Dbfetch

ID   CP000846; SV 1; circular; genomic DNA; STD; PRO; 2133 BP.
XX
AC   CP000846;
XX
PR   Project:PRJNA12997;
XX
DT   29-OCT-2007 (Rel. 93, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Acaryochloris marina MBIC11017 plasmid pREB9, complete sequence.
XX
KW   .
XX
OS   Acaryochloris marina MBIC11017
OC   Bacteria; Cyanobacteria; Synechococcales; Acaryochloridaceae;
OC   Acaryochloris.
OG   Plasmid pREB9
XX
RN   [1]
RP   1-2133
RX   DOI; 10.1073/pnas.0709772105.
RX   PUBMED; 18252824.
RA   Swingley W.D., Chen M., Cheung P.C., Conrad A.L., Dejesa L.C., Hao J.,
RA   Honchak B.M., Karbach L.E., Kurdoglu A., Lahiri S., Mastrian S.D.,
RA   Miyashita H., Page L., Ramakrishna P., Satoh S., Sattley W.M., Shimada Y.,
RA   Taylor H.L., Tomo T., Tsuchiya T., Wang Z.T., Raymond J., Mimuro M.,
RA   Blankenship R.E., Touchman J.W.;
RT   "Niche adaptation and genome expansion in the chlorophyll d-producing
RT   cyanobacterium Acaryochloris marina";
RL   Proc. Natl. Acad. Sci. U.S.A. 105(6):2005-2010(2008).
XX
RN   [2]
RP   1-2133
RA   Touchman J.;
RT   ;
RL   Submitted (25-SEP-2007) to the INSDC.
RL   Translational Genomics Research Institute, 13208 E Shea Blvd, Scottsdale,
RL   AZ 85004, USA
XX
DR   MD5; c02041753c3de45681ec1bb77c7fa9bd.
DR   BioSample; SAMN02604308.
DR   EuropePMC; PMC2538872; 18252824.
DR   StrainInfo; 373281; 0.
DR   PubMed; 18252824.
XX
CC   Source bacteria from Marine Biotechnology Institute Culture
CC   Collection, Marine Biotechnology Institute, 3-75-1 Heita, Kamaishi,
CC   Iwate 026-0001, Japan.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2133
FT                   /organism="Acaryochloris marina MBIC11017"
FT                   /plasmid="pREB9"
FT                   /strain="MBIC11017"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Acaryochloris marina"
FT                   /db_xref="taxon:329726"
FT   gene            complement(12..257)
FT                   /locus_tag="AM1_I0001"
FT   CDS             complement(12..257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_I0001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_I0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33471"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR35"
FT                   /protein_id="ABW33471.1"
FT                   /translation="MHGCIFFTSNFSIKKLSLKQLFFGTLVKSLFTPVAETLIFNSFLK
FT                   VVRIAAFSNQFYAAIRILFQSCQIQETSSSNQALVC"
FT   gene            complement(279..608)
FT                   /locus_tag="AM1_I0002"
FT   CDS             complement(279..608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_I0002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_I0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33472"
FT                   /db_xref="InterPro:IPR003609"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR36"
FT                   /protein_id="ABW33472.1"
FT                   /translation="MKKLVLLFFLSIAILAGSVTISHAQTFGPVFLVEYNTDRQGGDIR
FT                   SGFPVGNVGQCMNECASSSQCRAFTFVDVNQQPPNYNNNRPLCWLKRSVPGKRRNSGMI
FT                   TGVRQ"
FT   gene            complement(1103..1675)
FT                   /locus_tag="AM1_I0003"
FT   CDS             complement(1103..1675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_I0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_I0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33473"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR37"
FT                   /protein_id="ABW33473.1"
FT                   /translation="MTALAGLKDAQLFANGVYSAWEWVKACDGIRWFTDGERRYGQELW
FT                   QLASVYLKGDECHPDYGHRKVWREGLEVVMKVKGSQGNRRVEWVKTEHPFTAISPRSEI
FT                   HANHNEAHNAALRRRCSAYRRRQNLYAKKRLGLQRVLDVQRLIHNWVRPHWGLSKQTTP
FT                   AMEMGFCSRPLSTLELLTNKGFRYVPC"
FT   gene            complement(1786..2100)
FT                   /locus_tag="AM1_I0004"
FT   CDS             complement(1786..2100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_I0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_I0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33474"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR38"
FT                   /protein_id="ABW33474.1"
FT                   /translation="MECPYCQSEKILKRGFDSLQDGTLVQRYQCKDCNRRFNERTGTPM
FT                   ARLRTASSVVSYAIKARTEGMGVRSAGRTFGKSHTTIMRWEKRLADQAQNWSPPRTSSL
FT                   "
XX
SQ   Sequence 2133 BP; 597 A; 454 C; 453 G; 629 T; 0 other;
     gctagatcct gctaacagac cagtgcctga ttgctggatg aggtttcttg tatttggcaa        60
     gattgaaata ggatgcgaat agcagcataa aattgattac taaatgctgc tattcgcact       120
     acttttagaa agctattgaa aataagtgtt tcagcaactg gagtaaaaag tgatttaacg       180
     agtgtaccaa agaaaagctg cttcagactg agcttcttaa ttgagaagtt agatgtaaaa       240
     aaaatacatc catgcactac tcaaatagga attaaatatt actgtctaac tccagtgatc       300
     attccagaat ttcttctttt acctggtaca gaccttttta gccagcaaag agggcgatta       360
     ttattatagt tgggaggttg ctggttaaca tcaacaaatg taaaggctct acattgagaa       420
     gaactagcac actcattcat acactgaccg acattaccca caggaaatcc tgaacggata       480
     tctccaccct gacgatctgt attatattcc acaaggaaaa caggcccaaa agtttgtgca       540
     tgagatatgg tcacagaacc ggcaagtatt gcaatactta gaaaaaaaag taaaactaat       600
     tttttcatga ttgtttttct ccaaggtaga tcgtttttag cattaatatt ctgaaatgca       660
     aatatttcca gatttatagt gttacaaaac ctatttatag ttatctagta attaaaactt       720
     atgccaaagt tcatagtttt aaaagttcat tgttttaaat tagagttttt aagcgtaaca       780
     ccatttattt gctgaaatta aaggcttaat tttgaagatt ggctgattta cagagcttta       840
     agaagactga cataggctgt tttactaggt aattggtata aggtgtctaa gaacctcggt       900
     actttgatgt cttatctttt accttttcct tgtttatgca tttatttata ttttgtaact       960
     ttttaatagg tatgaagtgg gatgcaatgc cctataaaaa accccgaaaa caggagagtc      1020
     acgggggatt aagaaggttg ataaattctt gggtttgctt tgaggtgcga tcgtgggttg      1080
     gatgagtgcg ggcactggtc tactaacagg gcacatacct aaacccttta ttggtgagga      1140
     gttctaaagt actcagtggg cgagaacaaa atcccatctc catggctggt gtggtctgct      1200
     tactgagtcc ccaatggggt ctaacccagt tatgaatcag gcgttgtacg tctagcactc      1260
     gctgtaaccc caaccgcttc ttagcgtaga gattctgccg ccttcgataa gcactacatc      1320
     gtctcctcaa ggcagcattg tgagcctcat tatgattggc atggatctca gaccttggac      1380
     tgatagcggt aaagggatgc tctgttttca cccactctac tcgccgattc ccctgagacc      1440
     ctttaacttt catcacgact tctaaccctt ctcgccaaac cttgcgatgc ccatagtcag      1500
     gatgacactc atcacctttg agatagacac tggcaagctg ccaaagttct tgtccataac      1560
     gcctttcacc atcggtaaac catcgaatcc catcacaggc tttcacccac tcccaagctg      1620
     agtaaacgcc atttgcaaaa agttgtgcat ccttgaggcc agctagtgct gtcaaccaat      1680
     agcggctttc gcgttcaagg aagtggatgg tccagccctg ggactggctg ggggggaaga      1740
     tttttgccta cacgagtgta tacttcatcc ccttctaccg tcacatcaga ggctgctggt      1800
     gcgggggggt gaccagttct gtgcttggtc tgctaggcgt ttttcccaac gcataatggt      1860
     ggtatgagat ttaccaaagg tacgacctgc tgaacggacc cccattcctt cggtgcgagc      1920
     tttgatggca tagctcacca ctgaactagc ggtgcgtaaa cgagccattg gggtgcctgt      1980
     gcgttcgttg aaacgacgat tgcaatcctt acactgatat cgctggacta atgtcccatc      2040
     ttgcagacta tcaaagccac gcttaaggat cttctcactt tgacagtatg ggcattccat      2100
     tgatctacat caggttccgt cgaaggcatt ata                                   2133
//