYAKDVILYIIKTITVNGATDRVLEFAGPVVDAMSMEARMTLCNMAIEAGAT
FT                   CGICPPDKTTAEYLWPFIQNDYATVDQAAADFRQWHSDPDAAYEQVLEFDVSTLAPQVT
FT                   FGFKPDEVKDITAMEGVPVDQIYIGSCTNGRIEDLREAAKVLKGRRIADQVRGILSPAT
FT                   PKVYNQAMEEGLLKIFQEAGFCVTNPTCGACLGMSNGVLAEGEVCASTTNRNFNGRMGK
FT                   GGIVHLMSPLSAAAAAVAGKITDPRPLLV"
FT   gene            631143..631658
FT                   /locus_tag="DaAHT2_0531"
FT   CDS             631143..631658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0531"
FT                   /product="aconitate hydratase domain protein"
FT                   /note="PFAM: aconitate hydratase domain protein; KEGG:
FT                   ppd:Ppro_1927 aconitate hydratase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85237"
FT                   /db_xref="GOA:D6Z0K8"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0K8"
FT                   /inference="protein motif:PFAM:PF00694"
FT                   /protein_id="ADH85237.1"
FT                   /translation="MKQFGGQALFLDRSDINTDEIIPAKYLTENTKMDLKPYVLEDLKL
FT                   GGFDPQRDLAGKGVVVSRANFGCGSSREHAVWVFEVNEINTVIAESFARIFRQNMYNCG
FT                   MLAIELPAADIEKLFNLGGEVNIEVDLATGKLTARGEQTAEFSFVLNDFDRRLVEAGGW
FT                   LNYADQHY"
FT   gene            631679..633031
FT                   /locus_tag="DaAHT2_0532"
FT   CDS             631679..633031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0532"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /EC_number="2.1.1.35"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmA family; KEGG:
FT                   dps:DP1443 RNA-methyltransferase; PFAM: methyltransferase
FT                   small"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85238"
FT                   /db_xref="GOA:D6Z0K9"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0K9"
FT                   /inference="protein motif:TFAM:TIGR00479"
FT                   /protein_id="ADH85238.1"
FT                   /translation="MLLTIEKIVAGGLGLGRRQDGCTVMVPGVLPQEEVLVRVRRRHRR
FT                   FLTAELQEVRRAAPQRRRAPCPCYEACGGCDLQHAVYSAQLTFKQQILQELLQRAGLAE
FT                   KVLPRLAPPLTAPSEFHYRQRIRMQVEQGQAGFFQTGSHRLQPVNSCLLARPEINALWQ
FT                   ELQPHEAWQQLAAQVSALEINLDPASRRLVLLLHHRRRPRPAERRAALQLCHDLPALKG
FT                   LAFLPVGHAAGPFIDRDSGPAGRLGSEALQLCLKLPVTPAGRTLELQFEPWGFSQVNEE
FT                   QNRQLLTLLIELLQPAGHEIVADLHCGMGNFSLPLALLVGEVHGVDLQAAAIRGAKRNA
FT                   EANRLNNCHFRQAEAHQGLAALQAAGIRPDVLLLDPPRAGCRELVATLEAPLPGKVVMI
FT                   SCDPATMTRDLAALLALNYQVETMRLVDMFPQTHHLETITLLSRNNSAKGA"
FT   gene            complement(633076..634293)
FT                   /locus_tag="DaAHT2_0533"
FT   CDS             complement(633076..634293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0533"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /note="KEGG: dps:DP2814 penicillin-binding protein 4
FT                   [precursor]; TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85239"
FT                   /db_xref="GOA:D6Z0L0"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0L0"
FT                   /inference="protein motif:TFAM:TIGR00666"
FT                   /protein_id="ADH85239.1"
FT                   /translation="MPPILATLCWLLLWLLPGPAAAGLPPSVFSDGGYLLSKDGRLLLA
FT                   HNHEQALVPASTWKIATGLMALEQLGPDFRFATELYRTNGALYIKGFGDPMLISEEVAA
FT                   ISAALAAAGISEINDIVLDDSFFQLEQANPAGSAASLRSYDAANGALVVNFNTAKIEVR
FT                   ADGTVHSAEPQTPTLPIMQQWAGKLPPGVHRINLSHTPAASLRYSGELFKYLFAARDIR
FT                   VTGKLRHGRLPAGAELIYRHHSARTLAETVEAMLLYSNNFIANQLFLVAAAKGGDNPAT
FT                   WGKARVNLHDYLLELGLPPGSFRVDEGSGLSRDNRISPDALHLLLQHFRPYAELLPHWE
FT                   GRLVKSGTLNGVYAYAGYFRGPEQLDPFVLILQQTANTRDRALEIMEGHWQNATGSAAP
FT                   YPDHNQ"
FT   sig_peptide     complement(634225..634293)
FT                   /locus_tag="DaAHT2_0533"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            634403..634900
FT                   /locus_tag="DaAHT2_0534"
FT   CDS             634403..634900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0534"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: dba:Dbac_2474
FT                   rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85240"
FT                   /db_xref="GOA:D6Z0L1"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0L1"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ADH85240.1"
FT                   /translation="MGKTEENLWAAFAGESQANRKYLAFANKAEKDGYPQAAKLFRAAA
FT                   HAETVHAHAHLRALKAIGDTRDNLRAAMEGELHEFEEMYPPMIETAKAEGNKAAEMSFT
FT                   FAHKVEKTHAELYRQALENLDNLPETDYYVCQVCGHTEDGDSAPDKCVVCGANSRAFSK
FT                   IS"
FT   gene            634913..635848
FT                   /locus_tag="DaAHT2_0535"
FT   CDS             634913..635848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0535"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="TIGRFAM: porphobilinogen deaminase; KEGG:
FT                   glo:Glov_0502 porphobilinogen deaminase; PFAM:
FT                   Porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85241"
FT                   /db_xref="GOA:D6Z0L2"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0L2"
FT                   /inference="protein motif:TFAM:TIGR00212"
FT                   /protein_id="ADH85241.1"
FT                   /translation="MWKTIRIGTRASMLALAQSNWIKGRIEAQYPGCSVELVKIVTKGD
FT                   KIVDVPLAKVGGKGLFVKEIEEALLRREVDIAVHSMKDVPAELPEGLHIGIITEREKPF
FT                   DAFITNNYKTLAEVPQGATIGTSSLRRKAQLARLRPDLKIEDLRGNLDTRLRKLDEGVY
FT                   DAIILAAAGLNRLDLFHRATFCFQPDEMLPAVAQGAVGIELRRADEDLLQMLSFMDHRE
FT                   TTLAVHAERSYLKRLEGGCQVPLAGFATLAGQTLTINGLIASVDGGKMVKAKHSGPAAQ
FT                   AKTLGLELAEELLAMGGREILEEVYGASLK"
FT   gene            635879..637405
FT                   /locus_tag="DaAHT2_0536"
FT   CDS             635879..637405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0536"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="KEGG: dps:DP1734 uroporphyrinogen III
FT                   synthase/methyltransferase (HemD+CobA); TIGRFAM:
FT                   uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; Uroporphyrinogen III synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85242"
FT                   /db_xref="GOA:D6Z0L3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0L3"
FT                   /inference="protein motif:TFAM:TIGR01469"
FT                   /protein_id="ADH85242.1"
FT                   /translation="MSKKGKVYLVGAGPGDPELITVKGKRLLGRAEVVVYDYLANKKLL
FT                   AHVPPTAVLIYAGKKGGSTHTHSQTEINQMLVDHALGGKTVVRLKGGDPFIFGRGGEEI
FT                   EELSAHGVPFEVVPGVTSASAAATYAGVPITHRAFTSSVAFITGHEDPNKKESRIAWDK
FT                   LATGVGTLVFYMGIKNLPNIVANLIKHGRDPQTPVAVVRWASTPEQRSVVGTLASISEV
FT                   VRQAGITPPALVVVGEVVSLREVINWYEKRPLFGKKILVTRSREQASELVQSLEDLGAD
FT                   CLEGSTIALAEPPDWAPLDQALDKIATYNWLLFTSPNAVNFFFKRLAALGLDSRRLHGP
FT                   QIAVVGTATAEALQNYGIKADLLPARFTAEGLAEALLAQGVSGRKILLPRALKAREVLP
FT                   ESLRAAGAEVDIAPVYQNTRPPMADEIRQALERQEVDLITFTSSSTASNLFALLNWPAE
FT                   ELARRLAGVKIAAIGPITAATVEKAGLKVDIQPETHTIPEMVSAIAAYYL"
FT   gene            637525..637842
FT                   /locus_tag="DaAHT2_0537"
FT   CDS             637525..637842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0537"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   dal:Dalk_2029 cupin 2 conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85243"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0L4"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADH85243.1"
FT                   /translation="MKKISLHDSNQYDDKTFKRFLLHDSAYFRVLNFNLKAGQVFPVHS
FT                   HPAEGQLTIQVVAGRGEFLGAENSTMPAETGDILVSEISEPHGVRADSDMRILVTIAPP
FT                   I"
FT   gene            complement(637888..638397)
FT                   /locus_tag="DaAHT2_0538"
FT   CDS             complement(637888..638397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0538"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   dps:DP0069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85244"
FT                   /db_xref="GOA:D6Z0L5"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0L5"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ADH85244.1"
FT                   /translation="MKELLFVGDSLIEYYDWARRFPAQRVHNLGWSGETVQGLLGRQGV
FT                   IIAQGPAPDLILIMSGTNNIGLEETDFIADYRQIIENFQQAWPTARICMHSLPPILLPW
FT                   LDPELVPKANEKLRRLAAATGCDFIDVYQLFQQEGPSNCLVEDGVHLSDRGYTIWAEAI
FT                   AKLMGK"
FT   gene            complement(638456..639853)
FT                   /locus_tag="DaAHT2_0539"
FT   CDS             complement(638456..639853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0539"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: dps:DP1446 Ntr family two-component response
FT                   regulator; PFAM: sigma-54 factor interaction
FT                   domain-containing protein; response regulator receiver;
FT                   helix-turn-helix Fis-type; SMART: response regulator
FT                   receiver; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85245"
FT                   /db_xref="GOA:D6Z0L6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0L6"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADH85245.1"
FT                   /translation="MTAQTAEVNILVVDDDEAHRYMLRAMLAEWGWRSAEAADGALAVA
FT                   AVAEQPFDAVLMDVRMARMDGMEALRRIQAHNPAIPVIIMTAYSSVDSAVEAMKAGARD
FT                   YLTKPLDFDRLRLTLAKALDHRQVEESRRSRRHDDPADQLDQAGIIGNSPAMKELLEMI
FT                   TYVAPTEATVLISGESGTGKELVATALHRNSTRKDGPLVKVNCAALVESLLESELFGHE
FT                   KGAFTGADRRREGKFIQAASGTIFLDEISETSPAMQAKLLRVLQEHEIQRVGGQETLKV
FT                   DVRVLAASNRVLEDAVKEGKFREDLYYRLNVVTLQVPPLRERSEDIPLLAAHFVDKFAA
FT                   RNRRRVEGITPQAMDLLLKHPWPGNVRELENAIERGVILMRGDYLDEQSLPLSLRRIAD
FT                   EAGAPPAESTTGRPSSPSSPSSLEEAEKLVVRRTLEETGGNRSEAARRLNITRKTLLSK
FT                   INKYGLG"
FT   gene            639944..640019
FT                   /locus_tag="DaAHT2_R0014"
FT                   /note="tRNA-Thr1"
FT   tRNA            639944..640019
FT                   /locus_tag="DaAHT2_R0014"
FT                   /product="tRNA-Thr"
FT   gene            complement(640267..641940)
FT                   /locus_tag="DaAHT2_0540"
FT   CDS             complement(640267..641940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0540"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein;
FT                   Peptidoglycan-binding domain 1 protein; KEGG: aeh:Mlg_0096
FT                   peptidoglycan binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85246"
FT                   /db_xref="GOA:D6Z0L7"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0L7"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADH85246.1"
FT                   /translation="MSFQRLYLLLLLSFTLLLPLPASGQENQDSEPIRQLLEATDPSEP
FT                   LTIHRIHLRATPLLREFYRQRAFQPAWVDTNGAPQGSAQLLLAAIKEADADGLSPRDYH
FT                   LESILVLSSLLAAHPSPGLAAELDLLLTDAFLLLGYHLLHGRVDQESGAPQWQVEHSQA
FT                   KLSLALHAAAAPDGNPQAILTGLLPQQAGYRELRATLADYRRLAEQGGWPQVPGSTTLR
FT                   LGDRDHRVVTLRQRLHRSRDLSGTAARGDVFDETLEAAVRSFQQRHGLLADGVVGRQTL
FT                   AALNVPLEVRIRQLKLNLERWRWLAEEFGRRHILVNTAANKLELIEDEQAILSMRVVTG
FT                   TPYRRTPNFSDRVTYLVLNPYWNIPASIAAQDILPELQENPDYLAQNGIKVLDGWNADS
FT                   ATVTPDTVDWERLRTRPQAFPYRLRQDPGPRNPLGRIKFMFPNAYSVYLHDTPARELFH
FT                   RQTRNFSSGCIRLERPLELAANLLAGTPLDSVGALRRALFDETSHDRHVRLPSPVPVHL
FT                   VYWTAWVAPDGSVQFRDDIYERDGLLAQALTTPPPMLASR"
FT   sig_peptide     complement(641866..641940)
FT                   /locus_tag="DaAHT2_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            complement(641992..642552)
FT                   /locus_tag="DaAHT2_0541"
FT   CDS             complement(641992..642552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0541"
FT                   /product="protein of unknown function DUF882"
FT                   /note="PFAM: protein of unknown function DUF882; KEGG:
FT                   gur:Gura_0028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85247"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0L8"
FT                   /inference="protein motif:PFAM:PF05951"
FT                   /protein_id="ADH85247.1"
FT                   /translation="MLFPPSGRRSFLKRSLLATVALGGGGLAWAHELLAAVRPARRLAL
FT                   YHLHTGERLTITFRDPRGNHIPSALAEINRLLRCHHTGEIHPIDPETIDYLSLVDSKLG
FT                   GGNEFHIISGYRSPAYNRRLLREGRQVAPRSLHLTGRAIDVRLPKIGAATLRRAALDLK
FT                   LGGVGYYPRSGFVHLDSGPFRSW"
FT   sig_peptide     complement(642460..642552)
FT                   /locus_tag="DaAHT2_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 31"
FT   gene            642762..643595
FT                   /locus_tag="DaAHT2_0542"
FT   CDS             642762..643595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0542"
FT                   /product="CDP-diacylglycerol/serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /note="TIGRFAM: CDP-diacylglycerol/serine
FT                   O-phosphatidyltransferase; KEGG: dps:DP2772
FT                   CDP-diacylglycerol--serine O-phosphatidyltransferase; PFAM:
FT                   CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85248"
FT                   /db_xref="GOA:D6Z0L9"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0L9"
FT                   /inference="protein motif:TFAM:TIGR00473"
FT                   /protein_id="ADH85248.1"
FT                   /translation="MSNRRRRYFGRERQGGKGRISLLPSLLTTISLFSGFYAIVAAIEG
FT                   QFFHSAVAIIIAGVFDGLDGRVARLTGTTSGFGKEYDSLCDLVAFGVAPAILAYQWVLH
FT                   PFGRYGWLAAFLYVATTALRLARFNSQAGGEESKNFTGLPCPAAGGMIATSFLFCHFFG
FT                   ITGRPMDVVMLAAVYLLSYLMVSSITYLSFKKPETQRRKAFQTVVGLVLMIMVLATEPR
FT                   VTLFALGLVYVLSGPLAAAYRWLKPAQPAGDEQEKEATPGEATEETAAKNIKHGG"
FT   gene            643633..645174
FT                   /locus_tag="DaAHT2_0543"
FT   CDS             643633..645174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0543"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="KEGG: pca:Pcar_1907 2-isopropylmalate synthase;
FT                   TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85249"
FT                   /db_xref="GOA:D6Z0M0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0M0"
FT                   /inference="protein motif:TFAM:TIGR00973"
FT                   /protein_id="ADH85249.1"
FT                   /translation="MSDKIFIFDTTLRDGEQSPGASMNIHEKFRLAQQLGKLNVDVIEA
FT                   GFPAASLGDFECVKNIADNVRGPQIAALARCNVKDIDTAWEALKNGENPRIHTFLATSE
FT                   IHMQHKLRMTREQVLELATASVKHAAKYTSNVEFSAEDASRSDLDFVCRVFEAVIEAGA
FT                   TTLNFPDTTGYALPEEYGAQIRYLLENIRNIDRAIISVHCHNDLGLAVANSLAAINNGA
FT                   RQVECTINGLGERAGNTAMEELVMILRTRGEQARLHTDIVTEHIFPTSRLVSTITGMPV
FT                   QPNKAIVGANAFLHESGIHQDGVLKERSTYEIMNPKDIGISTSNIILGKHSGRHALRDK
FT                   IKEMGYTDLGEEEINRVFERFKAVADLKKEMFEEDLEAIIMDEVLRVPEAFQLLHLGAM
FT                   SGSRSLPTAAVKMLVRGEEKETASLGVGPIDAAFRAIAQLAGTDSKLLYFSVSSITGGT
FT                   DAQGEVMVRIEDDGKVVVGQGADPDIITAAAKAYLTGLNRLEYLKKENKRREQKQ"
FT   gene            645171..646199
FT                   /locus_tag="DaAHT2_0544"
FT   CDS             645171..646199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0544"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="TIGRFAM: aspartate-semialdehyde dehydrogenase; KEGG:
FT                   sat:SYN_00911 aspartate-semialdehyde dehydrogenase; PFAM:
FT                   Semialdehyde dehydrogenase dimerisation region;
FT                   Semialdehyde dehydrogenase NAD - binding"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85250"
FT                   /db_xref="GOA:D6Z0M1"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0M1"
FT                   /inference="protein motif:TFAM:TIGR01296"
FT                   /protein_id="ADH85250.1"
FT                   /translation="MSNEGRKYNVAVAGATGAVGGAMLEVLERRDFPVGELRLLASSRS
FT                   VGKKLTFKGAEHPVQLLAPDAFAGIDIALFSAGGDRSLEFAPAAAAAGAVVVDNSSAFR
FT                   MDPEVPLVVPEVNPHAIAQYKNKGIIANPNCSTIQMLVALKPIHDAVKIKRIVVSTYQA
FT                   VSGSGAEAIDELEKQVRAWAAGQPLPREVYPHQIAFNCLPHIDAFLDNGYTKEEMKMVN
FT                   ETRKMFEDPTIGVTATTVRVPVFYGHSEAVNIETEKKISAAEVRELLAVAPGVKLVDEP
FT                   TLSQYPMALDCAGKFETLVGRIREDESIANGINLWVVADNILKGAALNTVQIAEIVARD
FT                   YL"
FT   gene            646429..647019
FT                   /locus_tag="DaAHT2_0545"
FT   CDS             646429..647019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0545"
FT                   /product="methyltransferase"
FT                   /note="KEGG: sfu:Sfum_3033 putative methyltransferase;
FT                   TIGRFAM: methyltransferase; PFAM: Protein of unknown
FT                   function methylase putative"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85251"
FT                   /db_xref="GOA:D6Z0M2"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0M2"
FT                   /inference="protein motif:TFAM:TIGR00095"
FT                   /protein_id="ADH85251.1"
FT                   /translation="MRIIAGRFKGRRLRAPGRRFADSLVRPTSDRAREALFNLLQGEVT
FT                   GAAVLDLFAGTGALGLEALSRGAEQALFVEGNPSVARLLRENIELCGVAEQSRLVVRDC
FT                   AFGLDFLTPLAPPAGFDLIMVDPPYDKGLAEATLARLAALPAAVFAPGAMLVVETRQQE
FT                   TLPPAAGPFQCRRDSRRYGEARFHFFNYEKGAR"
FT   gene            647016..647543
FT                   /locus_tag="DaAHT2_0546"
FT   CDS             647016..647543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0546"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="TIGRFAM: pantetheine-phosphate adenylyltransferase;
FT                   cytidyltransferase-related domain protein; KEGG: dps:DP2774
FT                   phosphopantetheine adenylyltransferase; PFAM:
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85252"
FT                   /db_xref="GOA:D6Z0M3"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0M3"
FT                   /inference="protein motif:TFAM:TIGR01510"
FT                   /protein_id="ADH85252.1"
FT                   /translation="MSDYEPLVREETNQRIAVYPGTFDPITMGHIDIIKRALTLFDRVI
FT                   VAIAVNPAKQPLFSLAERKQMIRDSFTDVNDRIEVDEVSGLLVDYAYRRGARAIVRGLR
FT                   AVSDFDYEFQLALMNRRIEREVETVFLMTGFRWIYISSSIIKDAARHGGDVGGLVPDHV
FT                   CDRLRERFMVEG"
FT   gene            647735..649909
FT                   /locus_tag="DaAHT2_0547"
FT   CDS             647735..649909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0547"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molybdopterin
FT                   oxidoreductase Fe4S4 region; molydopterin
FT                   dinucleotide-binding region; KEGG: ote:Oter_1466
FT                   molybdopterin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85253"
FT                   /db_xref="GOA:D6Z0M4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0M4"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ADH85253.1"
FT                   /translation="MSVKSGFTRRSLLQAAGVAAAALPLRSLQAGAAVPGGEAWSEERL
FT                   VPTVCGMCPAHCLVTAKVRDGRLESLTGTGDNPLNGARICARGMAAPDLLYDPDRLKYP
FT                   MKRVGPRGSGQWQRISWAEAIDVVSLRMEQALRRHGPESLALFAAGPSALYIKELFAEF
FT                   GVSRVNDSRYEHCHCNREAAYLATFGFAPGAPARLDYANTRCLVLLGSHFGENLMLPEF
FT                   RRFTAAREQGARLIVADPRRSVIAAQADRHLMLKPGSDTALLLGWINYLLQRDLFDRDY
FT                   IASHALGLDELREHAAAYPLERVAELTGLTPREIEQSARLLAASAPAVIIHPGRHSNWY
FT                   GNDVHRLRAQAILSALLGAPGRPGGMSLVGLNEPGAEVTPYARGRQRLARALQPGSKER
FT                   AEEIFRALEADQIKVLGCWGQNPFQGYPNPYRTTLAWRRAEFVFATDVLPSEACLMADI
FT                   ILPEATFLERSGRVELRDEVDPPLLTAGFPALQPAFEARDPYWIARQLSIRLGRGRGVQ
FT                   YPEASSRLEHELAPWRLRLEDLRRGQGYVALPAPPAPELDEFRFPTISGKIELVSRDLV
FT                   EAGQAPLPHFHPPPEPPEGYFRLLYGRSPLHTLSSTQNNRRLMDREGENELWLNDEVAD
FT                   RLGLGSGERVLLENQDGLTSLRTVRLYVSRDIRADAVYLVHGFGQRSHLLGRAFHQGVS
FT                   DAALMSRATANPVTGTHALRNNFVRLRKVP"
FT   gene            complement(650039..650683)
FT                   /locus_tag="DaAHT2_0548"
FT   CDS             complement(650039..650683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0548"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr9730 N-methyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85254"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0M5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85254.1"
FT                   /translation="MADHWQQPLAELDHCPHHEDEFSRCEVFINLSNRFLGLLAGEASR
FT                   DSDNDTSREYPFVAMDSRQVFRQLALTRRQLGLDREPAAGPGPSFLDVGCGIGNVMLLA
FT                   EQLGFDVYGLEKDRKPCATARKFFGPERVSAGDIWEYGDYRQFRVIYYFRPFADRTLQQ
FT                   RFERMIEDQLQPGGILIANHKNSDAISSDHRFSRLHPELPVWLKRTVHQGY"
FT   gene            651099..652907
FT                   /locus_tag="DaAHT2_0549"
FT   CDS             651099..652907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0549"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: dze:Dd1591_1251 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   Nitrate and nitrite sensing domain protein; SMART:
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85255"
FT                   /db_xref="GOA:D6Z0M6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR010910"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0M6"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADH85255.1"
FT                   /translation="MDYFRNLKIITMMQLLVFVPVTFLVGVLLFNGLERYQLYRQAQEL
FT                   RELSVVATMATEIAHQAQLERGMTAGFVGSQGRQFGGRLADQRAATDRDIEALRRFMAD
FT                   STVVQRDLAINNRLRQALANFDQLADVRRRADALTIAGPEAIAFYSNAIEGFLSTIPLI
FT                   AGVSPDQEIMRDLTAYYNFVEAKERMGVTRAVLSNVFAQDRFAEGMFQRYAELLSARAV
FT                   FLNNFQAFADGSARDYYRERMRGTAVDQVASMENRALERWQAGGFGIDATRWFDTMTAK
FT                   IDLMKDVETRLAEGIQELAGERIAHARAALIGGVLSAAAVVALLLYLARFFSLLLIRKL
FT                   EDVSDQLSAGAGQVSAASEEVSSASHSLADGANNQAAAIEETSASLEEIASMTKQNADN
FT                   VGQADILVNEARQVVESANQSMHQLTDSMAEISRASEETSKIIKTIDEIAFQTNLLALN
FT                   AAVEAARAGEAGAGFAVVADEVRNLAMRASEAARNTATLIEGTVSKIQAGSQLVGATDT
FT                   SFNQVAESIVKISSLMGEIAAASREQSAGVEQINNGVAEMDSVTQQNAAAAEEAASAAE
FT                   ELNGQAEQMKEMVDVLTALVKGREQS"
FT   gene            complement(652933..653973)
FT                   /locus_tag="DaAHT2_0550"
FT   CDS             complement(652933..653973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0550"
FT                   /product="molybdopterin binding domain protein"
FT                   /note="PFAM: molybdopterin binding domain; KEGG:
FT                   mta:Moth_0932 molybdopterin binding domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85256"
FT                   /db_xref="GOA:D6Z0M7"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0M7"
FT                   /inference="protein motif:PFAM:PF00994"
FT                   /protein_id="ADH85256.1"
FT                   /translation="MAKTVPVAQAVGMVLPHDITEIRQGEFKGRAFRKGHIIRAEDIEH
FT                   LKRLGKEHVYILELGHDEIHEDEAAQKLAAALAGSGIMSGGEPVEGKIGLCAAHDGLLR
FT                   VDQEALYRFNLLGEVMCATLHHNTQVKAGQQVAATRLIPLVGKRQVVDEAVALADNQGL
FT                   GAVRVEPLRTAAAGLVITGNEVYHGRIKDAFEPVLREKLAALGSEVIAVRKAPDDAAQI
FT                   AAAIGDCLAAGADLIVTSGGMSVDPDDVTREGIARAGTREIAYGTPVLPGAMFLVGYLA
FT                   HQGKEIPVLGLPACGMFHRTTVFDLLLPRILVGEKIDRRALARMGHGGLCLNCKHCLYP
FT                   VCPFGK"
FT   gene            complement(654033..654617)
FT                   /locus_tag="DaAHT2_0551"
FT   CDS             complement(654033..654617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0551"
FT                   /product="formylmethanofuran dehydrogenase subunit E
FT                   region"
FT                   /note="PFAM: formylmethanofuran dehydrogenase subunit E
FT                   region; KEGG: aba:Acid345_0503 formylmethanofuran
FT                   dehydrogenase, subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85257"
FT                   /db_xref="GOA:D6Z0M8"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0M8"
FT                   /inference="protein motif:PFAM:PF02663"
FT                   /protein_id="ADH85257.1"
FT                   /translation="MESFEQLLEKSTTVHGHICAGQVIGVRLAMIGLREIGIDDPRGSQ
FT                   RKDFYVVVEIDRCATDAIQSVTGCTLGKRSLKWLDYGIMAATFINLKTSQAVRITAREE
FT                   ARELARHYCPEIEDRYQQQLQAYRVMPEEELFTIQRVAVEVPAADLPGKPLRRVQCQQC
FT                   HDWVQDCREVEQNGKILCRPCATGRYYRIIE"
FT   gene            complement(655238..656764)
FT                   /locus_tag="DaAHT2_0552"
FT   CDS             complement(655238..656764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0552"
FT                   /product="sigma54 specific transcriptional regulator with
FT                   PAS/PAC sensor, Fis family"
FT                   /note="KEGG: dal:Dalk_4043 sigma54 specific transcriptional
FT                   regulator with PAS/PAC sensor, Fis family; PFAM: sigma-54
FT                   factor interaction domain-containing protein;
FT                   helix-turn-helix Fis-type; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85258"
FT                   /db_xref="GOA:D6Z0M9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0M9"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADH85258.1"
FT                   /translation="MFQLLDCSPLPQFAVGLDNKITYWNKACEALTGFKAAEMIGTDRH
FT                   WEPFYSHKRPIVADLVLNNDRNSFFHLYQDKNPGQSRIIPNAWEAFDWFRMCGQPLHLH
FT                   FMAAPVFNEQGKLVGAVETLHDLSGRMLALLAPSEHTAPGADGRGRSTNLLRHNIRFGL
FT                   LVGNSPAMQRVYDVLAKAAGSNANVIIYGESGTGKEVVARTIHDLSHRAKKNFVAVNCG
FT                   AIPETLAESEFFGYRKGAFTGAGTDREGYLDQADGGTLFLDEIGEISLAMQVKLLRVLE
FT                   GNGFCPVGSRETRKPDVRIIGATSRDMEQLVREGRIRRDFFYRIHVIPVQLPPLRDRKE
FT                   DLRALTDHFINKFSPDHQELSLSEEIYQRLEQYPWPGNVRELQNVIQRYLTLGELVFTP
FT                   TGPGSPGNGPEPPIAPPHNSLPGAAVGQSSLNIPEAMAPPASSPEIASVNTNPVALLRN
FT                   HGGLEGMISTIERELIRQALESNQWHRENTAMMLDISRKTLFRKMRQFNL"
FT   gene            656928..658541
FT                   /locus_tag="DaAHT2_0553"
FT   CDS             656928..658541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0553"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: sfu:Sfum_1087
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85259"
FT                   /db_xref="GOA:D6Z0N0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0N0"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADH85259.1"
FT                   /translation="MDANSPADYFVTPAAIPKAHRPGPVLEQRHYLCNGELRCWDGPVH
FT                   DVFSPVYLASAAGSPAPLRLGSHPLLGSREAEAMLEAACNAYDRGCGEWPSMSPSQRLA
FT                   RVEQLLAGLEKCRQEVVRSLMWEIGKSREESEMEFSRTLEYLAETAVEIRRRSREEEGL
FT                   LRQQGVIARRLRAPVGVALCLGPYNNPFYETYTTLIPLLLMGNTVIFKPPRLGVLLHRF
FT                   ILPLLQECFPPGVVNSLYGEGEAVLAPVLRSGRIDLLAFIGSRRGAELLRSWHPTPGRL
FT                   RCLLGMEAKNAAIILADADLEQAAAECALGALAFNGQRCTALKILLVQHSITLPFLEQL
FT                   SREVQRQPIGMPWLPGVRITPLPEPARVAYLGELLADALSKGARIINPGGGEIRETLMT
FT                   PAVLYPVGPGMRLYHEEQFGPLIPVASFETLEEARRYVAESEFGQQVSVFGQDEEQLAA
FT                   VSRSLLNQVCRININSKCQRGPDGFPFTARRNSAEGTMSVAETLDACSITSLVAGRDTP
FT                   GNQRILAASTYANSCAKSYD"
FT   gene            complement(658563..658763)
FT                   /locus_tag="DaAHT2_0554"
FT   CDS             complement(658563..658763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0554"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: dsa:Desal_1558 heavy metal transport/detoxification
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85260"
FT                   /db_xref="GOA:D6Z0N1"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0N1"
FT                   /inference="protein motif:PFAM:PF00403"
FT                   /protein_id="ADH85260.1"
FT                   /translation="MASIKIKGMTCAHCVASVTKALSSINGIEDVHVSLSENQADFSMT
FT                   KEVPRATIKAAIEKIGFEVDE"
FT   gene            complement(658825..660033)
FT                   /locus_tag="DaAHT2_0555"
FT   CDS             complement(658825..660033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0555"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase"
FT                   /EC_number="6.3.2.5"
FT                   /note="TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; KEGG:
FT                   dps:DP1673 DNA/pantothenate metabolism flavoprotein; PFAM:
FT                   DNA/pantothenate metabolism flavoprotein domain protein;
FT                   flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85261"
FT                   /db_xref="GOA:D6Z0N2"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0N2"
FT                   /inference="protein motif:TFAM:TIGR00521"
FT                   /protein_id="ADH85261.1"
FT                   /translation="MSFLLNDKRILLGVSGGIAAYKVADWVRQLRREGAEVTVMMTDAA
FT                   QSFVTPLTFAALSGKRVHTTMLAAADGEYLPHINLGRDHDLILLAPATANTIARLARGQ
FT                   ADELVSTVVLAARAKVLLCPAMNSEMYRHPATRQNLGLLQEYGYTIIEPDSGELACGDQ
FT                   GPGRLAEWETVRQEVIAALTPQDLQGRNILVTAGPTWEPLDPVRLLTNRSSGKMGYALA
FT                   AAARRRGANVTLVSGPGSIRPPAGVELIPVVTANEMHQAVCQRVDATDIMIMAAAVSDY
FT                   RPARHEPHKIKKGATDASLALVSNPDILRELGERKKTATCFPLLVGFAAESENHLEEGQ
FT                   RKLTSKNLDLIAINDIGAEDAGFAVDNNRVTLLDRNGAVEELPLLSKEEVAHRILNNIL
FT                   RLT"
FT   gene            complement(660063..660608)
FT                   /locus_tag="DaAHT2_0556"
FT   CDS             complement(660063..660608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP2176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85262"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0N3"
FT                   /inference="similar to AA sequence:KEGG:DP2176"
FT                   /protein_id="ADH85262.1"
FT                   /translation="MFKQTVPFAKSYLALLACIFLLFLLAGCTQHQNAGPEDREKREAV
FT                   QERRPDPYTPSGFRDLLIPAELTWLREKSMVVHTDSYAGGVLHFSGRVDVNSLTDFFTT
FT                   TMRRNNWQLVGSVKYQDVMLAFTKPHKTCTIIINDRGLGRATEVQVYITDDLSKSRQGD
FT                   TVAPAPVAPAAPATPFSF"
FT   sig_peptide     complement(660504..660608)
FT                   /locus_tag="DaAHT2_0556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.837 at
FT                   residue 35"
FT   gene            complement(660637..661146)
FT                   /locus_tag="DaAHT2_0557"
FT   CDS             complement(660637..661146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0557"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: gme:Gmet_1074
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85263"
FT                   /db_xref="GOA:D6Z0N4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0N4"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADH85263.1"
FT                   /translation="MHNPVLEAIYRRRSVREFTPEEVSPDELQEIVRAGIWAPSGLNNQ
FT                   PWRFVLIRAEETRARLAELTKYSRIVLAAPALIAVFLDQGAMYDPVKDQQAAGACIQNM
FT                   LLAAEALGLGAVWLGQILHNKDKVRQELDLDDHLDLMAVIALGRPEPKDRRSQRKPLED
FT                   FILKSI"
FT   gene            661445..662278
FT                   /locus_tag="DaAHT2_0558"
FT   CDS             661445..662278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0558"
FT                   /product="hydrolase, TatD family"
FT                   /note="KEGG: dps:DP2779 hypothetical protein; TIGRFAM:
FT                   hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85264"
FT                   /db_xref="GOA:D6Z0N5"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0N5"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ADH85264.1"
FT                   /translation="MAATNQAAEGLAEGLAEGLIDTHCHLDFPDYQADLEQVVGRAAQA
FT                   GVRQMISVGIDLATSRKAVELAGQWPGVYATVGVHPHHVKEIGADDYRALQELAGHPRV
FT                   VAYGEIGLDYVKEYSPAALQREHFARQVEIARQLALPLIIHDREAHADTLAILRAAGEL
FT                   PAGGVMHCFSGDAALAQEVLALGFYISIPGVVTFKSAAGLAEAVRQVPLERLLLETDAP
FT                   FLAPVPLRGKRNEPAYLTHIAAKVAELKGCEPAEVARQTTANARHLFALPEAGAC"
FT   gene            662278..663030
FT                   /locus_tag="DaAHT2_0559"
FT   CDS             662278..663030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0559"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   dps:DP2780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85265"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0N6"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ADH85265.1"
FT                   /translation="MTDIGANLAAVKARIAAAARRSGRDPASVRLVAVSKRVEAERIVT
FT                   AVAAGQRLFGENYLQEAQAKISRVNELLAGPEAGPEASLDPTGKAEVSWHFIGHLQSNK
FT                   AKAAATTDFTMVETIDRLKLARALDRHAAAAGRLLPVLVQVNVGGEAQKAGVMPEQAPE
FT                   LLRSLAELPALRVMGLMTMPPMAAHPEESRPHFARLRQLAEEFARQGLLGAHGSPLLSM
FT                   GMSADFEVAVEEGANLVRVGTAIFGPRQ"
FT   gene            complement(663066..663332)
FT                   /locus_tag="DaAHT2_0560"
FT   CDS             complement(663066..663332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:663252..663254,aa:Sec)
FT                   /locus_tag="DaAHT2_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains selenocysteine; TIGRFAM: conserved
FT                   hypothetical protein; KEGG: sai:Saci_0387 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85266"
FT                   /db_xref="GOA:D6Z0N7"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0N7"
FT                   /inference="protein motif:TFAM:TIGR02174"
FT                   /protein_id="ADH85266.1"
FT                   /translation="MVNLIKIGNHVKKEKKMKVEITYCSKUNYLPRASGLEAEIKQNFP
FT                   QATVELSAGSNGIYDIKVDGRQIFSKHQSGRFPDNQEIIALLK"
FT   gene            663397..665277
FT                   /locus_tag="DaAHT2_0561"
FT   CDS             663397..665277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0561"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: dps:DP0847 hypothetical protein; PFAM: Radical
FT                   SAM domain protein; Radical SAM domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85267"
FT                   /db_xref="GOA:D6Z0N8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0N8"
FT                   /inference="protein motif:PFAM:PF08497"
FT                   /protein_id="ADH85267.1"
FT                   /translation="MRKNATPGSKLPLLPATASEMHQRGWETVDVVLVSGDAYIDHPSF
FT                   GLALIGRWLEAHGYRVAILAQPRYDRPDDFLRFGRPRLFFGISAGNLDSIVANYTGNVK
FT                   VRDRDDYSPDGNPYFGGQAQRRFRRRPDRATIIYAQQARRACGQVPIILGGLEASLRRF
FT                   VHYDYQQRKLRASVLTDAKADLLVYGMGERAVLEVARRLEAGEHLHGIAGTCERLTPAQ
FT                   LVARGYDESMPARASAPDPERAGPAHFKVLPGYEQIMVDKSHFLAAEREIDRQARARQP
FT                   AMLLQRQQAQWLLQHPPAAPLRPEELDRLYALPYARRPHPQAGRVPAFTMVRDSVTIVR
FT                   GCCGNCAFCAITRHQGGRVVSRSRESIIAEVAQIAQAPDFRGTITDLGGPTANLYGCSC
FT                   SRRKEGCSRRDCLYPDVCRELRIDEDTLLELLQAAAAVAGVRHLLVSSGLRMELLLKTP
FT                   RLLRRLLEHHTPGTLKIAPEHTEPEVLRLMHKPDGSVLEKFVQTFNRLAAELARRSEKK
FT                   PPTLNPYLISAHPGCTMAHMEEMVRKLQKLNLVPRQFQDFTPTPGTLATAIYVSGLDPA
FT                   SGRPVHVPKGDQERRRQRLVLEQVTKSSAKPGRAARPASRRKAPATKPKR"
FT   gene            665348..665911
FT                   /locus_tag="DaAHT2_0562"
FT   CDS             665348..665911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0562"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG:
FT                   aba:Acid345_0669 isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85268"
FT                   /db_xref="GOA:D6Z0N9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0N9"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADH85268.1"
FT                   /translation="MAPELYHLQPRNCALLVVDIQENLMKVIPARDEVARNAALLIKAA
FT                   RALEIPILATTQYAHRIGDFVPEVKAELAGVTILDKLEFGCFNNQAIREAVKTLGTSVD
FT                   TLIVCGVETHICVYQTVLGALRHDYRVWVPADAVASRAAKNYETGLARLREIGAVVANS
FT                   EMIIYDWLHKAGTPVFKELLPALK"
FT   gene            666107..667723
FT                   /locus_tag="DaAHT2_0563"
FT   CDS             666107..667723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0563"
FT                   /product="putative chemotaxis phosphatase, CheZ"
FT                   /note="KEGG: pin:Ping_0445 colicin uptake-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85269"
FT                   /db_xref="GOA:D6Z0P0"
FT                   /db_xref="InterPro:IPR007439"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0P0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH85269.1"
FT                   /translation="MAERRAEINLEVSTGFFRISTDDLVYNITVLPGPAGESASAPGGG
FT                   QVAAPVPSCPPPPPPEFVGPGDDYYKQISTDVYNEIGNLAKSLSSTLQDLPAEDRKIQR
FT                   ADLDEAGEKIEDAKNQLRDIVSMTEQATMEIMDHVEKVQHQTDDVRDLLAQLKDHKAFL
FT                   QQQINAAENGGGGEEAAGVLAEKLDLLEEKLAKAEELLAGLGSAEGESAAAAAAEAAEE
FT                   PAAPEPAESVSAGEPRRRFLFELDTVFQTIYELCTNEQVKGHISIAREKAAEIFDYDAF
FT                   VEAISGRVAELEPDDDNFYTVPLSDVLKSLATACLEKKIQNLLVKMEANQGEIFLDSAL
FT                   PLEVPAIEEVGGGDGAAEPAPAADAAAAEAPPEAGSGKTIGAEVAPVREVLAEATAMIG
FT                   DLRQGLHDLSVGNAAGGMSKEDQLDIFHKIENAFSVVSSIYEDVARITEALSFQDLSGQ
FT                   QILKIIKLLSDFQVQLLAIVVSFGSQLKIKERNADITPEESKRLAQDDVDRYLKTMTGE
FT                   HETEGPLDQDTVNKMLEEFGF"
FT   gene            complement(667720..668607)
FT                   /locus_tag="DaAHT2_0564"
FT   CDS             complement(667720..668607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0564"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cpc:Cpar_1398 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85270"
FT                   /db_xref="GOA:D6Z0P1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022525"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0P1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH85270.1"
FT                   /translation="MMNNLNVTADRPAVTTADQTMTLGRSLVQHGRASDRVYLMAVADQ
FT                   DMPDLLTTLDELARENRYGKIFAKVPARWRRQCVAAGYRVEAEVPGFYGGEENGLFLGK
FT                   YLEKERRKTSEDADIQAVLELCRRAAEAPTQPGVAGENGSYQTRLCTRADTPAMAELFR
FT                   RVFSSYPFPVHDPAFLRQTMNQQVVYAGAWQGEELAALASAEFSPQAAHAEMTDFATAP
FT                   EHRRRQLAGRLLSKLEQEMSTRGIRVAYTIARAVSAGVNLTFAKAGYRHAGTLINNTQI
FT                   CGRIESMNIWYRRL"
FT   gene            complement(668597..669928)
FT                   /locus_tag="DaAHT2_0565"
FT   CDS             complement(668597..669928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0565"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number="5.4.3.2"
FT                   /note="TIGRFAM: lysine 2,3-aminomutase YodO family protein;
FT                   KEGG: drt:Dret_0696 lysine 2,3-aminomutase YodO family
FT                   protein; PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85271"
FT                   /db_xref="GOA:D6Z0P2"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022459"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0P2"
FT                   /inference="protein motif:TFAM:TIGR00238"
FT                   /protein_id="ADH85271.1"
FT                   /translation="MYAPPNSDHQQANAKNARAGMTSTPEQWEDWHWHLRHTIKSIDTV
FT                   ERLLNTTFSPEKRRELEETIARFPMAITPHYFSLIDRENYEEDPVFRQSVPSLSELKIG
FT                   ASEHSDPLAEDQDSPVTGITHRYPDRVLFHVSNLCAMYCRHCTRKRKVGDVDSVPGKKT
FT                   LAAGLDYIRQTPAIRDVLLSGGDPFLLGDDLIDWLLTELRAIEHVEVIRIGTRTPVVLP
FT                   QRITPRLVEILKKHHPLWVNTHFNHPREITSRSRRALAMLADAGIPLGNQSVLLAGVND
FT                   CPRVIKRLVHKLVANRVRPYYLYQCDLSEGLASFRTPVGKGIEIIESLIGHTSGFAVPT
FT                   YVIDAPGGGGKIPVMPNYLISWSTNKVVLRNFEGVITTYKEPDSYQPIFCDRNCNDCHL
FT                   DLPLENTEEQENTIGISGLLADYEEAITLVPENNERMERRDDDE"
FT   gene            670571..671692
FT                   /locus_tag="DaAHT2_0566"
FT   CDS             670571..671692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DaAHT2_0566"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: hmo:HM1_1947 hypothetical protein; PFAM:
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:DaAHT2_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADH85272"
FT                   /db_xref="GOA:D6Z0P3"
FT                   /db_xref="InterPro:IPR005244"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022432"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z0P3"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADH85272.1"
FT                   /translation="MPTMMEKLFA