Dbfetch

ID   CP001732; SV 1; circular; genomic DNA; STD; PRO; 26615 BP.
XX
AC   CP001732;
XX
PR   Project:PRJNA18803;
XX
DT   25-JAN-2010 (Rel. 103, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Sulfolobus islandicus L.D.8.5 plasmid pLD8501, complete sequence.
XX
KW   .
XX
OS   Sulfolobus islandicus L.D.8.5
OC   Archaea; Crenarchaeota; Thermoprotei; Sulfolobales; Sulfolobaceae;
OC   Sulfolobus.
OG   Plasmid pLD8501
XX
RN   [1]
RP   1-26615
RG   US DOE Joint Genome Institute
RA   Reno M.L., Held N.L., Fields C.J., Burke P.V., Whitaker R.J.;
RT   "Contemporary genome evolution in thermophilic Archaea";
RL   Unpublished.
XX
RN   [2]
RP   1-26615
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Bruce D., Goodwin L., Land M., Whitaker R.J.,
RA   Richardson P.;
RT   ;
RL   Submitted (03-SEP-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 126af83e887563ee2fdee4527bdf4245.
DR   BioSample; SAMN02598413.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4023472
CC   Source DNA and organism available from Rachel Whitaker
CC   (rwhitaker@life.uiuc.edu)
CC   Contacts: Rachel Whitaker (rwhitaker@life.uiuc.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Sulfolobus islandicus  L.D.8.5
CC   GOLD Stamp ID         :: Gi01317
CC   Isolation Site        :: Lassen National Park in California
CC   Isolation Country     :: USA
CC   Latitude              :: "4,049,703"
CC   Longitude             :: "-12,142,752"
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Coccus-shaped
CC   Motility              :: Nonmotile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Hyperthermophile
CC   Temperature Optimum   :: 75 - 85C
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Fresh water
CC   Phenotypes            :: Acidophile
CC   Energy Source         :: Lithotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..26615
FT                   /organism="Sulfolobus islandicus L.D.8.5"
FT                   /plasmid="pLD8501"
FT                   /strain="L.D.8.5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:425944"
FT   gene            2734..3297
FT                   /locus_tag="LD85_3131"
FT   CDS             2734..3297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3131"
FT                   /product="hypothetica protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3131"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88722"
FT                   /db_xref="GOA:D2PK89"
FT                   /db_xref="UniProtKB/TrEMBL:D2PK89"
FT                   /protein_id="ADB88722.1"
FT                   /translation="MARLREETVGWLYTVSGLDEKSFPLGLKNVNMKELAVIFPLLMLG
FT                   ISFAFKNIMIAMAFIAPVFFFIFYEEKSMDEFQYVYHFMKFYLNDFLAPKEKKEKSKEK
FT                   NKKENKKLTVRPKTSVIDYGFIASGALMMLISFHEFLDVIEMKIALGFLESMVYILMFA
FT                   AGVGILGGEIAYIILEFTTKKISK"
FT   gene            complement(3299..3457)
FT                   /locus_tag="LD85_3132"
FT   CDS             complement(3299..3457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3132"
FT                   /product="conserved conjugative plasmid protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3132"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88723"
FT                   /db_xref="UniProtKB/TrEMBL:D2PK90"
FT                   /protein_id="ADB88723.1"
FT                   /translation="MPYIVRVKDPEQIGQLAKKYRKFQMELTIYLNDPQAVGGLKSKRK
FT                   VDVIKID"
FT   gene            complement(3597..4481)
FT                   /locus_tag="LD85_3133"
FT   CDS             complement(3597..4481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3133"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3133"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88724"
FT                   /db_xref="UniProtKB/TrEMBL:D2PK91"
FT                   /protein_id="ADB88724.1"
FT                   /translation="MSEKETFFLDTNIVIKWLYREILNENPAVEYFINSLSEGQCVILH
FT                   INLSEFEAIIYDAYNITSHVIYEKILSRQDWDKLGVEDKLRVLEDIRKNFEQIYEQILT
FT                   KYYKGQILPGGIRRILAKGFFIRLEDKLLNSNLEALRNHITLNERTQDLIDYLAIAEYL
FT                   IKQKCTVIDDTKILFSDNTIREIQLIYEGINAYIRNLKSKGYNKTPSRNDQIIFVYLFL
FT                   LLRGRIYDKIVFITDDNDFERMHNTVLNHLKDIINGNADLRGDFKEYAIEAYDILRKLV
FT                   IKGINDLITQQKR"
FT   gene            complement(4474..5178)
FT                   /locus_tag="LD85_3134"
FT   CDS             complement(4474..5178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3134"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88725"
FT                   /db_xref="GOA:D2PK92"
FT                   /db_xref="UniProtKB/TrEMBL:D2PK92"
FT                   /protein_id="ADB88725.1"
FT                   /translation="MSVGLSLVLEEYYKVPNEMKNRNFPVHRLEKMRDYLVKQYEENLF
FT                   EIYEGMLTLILNPEDENKLKILSKETEKIKEDFELYNSILENNTTIGEYVKMVMNELQK
FT                   LIDGLKENEEKFYKEVLNSDNPNFLITTYYSLYLRFVTTVYLKLHKTNITNPNIKTKDS
FT                   RIKDIFNIANFLVGFFGIPILIYIKKKEVFPYISELSGALLHALVADRTPMPSKDSLGY
FT                   YLFSRSTLITHE"
FT   gene            5377..5796
FT                   /locus_tag="LD85_3135"
FT   CDS             5377..5796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3135"
FT                   /product="conserved conjugative plasmid protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3135"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88726"
FT                   /db_xref="UniProtKB/TrEMBL:D2PK93"
FT                   /protein_id="ADB88726.1"
FT                   /translation="MGIIDKVKKNVTDVISTSEHRLTGRPPVKGKFMVNIPKALVVEDW
FT                   YWDDEGIFTLEKRPGLLSPGMRKGKIIRWEEIDDIIPLNVSQTSNYSAFGLSGETNIIG
FT                   DWIIKKKDGTTVTIKYVIDPINRANAFKKIYLNKK"
FT   gene            complement(5804..7237)
FT                   /locus_tag="LD85_3136"
FT   CDS             complement(5804..7237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3136"
FT                   /product="conserved conjugative plasmid membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3136"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88727"
FT                   /db_xref="GOA:D2PK94"
FT                   /db_xref="UniProtKB/TrEMBL:D2PK94"
FT                   /protein_id="ADB88727.1"
FT                   /translation="MRKALTILLIILVLPSLLSGVGNIIVMAQGGGGGGSNNLGQFIAT
FT                   LQTLIPAALILLAILANRYDQRYALVLFAAALASAIFLAAATGGKIGGNVQITLVQLQV
FT                   TVSGPTSAYTGQTEYYSVSYSPSVPNPIVVWQIYANGTLVANFTGSTEMSYVFQSPGKY
FT                   LVVAIVEDPQNYAYGSNGLLVSVTNPPGPLGWIQGAIEGSLESFFGAIANGIEGLVTTF
FT                   LQFIGYPLEQMVESPIPGSFDKQLFNEVYDYSVGLAMLFIAFSIAYNAFQGFYSDIIDL
FT                   AGDVMYKLSVWALFAVGGITIYTYAASFINSLIYATVGPELGIASVGLAAGTGLYLAIG
FT                   GGLAAIPFFANDFDYLISAILYLMLFTTAIATVRNSVMLAIVALIPFQATLWLFEWTRK
FT                   IALIMANLLIGMMVAGLVAAFTIALLVHTVFGFLLLFLLPLALDVEFISTLALFVFTLQ
FT                   PGDVLVSKVHSALKQKLRE"
FT   gene            7275..7788
FT                   /pseudo
FT                   /locus_tag="LD85_3137"
FT   gene            complement(9145..10089)
FT                   /locus_tag="LD85_3138"
FT   CDS             complement(9145..10089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3138"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88728"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PK95"
FT                   /protein_id="ADB88728.1"
FT                   /translation="MNGKVIAIHNFKGGVGKTTLTAVLGMGLAVNYRVLLIDFDPQMSL
FT                   TQIFVKEERRKEILQQSIRPESDRSAYALIREISDVIVENFIHVSKTSRGEVKVSLDII
FT                   PGSYVSTFHAMFKGYFPMFDEFAVKKELDNFREKYDFILIDTSPSDVVTIKPVLRASDY
FT                   LIIPEDGTIEAFNAMLIFLKEALPKYIWSSFDNPRVLGSVLTKVRRNSTKLLLEHNKLL
FT                   LNEISENTEVMSHIYDPPYFGANDDHPEDFILSSNKEYLSDLIWRNESIPPIGEVFDKL
FT                   FLVSEKLQPDLYSYFYKVFYRLPSEVVRRVREW"
FT   gene            complement(10086..11429)
FT                   /locus_tag="LD85_3139"
FT   CDS             complement(10086..11429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3139"
FT                   /product="ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3139"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88729"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:D2PK96"
FT                   /protein_id="ADB88729.1"
FT                   /translation="MSKLKEYKEIPIEEIKEVDEFKTFIPENNMYDKIKEDIAKNGIKV
FT                   PLIVNQNYELINGYTRLKIARELGIKKVPVAVYETTDRADEYDLLVSTNLTQRQLSKAQ
FT                   ALALIEKAVEEKTKILKKNQNSENNPKETKVERPGVQLSATESKKIQNLTDLRNAVKEE
FT                   LKKYNVKVDDRALDYYIRIKENAPWLTDYILKGKIGIKPAYSIYTKLQEMGLLEAVAKL
FT                   PPYERNTLLTDGRKIILDERKDLLEEIVNHRMAVSQAINKLKTEEKLKRTKGSKPRTKE
FT                   DLEEEEELEEEAESTEGEDSESDEEYDLVGEWKKANEEEEKEEEAKQQLTPQFNTEVHS
FT                   PAEEITRINHEKWLQTVAKLKEEMLSNCPEIKQLYEEKKLDEEAILTMVEVWRNFQIAF
FT                   KNLSINWHNVAEPLLSSHLNRQQLEELFYKFVKGNMRLYPKEEFGVVK"
FT   gene            complement(11426..11710)
FT                   /locus_tag="LD85_3140"
FT   CDS             complement(11426..11710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3140"
FT                   /product="transcriptional regulator TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3140"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88730"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PK97"
FT                   /protein_id="ADB88730.1"
FT                   /translation="MLDSLSNEVKILLTLIDGKSKSRRQISKETNIPYQTVANVIARLV
FT                   EYGFVELEKIEDNEKFYKITEKGLKELSESVSKEREELEKLLKIAGVVQ"
FT   gene            11818..12096
FT                   /locus_tag="LD85_3141"
FT   CDS             11818..12096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3141"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3141"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88731"
FT                   /db_xref="GOA:D2PK98"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PK98"
FT                   /protein_id="ADB88731.1"
FT                   /translation="MDYTLSETAQKLLVALLKKDGVTIRELIDLAEVNNTPALRALEEL
FT                   QKYKLIREERETTFPRRRLIYLTDDGKYVATRIKEIMEVLVKNHPPI"
FT   gene            12186..12536
FT                   /locus_tag="LD85_3142"
FT   CDS             12186..12536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3142"
FT                   /product="zinc finger, SWIM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3142"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88732"
FT                   /db_xref="GOA:D2PK99"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:D2PK99"
FT                   /protein_id="ADB88732.1"
FT                   /translation="MFFVIVFRTNMISTQIPSKSYVKRLDVFYVLSEGVVVAGDVESKS
FT                   RKGLLHYTRIVLDPVTMKITKASCDCEAGAFGKKCWHVKTLEELVKTDLKKEVEKVREE
FT                   MLAVEEDIASWG"
FT   gene            12527..12724
FT                   /locus_tag="LD85_3143"
FT   CDS             12527..12724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3143"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3143"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88733"
FT                   /db_xref="UniProtKB/TrEMBL:D2PKA0"
FT                   /protein_id="ADB88733.1"
FT                   /translation="MGLRIMQVQLQGDKLLELLEALYHINEAMKIMEGYNSEILDKLEE
FT                   ARNSLVQYLIQHYLEVKDYE"
FT   gene            12717..12899
FT                   /locus_tag="LD85_3144"
FT   CDS             12717..12899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3144"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3144"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88734"
FT                   /db_xref="UniProtKB/TrEMBL:D2PKA1"
FT                   /protein_id="ADB88734.1"
FT                   /translation="MSEVLQTQRNLEELVKLLKIYFQLDEIVDFAINELDDDEIVVEIT
FT                   AVKDRIRKVIEKLIS"
FT   gene            complement(12856..13920)
FT                   /locus_tag="LD85_3145"
FT   CDS             complement(12856..13920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3145"
FT                   /product="ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3145"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88735"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:D2PKA2"
FT                   /protein_id="ADB88735.1"
FT                   /translation="MARFITIIKVSIDNIKEVPEYKELIPENNSYEELKKSIQQLGFLD
FT                   PITVNKNYEILDGYTRYRIAKELGIKEIPVEIYETSGREEELDIVASFNLKRRHLSKDE
FT                   IIAIIDRIAEKKKALKTQTTEKTNELKKDNLDEQNTSTSASILQTDINKKSTTQESREI
FT                   KEELKRLAPDVQINDETIRKYLQIKKDVPWLVQYIGDEKKDKIGIRKAYDIYLLLKEKN
FT                   LLDLDKRIPKPELSKLITDKNGRKVLERDDLLQLILDHKMAVSQAINKIKTEEKLQRSK
FT                   KKPRTKEDLEEEEELEEEAESTEGEDSESDEYPFVEEWAQAQKEEEAKQQLTPQFNKKN
FT                   SNLSTSQSLSLSCP"
FT   gene            complement(13920..14216)
FT                   /locus_tag="LD85_3146"
FT   CDS             complement(13920..14216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3146"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88736"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:D2PKA3"
FT                   /protein_id="ADB88736.1"
FT                   /translation="MIKRDKFISNKNVSNIEMSKNLYPIHYLEVLKEIEKGEKSFTELR
FT                   ERTKLDRNKLWRALTRLQLDGLIQKVGEGRNEKYRITEKGREYLKQLKELVTA"
FT   gene            14267..14785
FT                   /locus_tag="LD85_3147"
FT   CDS             14267..14785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3147"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3147"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88737"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PKA4"
FT                   /protein_id="ADB88737.1"
FT                   /translation="MSKKFETYAEEFFSTHERMLIALCEEDGITVRELINRSKISSSAY
FT                   RSPLDFLIKIGLVKIEKGGEKKMMVKLTNNGREICKKLQELYEILKNMKPTIEIYPGLS
FT                   LPIDELEKLVDKYLIIGGTPPRIMAVANDDEEARNKFLDLSEKADLNRETDFPKAIIFL
FT                   TRDMLKPYL"
FT   gene            complement(14776..15048)
FT                   /locus_tag="LD85_3148"
FT   CDS             complement(14776..15048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3148"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88738"
FT                   /db_xref="UniProtKB/TrEMBL:D2PKA5"
FT                   /protein_id="ADB88738.1"
FT                   /translation="MESKQVEKEVVFVSKVSVTKSKKNGKEYVTYRITIPMDKAKELEL
FT                   DDGDYLLIKAKKAKWYHLLNWEEMKNVYNMLPEEIKREVDELNHK"
FT   gene            15111..15392
FT                   /locus_tag="LD85_3149"
FT   CDS             15111..15392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3149"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88739"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PKA6"
FT                   /protein_id="ADB88739.1"
FT                   /translation="MAKCSIETLNAILVAVFDATNGSLSAHVPLEAVLRRFPGHLRGDV
FT                   RRCIKELIKRGLLTLHPTRGSTTYQLTQRGLECATKLTKGEISSIEEC"
FT   gene            15386..15784
FT                   /locus_tag="LD85_3150"
FT   CDS             15386..15784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3150"
FT                   /product="zinc finger, SWIM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3150"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88740"
FT                   /db_xref="GOA:D2PKA7"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:D2PKA7"
FT                   /protein_id="ADB88740.1"
FT                   /translation="MLIVSIFETEKFLNGYVYIVSRYKMISTQIPSKSYVKRLDVFYVL
FT                   SEGVVVAGDVESKSRKGLLHYTRIVLDPVTMKITKASCDCEGFTFRGKCWHIETLKQLV
FT                   VSDERVREEVMKAKEELMRIEEDIASWG"
FT   gene            15775..15972
FT                   /locus_tag="LD85_3151"
FT   CDS             15775..15972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3151"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88741"
FT                   /db_xref="UniProtKB/TrEMBL:D2PKA0"
FT                   /protein_id="ADB88741.1"
FT                   /translation="MGLRIMQVQLQGDKLLELLEALYHINEAMKIMEGYNSEILDKLEE
FT                   ARNSLVQYLIQHYLEVKDYE"
FT   gene            15965..16147
FT                   /locus_tag="LD85_3152"
FT   CDS             15965..16147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3152"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3152"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88742"
FT                   /db_xref="UniProtKB/TrEMBL:D2PKA9"
FT                   /protein_id="ADB88742.1"
FT                   /translation="MSEVLQTQRNLEELVKLLRIYFQLDEILSFATFELEDNEVVAEIS
FT                   AVKDRVRKVIEKLIS"
FT   gene            16238..18109
FT                   /locus_tag="LD85_3153"
FT   CDS             16238..18109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3153"
FT                   /product="AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3153"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88743"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2PKB0"
FT                   /protein_id="ADB88743.1"
FT                   /translation="MSFLNIFKKSNQQVAKSKTKYYRLEGIPFFLLSPEDRDMKMKELS
FT                   ALLSQAEKGYIYISRKQDTYEFEGIKFPIINSNFQLITEKELDLETSEPPKRPAIKKEY
FT                   AKYLQTTEGYARVLVSYAYSTKIYEGVLGRIDFKSLRPELFELVVQFQKISPLSVRNYL
FT                   NSLEVKKQKMARYASSSVQVEEMLVRGAQLKKDLDEEAADPLKFRFIFIIHAKTTQELE
FT                   SLSRELVQVSQENGILLDIPCCAQREIYEFQGSVGYRISTNISLSKFYPLVGFSLVEPN
FT                   GIFLGTDDKGAPIAINPYLSINGRQNPHWAITGTTGAGKTTTGAVLIDRLRKAHDNVYV
FT                   IVIDPMSNYNGFFQNEADLNIVFRDTDYLGLDPVSLANEGVVSSGDIADFLIESYGIPA
FT                   ELRGILVSQLEQNKSLKELMDNLEDLASKKFATEYRKLENFLLNMTSGADKYVFQGTPP
FT                   SLKNKKFIILGLSTEDTRKKRLAATMLMLYAYSLINKLPRSVEKLILIDEAHFLFEYQS
FT                   VAKIIAIIYRTARALRTSMITMTQLIQHYNMNNYSREAWQLADNKLILKQEKEAKDDLI
FT                   NLAHLSEEEIDYILKSSRGRGILRTGAVTTHIQVQLTEEEKERWRTE"
FT   gene            18106..18369
FT                   /locus_tag="LD85_3154"
FT   CDS             18106..18369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3154"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88744"
FT                   /db_xref="UniProtKB/TrEMBL:D2PKB1"
FT                   /protein_id="ADB88744.1"
FT                   /translation="MKMKLIKLLKEVADENNLKLNILDNGVIIIIKEDKAILQIAAVRD
FT                   VYYIRYMDRNGSYILRKLDKETIEKILNGEVEKTEAIKIPDV"
FT   gene            complement(18319..18996)
FT                   /locus_tag="LD85_3155"
FT   CDS             complement(18319..18996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3155"
FT                   /product="conserved conjugative plasmid protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3155"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88745"
FT                   /db_xref="UniProtKB/TrEMBL:D2PKB2"
FT                   /protein_id="ADB88745.1"
FT                   /translation="MQEECVIVKNAEGYLVNSCTGEIIDFDNYTYQDYSNLEYYERVSS
FT                   KREEKKEIRDMKKIVLNYLLSIMSDEEKEMFYKILQKIDEKKLDAAYYLAIYEYVLERE
FT                   GKVVSREYVRFLKGKGLGSYSIRQKKKLLRRVLKEDVVIYYIYNEYNGDKEEALKIYEL
FT                   LKKYGIMYGKVETRKRILLKYLSDHKLKEKLFEEERMKEIERTLFLLNIRDFDSFSFLD
FT                   LPV"
FT   gene            complement(19090..21201)
FT                   /locus_tag="LD85_3156"
FT   CDS             complement(19090..21201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3156"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88746"
FT                   /db_xref="GOA:D2PKB3"
FT                   /db_xref="UniProtKB/TrEMBL:D2PKB3"
FT                   /protein_id="ADB88746.1"
FT                   /translation="MKEKIKIIPLVMKFFLRTFLDIITMQIFKNPQSREVKMGNVFGMD
FT                   IRRFSVLFIAIIIILSFLASFTNLKVPQQNSSTVQIGSGGGSSEFYSYPGPKYIYNKTI
FT                   TLAPNIQDLAYVKGTYSDLPAPYYYLPNTSIPVLFNFSKPENNILNLLLDALSRNASII
FT                   APGPYGALLSIASSAYVNIINYTNTTLQPFPLNKNDTENYSKWEIIIKYAKEFQVPSSF
FT                   QSGWSYPPSDYIVVNSPVYKIINTYSVTTSVNVLYTSHTYLAHKYTYKKGNTTYVYEYY
FT                   AMNVSGTAYLYANNKLISSQSFNYTFYWYGGTYTSTASGYITVPPNVTEEVYGSYSIST
FT                   GAGYKHYQRTVNNTTYIYYIYYPTGPYSSTTSYTFNWYEYDAIVPIHITVYNGTDPQTL
FT                   IDNKIYTSRNITFYLMDITWSSAPQSNSTSVITHDYIQVVNYSIERTWDAGSVEIIPRL
FT                   QTQISGNVINYYLTFNVQSDLVQPPPWIYQQMLYNKFAALDWYYLEQNATLAHALYQYV
FT                   INTINKSDLQFWKFEYFVLASEFVMYTYNTTYSVFNNLLELESFYENWSLVNANILNLS
FT                   KWPNLEYFNNLLMFFNVSEIPEIYNNTIFYNITGNYEIYLVDIYNALNYQKWNKVPFGN
FT                   EYYFYDPETNQTVYFYLNTSMLPIPYIHETLYFTSANYVPVIFYATFQYTAAVKTEIIS
FT                   IWNGTAWTS"
FT   gene            22009..22434
FT                   /locus_tag="LD85_3157"
FT   CDS             22009..22434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3157"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88747"
FT                   /db_xref="UniProtKB/TrEMBL:D2PKB4"
FT                   /protein_id="ADB88747.1"
FT                   /translation="MKRIEINITTGLDKSTIVNLLWDPEVALSIPYVVEKLVKLGNDRY
FT                   ILNNKYEVYRYVYPDDTVKYECYKNEKLLDTLSFEYRCGLFSKLCPVKLIFETKRLFPF
FT                   KKLLQAEIVSTLNLIFKVTYNVKEIEEVRRILSFKIR"
FT   gene            22462..22965
FT                   /locus_tag="LD85_3158"
FT   CDS             22462..22965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3158"
FT                   /product="Protein of unknown function DUF1286"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3158"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88748"
FT                   /db_xref="GOA:D2PKB5"
FT                   /db_xref="InterPro:IPR009705"
FT                   /db_xref="UniProtKB/TrEMBL:D2PKB5"
FT                   /protein_id="ADB88748.1"
FT                   /translation="MFSVGLLTLVTSFIVSSFYFSLLVSSFISVLGNSVIDKLGHREVL
FT                   TRHGQVPVRTPLTHTLPRSVFWGLIASIPVIILLSLLYGIVFNAEIFTALIGGILVGPS
FT                   HMLLDVFTERGIYVKRNGKWRRFALAHFSYDNPLVNGLAILLGIIMLFTALYLHNYHYY
FT                   NYYF"
FT   gene            23052..23339
FT                   /locus_tag="LD85_3159"
FT   CDS             23052..23339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3159"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88749"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D2PKB6"
FT                   /protein_id="ADB88749.1"
FT                   /translation="MFRKRITNLEELSEFLAKKFPHEEVVMLIFDKLYLLREDPKKYAR
FT                   EKLKNQTDKDGRPLFSIEVTGDIRIVYSFEPKNCTVFIWRIGKHKKAYRF"
FT   gene            24119..24355
FT                   /locus_tag="LD85_3160"
FT   CDS             24119..24355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3160"
FT                   /product="Sulfolobus plasmid regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3160"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88750"
FT                   /db_xref="InterPro:IPR008848"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2PC30"
FT                   /protein_id="ADB88750.1"
FT                   /translation="MQKVELYDKLKIYIARRGCCTLKEIEEALGIDEGTALVYLSRLAK
FT                   QHVITRKWTRDYQGRKVRLYCISSGFLKEIGLS"
FT   gene            24589..25820
FT                   /pseudo
FT                   /locus_tag="LD85_3161"
FT   gene            25789..25905
FT                   /locus_tag="LD85_3162"
FT   CDS             25789..25905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3162"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3162"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88751"
FT                   /db_xref="UniProtKB/TrEMBL:D2PKB8"
FT                   /protein_id="ADB88751.1"
FT                   /translation="MQGRMAPGQFKILQQHYFVISDIELKKVYDEKAPKLLS"
FT   gene            complement(25897..26211)
FT                   /locus_tag="LD85_3163"
FT   CDS             complement(25897..26211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3163"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88752"
FT                   /db_xref="UniProtKB/TrEMBL:D2PKB9"
FT                   /protein_id="ADB88752.1"
FT                   /translation="MRSLEVSQLLIPGLTVHKYDSKGGIYALIIPKSFTHYISKSKVWE
FT                   VILIIDGREMNIGIRNVYRTGKDIYMLSLPKKNMENLWKRLMEEKKKIDIIVKLPEVLA
FT                   "
FT   gene            complement(26208..26483)
FT                   /locus_tag="LD85_3164"
FT   CDS             complement(26208..26483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LD85_3164"
FT                   /product="protein of unknown function DUF904"
FT                   /db_xref="EnsemblGenomes-Gn:LD85_3164"
FT                   /db_xref="EnsemblGenomes-Tr:ADB88753"
FT                   /db_xref="GOA:D2PK70"
FT                   /db_xref="InterPro:IPR009252"
FT                   /db_xref="UniProtKB/TrEMBL:D2PK70"
FT                   /protein_id="ADB88753.1"
FT                   /translation="MTVNEIIRRNEELELQYAKAIDTITKLQNKIARLERENQQLKEEN
FT                   KKLRKLNNILYRAMEIALQIHNAEAQYRHLKAVLERIRRETGEFKG"
XX
SQ   Sequence 26615 BP; 8215 A; 4724 C; 4895 G; 8781 T; 0 other;
     gtatagatct ctaaatgtag gttctggagt tttagaataa agtagctgca ttgatacttg        60
     aatgatatat tttacgtaaa ctgcggtatc cttaagtcca aatagtttct cgaatatttc       120
     cataacattg ctgaacccta gtagcaaggc ttgttctcta ttcgggatgt ttggcagtgc       180
     taatgggttg attgaaatcg ctgattctac agggtggaag tagattagtt tttcgtcatc       240
     tgcaaaatat gaagcaacct cttcagccat gtctccgtgc gggtcaaaaa tcattattat       300
     cgcgttgtta taggctttct ttatagcagt tatcaaggaa ataattgttg tagtctttcc       360
     tgcaccagtg ccacctatga tatatccgtg acgataaaga tcttctaact ctaacttgta       420
     agatttacca gatgggatag ttttgcctat ttcgaaacca ttcctgttag gaggaagctc       480
     tggaagtatc cctccggtta cgaagttcac tgggattatt gacgggttgg ggattacagc       540
     tactttattt attttctctt catcaaccca gagccatctc ttaattttta aaccgtgaaa       600
     tctaggtatt ctaggctgtc tatcttccca tccctttgtc ttccttatct gcattttcag       660
     tttcctgctc ctggtcagaa cgaagttctg tagatccttt attaactgtt ttattctctt       720
     cttatcatct gccaaaatat acggctgtaa atagtagacg ttatccttag caaaaccttc       780
     taatctcgaa gctaaaactt ccctctgcct cttcccgata atactctgat tcctctttaa       840
     tttgtcacta tacttaagga atatttcatt cagtctaggc tctagaacta tccagagcct       900
     tagttgttct cctggctgca gtttcgtaag aaaactgttg aaatcgttaa actcggcgcc       960
     ccaatagaaa tctttctcat ttctgaaaga aattctcccg acaaactttg gaacgggaat      1020
     gttaacattt tcgttcacgc cgaagtcctt tctcagtact tccagttgag aattagtata      1080
     tgcataaatg tgcatgatgt ctttatctct ggagtagatg atctcaaaga cgtgccctaa      1140
     gctgttgaga acgttgaatg acttatcgta ctcgaccctt ggaaataact catagtattt      1200
     gattacttct tttttgcccc acatcagtag aatattgttt taaaaactaa aaatcgggct      1260
     cagctttggc agtcgttcct catctcctca gtttcgccgt actctcatca tcgctctaat      1320
     tctctatttc aagagagttt tataaacgtt tctaaacttt gaataaactc cccagtttac      1380
     taagaaaaaa ttgaaaataa ctttagtggg ctaggatcat cacgactatc agaaatagcc      1440
     agcctgcagc aataatatag cctaaaaatt tccttgctac ttccactaga gtcagtagta      1500
     tgtagagcgc agtaaggggc actaaccaag ctatgatgtt tgcatacgta tttgccagtt      1560
     ggggatcctg ctttagtagt gttgattgta gaatgttttg aatgatccct acaagccaat      1620
     tatatccttg tcctacataa tataatatct cctggaagaa atttgaagga ggtgcgggga      1680
     ttttctgtgc tgcttgttga atttgtgttg aattaatgat gttagtcgta gtattattac      1740
     ttgtcactgc agctgcagtt atactaaata atattataat gaacattggt agtagaactt      1800
     ttgccctcat tttttccctc aactaaaagt agtttttaaa aagcagttta ggtgatgtta      1860
     agcttctttc cagtagcgtt aacctttctt ctatttattt atgaatttag aaactacaga      1920
     ctcataaaga aagcaagatt tctttatgaa aaagacaacg taaagtatta tcaaattgaa      1980
     agtaatgaag acaacgctat aacaataaaa tctatcgtat ttggaaagaa tgtaataatc      2040
     ataggaaaag aagacttcaa gattttagca catgaggaag gacatctgca ccagccctac      2100
     ttcatttatt attttttggt aatatcagca ctagcaataa gctataacat tctaactatt      2160
     ccatttttac taattattta caaagcaatg tttcttcatt acgagaggga tgcggatctt      2220
     tatgcttact ataacttcaa tgtaaaatat tcctcagacc aacaaagacc taaatctaaa      2280
     attgatagaa taaaagcttg ggtcttcgac actcacccac ctgattacat tcgaacaaaa      2340
     gaagaatatt atgaaaaaaa gaatagctta attaaattat ttcttgaaga cttactttct      2400
     tagttttctg tactccacga tgcctcctac tagcgcgaca aaaccaatta acgccagaaa      2460
     gtccgttata taacttgcgt cgttccccag taagctgcta aagttgctgt caaatgttga      2520
     agctatagat ccgcctagga atgcaagccc tgctaaaatg cctgccattg cagcctcatg      2580
     attacctttt ctgtattttt gtactggtag tgatattata tttattacct tctctcctac      2640
     taccttaact cccgtcttaa ttacttgaac tgttttttgc aggactttca tatgctgctc      2700
     acttcatact ctttttaaaa acccccttat cttatggcaa ggttaagaga agaaacagta      2760
     ggttggttat atacagtctc agggttagat gagaagagct tccccctcgg gctcaaaaac      2820
     gtgaatatga aagaactagc ggtgatattt ccgttactga tgttaggaat ttctttcgct      2880
     ttcaagaata taatgattgc aatggccttc atagctccag tgttcttctt tattttctac      2940
     gaagagaaaa gcatggacga gtttcaatat gtgtaccact ttatgaagtt ctatcttaac      3000
     gacttcttag cacctaaaga gaagaaagag aagagcaaag agaaaaataa gaaagagaat      3060
     aagaaactta cagttaggcc taaaacgagt gtcatagatt atggttttat tgcatctgga      3120
     gctttaatga tgttaatatc tttccatgag tttttagatg taattgaaat gaaaatagct      3180
     ctaggatttc tagaaagcat ggtttatatt ctgatgtttg ctgcaggagt cggaatctta      3240
     ggaggagaaa tagcttacat tatattagaa ttcacgacca aaaaaataag taaataagtt      3300
     aatctatttt tatcacatca acttttcttt tgcttttcag ccctccaacg gcttgcgggt      3360
     cgttaagata tatcgttaac tccatctgga atttcctata cttcttggct aattggccaa      3420
     tctgctctgg gtctttgact ctaactatat atggcattat gaataaatta atttcacaag      3480
     ctataagttt taactctacg ggagtttaac gtaaaattac cgtgaactct agaggagttt      3540
     aaaggaagag ttaaaggaga aaccgaggga aactaaagga tagataaaag ttttaattat      3600
     ctcttttgtt gagtgattaa gtcattgata cctttgatta ctaattttct taagatatcg      3660
     taagcttcaa tagcatattc tttaaagtct cctcgaagat ctgcatttcc atttataata      3720
     tccttcaaat gatttaacac tgtgttatgc attctttcaa aatcattatc atctgtaatg      3780
     aaaacgatct tatcataaat cctgccacgt aataacaaaa agaggtatac aaatattatc      3840
     tggtcatttc tacttggcgt cttgttatat cctttggact ttaagttgcg tatatatgca      3900
     ttaatacctt cataaattag ctgaatttct cttatggtat tatcactaaa aagtatttta      3960
     gtatcgtcaa ttacagtgca tttttgcttg attaaatatt ccgcaatagc taaatagtca      4020
     attagatcct gtgttctctc atttaaagtt atatggttcc taagagcttc aagatttgag      4080
     ttgagcaact tatcttctaa ccttatgaag aacccctttg caagtattcg ccttattcct      4140
     cccggtaaga tctgtccttt atagtactta gttagtatct gttcatagat ttgttcaaaa      4200
     ttctttctaa tatcttcaag cactcgtagt ttatcttcta cccctagttt atcccaatcc      4260
     tgtctagata gtattttctc ataaatcaca tgggaggtta tattataagc gtcgtaaatt      4320
     attgcctcaa attcacttaa attgatatga agtataacgc attgtccttc acttaacgag      4380
     ttaataaaat attcaacagc tggattttca ttcagaattt ctctatataa ccattttata      4440
     acaatattgg tatctaagaa aaaagtttcc ttttcactca tgagttatca gcgtggatct      4500
     tgaaaatagg taataaccta aggagtcctt tgagggcata ggtgtcctat cggcaactag      4560
     tgcgtgtaat aatgctccgc ttagctcaga tatataaggg aatacttctt ttttctttat      4620
     atatatcaat ataggtatcc cgaaaaatcc tactaggaaa ttagcaatgt tgaatatatc      4680
     tttaatccta gaatcttttg tttttatgtt aggattggtt atgttagtct tatgtagttt      4740
     taagtatact gttgttacga agcgtaaata caacgaataa taagtggtta ttaggaaatt      4800
     agggttatca gaatttaata cctctttgta gaacttctct tcattttcct tcaacccgtc      4860
     aataagtttt tgtaactcgt tcattaccat tttaacgtat tctcctatgg ttgtattatt      4920
     ttcaagtata gagttatata attcaaaatc ctcctttatt ttttcagttt cttttgacag      4980
     tatttttaac ttattttcat cttcaggatt taggattaac gttagcatac cctcatatat      5040
     ctcgaacaaa ttctcctcat attgcttgac taaataatcc cgcatcttct ctaagcgatg      5100
     tacagggaaa ttcctattct tcatttcgtt tggaaccttg taatattcct ctaaaacgag      5160
     agaaagacca actgacatag ttatcaatct gatatgatat agtatagcag aatagtacaa      5220
     aaaactttct tctagctatc ctagagctag atctcatttt gccttaaact cttcctttga      5280
     actcatctag agttcacggt aattttagga ctaactcccg tagagtttaa aattcccagc      5340
     gaaaagtatt tagctataga aggagaatag aaatacatgg gaatcattga caaagtaaag      5400
     aagaatgtta ctgatgttat aagtacaagt gagcataggt tgacgggaag acctccagta      5460
     aaaggtaaat ttatggtaaa catcccaaag gcactcgttg tagaggattg gtactgggac      5520
     gatgaaggaa tattcacttt agaaaaaaga cctgggctat tgtccccagg tatgagaaag      5580
     gggaaaataa taagatggga agaaatagat gacatcattc cgctaaacgt tagtcaaaca      5640
     tctaattaca gtgcatttgg attatcagga gaaacaaata tcataggcga ttggataatt      5700
     aagaagaaag atggaactac ggttacaatt aaatatgtga tagaccccat aaacagagct      5760
     aatgctttta agaaaattta tttaaataaa aaatagtttt tccttattct cttaattttt      5820
     gttttaatgc ggaatggact ttgcttacta aaacgtctcc gggctgtagt gtaaatacga      5880
     ataacgctag cgttgaaatg aattctacat ctaatgctaa tggcagtaga aataacaaaa      5940
     gaaatccgaa tactgtatga actaatagcg ctatggtaaa agctgcaact aaaccagcta      6000
     ccatcattcc tatcaataag ttagccataa ttagcgctat ttttcttgtc cactcaaata      6060
     accagagcgt ggcctgaaat ggtatcagag ctactattgc cagcatgaca ctgtttctaa      6120
     cggttgctat agctgtagta aacaacataa gatacaaaat tgcggatatt aaataatcaa      6180
     aatcgttagc aaagaagggt atagcagcta accccccacc aattgctaag tagagccccg      6240
     ttcctgcagc taaaccaaca gaagctatac ctagttctgg acctacagta gcataaatta      6300
     gactattgat aaatgaagca gcataagtgt atattgtgat cccacctacc gcaaataaag      6360
     cccagactga taacttatac atcacgtcgc cagcaaggtc aataatatct gaatagaacc      6420
     cttggaacgc attataagca atagagaaag caataaacaa catcgcaaga cctacagagt      6480
     aatcatatac ttcattgaat aattgtttgt caaaagatcc aggtataggc gattctacca      6540
     tctgctctaa tggataacct ataaattgta agaaagttgt gaccaaacct tctatcccgt      6600
     ttgctatagc cccaaagaag ctttccagac tcccttctat agcaccttgt atccaaccta      6660
     aaggacctgg cggattggtt acagagacta ggagaccatt acttccatat gcgtagttct      6720
     gtgggtcctc aactattgct acaacgagat atttacctgg gctctgaaat acgtaactca      6780
     tttccgttga tccagtgaag ttggctacta gagtcccatt tgcataaatt tgccagacta      6840
     ctatggggtt agggacggaa ggactataag atactgaata atattctgtc tgaccagtat      6900
     atgcggaggt aggtccgcta acagtcacct gtagttgcac tagcgtaatt tgtacgtttc      6960
     ctcctatctt ccctccagtt gcggctgcta agaatatggc gcttgctaaa gcggcagcga      7020
     ataacactaa cgcataacgt tggtcgtatc tgttagctaa tattgctaag agtatgagag      7080
     ccgctggtat cagtgtctgc agcgtagcta taaactggcc taagttattt gaacctcctc      7140
     caccaccacc ttgagccatc actattatat ttcctactcc tgaaagcagt gatggaagta      7200
     ctaatattat taataggata gttaatgctt tcctcatttt cacttctcaa aagaagtctt      7260
     tttaaaaagc tcagttgaat aaactcccca gtttacacaa agggggggtt aagggggcgg      7320
     aaagtctcgc cagaggatgg atagccccct tatatttaaa tatttctttt tctaaaattt      7380
     cattaatggc taggagggtt aaggcgatca gagctacagt ttcaatgaag atcgccctct      7440
     ctgattccct cctagccctc gtgaacaact atgtaaaggc actccgcttc gtcctattct      7500
     ggttgaagga taacgtgaaa aatccagacg agaaaggagt gctatcgaaa gttcacgagg      7560
     agttgtacac aaggctaaga gaagagtata acctaccttc aaaggttgct gaggactgct      7620
     atagggatgc cctctcaata tacaagggtt ggtataataa tccgagaaga gggcgttttc      7680
     cgagagtata cagacctacg gtgtggttaa caccaaaagc aagttataat gttgacttcg      7740
     acaagatgag cgttaggata acaggtgtcg gtgaacttcc aatcctaggc tatcccagaa      7800
     acttgaaaga gtacttgagt tggaggatga aggaggctag gttagtaata aaggatggga      7860
     gggctttctt aaaggttgtt tttgagaaag aggaggcgaa tgctgagcct aagtcaagta      7920
     ttgctgttga tattaacatg agtgagatag ttgtaggaaa agatgaccag aactacgtta      7980
     ggattccgac tcgccttgat gaggttcacc actggaagtc tttggctgag aatttgcaga      8040
     ggaagtaccc tagaatgtgg agggagaata agaggatcct tcacagaatt cactccttcc      8100
     accaaaaggc taaaagaatt gcagaagatt ttgctaggaa ggttggtaaa tgggttgttg      8160
     aaattgcaag aataatgggt gctaacgtca ttaagttgga gaacctaagg aacctcatca      8220
     agaatgtgga tagactgcca agagagtttc atgataaact gtatttaatg cagtaccgtc      8280
     gtttgcagta ctggatttcg tggcaggcta ggaaacacgg aatgattgtt gagtttgtta      8340
     atcccagtta ctcttctgtt tcatgcccga aatgcggtag aaagatggtt gaggtttccc      8400
     atcgttggtt taagtgttct tgcggttatg agaatgatcg tgatgttatt gcaatcatga      8460
     atcttaatgg gagggggtct ctgaccctct cgactgcccc tcaaatgaga aatgtaaacc      8520
     cgaatcgatg aggggaaccc tcgctggcgg ggaggaagtc agcttcattt tcggcctccc      8580
     tctttaactc ctcaaataac ttccttaact cctcactatt tctaattatc agaacctcgt      8640
     tcgtttctgg cttaaggact ttcataaaat ataatcttaa acaaaaagct taatctcttt      8700
     tttcaaactc cttaacaaac ctactaacta gtcctaacac ttccttaatc ttaggtaaaa      8760
     aagcggataa gggaatatag taagtattct ccaagcttat gtctggttcc cttgaggcga      8820
     taactattaa ataactttta tcacacgacc ttaattccct caaaccttcc agttcttccg      8880
     taagttggtc tttgtctata ccgttaccgc tcttgacctc aaagcctatg cataagctct      8940
     tcaattcggc atccgtagct atatataacg catctatagc cctatcgttg ggcagtttaa      9000
     cctccttaga ggagtacttt atgccgataa ttttcctagc ccaatcgtcg gcattagctt      9060
     gtaaaagcgt cattacgaag ttagggttgt aaactattat cgtctgtatt atgtcgtgta      9120
     catatactag gttagaatag ttggctacca ttccctaacc ctccttacta cctccgaagg      9180
     taatctgtag aatactttat agaagtagga gtagaggtct ggttggagtt tctcgctaac      9240
     taagaagagc ttgtcaaata cttcacctat aggcggtata ctctcgttcc tccatattag      9300
     gtcactcaaa tactccttat ttgatgaaag tatgaaatcc tccgggtggt cgtcattagc      9360
     tccgaagtaa ggcgggtcgt agatatggct catcacttcc gtgttctctg agatttcgtt      9420
     aagcaataac ttgttatgtt ctaacaacag tttagttgaa ttccttctca ccttagtaag      9480
     gactgatccc aatactctgg gattatcgaa actgctccat atgtatttag gcaaagcctc      9540
     cttaaggaat atgagcattg cattaaaggc ctcaatagta ccgtcttctg ggattattaa      9600
     atagtccgaa gccctcagaa caggctttat tgtgactacg tcagaaggtg aggtatctat      9660
     cagtatgaag tcatattttt ctctgaagtt atctaactcc ttcttaaccg caaactcgtc      9720
     gaacattggg aagtagccct tgaacattgc gtggaaagta gatacgtagg atcccggaat      9780
     tatgtctaat gaaactttta cttcccccct agaagtcttt gagacgtgga taaagttctc      9840
     tacaattacg tccgatatct cccttattag ggcgtaagca ctcctatccg attctggtct      9900
     tatagactgt tgtaggattt cctttcttct ctcctcctta acgaatatct gtgttaagga      9960
     catttgtggg tcgaaatcta tcagcaatac tctatagttt actgctaagc ccattccaag     10020
     aactgccgtt agggtagtct tacctacacc gcccttgaag ttatgtatag ctataacttt     10080
     accgttcatt tcaccacccc gaattcctcc tttgggtaaa gcctcatgtt tcctttaacg     10140
     aacttgtaga agagttcctc cagctgttgt ctgtttaaat gagaagatag taggggttct     10200
     gctacattat gccagtttat tgataggttt ttgaaggcta tctggaagtt cctccaaact     10260
     tctaccatgg taagaatggc ctcttcatcc agtttcttct cttcatagag ttgtttaatt     10320
     tctgggcaat tggataacat ctcctccttt agtttggcta cagtctgtaa ccatttttca     10380
     tggtttattc tggttatctc ttctgcaggc gagtggactt cagtattaaa ctggggagtt     10440
     aactgttgtt tagcctcttc ctccttctct tcctcctcat tagccttctt ccactctcct     10500
     actaaatcat attcttcatc actttcgcta tcctctccct cagtactttc agcctcctct     10560
     tctaactctt cctcttcttc taagtcctcc tttgtcctgg gcttgctacc tttagttctc     10620
     tttagtttct cctctgtctt cagcttatta attgcttgag aaactgccat cctatggttt     10680
     actatctcct cgagtagatc cttcctctca tccagaatta tctttcttcc atcggtaagt     10740
     aatgtatttc tttcgtaagg aggtaactta gctacagctt ctagtaagcc catttcttgt     10800
     agtttagtat agatactgta ggctggtttt atccctatct taccctttag tatataatca     10860
     gttagccagg gtgcgttttc tttaatccta atatagtagt ctagcgctct atcatcaacc     10920
     tttacattat acttctttag ctcttctttt actgcattcc ttaaatcagt gaggttttga     10980
     atttttttac tttcggtcgc actaagttga acgcccgggc gttcaacttt tgtctcttta     11040
     ggattatttt cactattctg gttctttttt aatatcttag tcttctcttc tactgctttc     11100
     tctattaacg ctagggcttg agctttactc agttgcctct gtgttaaatt tgtagatacc     11160
     aatagatcgt attcatcagc tctgtcagtc gtttcatata ccgcaactgg aacctttttt     11220
     attcctaatt ccctagctat cttcagcctg gtgtatccgt taattaactc gtagttttga     11280
     ttaacgatga gcggtacttt tattccattt ttagctatat cttctttgat tttatcatac     11340
     atgttatttt cagggatgaa ggttttgaat tcatcaactt ccttaatttc ttcgatagga     11400
     atttctttgt actctttcag cttactcatt gaaccacccc cgcaatcttt agtagttttt     11460
     ctaactcctc cctctcttta cttacagatt cggaaagttc tttgagacct ttttcagtga     11520
     ttttgtagaa cttctcattg tcttcaatct tttctaattc tacaaacccg tattccacta     11580
     gtctagctat tacgttagct acagtttggt acggaatatt agtttctttt gatatttgcc     11640
     ttctactttt gctctttcca tctattaggg ttaggagtat ttttacttca tttgaaaggg     11700
     agtctaacat ggctattcca tgttatagtt tttagaacat atatataaag ttacatgctc     11760
     taaaatatag tacaaagaac ctattcttat tacactatat ataaagtata acatggaatg     11820
     gattacacac tttcagagac tgcccaaaaa ctattggttg cgctactcaa aaaagacggc     11880
     gtaactataa gggaattaat agatttagcc gaggtcaata atactcctgc actgagggct     11940
     ttggaagaac ttcagaaata taagttaata agagaggaaa gggaaaccac atttcctaga     12000
     aggaggttaa tttatctaac tgatgatggg aaatatgtag ctacaagaat aaaggaaatt     12060
     atggaagtat tagttaagaa tcatccgccc atataatcat acctcaaatt aaatttgaac     12120
     ttctaaagca gtatcttccc tcattgttat ttgttctatg ttttagaaca aataatttta     12180
     aatacatgtt ctttgttata gtttttagaa caaacatgat ttccacccaa atcccttcaa     12240
     aaagttacgt aaaaaggtta gatgtttttt acgtattatc tgaaggtgta gtagtagctg     12300
     gagacgtaga gagcaagagt aggaaggggt tattgcatta tactaggatt gttctggatc     12360
     ctgtaacaat gaagattact aaggcttcct gcgactgcga agcgggtgcc ttcggaaaga     12420
     aatgctggca cgttaaaaca ttggaggaat tggtaaagac tgacctgaag aaggaggtag     12480
     agaaagttag agaagagatg ctagcagttg aagaagacat tgcctcatgg ggttgagaat     12540
     tatgcaagtc cagctccaag gtgataagtt attggagctt ttggaggctt tataccacat     12600
     caacgaggct atgaagatta tggagggata taattcggaa attttagata agctggagga     12660
     agctaggaat tctctagtcc agtacttaat ccagcattat ttagaggtga aggactatga     12720
     gtgaggtact gcagacccag agaaacttag aagagttagt aaagctattg aagatctact     12780
     ttcaattaga tgaaattgtg gacttcgcta taaatgaact agatgacgac gaaattgtag     12840
     ttgaaataac agcagttaag gacaggataa ggaaagtgat tgagaagttg ataagttaga     12900
     atttttctta ttaaactggg gagttaactg ttgtttagcc tcttcctcct tctgagcctg     12960
     agcccattcc tctacgaaag gatactcatc actttcgcta tcctctccct cagtactttc     13020
     agcctcctct tctaactctt cctcttcttc taagtcctcc tttgtcctgg gcttcttctt     13080
     agacctttgc agtttctcct ctgtcttgat tttgttgata gcttggctta ctgccatttt     13140
     atgatccaaa attagttgaa gtagatcgtc tctctccagg actttcctac catttttatc     13200
     agtgattaat ttagacagtt ctggcttggg gatgcgtttg tccaagtcta gtaagttctt     13260
     ttcctttaat aataggtaga tatcgtaagc ctttctgatc cctattttgt ccttcttttc     13320
     atccccaata tattggacta accacggtac atctttctta atctgaagat attttctaat     13380
     agtctcgtcg tttatctgaa cgtctggtgc taatcttttc aattcctcct ttatctctct     13440
     agattcttgt gttgttgatt ttttattaat atctgtttgt aaaatactag cactagtgct     13500
     agtattttgc tcatctagat tatctttttt caattcatta gttttttcag ttgtttgtgt     13560
     tttgagagcc ttcttctttt ctgcaattct atcaattatt gcaattatct cgtctttgct     13620
     tagatgcctt cttttaagat taaagctcgc aacaatatct agctcctctt ccctaccaga     13680
     agtctcataa atttcaactg gtatttcctt aattcctaac tcctttgcaa tcctatatct     13740
     agtgtagccg tctaaaatct cataattttt attgaccgtg ataggatcca gaaagcccaa     13800
     ctgctgtatc gatttcttta gctcctcata actgttattc tctggtatta actccttata     13860
     ctctggtact tctttgatgt tatcaatact gactttgatt attgtaatga acctagccat     13920
     tatgcagtca ccagctcctt taattgtttc aaatattccc ttcccttctc cgtaattctg     13980
     tacttctcat tccttccttc tccaactttt tgtattagcc catctaactg caacctggtt     14040
     aatgctctcc atagtttgtt cctgtccagc ttcgttcttt cccttaattc tgtgaatgac     14100
     ttttctcctt tctctatttc ctttaatact tctaagtaat gtatagggta tagatttttt     14160
     gacatctcga tattcgatac atttttgtta cttataaact tatctctttt tatcaattcg     14220
     atataggaga cataatatta aaagaggact tttcaataat cgaaacatga gtaaaaaatt     14280
     cgaaacttat gcagaggaat ttttctccac tcatgaaaga atgctgattg cgttatgtga     14340
     agaggatgga ataacggtta gggaattaat aaataggtca aaaatcagtt cttcagctta     14400
     tcgttctcct ttagatttcc taataaagat aggtttagtt aaaatagaga agggcggaga     14460
     gaagaagatg atggttaagc taaccaataa cggtagagaa atttgtaaga agcttcagga     14520
     actttatgag atattgaaaa atatgaaacc tacaatagaa atctaccctg gactatcgtt     14580
     acccatagat gagttggaga agcttgttga taaatatcta attataggtg gtacaccacc     14640
     tagaataatg gcagtagcaa acgatgatga ggaagctaga aacaaatttt tagacttatc     14700
     cgaaaaagct gaccttaata gggagaccga ttttcctaag gctataatat ttctaacaag     14760
     agatatgttg aaaccttatt tatgattcag ttcatcaact tctcttttta tttcttccgg     14820
     taacatgttg taaacgttct tcatttcctc ccaatttaag aggtgatacc acttagcctt     14880
     tttagccttt attaaaagat aatccccgtc gtctaactcc aattccttag ccttatccat     14940
     aggaatagtt atcctatacg tgacgtactc cttaccgttt ttcttacttt tagttacaga     15000
     gaccttgctt acgaaaacta cctccttctc tacttgttta ctttccataa ttaccacttt     15060
     ctaccaaaaa cttataaatc ttgttatgaa taaaatgatt ctggcagaaa atggccaaat     15120
     gcagtattga gacacttaac gcaatattag tagctgtttt cgatgctaca aacggttcat     15180
     tatctgctca cgtcccatta gaagcagtat tgaggaggtt tccaggacat ttaagaggag     15240
     atgtaaggag gtgtattaaa gaactgatca aaagagggct attaacgtta caccctacca     15300
     gaggttctac cacttatcaa ctgactcaga gagggctaga atgtgcaact aaactaacta     15360
     aaggagaaat ttcatcaata gaagaatgtt aattgtctcg atattcgaga cagaaaaatt     15420
     tttaaatggg tatgtgtata tcgtatctcg atacaaaatg atttccaccc aaatcccttc     15480
     aaaaagttac gtaaaaaggt tagatgtttt ttacgtatta tctgaaggtg tagtagtagc     15540
     tggagacgta gagagcaaga gtaggaaggg gctattgcat tatactagga ttgttctgga     15600
     tcctgtaaca atgaagatta ctaaggcttc ctgcgattgc gaagggttta ctttcagagg     15660
     aaagtgctgg catatcgaaa cactaaagca gttagtagtt tctgatgaga gggttagaga     15720
     ggaggtaatg aaagcgaagg aggagctgat gaggatagaa gaggacattg cctcatgggg     15780
     ttgagaatta tgcaagtcca gctccagggt gataagttat tggagctttt ggaggcttta     15840
     taccacatca acgaggctat gaagattatg gagggatata attcggaaat tttagataag     15900
     ctggaggaag ctaggaattc tctagtccag tacttaatcc agcattattt agaggtgaag     15960
     gactatgagt gaggtactgc aaactcaaag gaatttagaa gagttagtga aactgctgag     16020
     gatatacttt caacttgatg agattctcag tttcgctaca tttgagttag aagataatga     16080
     agtagtagct gagatttcgg cggtaaagga cagggtaagg aaagtgattg agaagttgat     16140
     aagttagaat ttttcttatt aaactgggga gtttattcta atttttctaa ctatttgtgc     16200
     tacatgggtt tttaaaaacg gctctttttt gagacatatg agtttcctta acatcttcaa     16260
     aaaatcaaac caacaagttg caaagagtaa aactaagtac tataggctgg aagggatccc     16320
     gttcttcttg ttatctccag aggatcgtga tatgaaaatg aaagaattga gtgctttgtt     16380
     aagccaggca gaaaagggct atatttacat cagtcgtaag caagatacct acgagtttga     16440
     gggaattaag ttccctatta taaattctaa ctttcagttg ataacagaga aagaacttga     16500
     tctagaaacc tcagagcctc ccaaaagacc agcgataaaa aaagaatatg caaaatattt     16560
     acaaactaca gagggttacg ctagagttct cgttagttat gcatactcga ctaaaattta     16620
     cgaaggtgtt ttggggagga tagacttcaa atctttacgc cctgagctct ttgagttagt     16680
     tgttcagttc cagaaaattt ctccactttc tgtaagaaat tatctcaaca gccttgaggt     16740
     caaaaagcaa aagatggcac gatacgctag cagtagtgtc caggtagaag agatgctagt     16800
     ccgtggagct cagctcaaaa aggatcttga tgaggaagct gctgaccccc tcaagttcag     16860
     attcatattc ataattcatg caaagacgac tcaggaacta gagagcctaa gtagagaact     16920
     tgttcaagta tcgcaagaga acggaattct gctcgacatt ccttgctgtg cacaaaggga     16980
     aatttatgaa ttccaggggt ctgttggtta cagaataagc actaatatta gccttagcaa     17040
     attctatcca ttagtaggtt ttagtctagt tgagcctaac ggtatctttc tggggacaga     17100
     cgataagggg gctccaatag caattaatcc ttacttgtcg atcaacggtc gtcagaaccc     17160
     acattgggca ataactggga ctacaggtgc tgggaagaca acgactggtg ctgtcctcat     17220
     tgatagactg agaaaagctc acgataatgt ctacgttatc gtgatagacc cgatgtcaaa     17280
     ttacaatggg ttctttcaga atgaagcaga tcttaacata gttttcagag atactgacta     17340
     ccttggcttg gatcctgtta gtctagctaa cgaaggggta gtttctagcg gggatatcgc     17400
     tgatttctta atagaatcgt atggtatacc agcggagtta cgagggatcc tagtaagcca     17460
     gcttgagcaa aataagagcc tcaaggaatt aatggataac cttgaagacc tagctagtaa     17520
     gaagttcgct accgaataca gaaaattaga gaacttttta ctaaacatga cgtctggcgc     17580
     tgacaagtat gttttccagg gaacaccacc cagtttgaag aataagaagt tcattattct     17640
     aggtttgagc actgaggata ctaggaagaa acgtttagca gctacaatgt taatgctcta     17700
     cgcctattcg ttgatcaaca agctccctag aagcgttgag aaattgatct tgattgacga     17760
     ggctcacttc ctctttgagt atcaatcagt agctaagatc attgcaatca tttacagaac     17820
     tgcaagagct ttacgaactt caatgatcac aatgactcag cttattcaac actataatat     17880
     gaataactac agtcgtgagg cttggcagtt agcagataat aagctaattc ttaagcaaga     17940
     gaaagaagca aaagacgatc taattaattt agctcatctt tctgaagaag agattgacta     18000
     tatcctaaaa tcttcacgtg gaagggggat tctgaggact ggcgcagtta ctacgcatat     18060
     ccaggtgcaa ttgacggagg aagaaaaaga acgttggagg actgaatgaa aatgaaactc     18120
     ataaaacttc ttaaagaagt agctgatgaa aataacctca aattaaacat tctagataat     18180
     ggagttataa ttataataaa ggaagacaaa gcaatactac aaatagctgc ggtgagagat     18240
     gtatattata taaggtacat ggacagaaat ggatcatata ttttaaggaa attagataaa     18300
     gagacaatag aaaagatatt aaacggggag gtcgagaaaa ctgaagctat caaaatccct     18360
     gatgtttaat aaaaataaag ttctttcgat ttctttcatt ctctcttctt caaataattt     18420
     ttctttcaat ttgtggtcag atagatattt taataatatc ctctttctcg tctcaacttt     18480
     tccatacata atcccgtatt tcttcagtaa ttcgtatatc ttcaaagcct cttctttgtc     18540
     tccgttatat tcattatata tataatatat aacaacgtct tctttcaaca cccttctaag     18600
     cagcttcttt ttttgtctaa tactatacga ccctaatccc ttccccttca aaaaccttac     18660
     atattccctg ctcactactt ttccttctct ctccaagaca tattcataaa tagcaagata     18720
     gtaagcagca tctaacttct tctcatcaat cttttgtaaa attttataaa acatctcttt     18780
     ctcttcatca gacatgattg aaagtaaata atttagcacg atcttcttca tatctctgat     18840
     ttctttcttc tcttctcttt ttgaagatac tctttcataa tattctaaat tagaataatc     18900
     ttggtatgta taattatcaa aatcgatgat ctccccagtg caagagttta ctaaatatcc     18960
     ttcagcgttc ttaactatta cacactcttc ctgcatcaga atttcttctt tttaaaagcc     19020
     tgtaaggatt tctagcgaaa aagaagtatt accagtaaac tggggagttt aatgagaaat     19080
     aaaaaagatt taacttgtcc aggccgtccc gttccagatt gatattattt ctgttttgac     19140
     tgctgcagtg tattgaaatg tagcatagaa tataactggt acatagttcg ctgaagtaaa     19200
     gtatagagtt tcatgtatgt atggaattgg cagcatggaa gtattaagat agaagtaaac     19260
     tgtttgattg gtctcaggat cgtagaagta atattcattc ccgaatggga ctttattcca     19320
     cttctgatag tttaaagcgt tgtagatatc tacaagatat atttcataat ttccagtaat     19380
     gttatagaat attgtattat tgtaaatttc tggaatttca gagacgttaa agaacatcaa     19440
     tagattgttg aagtattcta gattgggcca cttacttaga ttaaggatgt tagcatttac     19500
     taagctccag ttctcgtaaa agctctctaa ctctaacaaa ttgttgaata cactatacgt     19560
     tgtgttataa gtgtacatga cgaattcgct agctagtacg aagtactcaa atttccagaa     19620
     ctgtaaatcg ctcttgttta tcgtatttat tacatattga tatagggcat gggctaatgt     19680
     cgcattctgt tctagataat accagtccag tgctgcaaac ttgttataaa gcatttgttg     19740
     atagatccag ggaggaggct gtactaaatc actttgaaca ttaaaggtaa gatagtagtt     19800
     tattacattt cctgaaattt gtgtctgtaa tcgtggaatt atttctacac ttcctgcatc     19860
     ccacgttctc tcaatcgagt agtttactac ttgaatgtaa tcgtgggtaa ttacactagt     19920
     agaattcgat tgaggtgctg agctccatgt tatgtccatc aaataaaatg taatgtttcg     19980
     ggaagtgtag attttattat caataagtgt ctggggatct gttccattat aaactgtaat     20040
     gtgtattggg acaatggcgt catactcata ccagttgaaa gtgtaacttg tagtagatga     20100
     ataaggccct gtagggtaat atatataata aatatatgtt gtattattaa cagtacgttg     20160
     atagtgttta tatccagctc cagtacttat actgtaactt ccataaactt cttccgtaac     20220
     attaggaggt actgtaatat atccgctggc tgtactagta tatgttccgc cataccaata     20280
     gaaagtatag ttaaaacttt gtgagctaat tagtttgtta ttagcatata gataagcagt     20340
     cccagaaaca ttcatcgcgt aatactcata aacatatgtt gtatttcctt ttttatacgt     20400
     gtacttatgc gctaaatatg tatgactggt gtataggaca tttacgctag ttgttacaga     20460
     ataagtatta attattttgt aaactgggga gtttactact atatagtcag aaggaggata     20520
     gctccagcca gactgaaaag agcttggaac ttggaactcc ttcgcgtatt ttatgattat     20580
     ttcccatttt gaatagtttt ctgtatcatt tttatttaat gggaacggct gtaacgtagt     20640
     gttagtgtaa tttatgatgt tgacgtaagc ggatgacgca atgctcaata atgctccata     20700
     cggcccaggc gcaattattg aagcgtttct acttaacgca tccaataaga gatttagtat     20760
     gttgttttct ggctttgaga agttgaagag aactggtata gacgtattgg gcagatagta     20820
     atacggtgca gggaggtcag aataggttcc tttaacgtaa gctaaatctt gaatatttgg     20880
     agctaatgtt atagttttat tgtagatata cttaggccca gggtaactgt aaaactctga     20940
     acttcctcca ccgcttccta tttgtactgt tgaagaattc tgttgaggca ctttcagatt     21000
     tgtaaaactc gctaggaagc ttagtattat tattatcgct atgaaaagaa ctgagaatct     21060
     tcttatatcc ataccaaata cgttacccat tttcacttcc ctactttggg ggtttttaaa     21120
     aatctgcata gtgatgatgt ccaaaaaagt ccttaagaaa aatttcataa ctaaaggtat     21180
     aatttttatt ttttctttca tactaagaaa atattatcta atttatgaag acggagataa     21240
     gattgtgctt ctgagaaaag gtagggaata taatatctcc agggtggtga aatgatttcg     21300
     ccggacttag caataaaaat tcttctatta gttccttcag taatattctt cttctacagt     21360
     gcagtatatt taatgttatt tgagctaaat gtacaaccta aactgagcaa attctacaga     21420
     aatactagtc tagttttagc tggaggtggt atactattat tggcaattta tttaatgatt     21480
     tagatagcat agatgatata attttagtaa ttttagcaaa cgtatgtgat aatactgtcg     21540
     aagagatatc tagaaaaact ggcataaaag aagaagctgt atatcatttg ttagaatttc     21600
     taacgatagc tggaattgta aggaaacaga atgatagata ttttgtagat gaaacaacaa     21660
     ggactattgc atctcttata aaagatttag atgatttaga attttataat aaaaatcttc     21720
     tgagaaattc taattgaggt gttgcaaaat gtacgtttgt cctttcggca atagagaatt     21780
     cgatacgtta atgtatctta agaaacattt taagagacat aatatttctt tctgccccta     21840
     ttgcaaaaaa tactataaaa aacctttaga gcattatgca aaaaaaggga ctagagatga     21900
     acgccattta attttgtatt atttatccac aaacctatac aaaaaccata agcctaattc     21960
     aaaattattc aaaaaagcgt ctgatattac aaaggaactg gtgaggaaat gaagaggata     22020
     gaaattaaca taacaacggg tttggataag agtactattg ttaatttatt atgggatccg     22080
     gaagttgctt tatcaatacc ttatgttgtc gagaaacttg ttaaattggg taatgatagg     22140
     tatattctaa ataataagta tgaggtgtac agatatgtgt atccggatga tactgttaag     22200
     tatgagtgtt ataaaaacga aaagttatta gatacattaa gttttgagta taggtgcggc     22260
     cttttttcca aattatgtcc cgtaaaatta atattcgaaa ctaaaagatt gttccctttt     22320
     aagaaattgc ttcaagcaga aattgttagc acgcttaacc taatattcaa agttacttat     22380
     aatgtgaagg agattgagga agtgaggagg attttgagtt ttaagataag gtgaataaaa     22440
     ttgaagttaa ggagtcattt tgtgttttct gttgggttgt tgactttggt tacttctttt     22500
     attgttagta gtttttattt ttctttgtta gtatcatctt ttataagtgt tttgggtaat     22560
     agtgttatag ataaactggg gcatagggag gttttaacta ggcatgggca agttcccgtt     22620
     aggactcccc tgacgcacac tttgcccagg agtgtttttt ggggtcttat tgcttcaatt     22680
     ccggtaataa tattattaag tttattatac ggtatagtat ttaacgccga aatttttaca     22740
     gctttaattg gggggatttt agtaggccca tcacatatgc ttcttgatgt atttacggaa     22800
     aggggaattt acgttaagag gaacggtaag tggaggagat tcgcattggc acacttctcc     22860
     tatgataacc ccttagtaaa tggattagca atcttactag gaattataat gttatttaca     22920
     gcactttatc tacataacta ccattattac aactattatt tctaatgaga taatatacga     22980
     aaagagaaaa atttttaaat aagttttcta tatcttttaa tgtggcttgt gagaagtggg     23040
     aattgaagtt catgtttagg aagagaataa ctaatcttga agaattatcg gaatttttag     23100
     ctaagaaatt tcctcatgag gaagttgtaa tgttaatctt tgataaattg tatttactca     23160
     gagaagaccc taaaaagtat gccagggaga aattaaagaa ccaaacggat aaggacggga     23220
     ggcctttatt ctctatagaa gttaccggag atataaggat agtctatagt tttgagccaa     23280
     aaaattgtac tgtattcatt tggaggattg ggaagcataa gaaagcttac cgtttctagc     23340
     cctaactttc ttaagcgtta attcctttaa cttctctaat tcttcatcac tttcaattgt     23400
     tacgaagtaa tattctccgt cttttccgct cctcatatgt ataaacttct cacagaggtt     23460
     attaaaacga tatgctaatc gaattctctt attgaatttt gaaaaattgt taagtaagca     23520
     gtataagcgc tactcatggg atcccggctt tccactcccg ttagaaaaac tgaataaact     23580
     ccctagttta ctttacaaaa attctttctt ctaatttctt aatctcatct aattttgtat     23640
     tattagctaa taatgtacaa taaatacagc tgaggagtga tataatgcaa cataagtaca     23700
     ctatgcattc gttataataa actgaaatat gataatgtat tcgaattgaa ttaagcatct     23760
     ttataattag gcaaatttgt ataacacaaa tataagtgtg cgtaattatt gcagaaatag     23820
     ttatcataat acttatgaga ataaaagaaa tgatgagaag agttttctta ctcataatat     23880
     tataaattta tttaaaaacc tcttattgaa ttaactcctc agtttactga agaaaaattc     23940
     aaagtagtta atcctgcttg gatcccaagg tttttcttta caagagcaag ctctcacaaa     24000
     aagcaaggaa atataacaat agaattaatc ctactggaag ggataaagaa aactaatctt     24060
     ctaacgtgct gatgaaacct aacaacattt ttaatcctat ttaaggagaa tttagattat     24120
     gcagaaggtg gaactttacg ataaattaaa gatatatatt gccaggagag ggtgttgtac     24180
     attaaaagaa attgaagagg ctttaggaat tgatgaagga actgctttag tatatttgtc     24240
     caggttggct aaacaacatg tgataactag gaaatggacc agagactatc agggtagaaa     24300
     agttagatta tattgcataa gcagcggatt cttgaaggaa ataggtttat catgattaaa     24360
     ctggggagtt taacgataag aaaccttctt actcttcaac tataactaga aatcatattt     24420
     ttcatctcta cttttctcca ttaacttaaa caagtaaaga ggaaacctta atgtatttct     24480
     aaaaccttat cttagaaaac agactagccc tctcgagccc gtgacccggg ttcaaatccc     24540
     ggccgcggca ctaattttta attaaattga aaggttggtt gagaggttat ggccgaggtc     24600
     ggaaaccatc taggaaaaat tggaaaccat cttaaacaca cactggaaac taatagtatg     24660
     ccagtactgg atatagataa gctaactaat gagcaaaaaa tccgattatt tgcatatgta     24720
     acagaaaaag gaataactta tgaacagtta ggaatttcaa aagctactgg ttggaggtat     24780
     aagaaagggc ttagggaaat acctaaagaa gtaatggaga aagtactgag tttcctggct     24840
     ccagatgaaa tagccagggt agtttacggt aagaagatag agaaagctga tattaacgat     24900
     ttgttaaaag tgataaatac tgcagtagag gatcctcagt tccgttctct cctttttatg     24960
     atgctaaaca ggttcttagg agaatatgta aaacagaaca ctaacagtta tgtggtaact     25020
     gaagaagacc taaaactgtt tgagaaaatt ttagaacaga aaagcaaggc aacaaaggaa     25080
     gaaagactga gacatataaa atatgcgatg agggatctaa gtttttcact ttcaccggac     25140
     tctcttaagg agtatatagt agaattagcg gcggaggaag ggcctaacgt tgcaaggcat     25200
     agggctaata cacttaagct atttattaaa gaagtagtaa tgccaaaaaa cccaattata     25260
     ggccagatat tatacaattc ctttaaggta cctaaagttg agtataagta ttccccgccg     25320
     ccgctttctt tggatctact gaaaaagatt ttcgactcca tagaccattt aggtgcaaaa     25380
     acattcttcc tgattttagc cgaaactgga ctgagagtag gcgaagttta ttcattaaat     25440
     gttgaacaag tagacttaga aaacggaata atcaaactaa tgaaaagcag tgcaacaaag     25500
     agggcttata tttcattcct tcataaagaa acgattgaat ggataaagaa gaattattta     25560
     ccctttagag aagacttcgt ttccaggtac gaaaaagctg tacaacagat cggaggagat     25620
     acagagaagt ggaaactaaa gttcttccca tttcaattag ccgatttaag gagtgaaata     25680
     aaggaaggga tgaggagggt aggaaaggag tttagattat acgatttgag gagcttcttc     25740
     gcctcttaca tgactaaagc tggagtatct ccttttatta taaatgtgtt gcaagggaga     25800
     atggccccag ggcaatttaa aatactccag cagcactact ttgttatttc ggatatagag     25860
     ctgaagaagg tatatgacga gaaagctccg aaactcttaa gctaaaactt cgggtaactt     25920
     aacaataatg tctattttct tcttctcctc cattaaccgc ttccataagt tttccatgtt     25980
     cttcttagga agagataaca tatagatatc tttccctgtt ctataaacat tcctaatacc     26040
     tatgttcatt tccctgccgt ctatgattag tataacttcc cacactttag attttgaaat     26100
     gtaatgagta aaagatttag gaatgatgag agcgtaaatc ccgcccttac tatcatattt     26160
     atggaccgtc aatccaggga taagcagttg tgaaacttcc aaacttctca ccccttaaac     26220
     tccccagttt cacgccttat tctctctaaa acagccttca gatgtctgta ctgtgcttca     26280
     gcattatgta tttgtaaagc tatttccatt gccctgtaca atatattatt taatttccta     26340
     agctttttat tttcctcctt tagttgctgg ttctctcttt ctaatcttgc aatcttattt     26400
     tgcagtttag taatagtgtc tatagcttta gcgtattgta gctctaattc ctcatttctc     26460
     cttattattt cattaactgt cattctccca ccttaaagaa gtcctccagg tgagattgca     26520
     ccatcttttt ctccttattc ttcttagtcc atttttctgc ataagggcaa gaaagacgat     26580
     gaggtttcca atctggatca actggaattt tatag                                26615
//