Dbfetch

ID   CP000845; SV 1; circular; genomic DNA; STD; PRO; 120693 BP.
XX
AC   CP000845;
XX
PR   Project:PRJNA12997;
XX
DT   29-OCT-2007 (Rel. 93, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Acaryochloris marina MBIC11017 plasmid pREB8, complete sequence.
XX
KW   .
XX
OS   Acaryochloris marina MBIC11017
OC   Bacteria; Cyanobacteria; Synechococcales; Acaryochloridaceae;
OC   Acaryochloris.
OG   Plasmid pREB8
XX
RN   [1]
RP   1-120693
RX   DOI; 10.1073/pnas.0709772105.
RX   PUBMED; 18252824.
RA   Swingley W.D., Chen M., Cheung P.C., Conrad A.L., Dejesa L.C., Hao J.,
RA   Honchak B.M., Karbach L.E., Kurdoglu A., Lahiri S., Mastrian S.D.,
RA   Miyashita H., Page L., Ramakrishna P., Satoh S., Sattley W.M., Shimada Y.,
RA   Taylor H.L., Tomo T., Tsuchiya T., Wang Z.T., Raymond J., Mimuro M.,
RA   Blankenship R.E., Touchman J.W.;
RT   "Niche adaptation and genome expansion in the chlorophyll d-producing
RT   cyanobacterium Acaryochloris marina";
RL   Proc. Natl. Acad. Sci. U.S.A. 105(6):2005-2010(2008).
XX
RN   [2]
RP   1-120693
RA   Touchman J.;
RT   ;
RL   Submitted (25-SEP-2007) to the INSDC.
RL   Translational Genomics Research Institute, 13208 E Shea Blvd, Scottsdale,
RL   AZ 85004, USA
XX
DR   MD5; 700a7154bf8e7800f181d65629937fb7.
DR   BioSample; SAMN02604308.
DR   EuropePMC; PMC2538872; 18252824.
DR   StrainInfo; 373281; 0.
DR   PubMed; 18252824.
XX
CC   Source bacteria from Marine Biotechnology Institute Culture
CC   Collection, Marine Biotechnology Institute, 3-75-1 Heita, Kamaishi,
CC   Iwate 026-0001, Japan.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..120693
FT                   /organism="Acaryochloris marina MBIC11017"
FT                   /plasmid="pREB8"
FT                   /strain="MBIC11017"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Acaryochloris marina"
FT                   /db_xref="taxon:329726"
FT   gene            28..1722
FT                   /locus_tag="AM1_H0001"
FT   CDS             28..1722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0001"
FT                   /product="transposase, putative"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33354"
FT                   /db_xref="GOA:A8ZQR8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQR8"
FT                   /protein_id="ABW33354.1"
FT                   /translation="MNGRDLGLKQADAAYIAEISTRTGQRIEAGTHQPNRGRLQDQRTV
FT                   PDPLADVWEDELEPMLRRDPRLKPMTLYEYLQDKYPGQYPQVLRTLQRRVRTWKALHGP
FT                   SPEVMFELRHEPGVQGFSDFTELKGITITIAGKPFEHLIYHYRLGYSGWRYAQIIEGGE
FT                   SFVALSEGLQNAFAACGGVPTQHRTDSLSAAYRNMGGRRSKNLTRLYDELCDHYRLEPT
FT                   RNNKGVAHENGSIESPHGHLKNRIKQAIYLRGSADFTSVAEYQALIDAQVAKLNQQCQT
FT                   KYEQEKDHLQPLPKYRTPDYEVLTAKVSKRSTIDVRCILYTVPSRLIGRQLELHLYHDR
FT                   IVGYLERHPVVELPRKRVSGKGKRRDRCINYRHVIGSMRLKPRAFIYCTWQSDLLPNPE
FT                   YRQIWEQLKAQFDLEQAAKIIVEALYIAAVQDKEQAVAVYLQQQLRSSSLTLNRLKKQF
FT                   EPPQMKQVPELSIEQHSLELYDKLLPSCSVPAEPLPAPEPLFKKAQALPHVDPLGIYRI
FT                   PSHAGKLVLCGILTSLVRNGGPTKRTSSSKTCPHRSQAPKRKKFYQL"
FT   gene            1550..2281
FT                   /locus_tag="AM1_H0002"
FT   CDS             1550..2281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0002"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33355"
FT                   /db_xref="GOA:A8ZLR9"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLR9"
FT                   /protein_id="ABW33355.1"
FT                   /translation="MLTHWESIESQAMQENWSYAEFLLALCETEAQRREQARLKRALTE
FT                   ARLPNAKSFTNFDFSHCPQLNPAPLMQLAADPGWLERAENCLILGPSGVGKTHLATGVS
FT                   KKMLEFGKRVKFFAANALVQQLQQAKLQLQLHPMLKKLDRYDLLILDDLGYCKKSEAET
FT                   SVLFELIAHRYERKSLLITANQPFSQWDDIFTDSMMAVAAIDRLIHHGLIIEIQADSYR
FT                   RKSATQRTAQTQSQPQKSQSK"
FT   gene            complement(2439..3584)
FT                   /locus_tag="AM1_H0003"
FT   CDS             complement(2439..3584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0003"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33356"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLV9"
FT                   /protein_id="ABW33356.1"
FT                   /translation="MDNSIRIPLNLPDIRVLELSKTERGDWLIKIESTLQGTTCHQCGR
FT                   EITDLHCHDQPFRIRHLPLFEVPVYLEIRPKRYRCKYCDDHPTTTQHLEWHEPRSPNTK
FT                   AYERWLLRILINSTVSDVARKLGVSEDIVSGIIDRWIAAQVDWSEYADLKVMGMDEISL
FT                   KRGHRDFVVLITIPTTDGVDILAVLADRKQQTVANFLQSIPIDLRQTIERVCTDMYQGF
FT                   VSAVREQLPQAKIVIDRFHVTKAYRNCADTVRKREVKRLRRELSKQEYDSIKGAMWPFR
FT                   KRPENLKESEQQLLERLFAYSPQLKQAYNLREKLTQIFEGRYTKHGAKCAIRAWCKQVL
FT                   KSDIKEFDCFLTTINNWMDEMTNYFLEGWTSGFVEYWMSTP"
FT   gene            complement(4247..8176)
FT                   /locus_tag="AM1_H0004"
FT   CDS             complement(4247..8176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="Shows homology to DNA helicase but no HMM support"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33357"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR024385"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQS1"
FT                   /protein_id="ABW33357.1"
FT                   /translation="MLDITTISSNIKDGARYYTKEESYYSQNEEVQEMTESEWFGSMAP
FT                   HEPYSPELFTKMFYGDLPNGQRMRGMVLGKGKERLAYDLTFKVPGKSLSMAIHGPNGDK
FT                   RLWKAHVESIKEVLTIIEDQYAAARKMESGDRQIIKTGSLAATLVHHHESRAGDPHVHT
FT                   HVVLFNGTLCPDGEFRALYKELLTRSGVLGDIYHQKLALKIQEMGYEIRETDTGFELAG
FT                   VTDEQIEAFSKRSTEIEDYLKVKGWSNTPANRQKAVFETRIAKDITESLEDKQDRWGTE
FT                   MQVVGFHGITPASHPITPQNQETPRELLDAAIGHLSERQSSFSREDIQRFVFSHLRSFD
FT                   EKPLNQEIDTHPDLLDAWDGRYTTQTAVDRDIRIIDNWLKGNDSVTPLNPNADFSHTQL
FT                   NSGQSEAMKRLLSSPDQYQILKGLAGTGKTTAMGIAREQLPPETVIKVFAATHNAKNAI
FT                   AESFDLEGATIAQLAVSEPTPEPNQLWILDESGMVGSEDFEMVMNKAAKVGARVWAVGD
FT                   TGQNGAIAAGAPVRMLMHSGATVHKLSEIIRQQNKEQKTAVKLIAEGHGIEALSVLEKH
FT                   GHIHEVVDADTKISAAVKQYISLPQSRRDKTLVVIGTNAEREAFTDQLRVRLIEEGKLT
FT                   QNTEFTQLKNRNLTKVQKKRAENYRKGDLLILHRKHRTYTQLQTHVPYKVLAVEGQHLR
FT                   VVSPGGRQFKINPAQHERTEVYTAKKNHIAVGDQLRFTSTNKKEGIYTHAYLECINIQE
FT                   GIATVQGNKGQLHQLDLSKPQQIDHDWATTTYRAQGGTNSETIYIASLNPSSARESFYV
FT                   GISRHRTKHISVFTESLEDLKEWVATSNAQENAIETLFDPHEGWTPDYMGVEKPWQLDT
FT                   DTWTEMKGSGIHPSLLTPEHLRSEAGSSEPSIRDNVLLEALLGAEFTKPKYGAGQEVTN
FT                   EMKRKLNGTHKVNGKWVDDPERAYTRIAEGGGWIGYGGTDLLSVIEGNPQPSSYCQVKP
FT                   KTPRIFDGEEVKYETPKGVDQQVFLPHIPDEITELIYQRNAISPTPEERAKGVWYVADQ
FT                   YNLPIVLTEGLKKTWASLSQGHLTVGLPGVTALYRAKDEFDNRLPQRELTEYGKALAKP
FT                   GRKITFAFDQDTKLSAIFNVRRDLVRTIELLQAEGVVCKLAPWNPKLGKGLDDVIAKVG
FT                   PRYYNAAIANAISPDAEVKRHYKGQYNSIAKRVQKRLGEMPKERVDLEIYAYCKEHAEL
FT                   NDAYRFISESDHMRAATPEQKRLYLLAIHKVSPIYEELMNSDKPINFNQRMPEMVQNRI
FT                   KLQIVKEKPTPLQSEQINFDIGQSY"
FT   gene            8325..9566
FT                   /locus_tag="AM1_H0005"
FT   CDS             8325..9566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33358"
FT                   /db_xref="GOA:A8ZQS2"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQS2"
FT                   /protein_id="ABW33358.1"
FT                   /translation="MANEEQLSLLKQGVEAWNSWREENLDVEIDLSSADLRNADLRDAD
FT                   LRDADLFNADLFNASLSNASLSGADLTNANLRDASLSNADLSKANLRFASLRYADLSKA
FT                   NLSNASLYEAKLFGANLSNADLRLSKAIRTNFMDADLSGTCITDWHIIRGTNFECVKCS
FT                   YIYLGYNLEQEKFTDRLPVNPDQEFKPGEFEEWIKDSAEAQQTIDLTFTEGIDWQAFSQ
FT                   SLQGVRQKYPDSGVGLQAIEEKGTAFVIRLKTSLDADQGVIKSSQKELYETQLQLREAQ
FT                   GENRVLREMSEVLEKLASRPTTNVDFNRETQGSDKSNLLMTFLSWFQNGQAIIAIIALV
FT                   LGVASTYFIPKMFPNGFPPVNSDPQPEVIQSAPSSPRTEIGIGKRMAQQVHQFLLTSEQ
FT                   ADRHVNAESLKLNQ"
FT   gene            9986..11011
FT                   /locus_tag="AM1_H0006"
FT   CDS             9986..11011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33359"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQS3"
FT                   /protein_id="ABW33359.1"
FT                   /translation="METESIEAIVIDLGTSLTKVLYYQQGQYHFFAQSSSVLELDHRKY
FT                   QQHAAHPQTKTHAIWTEGAGYLVGRGASQPYEEVDLSQTKATSAIAKVLAAIGEIKDRV
FT                   NSDKAIKLENVILLLPLKERKEYETLKTAIVKALYGFGFNGKTTKFWVGRFNIQYEGYG
FT                   ITTISTEERAAFAVFGQKDLTIGAMNQGDLTPNMSQTLVGWGMSKVLEEVQYTFESDVY
FT                   GAKCVYSYNQRRTNLKKLIPAEKVEFVSASIDRALSSSWYQIERKLDSSQALMDAVTIY
FT                   VTGGSSQLWRKQLKGVYGRRLNCLDGIAREIAETFPQLDKDPMILRMADAYLTIRGMVA
FT                   A"
FT   gene            11008..11415
FT                   /locus_tag="AM1_H0007"
FT   CDS             11008..11415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33360"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQS4"
FT                   /protein_id="ABW33360.1"
FT                   /translation="MSNRKTLNLNFSTRPTTRLAATIDTMNELYGTDIKAATANLLEYM
FT                   MAPMTAALSGASRSEVDALIAKSLARARLHLESARLHLPCDELPEKVAEPFAAQEASCL
FT                   SSPQEDSSPPPLDEDEEFDYSKPIGVFDDDY"
FT   gene            11405..12091
FT                   /locus_tag="AM1_H0008"
FT   CDS             11405..12091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33361"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQS5"
FT                   /protein_id="ABW33361.1"
FT                   /translation="MITSEILDLLKVDDAELEEILEACDWTGTTEFTDEQSETLLVMKA
FT                   LHDEKGHDYIDAYLRSIGQRLQVNDTLFNEIYAAIEAANGFLIDYRERFEEICQLVNDC
FT                   ISPAEAIIPPQPVVEDTPPEVKNEADPESVQMDRFIDEQANAAIATTISQIKGFADLAY
FT                   EEQERLKTLFMTKYRQGLAKELLSEEFKAEFMARMTASLEGKGEEKKQGELTGVKNPTP
FT                   LLSSSN"
FT   gene            12100..12366
FT                   /locus_tag="AM1_H0009"
FT   CDS             12100..12366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33362"
FT                   /db_xref="GOA:A8ZQS6"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQS6"
FT                   /protein_id="ABW33362.1"
FT                   /translation="MDGLLAENEKAIKQRIVDLKLKDKEISQLEKLQRIKRTEREIKRE
FT                   GTWFKVAFIGIGILIGVPVGGFLNHLAGQNAAVSSPIEQVSGK"
FT   gene            12363..12488
FT                   /locus_tag="AM1_H0010"
FT   CDS             12363..12488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33363"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQS7"
FT                   /protein_id="ABW33363.1"
FT                   /translation="MISGVVLGFAIANPDTNTPKSHLLNTLSFSLFQFLERFYIA"
FT   gene            12505..13056
FT                   /locus_tag="AM1_H0011"
FT   CDS             12505..13056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33364"
FT                   /db_xref="GOA:A8ZQS8"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQS8"
FT                   /protein_id="ABW33364.1"
FT                   /translation="MFFFASTSLVFGLMSMGFCGWAMRNNAAYKKIDIQLLGLMLSVVC
FT                   SSSLGIVAVLYPYLDSSGSVAVKQELIGEIEPNDSSESLPLYLDVLNKTASQKFGDELV
FT                   TLFQEPSRYVIVKKNGLLKSEKSKDLNTLAQSDCDQILEIAGSKRIYIRYIDVGAASIK
FT                   DFDCDLLAELERNLPMKLRR"
FT   gene            13221..13697
FT                   /locus_tag="AM1_H0012"
FT   CDS             13221..13697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33365"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQS9"
FT                   /protein_id="ABW33365.1"
FT                   /translation="MNNKFLNGFFRCSLIVAGISVCQWFNPVNRQPSKDASVKHRTPAL
FT                   SERDEIGRLKRAININGKDKLGDQFIGASRVKDRIEIWKQTDLIRSGNPKSLNALAKSD
FT                   CDKALRIFGIGPVNMFSFDPIDIEYFDEQAPDAKRFRCDQMAALERESYIRPKE"
FT   gene            13712..13828
FT                   /locus_tag="AM1_H0013"
FT   CDS             13712..13828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33366"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQT0"
FT                   /protein_id="ABW33366.1"
FT                   /translation="MDFVLPNSISHSSTQTKTQSFEIPTESILPRQFLLNHS"
FT   gene            13922..14146
FT                   /locus_tag="AM1_H0014"
FT   CDS             13922..14146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33367"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQT1"
FT                   /protein_id="ABW33367.1"
FT                   /translation="MTTNPFFGYYEQIWIDYQTDYGQHPDPCTRLPSDQILDRVSSWLA
FT                   EFNPLLPPESQLSESIQVGIVQRFYGWQL"
FT   gene            14447..14653
FT                   /locus_tag="AM1_H0015"
FT   CDS             14447..14653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33368"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQT2"
FT                   /protein_id="ABW33368.1"
FT                   /translation="MPNPNPKHAHLKPQPRADNSTGKLSKSISIRLEQDVYESLSKKYS
FT                   GSGELRAWLRKVTREAAEKEGLL"
FT   gene            14818..14958
FT                   /locus_tag="AM1_H0016"
FT   CDS             14818..14958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33369"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQT3"
FT                   /protein_id="ABW33369.1"
FT                   /translation="MPFEIDVLLQEQLGKQVLSCDFLEGGSVFHFEGYTLKLGSTELSQ
FT                   N"
FT   gene            complement(15134..15628)
FT                   /locus_tag="AM1_H0017"
FT   CDS             complement(15134..15628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0017"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33370"
FT                   /db_xref="GOA:A8ZQT4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQT4"
FT                   /protein_id="ABW33370.1"
FT                   /translation="MITLTRTTADHILKLRHQVLRPGLPIAEVIFAEDQDQETRHYGAI
FT                   HQHGEIICCATLIPSTWHGEPAWRLRAMATAPGWRNQGIGTGLIRYLLEDLQESNQARP
FT                   IWSNARVSSARFYRELGWREVSEQFENGNAGLSVTMLKEEKTLAAGQVPGAGIGSRIRL
FT                   R"
FT   gene            15901..16482
FT                   /locus_tag="AM1_H0018"
FT   CDS             15901..16482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33371"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQT5"
FT                   /protein_id="ABW33371.1"
FT                   /translation="MALMIPPKCLVSSAATLTTLDPSDFSGEPQITFDALPNQTSLNGR
FT                   VINGVRFSFGIGTSPGTDAPFQGVGSVEYGFQFSRQRHITSPYVNFAGPLILQFPKKLT
FT                   QFGYGFAIGTNSDVIPSLTTVELFKGTTSLGSLSFDGRRDGPNIFGSTNGGFAGVASDI
FT                   PFDRAKIKINALSPYAVDNIRYVSVPFKGL"
FT   gene            16714..17382
FT                   /locus_tag="AM1_H0019"
FT   CDS             16714..17382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33372"
FT                   /db_xref="GOA:A8ZQT6"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQT6"
FT                   /protein_id="ABW33372.1"
FT                   /translation="MIWRSRLLLLTFSSIVLTGNIQLQSVRAANIKYDFTVDFPPLPFR
FT                   QPLQGQKGAGFLTIDDTSQPIFSDTRSGIPLDFYEVEQLNFSLLGQTFTKQDDIAANRP
FT                   LQRFPLVAFQGERLQGLDFAVNRKSRTGLGFIFQVDTLSLSDEFFSPSDGDFTGNIGAI
FT                   VGPGFSRSIVAAQGSGLSLGRVKFRRVPLDDGAVSIVLSIFLSSLIVVYRQRKQQQPLP
FT                   "
FT   gene            complement(17684..17812)
FT                   /locus_tag="AM1_H0020"
FT   CDS             complement(17684..17812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33373"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQT7"
FT                   /protein_id="ABW33373.1"
FT                   /translation="MAATKLPPSKGEPQNLKAKSKSDSFGLIGLTSVIFAMAVNKY"
FT   gene            complement(18127..21120)
FT                   /locus_tag="AM1_H0021"
FT   CDS             complement(18127..21120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0021"
FT                   /product="TPR repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33374"
FT                   /db_xref="GOA:A8ZQT8"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQT8"
FT                   /protein_id="ABW33374.1"
FT                   /translation="MGGIGKTELAWEYAQRSLSQKIYPGGICWLRSRDQEIATQIIDFS
FT                   KSHLGMKPPDDLEAKAQVSFIWQRWPKGEVLIVVDDVVEYELVASCLPLWNPRFKALIT
FT                   TRLDFGRSVRSLCLEELDNESALELLGSLVGQDRIQIQLEDAKSLCAWVGNLPLGLELL
FT                   GRYLSNDQDLTIHDLIQELESMRLHAEALCEREDGMTAQLGVAAALELSWKKLKDFEKE
FT                   LACLLGIFSIAPIPWKHVESCLPETSVREIVKARNKGLLKRNLLKRIGKGTYQLHQIVQ
FT                   EFFRLKLDELTEKGESLKTAYCNAMVGIAQRIDGRSTIDVIAEIQGSIPHLEELIRQWI
FT                   DHLSDDELIWPYVGIGRFYEGQGNYDLALPWRQRCLKQCQHKFGSEHKNTATSLNDLAA
FT                   LYYYQGRYEEAESLNIQALNMYKRLLGNEHPDIAQSLNNLANLYTDQGRYKEAEPLYLQ
FT                   ALQMYQKLLGNEHPDFALGLSNLASLYDNQGRYEEAESLNIQALNMYKRLLGNEHPDIA
FT                   QSLNNLATLYDNQGRYEEAESLNTQALNMYKRLLGNEHPNIAKSLGNLATIYGHQRRYA
FT                   EAETFFIQSLEMKQRLLGDEHPDVAKSLNNLAALYYLQEQYLDAEPLYTRALEIFHKLL
FT                   GDEHPDVAASLSNLANLYCNQGRYKEAEPLCTQALKIFQKLLCNEHPNVAQGLNSLANL
FT                   YDNQGRYEEAEPLFIQALEMRQKLFGNEHPDVAQSLNNLATLYDNQGRYAEAEPLFIQA
FT                   LEMRKKLFGNEHPDVAQSLNVLAGLLDDQGRYEEAEPLYKQALQMRLKLLGHEHSDVAN
FT                   SLNNLAELYRNQRRYEEAEPLHKQALEMRQQLFGDEHPDVASSLNNLALIYSNQRRYRE
FT                   AEPLYKQALEINQKLLGNEHPFLASSLNNLAGLYACQRRCSEAEPLYVQALEMRQKHLG
FT                   NKHPDVAQSLNNLAYLYAYQRRYSEAEPLYVQALEMTQKLLGNEHPDTAAVQNNLDVCR
FT                   QAIKASNR"
FT   gene            complement(21289..21780)
FT                   /locus_tag="AM1_H0022"
FT   CDS             complement(21289..21780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33375"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQT9"
FT                   /protein_id="ABW33375.1"
FT                   /translation="MLKVSVNPRKSPDNLLDAFILSAMTEPLTFTAAAIVSLAFQKAIE
FT                   AAGSETGKKFATSAYALIDQLRTKIWSKFKGKEKAEAALQKADAGNTEALNAVISYLNV
FT                   EMLESEDFAKEIQQLAHEINLHVIEDNSSQVQNNYGGTNYQNKISGGVVNQAETINIQN
FT                   "
FT   gene            complement(22280..22459)
FT                   /locus_tag="AM1_H0023"
FT   CDS             complement(22280..22459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33376"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQU0"
FT                   /protein_id="ABW33376.1"
FT                   /translation="MLLDASLPRSLNMIVIRNLIAQSLTRTRLISRWVVMTFEGWYGLK
FT                   VMPHNAGFPGPGLQ"
FT   gene            complement(22482..22595)
FT                   /locus_tag="AM1_H0024"
FT   CDS             complement(22482..22595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33377"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQU1"
FT                   /protein_id="ABW33377.1"
FT                   /translation="MAALKLPPSKGEPQNLKAKSNSNFFRWIGAFFNPPYE"
FT   gene            22733..23230
FT                   /locus_tag="AM1_H0025"
FT                   /note="fragment; similar to N-terminus of transposase"
FT   gene            23301..23981
FT                   /locus_tag="AM1_H0027"
FT                   /note="fragment; similar to C-terminus of transposase"
FT   gene            complement(23965..24462)
FT                   /locus_tag="AM1_H0026"
FT                   /note="fragment; similar to N-terminus of transposase"
FT   gene            24670..25296
FT                   /locus_tag="AM1_H0028"
FT   CDS             24670..25296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0028"
FT                   /product="resolvase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33378"
FT                   /db_xref="GOA:A8ZQU2"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQU2"
FT                   /protein_id="ABW33378.1"
FT                   /translation="MLIGYARVSKVDGSQVLDLQMDALLEAGVPENRIYKDRVSGKTAR
FT                   RPGLKACLKALQPGNTLVVWKLDRLGRDLKHLVDVVGELRQREVGFKVLAGAGAEIDTT
FT                   TANGRLFFAVFAALAEYERELIAERTRAGLKAARARGRMGGRPRKMDVATLQMAMSAMS
FT                   DPRACAKEIAQKLGMTTATLYTYVNGDGSAKAAGLRLLDRSREVQ"
FT   gene            25349..26209
FT                   /locus_tag="AM1_H0030"
FT   CDS             25349..26209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33380"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQU3"
FT                   /protein_id="ABW33380.1"
FT                   /translation="MDKQTPLSIWNQLNSRQQKYLELIYQADQSAERFEKMSWNNGRRS
FT                   RPASVWRWLYYGDIDDRPSPLKSRLLRAELVDNGTGSTLNALERRTLIECDGTVPELYI
FT                   KVTRLGRKAVRTGTNESVFKAPRTPKGMLSYKAWQAMVLVFKAGKEGVQHDGYSKYTEG
FT                   IHMYTWRHLEQLAPPLIQGYSCSRFTAFGFIYYSRHYEQYRETYPDIDTPESRLTIDDI
FT                   INKLRAFRMQTLVQLVQMKRGVKGIQEAADEIGTPVSFAALSQFEDGQTIKLEQLEKII
FT                   DWLVQ"
FT   gene            complement(26163..27218)
FT                   /locus_tag="AM1_H0029"
FT   CDS             complement(26163..27218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33379"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQU4"
FT                   /protein_id="ABW33379.1"
FT                   /translation="MTKLITRLVSAKTSDPQGDLSANPQIDSAPQLSVEDIWDTLADRD
FT                   LYRLSIEIDSGLRLSTRLDAEDLGLDPHVVDELAGGYRKAFSEAFTKARNQLSGLQKKF
FT                   NKKFTIYVKPFRFIDGSIINDAVDFAQEIKKEAASLRQGLVDTYTDQLKTFLVELEQKL
FT                   NETIPGKKKQIEKALIYYAGEFPSIDDFSGSLQVIIDGPVQLTSLKNKLKADADLQAEL
FT                   AQKKRLTAKQKKEAQEIQERIKTSQLMLNGIAQAVQQSRVACLDEGWELLADLIDRFGA
FT                   SPDGKLTSKDQSAINSTFSRLELLEKHNPEISKHLDQRGHLNRKLRFRLKHFPSGFIEL
FT                   ASQLSSPVVQA"
FT   gene            27328..27750
FT                   /locus_tag="AM1_H0031"
FT   CDS             27328..27750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33381"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQU5"
FT                   /protein_id="ABW33381.1"
FT                   /translation="MDLRDFQDKSLAELEEIFLEPPETGSDALLSSGLALKTIQDNKLY
FT                   LPDSKGFKVYVEANLGVTYIHAFRCIQAAELVLFLQQHFSVLPQSESAARPLVKLSRAN
FT                   QLKAWGEVVRITAGDKWAPGKDRIKKTIAGLGLEKV"
FT   gene            complement(27808..28221)
FT                   /locus_tag="AM1_H0032"
FT   CDS             complement(27808..28221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33382"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQU6"
FT                   /protein_id="ABW33382.1"
FT                   /translation="MISIPSLSLDQLEILRLAKRYSVEEFELAYESPVNNDLESPMGHP
FT                   ALIQGLIDAGLISVQVKGSFLRASEYQQESWAKYCVGIDHPTQEDWELWRRSFMARKEE
FT                   GIDSLMIPGSSFKQFSNVWIREVDVQFVQPSNL"
FT   gene            complement(28290..28403)
FT                   /locus_tag="AM1_H0033"
FT   CDS             complement(28290..28403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33383"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQU7"
FT                   /protein_id="ABW33383.1"
FT                   /translation="MDIFDPEKAYVAACDKGRSWSNQLVTWKKIVSYSNPW"
FT   gene            28404..28580
FT                   /locus_tag="AM1_H0034"
FT   CDS             28404..28580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33384"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQU8"
FT                   /protein_id="ABW33384.1"
FT                   /translation="MVNCQIEPVIVWLTSRLSKVYAEGMRTKVEKDMGFRHMLAGYGNL
FT                   KSLHRFAVFINEG"
FT   gene            complement(28728..28919)
FT                   /locus_tag="AM1_H0035"
FT   CDS             complement(28728..28919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33385"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQU9"
FT                   /protein_id="ABW33385.1"
FT                   /translation="MPMERVEIIIRYYRKPIRVMVDPGKNHPRYERDWLLGWICQGESR
FT                   TPVLKKYPDAKIVSKQKT"
FT   gene            complement(28927..29190)
FT                   /locus_tag="AM1_H0036"
FT   CDS             complement(28927..29190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33386"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQV0"
FT                   /protein_id="ABW33386.1"
FT                   /translation="MQQLFAGQKELQQSQMQLISNIADLKDVVLANAEQISSLGQTVSD
FT                   LRSITSDLVGYSINQEGDIQTVREDLQALKRRVDAIDGSSSV"
FT   gene            complement(29229..29474)
FT                   /locus_tag="AM1_H0037"
FT   CDS             complement(29229..29474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33387"
FT                   /db_xref="GOA:A8ZQV1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQV1"
FT                   /protein_id="ABW33387.1"
FT                   /translation="MIKVVIPETMPMINTVKEFLDSRGITPYALGGDAGISKTTAYALY
FT                   KNPDQLPSPDVLRKICDTYEIQPGLLMKWEKDTRKS"
FT   gene            29673..29975
FT                   /locus_tag="AM1_H0038"
FT   CDS             29673..29975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33388"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQV2"
FT                   /protein_id="ABW33388.1"
FT                   /translation="MTTLTEAPTTVTELLQLVDSQVTDPLHPEVIAVEMQIEKYPGVCE
FT                   GGDLFEVYAPVKSKPGLIQPRLESWVKTFYGDDHWLADWRTIPTTRQIKAENEEF"
FT   gene            30045..30422
FT                   /locus_tag="AM1_H0039"
FT   CDS             30045..30422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33389"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQV3"
FT                   /protein_id="ABW33389.1"
FT                   /translation="MITAEDLQAELAHCHCSESHYQHWLGIRYTEGVKTLAEKGECFWL
FT                   LDAIASYQRVRLIKCNPNLQEFQLWLLTVNDGHSAVLACYEDSPSTCSPVITQDIPFTD
FT                   FVLPEIKLYVEYGVVLLPSEH"
FT   gene            30488..31471
FT                   /locus_tag="AM1_H0040"
FT   CDS             30488..31471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33390"
FT                   /db_xref="GOA:A8ZQV4"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQV4"
FT                   /protein_id="ABW33390.1"
FT                   /translation="MNPKDYDRTIIMFSGGKDSLACILWAIENNCPKIELWHHLVDGLP
FT                   VQGQTASTLMDWPITSGYCKAVARLLSLPIYFSWLEGGFEREMNRSNQAKAKTWFETPD
FT                   GLHSAGGNGGKQSTRQKFPQISADLSVRWCSAYLKVDVGAIAIRNQSRFNDSKTLVITG
FT                   ERAEESPARANYAEFEPDRTDNRDGKSNRHVDRFRPIHGWKESEVWAIIQRHGIIPHPA
FT                   YHLGWGRLSCMSCIFGSPNQWATIRKIAPAHFERIANYEQRFCTTIQRKRSVHELANLG
FT                   TPYAEANNSQLVKMALSSEWGDYPIWTHPQAWALPAGAYGESNGPT"
FT   gene            31579..31908
FT                   /locus_tag="AM1_H0041"
FT   CDS             31579..31908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33391"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQV5"
FT                   /protein_id="ABW33391.1"
FT                   /translation="MNKPTTRYQLIPRVQFTTTIELHDQQTAILNRLVLSSKDLTDDEA
FT                   LDLWLSINPYVHTFQHSTPRDIFSSLRYAALAALPNNPKPSYPVELLNSVRSEIEADGQ
FT                   DFICC"
FT   gene            complement(32006..32152)
FT                   /locus_tag="AM1_H0042"
FT   CDS             complement(32006..32152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33392"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQV6"
FT                   /protein_id="ABW33392.1"
FT                   /translation="MTLNKTAVTSNQIDQSSKIIHGEGGFRVLTMVEKDKRVFQRALNL
FT                   GQS"
FT   gene            32266..32904
FT                   /locus_tag="AM1_H0043"
FT   CDS             32266..32904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33393"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQV7"
FT                   /protein_id="ABW33393.1"
FT                   /translation="MTATLDNNATRNALTKAIKEHIDPAKPEKVNIKKYIVKQYKPDDP
FT                   TGQDKLAKFAWELHHGNRNLRNRDHVLELFGLLTLEATGLEQRKTNKAKCSPLKEAVFK
FT                   VLKQVAGQDILMIVALNELMDQLTVTRINSWETFFKQLAIKRTELESLADTVYELSGVS
FT                   PGAVEDLDAVIVPLYNEAKGQDIKAINWERRSWWDWAHTHLLERVSKAA"
FT   gene            33003..33383
FT                   /locus_tag="AM1_H0044"
FT   CDS             33003..33383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33394"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQV8"
FT                   /protein_id="ABW33394.1"
FT                   /translation="MQAHHLNLAEFLLNPPTVNLAYSPVAVMTVATAKNLMQSQELLLS
FT                   GAQKLFNPAVWPQLEPEIERIPFDRQKAQCFRDCVAYLMAEATTLRSERRHVDALKHME
FT                   AALMLEALTHSGYDEGPFVSEQ"
FT   gene            33457..33789
FT                   /locus_tag="AM1_H0045"
FT   CDS             33457..33789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33395"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQV9"
FT                   /protein_id="ABW33395.1"
FT                   /translation="MNHTTLPRLVIDSIDLPYYELHTRSTADNDRKLNVFFGSRLIGYV
FT                   YINFIQGQSNYVGTTLRHQSFGPFSRRMEAAEAVLEAFNAGLTDEQRLRVALAHEMAEN
FT                   LTVIAC"
FT   gene            33822..34232
FT                   /locus_tag="AM1_H0046"
FT   CDS             33822..34232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33396"
FT                   /db_xref="InterPro:IPR025475"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQW0"
FT                   /protein_id="ABW33396.1"
FT                   /translation="MPTIHIANLRKSRQLQPGVRCDRGTPLGNPFHMFAESERDRCIAA
FT                   FRVFLYEVAILGNEPSQDLIRRIAEQHKIMPSGSYKPFGRGAMMAVLEALGQKSEVTLL
FT                   CWCHPKPCHCDVIKAFLEWKCPAPQQQTLEVL"
FT   gene            34376..34618
FT                   /locus_tag="AM1_H0047"
FT   CDS             34376..34618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33397"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQW1"
FT                   /protein_id="ABW33397.1"
FT                   /translation="MIIHPEWFPNTSEGEEQKPQRFTLTVAHLDQDPQNNHPDNLKALC
FT                   APCHLKFDAPFRKANAYTKQEWFGQLTLDGLRNEE"
FT   gene            complement(34651..34875)
FT                   /locus_tag="AM1_H0048"
FT   CDS             complement(34651..34875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33398"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQW2"
FT                   /protein_id="ABW33398.1"
FT                   /translation="MASEMCDCMAQEFIDHEMVTDEMREELAIDWNAGINLRDGGSIDG
FT                   KKVEWMGIGLLVWGNCMKKLCLGWMKFDS"
FT   gene            complement(34995..35141)
FT                   /locus_tag="AM1_H0049"
FT   CDS             complement(34995..35141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33399"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQW3"
FT                   /protein_id="ABW33399.1"
FT                   /translation="MDQEGEPEVGQHCDRCGYQRYCPAKTEKPEPLPEGAREGRQVQLV
FT                   FGI"
FT   gene            complement(35437..35550)
FT                   /locus_tag="AM1_H0050"
FT   CDS             complement(35437..35550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33400"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQW4"
FT                   /protein_id="ABW33400.1"
FT                   /translation="MAIVAVVAAIMPSSVTLIGFSMMDYPAIDKKMNVDRY"
FT   gene            36145..36282
FT                   /locus_tag="AM1_H0051"
FT   CDS             36145..36282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33401"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQW5"
FT                   /protein_id="ABW33401.1"
FT                   /translation="MFATLNRTELAEVAAISNCKSLQHWTLMILQMRWYEPWLSVVLSI
FT                   "
FT   gene            36779..37366
FT                   /locus_tag="AM1_H0052"
FT   CDS             36779..37366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33402"
FT                   /db_xref="GOA:A8ZQW6"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQW6"
FT                   /protein_id="ABW33402.1"
FT                   /translation="MLLETSSSAQEIIVINLGFAFCGGAIKYIDDAFDSSDHGKTLAMI
FT                   FAPITGVICYLLIATDIAAATILLAIMLGVALKGKIDTVGHLLALAIVLLLLYVNPPEI
FT                   MLLPWLVLGLAGFADEIGNDFVDSRPNLLKRASFWSGTKFTYFFLEYRCFMKVMMIILF
FT                   FMNILSWHYLVAFLFFDLAYHLTGTWSEHWIA"
FT   gene            37645..38589
FT                   /locus_tag="AM1_H0053"
FT   CDS             37645..38589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0053"
FT                   /product="cation diffusion facilitator family transporter,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33403"
FT                   /db_xref="GOA:A8ZQW7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQW7"
FT                   /protein_id="ABW33403.1"
FT                   /translation="MSRNITIEEQGIRLSILGNFFMATLGLCFASLSHSEMILLDGVFS
FT                   LINLVIAYLSLKILRRSKQSNDYYNSIPPIYFEPLINLVKGVILTIVCLLAFGSSVIII
FT                   LNGGHAISTGKAIWYALLATLVCMTIAIKQGKRANACSSSLIEVDAKSWFIDGLLSGVV
FT                   VLVFTIVFFLQNTTLAIFLPYADPILVIFLCLIVAPIPVEIIKENWPKLVGEKYDVQLE
FT                   YKIIDIIDKHIPKTTIQDYYVSHGYLGDKLYVQCHLLVIEEISQKLSLAEQDKIRAFLY
FT                   QKLRDDFPSLAIDINFICDPIWVERRILHVSKA"
FT   gene            complement(38780..39568)
FT                   /locus_tag="AM1_H0054"
FT   CDS             complement(38780..39568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33404"
FT                   /db_xref="GOA:A8ZQW8"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQW8"
FT                   /protein_id="ABW33404.1"
FT                   /translation="MSYSLSATKLKTYGQCPKSYQFRYEHKLPSPTIFGSTKLGNALHA
FT                   ALANVYKDWNYAYPLPSLDWFAVCWQHHTSELTPTQIHEGWAALQLYYERYIAPLPQIR
FT                   KPLGIETKVRATLQVRNIEFTLSGRYDRLDYIDDGLELIDYKTSKSVNPPPSVDIQLGF
FT                   YYLILEQIYKKALKRLSLIYLRSNEKLIYEVTPDHHQQAQSLIEDMAMKLRCDQEWKPV
FT                   AGQHCDRCGYQKYCPAKNTRPEPLPQEAKEVTQVQLALGL"
FT   gene            39806..40015
FT                   /locus_tag="AM1_H0055"
FT   CDS             39806..40015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33405"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQW9"
FT                   /protein_id="ABW33405.1"
FT                   /translation="MSEQDKYAPAPTRNTEEIQKNYNSDAKAMRAKAARARIAARQKAE
FT                   RDARQRAAIEKIPLEHRYVPDQAS"
FT   gene            complement(40093..40239)
FT                   /locus_tag="AM1_H0056"
FT   CDS             complement(40093..40239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33406"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQV6"
FT                   /protein_id="ABW33406.1"
FT                   /translation="MTLNKTAVTSNQIDQSSKIIHGEGGFRVLTMVEKDKRVFQRALNL
FT                   GQS"
FT   gene            complement(40510..41628)
FT                   /locus_tag="AM1_H0057"
FT   CDS             complement(40510..41628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33407"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQX1"
FT                   /protein_id="ABW33407.1"
FT                   /translation="MNNAELLKVFVSSYLSGYSAFESNAELRFEPIGDTLQLLAKSEGL
FT                   IATAKLSGKRRFSSIRYKSSFWSQLHESMAKQKCLPIRQSNISGFYEYEPIDIPKNYSV
FT                   HFTNSLDLLQAWWRYEKENKQRSLMSLLILYRGVLYPIQNLACERGIIAIQISGHWMRL
FT                   NPLNMLSWLKSTEKPSLTTPSKPKKHFNKTQSKKRQNRLRQKQTVHRRTDASRYPGIKR
FT                   IGSYLVDAGLLSLAQVEVVLSDQDSTEMRFGEILVSRGWLKFETVEFVFQNVILPQRTL
FT                   AKKTVDAAYPSKLSSQRYGQERLNKAADEVAEPLPPKKKALPLVSAKNTMPSSGKLPFL
FT                   QLPSIHDHETLSTYDNLHSEYLPDWIETDSTV"
FT   gene            42568..43752
FT                   /locus_tag="AM1_H0058"
FT   CDS             42568..43752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0058"
FT                   /product="diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33408"
FT                   /db_xref="GOA:A8ZQX2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQX2"
FT                   /protein_id="ABW33408.1"
FT                   /translation="MKSSNIESIKSSHCWKIIVVDDKEQVHAVTRLALQNFQYKHKSLE
FT                   LISAYSSSEGQQLLEQNPDTAVLLLDIVMEREDAGLDLVKYTREKLHNRFIRIILRTGQ
FT                   PWIAPEQSIIEEYDINGYILKTELTQHKLFCFLLTAIRNYHNLLTVEEARQHISAQNQE
FT                   LENSNLILEKKVQEYTQILQKQTLALVENNKKLELEVQAKLHAQQNLEIINEKLFEANK
FT                   KLSLLANQDALTGLANRRYFDVYLQQVWESAQENKHPLSILICDIDFFKGYNDSYGHPE
FT                   GDHCLQRVSQIIHRVAGKSEGFAARFGGEEFAIVLPNTNLIDSQTIADMLRSEIHNARL
FT                   PHRASTVSEYVTVSIGVTSIQFQSDGSINDLILRADQALYEAKKLGRNQFVTLH"
FT   gene            complement(43904..44917)
FT                   /locus_tag="AM1_H0059"
FT   CDS             complement(43904..44917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0059"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33409"
FT                   /db_xref="GOA:A8ZQX3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQX3"
FT                   /protein_id="ABW33409.1"
FT                   /translation="MTVPEVKLIVLADQAITPIDTARSRTHPPQTTPADLLWMRVGEFM
FT                   RSREISSNTRKAYERDLKQFMDWTDKGWHEITARDLDRYKNHLKTEPNQRGQLRRNATI
FT                   NRNLAALQSFFKWLTVRDYIPKDPTLLLEKLKADPVLPQEFSQDEVDKLYQAICDRGFH
FT                   AFRDRALLHLIDHGLRASEIHRLNVGDYDGQRITIRVAKADSVGTVPLLKKARKAIDQY
FT                   KQWREQQGDVLENDSPLFVSHSNNSKGQRLQYWGIYKIFKAIAEIAEVENAHPHRGRHT
FT                   LATQLVMKDMDSVLARRITCHASEQSFVRYSDRGIELKAEQEFYEVHDEVPSGEDI"
FT   gene            complement(45208..46248)
FT                   /locus_tag="AM1_H0060"
FT   CDS             complement(45208..46248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0060"
FT                   /product="WD-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33410"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQX4"
FT                   /protein_id="ABW33410.1"
FT                   /translation="MAKIPQKRNWVMFLILSTTAALYALNAHEQLGVSSTYPHDPLLAG
FT                   ITTHMAMQTLKSHNKWVYAISISPDGETLASGSYDGKINLWNLQTGKLRATLNAHEDAV
FT                   SSLAISSDGQTLVSGSWDNRIDLWNLQTGEHLHTLDEAEDDVSAIALTPDGKYLAASAA
FT                   DKNLRLWNLKTGELIRIQPTPEDVLSLAFSPDGQTLASGSRDGVIRFWQREQLALTFSL
FT                   EGHKSAVKSVSFSPDGQYLASGSQDQSVKVWQRHQGKLLKILKGHTEPVLSVAFSPDGR
FT                   SLASGSYDRSIKLWQPLSGKPLGNLIGHTKSVRSIQFSPDGKKLISSGSDATIKIWSTI
FT                   TINAKG"
FT   gene            complement(46310..46879)
FT                   /locus_tag="AM1_H0061"
FT   CDS             complement(46310..46879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0061"
FT                   /product="ferric reductase like transmembrane component
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33411"
FT                   /db_xref="GOA:A8ZQX5"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQX5"
FT                   /protein_id="ABW33411.1"
FT                   /translation="MSILDSPPYANWLGFGAALLYVVTLLPTILRIVFPSLKETGIPKK
FT                   LLLQRRLLGLVAFILSIVHGYLMIIKREIDFLDIQTYWIYSQGIFTFTIFLLLAFTSND
FT                   WSVKKLKKNWKKLHQLTYLAMFLLLWHIIDKMWGHWTWLTPPSLLMIGIVTFLFLIRIL
FT                   YENNLLKKAPKQAPEKPKSPEPSNKN"
FT   gene            47573..49282
FT                   /locus_tag="AM1_H0062"
FT   CDS             47573..49282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0062"
FT                   /product="PAP2 superfamily domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33412"
FT                   /db_xref="GOA:A8ZQX6"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016119"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQX6"
FT                   /protein_id="ABW33412.1"
FT                   /translation="MYKFFRYILGKIMTAYPPVRDFAERLNQANEIRDLTRDDASNDFS
FT                   TEQPPTNDDEARFKQLGLPGFASFTKALGHQDNGLVQEQSFNSLLTAIQEGTQIAFEGV
FT                   QLGGGIRKLANPLNAFSFQLIGNDSHGARMAAAPSFSSRNSAVDLVERYWMALCRDIPF
FT                   DQYFLSPLIADACEDLNNLGFEQEFGFTCTPQTIFRGPYTGCDIGPHVSQFLLQDFDFG
FT                   NQPIRQLQRYPQEGLDYLTDFDGWFQVNNGNIDPTGTDFLVGERRIITLRDAGQWVHID
FT                   FPYQSALWSTIILLGLGAEISEASPYANGDIRSSEPFGSLGGPDVTIQPALAAVYALKH
FT                   AWFQKWCVHRRLRPEVYAQRLELFRRGLLEPTASDPLNNGLFNQLFGAGADVWRQTQVL
FT                   ERILEHNKMQNQVNFRTDPEGTWLLPIAFPEGSPTHPAYPGGHSAFVAAAATTAKALFQ
FT                   DAPFPNPVIPTSNGQGLVPYTGPALTIHGELNKLIANITLFRDGAGMHWRTDGTASGIN
FT                   TPPDRMGVGIPTGGNLLGEMLAVSMLRDIKRTYREELGLFKFQGLDGGPIEI"
FT   gene            complement(49532..51493)
FT                   /locus_tag="AM1_H0063"
FT   CDS             complement(49532..51493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0063"
FT                   /product="TPR repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33413"
FT                   /db_xref="GOA:A8ZQX7"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQX7"
FT                   /protein_id="ABW33413.1"
FT                   /translation="MGGIGKTELALQYAISQLNLGHYLGGLCWLRVKGQELAAQIIEFA
FT                   RTKLALALPDGLDEDQQVSYIWGQWPAGKVLIIFDDVMDLETIEPYLPPSDPRYKVLIT
FT                   TRQNLGLSVNPLSITELNDTSALFLLRTLVGAKRIDPQLDDAQALCRWVGNLPLGLELV
FT                   GRYLANKPDWSLHKLIKRLESKRLDAKALTERESGMTAQFGVAAALELSWVELSETEEE
FT                   LACFLGMFAVAPIPWTLVESCLSEQDPDDLEDTRDKGLIARNLLKRVDQGTYQLHQIVQ
FT                   EYFRIQLHQRPDQGESLKAAYCRGMVVAAQEIDYSLTTEVIAQMTAKIPHLEELINQRI
FT                   DSLNDGELTWPYVGISRFYEGQGNYGLALPWRQKCLEQTRQRLGSEHPDVARSLNNLAF
FT                   LYDEQGRYTEAEPLYVQALEMQKKLLGSEHPDVARSLNNLAALYDNQGRYTEAKPLYVQ
FT                   ALEMRQKLLGSEHSDVALSLNNLALLYKKQGRYSEAEPLYVQALEMSQKLLGSEHPLVA
FT                   TSLNNLAVLYKNQGRYSEAEPLYVQALEMRQKLLGSEHPSVATSLNNLAFLYYEQGRYT
FT                   EAEPLYVQALEMSQKLLGSEHPDVARSLNNLAFLYDNQGRYEEAISDFQQALSIAEVAL
FT                   GPEHPTTLVIRNNLESLL"
FT   gene            complement(51697..52794)
FT                   /locus_tag="AM1_H0064"
FT   CDS             complement(51697..52794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0064"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33414"
FT                   /db_xref="GOA:A8ZQX8"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQX8"
FT                   /protein_id="ABW33414.1"
FT                   /translation="MTAQTILFLAANPKDTQPLRLDQELRDIDEGLKRAQHRDEFQLEQ
FT                   RLAVRPRDIQRAMLDLNPQIVHFSGHGEGDEGLVFEDVSGNTQLVSGEAIADLFSLFAD
FT                   QLRCVVLNGCYTEVQAKAISEHIPYVIGMKRAIQDKAAISFAVGFYDALGSGRDVEFAF
FT                   KLGCAAIRLEGIEEHLTPILIKKPTTEETKDQDQPKAQTPPTPAPSPMIPDADDPLKVF
FT                   ISYSHKDDDLREELVTHLANLKRQGKIAAWHDRAIEAGEEWKSQIDSKLESAQMILLLV
FT                   SPDFIASDYCYDIEMQRAIARHDEGTAQVIPIILRPCDWLGSPFSKLQGLPKNAKPVTQ
FT                   WTNRDEAFLDVVNGIRRAVETLTKK"
FT   gene            complement(52929..56810)
FT                   /locus_tag="AM1_H0065"
FT   CDS             complement(52929..56810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0065"
FT                   /product="WD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33415"
FT                   /db_xref="GOA:A8ZQX9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQX9"
FT                   /protein_id="ABW33415.1"
FT                   /translation="MTSQNPPEQQTILFLASNPDGLRQAAQELRDIEDGIQRSKHRKQF
FT                   KLKSSLAVRVRDIQRALLDETPQIIHFAGSGKREAGLVFEDQAGNSQLVTGAALAGLFA
FT                   LFAEDIHCVILNGCYTQAQAQAIAQHIDYVVGMQQAISNEAALAFAVGFYDALGAGRDI
FT                   EFAFKLGFSAIQIEGFPESHTPVLVQKSSIHTEPIQPFSEQHPPEKLWRVPELPPYFLP
FT                   RPQTLKALREKVLNNLAQPVVMTGHQQRIGVQGMGGIGKSVLAAALAYDPQAQAAFPDG
FT                   IYWLTVGIDPNLLAQQTDLAEALCGERQVFEDINEGKNRLQILWQGRQSLLILDDVWRI
FT                   ADAEVFNVLGHQSTLVVTTRDSGLITRLGATDFSLSVLNDDQALELLAAWVGVPISDLP
FT                   SQAQAVAKECGNLPLALAQCGAMVRDLTPWPHVLSALQDSDLEFIQEQFSHYPYPDVFK
FT                   ALHISATVLAETNPIAAERYQELAVFPADELIPEAVIVRLWQYTGALKERDAGKILTTL
FT                   SRKGMLRLEGDYPQRQVSLHDLQQDYLQAQRANKGALHQQLLEAYQQSCLEGWHKGPKD
FT                   GYFYEHLAHHLKQAERTDELRQLLLDYRWMQRKLRITDINALLLDYETLPKDKDLNIVQ
FT                   SGLRLSSHVLNQHPEQLRSQLYGRLLSQDSPDVTALTQSLAQGPEECWIRCLFPHLNQA
FT                   GGALVRTLSGHTSNVRGVSISPDGQTVVSASYDHTLKVWDLATGEEQRTLTGHTSPVEG
FT                   VSISPDGQTVVSGSLDNTLKVWDLATGEEQRTLTGHTSPVEGVSISPDGQTVVSGSWDK
FT                   TLKVWDLATGEEQRTLTGHTNSVYGVSISPDGQTVVSGSLDNTLKVWDLATGQEQRTLT
FT                   GHTSPVEGVSISPDGQTVVSASYDHTLKVWDLATGEEQHTLTGHTDSVTGVSISPDGQT
FT                   VVSASYDHTLKVWDLATGEEQRTLTGHTSTVTGVSISPDGQTVVSASWGKTLKVWDLAT
FT                   GEEQRTLTGHTNSVYGVSISPDGQTVVSGSSDKTLKVWDLATGEEQRTLTGHTNSVYGV
FT                   SISPDGQTVVSGSLDKTLKVWDLATGEEQRTLTGHTSPVEGVSISPDGQTVVSGSWDKT
FT                   LKVWDLATGEEQRTLTGHTNSVYGVSISPDGQTVVSGSSDKTLKVWDLATGEEQRTLTG
FT                   HTVSVRSVSISPDGQTVVSGFWDKTLKVWDLATGEEQHTLTGHTDSVTGVSISPDGQTV
FT                   VSGSWDKTLKVWDLATGMEVMSFTGEGGFQCCEIALDGRTIIAGDAGGQLYFLRLEGPS
FT                   FSGGGEVIS"
FT   gene            57125..57652
FT                   /locus_tag="AM1_H0066"
FT   CDS             57125..57652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33416"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQY0"
FT                   /protein_id="ABW33416.1"
FT                   /translation="MPLPPNPICLQCIDYSRGEAKRIHGPQGDGCWTDNRCDRKRHHYR
FT                   YRKESNAKRRGEYASQKAITTSTETTETFSIPVQTPAVALLYLYKDKPKDAHLHALAVS
FT                   VWQGSEKLAEIEAVHCMGMTNTQVNRYLKEVLRVLKVRYGITEFEPPIRMEPSECEIAD
FT                   CPLKDKRHVQTA"
FT   gene            57636..58280
FT                   /locus_tag="AM1_H0067"
FT   CDS             57636..58280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQY1"
FT                   /protein_id="ABW33417.1"
FT                   /translation="MFKQLELDFASALASALNEPEQADISLMCASLDQHLQGRSPHEQL
FT                   RVAGDAIKDMAEVCLQRAELMIQGWEERYNSEGPVLDEDFLAGMVQQTMFLDISDLCRQ
FT                   PKSRKSRQGFTGEPVESVVGDVSKESVLEFVDELESGKEVALKVSHVDDVGAWVNAIAQ
FT                   YLERASEALSFAELVKGLGMPTVVVLIGVLLGGFQIEQTRDFYGSSIWIKI"
FT   gene            complement(58350..61373)
FT                   /locus_tag="AM1_H0068"
FT   CDS             complement(58350..61373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0068"
FT                   /product="dead/deah box helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33418"
FT                   /db_xref="GOA:A8ZQY2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQY2"
FT                   /protein_id="ABW33418.1"
FT                   /translation="MALLAGFIGVDRFADITIPELTGARRDAEALWALFSDSIPDIQAK
FT                   LITDKDASLHGIRQLLQSTLGAATSDDTVILSFSGHGTSNHQIVAHDTSRTDPADTTIP
FT                   MEELAHYFRETQAKAVLFILDCCFSGGAPAKVLGDIPVSRSISMSVSTLAGEGRILLAA
FT                   SRESEEAYEVPGEGHGLLTKALIDTFIETTSPTIDLVEMSAQVVEKARSVAIKMRIAQT
FT                   PVLFGHVTGGLVLPPIKPGPHFYTKFPQKGGLRVDADIQELAGFGLPLTILNQWAKQFP
FT                   TLNDLQLQAINDYRILDGSSLLAIAPTGSGKTFVGELAAIQAICEGRKAVFLLPYRALT
FT                   NEKYEQFSQVYGDGLGMRVIRCCGDYVDQTDLFVRGKYDLALLTYEMFLNLVVSNTGVL
FT                   NQLGLVVLDEAQFITDPTRGISVELLLTYLLSAKQRGFQIQLITLSAVVGDVNHFDEWL
FT                   DCDKLISQERPVPLVEGALDRSGIFQFVDTDGNEQVTQLLSPSEIQVRRKKASSQDVIV
FT                   PLVQKLVQQGENVIVFRNQKGPAQGCANYLAKELGLSPATEAISVLPQYDLPTTSQALR
FT                   ECLHGGTAFHNRNLTREEKEVVEQAFRSLDGQVRVLSATTTVAAGINTPASTVILAEHE
FT                   FVGQDGRQFTVAEYKNMAGRAGRPGHTSNSRGQAILLADNSYERQSLFRQYVQGQLEPI
FT                   RSSLDSQSLKTWLVRLLAQMERVQRAEIVAVLSNTYGGYLANRSDPSWRDRMKQHLEEL
FT                   IELMMEQDLIEEEDVYIQLTLLGRAVGESALSFDSAMRLIRLVRSIQTDDLSVITLVAL
FT                   LQQLPESDGGYTPMMKKGRSESIRPQQASERYGTEVVRLLQHLAQGELDYFARCKRASL
FT                   LWDWVHGVAIEEIERLYTPNPYQGKIGYGDIQKFADATRLYLRSAHQLAALIHIGNNPS
FT                   DEEVDRMQQQLEVGLPTEALGLLSVPLRLYRGEYLALLNNGVKSSQDVWTCSELQLSSI
FT                   LGKKRASELIALRPPAAA"
FT   gene            complement(61805..62212)
FT                   /locus_tag="AM1_H0069"
FT   CDS             complement(61805..62212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33419"
FT                   /db_xref="GOA:A8ZQY3"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQY3"
FT                   /protein_id="ABW33419.1"
FT                   /translation="MAKRKITDLLSNELTNSVSSKESNSQSSEVKDNYVSSHQVELAKG
FT                   TQELPESVSNEVPKYLTMERKEIRLPQEHLDQLTMLARQLNRARKNSGERITENTLIRV
FT                   AIAAMLEHTDQLRGISEDELLQAWMKYVSSQ"
FT   gene            complement(62212..62847)
FT                   /locus_tag="AM1_H0070"
FT   CDS             complement(62212..62847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0070"
FT                   /product="Conserved CobQ/CobB/MinD/ParA domain"
FT                   /note="CobQ/CobB/MinD/ParA nucleotide binding domain
FT                   (PF01656 and COG1192)"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33420"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQY4"
FT                   /protein_id="ABW33420.1"
FT                   /translation="MQIITIASGKGGSCKTTTALSVAAFLSKKRKTKVLVIDTDPQGSL
FT                   SWISDRASPGFDVAHETDHNVISKLRKIGGYDYILCDTPPGLDNETLTITLKLSDFAIL
FT                   PSPPSPLDIRELTRTIGQVVVPSETAYRVLLSRVDSRRINEALDMQSQLMDEDIPVFNA
FT                   VVRYLVAHERAILDGKLITEYKGSGGKEAANDYRKVVDELVRELKGQK"
FT   gene            complement(63784..64704)
FT                   /locus_tag="AM1_H0071"
FT   CDS             complement(63784..64704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33421"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQY5"
FT                   /protein_id="ABW33421.1"
FT                   /translation="MLSLKDIGQLIQVPIEQVQVSDESQGSGFQIAALSSILQEPDLRN
FT                   WIPVIVQEPEPRQYQAISNEHILLAMEAAGQEYVWVAVVPEDASAEEQVKLLTGQIPLT
FT                   INICSAEYDMIFAALQHLRGKLGKLDIALVADRIYQAAGRRGWSSLTPLTKLKCGLTKS
FT                   KLQVLSEVFDAAPLPIEINPIILNTASEAELLEAFETAACLPQCKLVDVNLTKLASAIF
FT                   SSKERLYWHDYKPLTKLKCGLTPSKLKGLDQILHLKPCAPPYLNNVRYLLEQMKVSDLK
FT                   KEAIQREITVPKGIKKAELVDLLTA"
FT   gene            complement(64704..66092)
FT                   /locus_tag="AM1_H0072"
FT   CDS             complement(64704..66092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="CobQ/CobB/MinD/ParA nucleotide binding domain
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33422"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQY6"
FT                   /protein_id="ABW33422.1"
FT                   /translation="MLKLMPKISEHALAELKLQLDSRPTVRGSGDEGNVVTPIIEKLLV
FT                   TLEFGQLDRVPQFKANSSPSRKSDIACRYPDKEGNNFFQQQKDPFLLVELKSTGQQLSL
FT                   NSPHYWKAFAQLKEQLLGNNAMSAHFGLISNGWELQLFKRFHKVVHPATSILSLNTQNA
FT                   QEVSNCLLRILQEDKRGIIIGVYNNKGGIGKTTLTTNLGIVLAQSQKKVLLVDFDPNQA
FT                   DLTDSLQQPVVEGKVWNFLKGKVPGKAIIQHCSFSQGKQQVQFDLIPADKSFLESHDVK
FT                   IQQEIRLEFLRNRLKELSKDYDYILIDMPPNWRWFAQAGVQASDTLLVPASHIDRASLR
FT                   NLEALVTNFIPQVNQRRAALEEGGPNLLPLVLNQYQHTDAQARNCYRYLADIVAKNNEW
FT                   KDAFNNFFYMPPKRFRRGQHCFELPYKIEICRAPLEGPKYVPAPLRYRRAKQVYEHLIR
FT                   EVLL"
FT   gene            complement(66728..66850)
FT                   /locus_tag="AM1_H0073"
FT   CDS             complement(66728..66850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33423"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQY7"
FT                   /protein_id="ABW33423.1"
FT                   /translation="MSNPWHKTHPRLLGKVLIEKSLSLMTNKELGSADQAKGST"
FT   gene            67121..68857
FT                   /locus_tag="AM1_H0074"
FT   CDS             67121..68857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0074"
FT                   /product="transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33424"
FT                   /db_xref="GOA:A8ZLS0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLS0"
FT                   /protein_id="ABW33424.1"
FT                   /translation="MPNKRIDSYHTRVYMNGRDLGLKQADAAYIAEISTRTGQRIEAGT
FT                   HQPNRGRLQDQRTVPDPLADVWEDELEPMLRRDPRLKPMTLYEYLQDKYPGQYPQVLRT
FT                   LQRRVRTWKALHGPSPEVMFELRHEPGVQGFSDFTELKGITITIAGKPFEHLIYHYRLG
FT                   YSGWRYAQIIEGGESFVALSEGLQNAFAACGGVPTQHRTDSLSAAYRNMGGRRSKNLTR
FT                   LYDELCDHYRLEPTRNNKGVAHENGSIESPHGHLKNRIKQAIYLRGSADFTSVAEYQAL
FT                   IDAQVAKLNQQCQTKYEQEKDHLQPLPKYRTPDYEVLTAKVSKRSTIDVRCILYTVPSR
FT                   LIGRQLELHLYHDRIVGYLERHPVVELPRKRVSGKGKRRDRCINYRHVIGSMRLKPRAF
FT                   IYCTWQSDLLPNPEYRQIWEQLKAQFDLEQAAKIIVEALYIAAVQDKEQAVAVYLQQQL
FT                   RSSSLTLNRLKKQFEPPQMKQVPELSIEQHSLELYDKLLPSCSVPAEPLPAPEPLFKKA
FT                   QALPHVDPLGIYRIPSHAGKLVLCGILTSLVRNGGPTKRTSSSKTCPHRSQAPKRKKFY
FT                   QL"
FT   gene            68685..69416
FT                   /locus_tag="AM1_H0075"
FT   CDS             68685..69416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0075"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33425"
FT                   /db_xref="GOA:A8ZLR9"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLR9"
FT                   /protein_id="ABW33425.1"
FT                   /translation="MLTHWESIESQAMQENWSYAEFLLALCETEAQRREQARLKRALTE
FT                   ARLPNAKSFTNFDFSHCPQLNPAPLMQLAADPGWLERAENCLILGPSGVGKTHLATGVS
FT                   KKMLEFGKRVKFFAANALVQQLQQAKLQLQLHPMLKKLDRYDLLILDDLGYCKKSEAET
FT                   SVLFELIAHRYERKSLLITANQPFSQWDDIFTDSMMAVAAIDRLIHHGLIIEIQADSYR
FT                   RKSATQRTAQTQSQPQKSQSK"
FT   gene            complement(69495..69893)
FT                   /locus_tag="AM1_H0076"
FT   CDS             complement(69495..69893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33426"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQZ0"
FT                   /protein_id="ABW33426.1"
FT                   /translation="MKYSPDEICKAAKAIQPYISELLDAPSAQRLERQLEGLMTDYSIQ
FT                   QGSHIQLSSLLAENESTRDWLRLYLEEGHPAEDILKALRIYYPLSGIKNPVESPRIGCQ
FT                   PHRRCRDNHKADQPPNLNRIIWRTLPLR"
FT   gene            complement(69893..70033)
FT                   /locus_tag="AM1_H0077"
FT   CDS             complement(69893..70033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33427"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQZ1"
FT                   /protein_id="ABW33427.1"
FT                   /translation="MEYIWIERGWLRSGGKSYQVIDERIRSDCHLWGNLKKIQRVIEHS
FT                   E"
FT   gene            70373..70672
FT                   /locus_tag="AM1_H0078"
FT   CDS             70373..70672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33428"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQZ2"
FT                   /protein_id="ABW33428.1"
FT                   /translation="MSVAVNSNKEHSSFLNFIPKFRRTLRTFHHTLDSNSPEFFIDSID
FT                   DQPGFYQMTSQGPRLRIGQSIEVEHSGQYQTYQVDDIEFYNELSDIWTAVLHRI"
FT   gene            complement(70725..70853)
FT                   /locus_tag="AM1_H0079"
FT   CDS             complement(70725..70853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33429"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQZ3"
FT                   /protein_id="ABW33429.1"
FT                   /translation="MELENTFDVLQVLSLRPGETIERIEEMIGVWLERERVSRVWG"
FT   gene            complement(70935..73025)
FT                   /locus_tag="AM1_H0080"
FT   CDS             complement(70935..73025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0080"
FT                   /product="pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33430"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQZ4"
FT                   /protein_id="ABW33430.1"
FT                   /translation="MANQEQVDLLKQGAEAWNQWREKNTGESIYLWGADLGGANLSGAD
FT                   LGGATLSGANLWDANLTYADLRGATLIYADLRGATLIGAALIGAALIGAALNGANLSDA
FT                   DLSGADLRNTKISAATKIDAKWKLVHELVNKGGEGKDLSGTDLSGANLSDADLSDADLS
FT                   GADLSDADLSDADLRNTNLRNTKISAETKIDAKWKLVHELVNKGGEGKDLSSTDLSDAN
FT                   LSGTDLSDANLSGTDLSDANLSGADLSDADLSGTDLSDTNLSGTDLSDADLSDADLRNT
FT                   KISAETKIDAKWKLVHELVNKGGEGKDLSGTDLSGADLSGADLSDADLSGADLSDANLS
FT                   DADLSGADLRNTKISAETKIDAKWKLVHELVNKGGEGKDLSGTDLNDANLSGVNLRNSN
FT                   LYRANFLGSKLQNAILTGACIQDWSINSKTGFEGVVCDYIYLKVNQEERRPFQGNFCPG
FT                   EFVALVQKSLETIDLIFVDGIDWQAFFQSFQLLRSKFNEYEVGIQAIEKKGAAFVVRLE
FT                   APPEANKSAIETKAKELYGKQLKVLEEQFIEKMKLQGATLDLAKESLAFERQKNAQLLS
FT                   MVQTMANKDKVTQNINAPVGNVAGVNEGIQQTTQHNYAPEIKQTPAESAKEIQDLLSQL
FT                   QKTNPTDIQTVVEQRIKIDPTFRQRLQNALKEGGVETLKVLFAPIGIPIETVRGWIDAE
FT                   GS"
FT   gene            complement(73139..73633)
FT                   /locus_tag="AM1_H0081"
FT   CDS             complement(73139..73633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33431"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQZ5"
FT                   /protein_id="ABW33431.1"
FT                   /translation="MRMEIMVMSEADQRLEDIKVKALEYRYQIYRHFRNVVCEGQSAVA
FT                   IVNKLVKRVAHELVKVGSEESVSLYVIRYSGNEAYKDQMLKAFQAKWNQRLEKNRPSCE
FT                   ICKKDSDLITEMEKRTENDEFGCGNDQEIGQKERGDDGIEGKSGVILGGDDGSAHKSLT
FT                   F"
FT   gene            73987..77475
FT                   /locus_tag="AM1_H0082"
FT   CDS             73987..77475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33432"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQZ6"
FT                   /protein_id="ABW33432.1"
FT                   /translation="MKSIKGFWLFLDTAIKDIPWGDVALHGIEAMKALPDASKAWQDNA
FT                   DKIQQLAPFVQKAEPLIKALDIPVTKLVISGLPFISAGINLLKIGIELAKVESTFESSV
FT                   TIVAQLAYLQSLEIVLVKQDETIKAKLAQLSLKDVVEKQLSKFYRTELTLTEAKTATTQ
FT                   FRESILVEKFGEALTEQLQQVGLDNSQTQRLTDQVIWGSHRYFHLAIVEAGESVEPLAE
FT                   FYRTGGQQELERYTAIDEYLETQIKPTPLEQVFDESAPRVSFQDIYVQLEVQPLTQEGE
FT                   VKRGASPICSHEWTKKILEQSANQTRKVMFMEGEAGRGKSVFCRMIADWVYSEFGDAFI
FT                   PLRIRLRDLRALANNLTETLEDCPDLEQAKFVRGESNWLADKNTRFFLILDGFDEILLE
FT                   GRTSGGLKEFLQQVTDFQRRSHHQLLVTGRPLALQGIDRLITQNKDLERVRLKPMSDEL
FT                   RELWLIKWQAIFGTNQVNQFRQFLTACPQDITDTLAREPLLLYLLARLNREGHLTQEMF
FT                   ADTQKGFNSETQAKLQIYRESVNWVLKKQRQDENLRLSGLDTLDDLREVLQEAALCVVQ
FT                   SGNETARLEMVKQRFKGSSNPVADLLKQAQETTGQSENKALNNLLTTFYLKPGEKDKRG
FT                   SVEFAHKSFGEYLFAERLLIAFETWTELDKRKRFRLDERSLNEQIYDVFGHGGLTQEIV
FT                   AYVMVLLEEGNIDRLQLFTRLSHFYDRWCQNEFLDALPHENIPQKKMIQLLDQDITTGL
FT                   KQVDVFTGLNAMIFLFRLHASTQPKDYPYLGDDTSQHEIYFYPCGKPEPEGLQADRLLK
FT                   IIRYADSLVPGIFNETVGPYLSSANLSSANLSFADLSSANLSFADLSFADLTNTDLLSA
FT                   NLNGADLRNANLNNADLRSADLNSANLNGADLRDANLNSANLSSANLSFADLSFANLSF
FT                   ANLSFADLSSSNLSRALVSDLTQIDYEWLSGSNDEYLIVLRTHQNFNIRIFDSDINSND
FT                   LSQLQTALDEFTKISGYEEVTVTREELGSFFKDIRYKIARLFYDDVQREAIETGQELYR
FT                   TGKANILTRLEWKGVESSKQLAEATAALLENVDKFDNVVLQAGKIIVVKITDENGKSTL
FT                   CSRTVSSEIKFLLERTPQLIDNPQALYDLLTKNPEQLQPSIENRTTLPAPSEPLK"
FT   gene            complement(77485..78105)
FT                   /locus_tag="AM1_H0083"
FT   CDS             complement(77485..78105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33433"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQZ7"
FT                   /protein_id="ABW33433.1"
FT                   /translation="MNPKLVSLKPKPTISSTGKPPINIESNPAYSDKTAFPTIARKDDQ
FT                   PVRRKPSPDVGTDERKRESAPIHIHREPDFVRRTQRGYTARETPGRVRPPRVSRAFESK
FT                   FHALERRQKNLVQQTKQKGQLEYLTVSISNSGKFWITVEITGKPFITIPFETPEFCYEC
FT                   ALELEDTFDVLQVIKLRPGETMERIEEMIGVWLDRERVAMSWG"
FT   gene            78193..79758
FT                   /locus_tag="AM1_H0084"
FT   CDS             78193..79758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0084"
FT                   /product="pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33434"
FT                   /db_xref="GOA:A8ZQZ8"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQZ8"
FT                   /protein_id="ABW33434.1"
FT                   /translation="MIYSGETRGKDYAAMTNQVLVELLKRGIGVWNSWREENLYENLDF
FT                   RRVQLSGSYLSEVDFSHANFEIAYLSSAKLSCANLEGINLNRAYLGGADLYSANLRGAN
FT                   LIRANFNDAHLKEADLTNANLSGAHLRGANLLNANLSGALLSRANLENADLSYANLENA
FT                   DLSYANLENADLSHANLKNADLSSTHLKRVIALDTSFLKSTLTGICIQDWNININTNFD
FT                   DVICEYFFRSYNPDLTQPSNRHPLSRNFDPGEFAILIKMSLETIDLIFVDGIDWQAFLQ
FT                   SFQDLRSQFSEQEIAIQAIEKKGTAFVVRLETRPEADKNAIEAKAKELYSGKLLRMEQK
FT                   YKSDLLAKESEIAIYKKQSAVLLEIVKLQATRPIAVEATAVAEKATNQTKIKDSTIGAM
FT                   HSGSGNITNFSQAIGSNLHEITKIIKKLKKSAKNIPEEYQEDLSEDFDDLVDAINNSEK
FT                   RTEKRLRKRIMALWAIVCAIAVGVAGATDFSNNLVDLAQKLNVPLTVEVIKQNPHVLQE
FT                   PNQP"
FT   gene            complement(79838..81112)
FT                   /locus_tag="AM1_H0085"
FT   CDS             complement(79838..81112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0085"
FT                   /product="pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33435"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQZ9"
FT                   /protein_id="ABW33435.1"
FT                   /translation="MIDQGLLNLLIGDVKVWNSWRQMNATVELDLGGANLSGADLKSVN
FT                   LSGTKLTSTNLSATNLKGANFSNADLTCAQLTSSNLWGANLVNANLSSAILMGANLSYA
FT                   NLGHANLSRVKLKRTNLIGTNFLSSNLKYANLTGACIQDWQINGDTSFDNVVCDYIYLR
FT                   ENQQERRPLNGNFSPGEFVALVQKSLETIDLIFIDGIDWQAFFYSFQQLRSQFVGQEIG
FT                   IQAIEKKGNAFIVRLETSYEANKGAIESVQKELYKTKLQLSEAHGELRVYREMSDVIKT
FT                   LAGKPMETTQNFNAQVGNVAAHNEGEMNNEQVISQTTINAEKIENLHSGSGNVNNYASP
FT                   EQQVLVEVATEIQQYLQQLEQSNPAASETDQIQYVNIATKPEFKQRVVSAMQAGGEKAL
FT                   EEFVLENRYLKVIKATIKAWLTGNA"
FT   gene            complement(81117..81365)
FT                   /locus_tag="AM1_H0086"
FT   CDS             complement(81117..81365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0086"
FT                   /product="transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33436"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR00"
FT                   /protein_id="ABW33436.1"
FT                   /translation="MYDFQVPFDNNQAERDIRMMKLKQKISGCFRSLAGGQQFCRVHGY
FT                   ISTLRKQDIPLLNAFRVIFASNPKVDWRISLSSNFLR"
FT   gene            complement(82218..82802)
FT                   /locus_tag="AM1_H0087"
FT   CDS             complement(82218..82802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33437"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR01"
FT                   /protein_id="ABW33437.1"
FT                   /translation="MDIGLIFSAGKVASSIAALTGLIDSVDAKLDRLTKADLSAALISL
FT                   DQASSSEKETISLLRESRLSFNRAIGLEKNFRLAVAYLGLSLCHYRLGDCKNSKNSLKE
FT                   ITLIYPDITAIQSTKAQLYDMYNVAIDPNPLNKLKLIAVYSQFNERLREETKTLIKIDK
FT                   DINALVKVQLSVSEYINKPVKWLKQLGISEI"
FT   gene            complement(82960..84513)
FT                   /locus_tag="AM1_H0088"
FT   CDS             complement(82960..84513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0088"
FT                   /product="pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33438"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR02"
FT                   /protein_id="ABW33438.1"
FT                   /translation="MANQDQVDLIRQGTSLWNKWRWENPNEPIDLSGANLKGADLVRAN
FT                   LEDANLSGTDLRKASLIVANLNRSILCRADLRGANLGGAKLEEANLSEAFYSELTTWDR
FT                   GFNPKQVEKLWLIGSGGNLEEANLSNLDLGDADLRGANLKNANLQNTDLLNADLGKASL
FT                   IGANLSNSNLTQANFYKANLSTANLNEAVLLNANFIDADLSMAELKNSKMIRTVALGAN
FT                   FQRAILSGGCIQDWNINNRTNFEEVVCDFIFLKSIFNDATNEIVPTERRPIDPDKAFVS
FT                   GEFAALIQKSLDTIDLIFLDNFDWEAFSQSFQKLRSQFNDQEIYIQAIEKKSLAFVIRL
FT                   ETSPDADKSAIETKAKELYGEHLKVLEEQYIEKMDLQDLTLDLVKESLAFERKKNTQLL
FT                   SIVKTMANRDKVTQNFNAQVGNVAGVNEGIQQAAQHNYASEIKQTPAESAKEIQDLLAQ
FT                   LQEENPTDIQAVVEQKIKSDLTFRQRLRNALKEGGMETLKVLFAPIGIPIEMVRGWIDA
FT                   "
FT   gene            complement(84679..88434)
FT                   /locus_tag="AM1_H0089"
FT   CDS             complement(84679..88434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR03"
FT                   /protein_id="ABW33439.1"
FT                   /translation="MTSTPSLTLNSPHLGFGTPTRYTSKLIPFKRQNHCPICGSNDGRC
FT                   SKGGDIILCLTETYDVGIINGYKFRKLSKDSNWGIWAPHTGDDNYNSINWQARKAIRDQ
FT                   QAKEERRQRIAKELPVGQRDYLYRQLLSDLSLCSMDRGDMGRRGMSQAEIDGFDAVSVG
FT                   QFQRVKDLSPDLPGVLPGGILNSQGGYLWPLYDVHDQIVALQLRKRNVHEDNRYIWLSS
FT                   STRRNPNGNGPHVHGEIPLAIYKSFGPYSRIALVEGTGVKPYLLSQRLQLPTIGAAGGL
FT                   WASSPDTLRETLTVLSKDAEQSPIITLYPDAGAVRNLNVFRQYQRVIRLLEEWGYIVEV
FT                   AWWGQTYKENSCDIDELTPVELAQIVFKPTWFFNSLGLEYELGQLFLKLNGLSDQATTV
FT                   INKRYIELSDLGTIDPGSVVAIASMCGTGKTEMLKSLVSQVKGQVIMPGYRNNLLFNTE
FT                   DRFTEKDDAGNTLYKLIHLFRLNKEYQGNISMGFRSERSILLCFDSLLKIELDDIEPDS
FT                   CIILDEADAALFHVLSGQTLGDRQNQILEHFHAIANRVLETRGNIILLEDSLSQIPIDY
FT                   IKGITGGKYNTKIVVNEYKPDDNFPTKVFSGQTSQFLERILNAVACDERFIVVATSQEF
FT                   LEKLERMIADMNPEFAKGILRHDRKTSERTENKIFQANPTEFVKEYQPTALFLSPTAES
FT                   GVSIDEPRLIPYFSRVFCYASSNHARSVYQQLWRYRAKVTREIYVTRKAHIPDIPSIKS
FT                   VEQVIMLQSKYGQDVAASIDLEQQLIHDQSPETAQQLAALKAYQQNPNNCHNVSFARYQ
FT                   TRSIASLLALRESLTLLLADHGHPIEMEELSERNADIVESFSKVRKQMEVETAVMLGTA
FT                   DGERFTVEQAIRVMGSSSATYKDTLDAKKVLLQDELPGVDLTDEFIHQVCVEHRGRLKS
FT                   ATKLHWMSYHPEVAEELDRRNFMKQLNSQFVLTHRLTNNRIQVQLLRDLGVFDLVDTYN
FT                   VTSADYEAYDKALEKGRQVQRQRQSLRLEAKGLAGQIREVIQEQKAIQAKLTALGRKAH
FT                   PRKAKLKGELEQLEQQKQALKYQKQGLVEAIEQQSQAFTQARYEQVEARMRMEIMVMTE
FT                   GDQRLEDIKVKALEYRYQIYRHFRNVISDGQSAVAIVNKLIKRVAHELVKVGSEESVSL
FT                   YVIRYSGNEVYKDQMLKAFQAKWDQRLEKNRPVCELCNKDSDLITETEKRSDIDEFDGG
FT                   NDQEIGQLKVGNDGIEGGSEVILGVN"
FT   gene            complement(88569..88685)
FT                   /locus_tag="AM1_H0090"
FT   CDS             complement(88569..88685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33440"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR04"
FT                   /protein_id="ABW33440.1"
FT                   /translation="MESNRELWTSQKVSAPQEWCVLILEQPTLCWQEFCNLN"
FT   gene            88796..89017
FT                   /locus_tag="AM1_H0092"
FT   CDS             88796..89017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33442"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR05"
FT                   /protein_id="ABW33442.1"
FT                   /translation="MNHTTLQPSIRKGFKTKDHQGFQNPGQHDSMRKKWVNSSNENEEI
FT                   CCLIRENLNWYLGINLVAEGVLSYIHPQ"
FT   gene            complement(88971..90242)
FT                   /gene="fliA"
FT                   /locus_tag="AM1_H0091"
FT   CDS             complement(88971..90242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliA"
FT                   /locus_tag="AM1_H0091"
FT                   /product="RNA polymerase sigma-24 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33441"
FT                   /db_xref="GOA:A8ZR06"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR06"
FT                   /protein_id="ABW33441.1"
FT                   /translation="MVYTNVFNSQSLETGPFSRKVQYPQIERAQAGDRRAEDRFIRKNQ
FT                   RLVFNEAKRYRGLVDWDDLVNAGTLGLSIAIQKFDLSRGFQFSTYAVKPIRTEIRQLIC
FT                   EQRGLSREITKHLKKIDEAEQDLKLELERKPTLDELAERTGYSHRVITNAWSKARVVDT
FT                   SSLNVLTGTEQGIECLDFVEDLEQLDSWDFAESINMKDYIAQLPDRESFIVRARRDGHS
FT                   YREIGTMLKLSGERIRQLYQKALEYLKHLITYGSCLVRFPQPDKTQLIHPEGIEKPTVK
FT                   RVDASRLGGKIGRAIQQIFKQTNKESHIHEPGELTNAQKHILVFRRRSSHEAANVARHR
FT                   LTPENQRCHQLERTQDDWRGHLGFSPVILNIILLPLALVSQSVRRLQDNDRPNERRSIM
FT                   SSITSGVSKVIEGGYRKEHPRPPN"
FT   gene            91425..92288
FT                   /locus_tag="AM1_H0093"
FT   CDS             91425..92288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33443"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR07"
FT                   /protein_id="ABW33443.1"
FT                   /translation="MLKTTLLSLGLLAITFSSALANPATIPIDKAFKHTQKLEVSDVDH
FT                   LLDFTDTRYRVIKAFPSNPQQLRALSLSRNDHQQLLLKWTPNGTAKKASVFLRVMGPGG
FT                   EQTITLLVKRSGNEPDNIRTAFVPSQTVSKDAVIGEVAEIPPKPTVAPIPNQLIRPNWK
FT                   SHNSPKTAQPVKAPLTLTHPKSPPVLKLRATPKPIPRIAKVTTTGRPLIDRTTLDNKAL
FT                   ANYLLRGLHRARGLRQINRHHDNYWFAQSMARYLKRGVSVDKALRWSRLPEKTFNDLLG
FT                   HGGVSR"
FT   gene            92373..93029
FT                   /locus_tag="AM1_H0094"
FT   CDS             92373..93029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33444"
FT                   /db_xref="GOA:A8ZR08"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR08"
FT                   /protein_id="ABW33444.1"
FT                   /translation="MQSPFLQHTRHYAHKYGPQWSAPVLLVILTLCPVFLPLNPGTQIA
FT                   WLEIMALVWSTALFLHLYQLLNIQTKLGLYLFFSGMIALVPSMVKAQNVGNAPSSACNS
FT                   GFFLIGPMLGAVDTSLGWFLGGVLAYSLCAFMIALMIVFFLVVIVGLVMAGAESHNSKR
FT                   TLFEVLSQYLNVIITMMVIASLVTVFNLQLSNNGNAAPIPVGGQNQPQGATSVLN"
FT   gene            93041..96166
FT                   /locus_tag="AM1_H0095"
FT   CDS             93041..96166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33445"
FT                   /db_xref="GOA:A8ZR09"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR09"
FT                   /protein_id="ABW33445.1"
FT                   /translation="MTQTEQIEKELRYGKINPYIGPTQFQVLSGQQIITLAASGCICFI
FT                   LGFSIGWFMAVFLWLGIFVLTVLALGKDYSRIFARMSKQRRYYSDRPNYQVKGGVPLMV
FT                   IELPEPFKLSQLFRRQTKQKALKKIEPEFDLRAYGEMLLGEDIGFYLVHQDKHDRAMLI
FT                   FGFTLKGIDPTLSEQDAMDRLQTIVMALQKIPGIELKFFWDVEGSADAVLLHQHDLVTH
FT                   NDLDLLSEKLIKSEAQVAVDLAAEGKLVHSVIRVYAKYRLSLADDYAVKEDRLDKLLAH
FT                   TQPLVGTFQEYLNPQPEGFSSKQAWEKVLDRAYQAGYIPTVKALTQMGVKPQPMSKEDL
FT                   WAIDWEDTHAEPADPCPQSITYSEAGLSPFNEDQPLPYHILGELFSPERGLPAVPTPYL
FT                   YTLYHPIKDQWAALVKINQLSTYNKIDNFLSIGYMKFLLQALEGFHGYRLISEITQIEP
FT                   DSRLKLVNSAIKERNRKAIDAQLLHSTRNVQAETDVNELVDASRELSSGRWPLKVSLGI
FT                   WVYRADKASLTAAVQDLIRRLPTSKTEQVSNHLMTHWISSHPFHWQSLFSKPQLRREEY
FT                   QCNQGVPLMPLVHPQTIDKQGIPFVSRGVAIPVHLNTALKKNLIAIFGPMGVGKSVLMN
FT                   RMILENIIHRIFTVVIDVPPGNGKSTYQPFLKQLQAINVAAAYFNIKEHIINVLAEIDT
FT                   SWAGDLLSVQLLKKIKQNHLSLLRALVLGDDLDHPLYKTIKSVLALSYQDWRALSEIDQ
FT                   RYRIAKAAAFGSEPSQRMPILQDFVDYFPQWVRQYKQDKDCEDLELQAIAMIRTELEAV
FT                   LTTDLGASINGINTFNFDLQTLVIGLTDLQDPQESVIYSMAAINLMELQSFRYPRSAIF
FT                   GDEISTTFKYRSISIRFAEICTKGRKEAKNVVIAGTEENTLVQSEGGRDILNNLDAVFY
FT                   GHCNPTAVENASKHLRLKPEVLSKYVRAEYAPNLAELCTSWYLRKGNQHYELLFYTSAL
FT                   MIALLCTQPEETAARDRILALYPDNPLQGYIKFGHLLKRAYKLNLPLSHIGA"
FT   gene            96170..97315
FT                   /locus_tag="AM1_H0096"
FT   CDS             96170..97315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33446"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR10"
FT                   /protein_id="ABW33446.1"
FT                   /translation="MNRNQAVLLSLIIVFSSPQLTQAQVFSDDITLPKNAPTFPSGSPS
FT                   TTGDVSVTQDNPFDDSPKPNFLKDIFLGPSNNRPIHSSTLKLFDILGKAQKGLKSYKFA
FT                   EQVYKGITGKNANSITDGVFGILEQYGIIDPQKATTASNRSTPILIGQGNQGPAYATAG
FT                   SIGALKLEPKEPYEWRVKALNENIVYKNAIQKTGDFVYSPEAQEILKVQDQVAADARDA
FT                   AAAAAQGGLESVLASTQVKDQSIYASTVVGEYGTSAQSAKSTQAVNKLETKQNTEIANI
FT                   LAGNAFQLNAINESMVRNTSALGNIVTTQSILVDKQTVSQYLDAAQLRQNGQIFTTLNN
FT                   HYSYEKRKDMYQHLAAADTSNLLHFPNLVEPQPNPSGQTQP"
FT   gene            97341..98618
FT                   /locus_tag="AM1_H0097"
FT   CDS             97341..98618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33447"
FT                   /db_xref="GOA:A8ZR11"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR11"
FT                   /protein_id="ABW33447.1"
FT                   /translation="MIIVLYQATHAHADFAEDLISDLEPSVAHDAFWDDLWNATFDRST
FT                   GISGDTQRIAFGAVGTVVRWVTLIALFVVLLHYGSGMMSSGTSLRKGNEFTIKSVFPVV
FT                   VILALLANQFAGVHAVGMFVNQARLGITGEAYAQSEFATTFRSAIKDAYFSEKYRENVA
FT                   FRAKQCNQIETPITTIPSLEEPTNPETPLTDEQRQYYKKVRCIQSMVDYIKTLQAKVEA
FT                   ECADGCVGTRVGIVKDLKRYGVQGVPAIVAENLDTFVIPIQKLGELAADAAKHGAQETY
FT                   RLIFRAIQWAWTSFLNMGFYLTAVGAPITYAISLMPTKRHFLFDLNLFSLLMFSLAEFA
FT                   NIFCIGIVALMLQRPTLVDLGGYIFPLTYGLLAPLVSGSIFLGGFKAAASFRGGALGVA
FT                   SAAGGIAGGIATSAMISARNRREQYY"
FT   gene            98694..99167
FT                   /locus_tag="AM1_H0098"
FT   CDS             98694..99167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33448"
FT                   /db_xref="GOA:A8ZR12"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR12"
FT                   /protein_id="ABW33448.1"
FT                   /translation="MPLYLTLIVVFVAFAILLMVIRGGMAELNPLSGLMACVVLTLFAA
FT                   YHRIFAGADQLSGLDSFFTLGCGLITCQLFIPEFRFWWSDFRFIYGMTVLFYFAFCWTF
FT                   DHIYIVWFWFTGFVLFLLLVQFLFGVASSGGGRRIRGVCDPDSEFDYSIYDEW"
FT   gene            99174..99851
FT                   /locus_tag="AM1_H0099"
FT   CDS             99174..99851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33449"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR13"
FT                   /protein_id="ABW33449.1"
FT                   /translation="MTKKLSRFLPLLVVSALLLNILVCFSWFTQGARAQAPSQVYIQTD
FT                   SGLVVKGKPVDPLYRSDEVVMRFAQEFVSVAYTWPMNGEGQNEGKLIYPLPMYTQAFKI
FT                   HPDIRAEWLGRQHITYAKAKDPFANYVGKPQHTKTTITGAKIERMDPEAHEWDVRLYAT
FT                   QYRFDGQNNLIFNPVKVNKILTLRAVQGFRPNWQIADTDLGRMIDDALHSELLITNIVD
FT                   LPT"
FT   gene            99885..101237
FT                   /locus_tag="AM1_H0100"
FT   CDS             99885..101237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33450"
FT                   /db_xref="GOA:A8ZR14"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR14"
FT                   /protein_id="ABW33450.1"
FT                   /translation="MPTDKRQVEEAKAALLDDPELNELLEENKIAEGRPINDLEKLVDP
FT                   GDKVKHPYYLQPWFRIGSIAIPLIILGFVGYKIWGPKPPVVMALGDKDKQIIELTEKLQ
FT                   QSELEKAQLTQDNMGLTQAAELEPFQQRQKRLKQQAQKARQAKQKKPVPVGGKPVQRQN
FT                   TVSLPRRLYRSPSPKSSFTPANPSPSLLAKGPSLSECVGYVERNINVPGCKRYQISQKP
FT                   QSSPQTNSIVKNPTVPRPAYTPRPQTKPVKLAFASKSKSKPRKKVTPDYQVNFMAGEIQ
FT                   TVDQFEAEFYGAGQSATAPTRTSMKAKVIDHVEWLSPQEAQQMVIPLKITSGPHKGQMA
FT                   EAKIQQMNGLQFTAHVVSINGQAIEPGTMEVRRKNTKYLRAQLKRQGGESFGDRVMGTV
FT                   AAIGGEIATDQLVDVRGGSHISRLVSNPQRRTREVTQYWRFDGEVELVPVG"
FT   gene            complement(101349..101747)
FT                   /locus_tag="AM1_H0101"
FT   CDS             complement(101349..101747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33451"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR15"
FT                   /protein_id="ABW33451.1"
FT                   /translation="MDYNKEAFNCAQKSTTAPTFLEARAILADIQIKKITNQDVLEYVQ
FT                   YCNELADFCIKYGISRDNMPTFLGVITGTDYRKAAGITIWESIKDLSIINGPAKMILSG
FT                   LWMRLRLSGWFKLHDKLTKQYSPEGSKA"
FT   gene            complement(102328..103302)
FT                   /locus_tag="AM1_H0102"
FT   CDS             complement(102328..103302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0102"
FT                   /product="lipase superfamily, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33452"
FT                   /db_xref="InterPro:IPR013818"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR16"
FT                   /protein_id="ABW33452.1"
FT                   /translation="MNNHPDLDQLKTSLEYEVSINYKVSLFPYNHKERGYKIDANAPNI
FT                   WIVIHGFNSSPKSSRIEHFVNSLDEIIRSKQGEVIPHVNTENLYGISPSDQILIMDWST
FT                   AAKSSTLKGIPLNYISVSLTVERVGHALSEILKQARVETKQINIIAHSLGSYVGAYAAK
FT                   FLGGVNTMTLLDPAATYNPPEYKEPIDILENAPRFDEVSNYSIQYGSTSKLGTRDTLTH
FT                   ESYWVDIPGINPNDEHGEILRWFIDNARRPIKSGIASKFNFFASEPQYSKIGLLKDDAD
FT                   VDGWEGTFWAIYHGDGWFTSEPKIFPGKKQRTLVQQALVFIPT"
FT   gene            complement(103479..104405)
FT                   /locus_tag="AM1_H0103"
FT   CDS             complement(103479..104405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33453"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR17"
FT                   /protein_id="ABW33453.1"
FT                   /translation="MLDYSKNNFKIWEEYYKNFSYITEADIRPECHPVIMEWEDQRDQA
FT                   IVLIHGLTDSPYFMRAIGEFFHKTLGFNVYIPLLQGHGLLNPNGMKGVSLEEWKRNVEF
FT                   AVEYAKTKGKKVSIGGLSTGGSLSVFMAMKDSDDINGGIFLFSAALDIAGKKGNLKEFL
FT                   LRTPISSIVDLVEDRWGEPLIGDNPYRYSRMDTGGAKMLSNLIQEVEKITGKLGKKSPL
FT                   SQPLFVAHSECDQAADIEGVEELIFKTTKNNKNTEFYRIGKHFNVPHASVVLKEPVLAL
FT                   NGSPLEPKNPFFEEMMNSIQEFVSKGF"
FT   gene            complement(105125..105241)
FT                   /locus_tag="AM1_H0104"
FT   CDS             complement(105125..105241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33454"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR18"
FT                   /protein_id="ABW33454.1"
FT                   /translation="MRCKWVDMSGVEAVACIAWEVTFTKDADLISGKATNQY"
FT   gene            107692..108378
FT                   /locus_tag="AM1_H0106"
FT   CDS             107692..108378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0106"
FT                   /product="M23 peptidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33456"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR19"
FT                   /protein_id="ABW33456.1"
FT                   /translation="MLGQHVYSHAGNVLRYGQFTSLPGGAEQHEIWKDPAILSQYGPNG
FT                   NAGQNPLLAAINTNSQRCNPALLASNGSVNFQQGSGVASGKLANPLADSSYVVTSNFGW
FT                   RYDPFTGDTDWHSGIDLAHSAGTPFRAADGGTVVMSQWNGDYGNFILIDHGNGLATWYA
FT                   HNQTNYVKVGDTVDPGQVIGTVGSTGRSTGPHIDFGVVEGYVKGNIHSGTNVDPRKHIN
FT                   FKGLRQ"
FT   gene            complement(108359..108475)
FT                   /locus_tag="AM1_H0105"
FT   CDS             complement(108359..108475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33455"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR20"
FT                   /protein_id="ABW33455.1"
FT                   /translation="MVLLRQASAWGEAWDGNAFNNRNATANSSFFMITASIP"
FT   gene            complement(108706..108828)
FT                   /locus_tag="AM1_H0107"
FT   CDS             complement(108706..108828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33457"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR21"
FT                   /protein_id="ABW33457.1"
FT                   /translation="MLEEDLDKFIGNFFAHTFIVVAPDIRFINSTLMPWPAAEA"
FT   gene            108897..110699
FT                   /locus_tag="AM1_H0108"
FT   CDS             108897..110699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33458"
FT                   /db_xref="GOA:A8ZR22"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR22"
FT                   /protein_id="ABW33458.1"
FT                   /translation="MPQQTTQPAPEYRGFHNIPINYGWLTVGFLSIVFIIWLSTLNRRR
FT                   TQIPEGMPNAREATPKEIKEGSNKARLIRAEGDIEKSAIQLNPETGITLGPINPGGLVS
FT                   GKSGGGKTESFALRLIESLAEDGASLLISDIKGELMEKTAAYLHDLGYDIHFLAPGIKE
FT                   TSKYSVEKLPFSGGLNLLDLIANDEDLAGTLELTRGININAAENYERRHQYFGPQSDLL
FT                   QQSMMLGAKSSEYADMLMVWELMGLNNIAERLAAAKDNDKMGKGLPYFMTHLSRGLRTV
FT                   AHSSSSANPGPTIQSTASQNWVQFLDPEIARCMTKTTIPLDLTGKQAIFFRINEDQLEA
FT                   TKTYLAAAIHMLVKRNIRYTRKRQNNLGVIIEEASFTLFPDAKKWSALGRQNGLLLWMI
FT                   YQQEEQMQELYGEKRWESTAANLPSRIYMNQGSYKSNQVIASRLGKKTIISTTENESFG
FT                   SNRSRSRNDSFQQVDLMTADRLDAMKKPGQCIIVDASTNGHPIIYEKKQLPYDKNSSQA
FT                   KIREQCKDAWRENILPSLQEEHQKHFGMINVQVAMENRAAAAEDLLPPSEYYAIEEEAA
FT                   EIDAEEATEDTTDIDEQEDIQDAA"
FT   gene            110689..111126
FT                   /locus_tag="AM1_H0109"
FT   CDS             110689..111126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33459"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR23"
FT                   /protein_id="ABW33459.1"
FT                   /translation="MQHSQDQTLERDAEKGMHLAEEGVEKAARLTAETLRILRAQLAKY
FT                   NNRVSIKFESRADDIANVKAGMQGGLKGVQLRQIVRAGDSIKEVAQRAQSAEKVKLYED
FT                   RVMSRAQHELNREKVEHRRSQQSQQSQKQSQRQSQSQNLGL"
FT   gene            111674..112108
FT                   /locus_tag="AM1_H0110"
FT   CDS             111674..112108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33460"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR24"
FT                   /protein_id="ABW33460.1"
FT                   /translation="MNFNFDFELGDASEASGNSGFYLIHASRLVSVKPIGFCLELSEKP
FT                   LKYQVVYSSGHTIQSYGDQYFYDKSPSVYRLEKKADFDYSLLMPEEGGNGFQAQPHVVG
FT                   DGLVVYGTSTGNAFVLTGTEGGNPHLTLKISPLGVEVGNG"
FT   gene            112662..113057
FT                   /locus_tag="AM1_H0111"
FT   CDS             112662..113057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33461"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR25"
FT                   /protein_id="ABW33461.1"
FT                   /translation="MKQPKFDENSSDQETFAPFILDNCMNSEWKDVRLIFGEWEWFEEN
FT                   FGTETFDGYYFNGYGLQGLVMAVRLDANLDVEPETIHYNSEGDICNIHFTEMAEAITTA
FT                   NLASEMIKDKAQLKRAIQVARENGFED"
FT   gene            113378..113503
FT                   /locus_tag="AM1_H0112"
FT   CDS             113378..113503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33462"
FT                   /db_xref="GOA:A8ZR26"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR26"
FT                   /protein_id="ABW33462.1"
FT                   /translation="MKQVIESGGDPQAIGAATASVLFVAIGLWLLFSKDKDRNPS"
FT   gene            113645..113977
FT                   /locus_tag="AM1_H0113"
FT   CDS             113645..113977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33463"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR27"
FT                   /protein_id="ABW33463.1"
FT                   /translation="MKRIHQTAFSVLTSFTVLSIGLASSALAETITVTRGPNGAAHQVK
FT                   VDRIPQDAQVRSETPTTGFPNIVTRGSHGAAHIAKTDSDRDTTAQSSVRRQVITRGPNG
FT                   AAYIAN"
FT   gene            114288..115811
FT                   /locus_tag="AM1_H0114"
FT   CDS             114288..115811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33464"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR28"
FT                   /protein_id="ABW33464.1"
FT                   /translation="MSTFKDLYNTAKEAEDVAFALSPIPLGFVKSGIQNVGVPLVVSAA
FT                   ATHTPFIAPVAGAAIQWGSDALQSGTHTLAQQAMSNFGESVMSGLPAFGGIQTSFDWIS
FT                   SQSAQVALAGQDMVTHAVGAVGSSVMLGRTVTNSAVLTFQKVRHITVGEVIASGQRALE
FT                   RSQEFLENAASYVRQTGIRAELFVEQEFAKLSNTEEQTTNVQPTESPEQATVFATDKTQ
FT                   GEAETQIKSAAQVESNGTQPEVNYQPSENGNSHTENGRQANIFEAAVESAVNVVNPIRS
FT                   ESSQEAEDYVLGLVDKLAAGNMNVDRLYIKMDGIDIFKMKNGAPDPSTSITDTQRDALQ
FT                   QALEDPAAFGGNLVIKQGNKVLLNIKDGRILHNPMGLAKQSLSAEMETKEHLQQQQPEA
FT                   KQAAVPNNPAEGLWSKYGANVSPDLRGARLATENALKDGLKPKEARAMLAQSAHFQGLK
FT                   ADKGASVAEKVIARTVKTAQARVAQQQRPKQKVQQKEEQKQAAVMAPGL"
FT   gene            116049..116285
FT                   /locus_tag="AM1_H0115"
FT   CDS             116049..116285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33465"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR29"
FT                   /protein_id="ABW33465.1"
FT                   /translation="MSPPLMRRLWQMIESLPQHSLEKLDDSGLVAWLLSYLERHHHLKT
FT                   DERKAAESYLNNHILLIRDIAESRQIHHCPLAG"
FT   gene            116967..117218
FT                   /locus_tag="AM1_H0116"
FT   CDS             116967..117218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0116"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33466"
FT                   /db_xref="InterPro:IPR014964"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR30"
FT                   /protein_id="ABW33466.1"
FT                   /translation="MIKTLEPKQKDLIFCSYRNSSPRVEVVRVTNIVNWYFERVVFPQQ
FT                   HLMFNAPRKAHLEIHSSEIATAIQVDCIPCQRLRVKTA"
FT   gene            117240..117497
FT                   /locus_tag="AM1_H0117"
FT   CDS             117240..117497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33467"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR31"
FT                   /protein_id="ABW33467.1"
FT                   /translation="MNCTQMLTEYLLHQFPWWRGSQLRYEPASKTVYVYCKYMRYLEIL
FT                   LHEVETISRLDIGVERFIVTVPHEMDMVVKCQPNSQPEIL"
FT   gene            117785..118576
FT                   /locus_tag="AM1_H0118"
FT   CDS             117785..118576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0118"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33468"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR32"
FT                   /protein_id="ABW33468.1"
FT                   /translation="MSKAYSSNLTLSQYELIAPLIPPAKPGGRPRSVNMWAVLNAIFYL
FT                   VSQGCKWRDLPGDFPCWSTVYTYFRNWRIDGTWVKIHDRLCSWVRADNDRPASPSQAII
FT                   DSQSVPTATMVNQAVGFDRAKYTKGRKRHTAVDTLGLVLRVVVTAASLPEREGGKKVLT
FT                   AVHQMAEAVQRLYLIWADGGYSGQPFLQWAMDNFRWVIAVVLRPEQTKGFVLLKKRWVV
FT                   ERTFGWFNWYRRLSKDYERLTDSSEAMIYICMIRLMVRRLA"
FT   gene            118631..119092
FT                   /locus_tag="AM1_H0119"
FT   CDS             118631..119092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0119"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33469"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR33"
FT                   /protein_id="ABW33469.1"
FT                   /translation="MSGCAVLTLAVCDAPSSVASTQSIEITEQIQSNISEYDLFNRALR
FT                   KYEQGDYKGAIADFDQAIALNPQNVMAYIHRGFTYDDMKEYSKAIADFDRAIALNPELP
FT                   AAYGGRSATYFSLDNTSQAKQDLETAAKLLKEQGEQAKYQAMLDILDYL"
FT   gene            complement(119562..120287)
FT                   /locus_tag="AM1_H0120"
FT   CDS             complement(119562..120287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_H0120"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_H0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33470"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZR34"
FT                   /protein_id="ABW33470.1"
FT                   /translation="MITPNIPDYVKGWLTDSEAQFLYSQAKACPPGTVIVEIGSWKGKS
FT                   TICLSQGSAAGNNVHIYAIDPHQEDSYPEFEHNVSSAGIRELVTPIVKTSADACEGWTQ
FT                   PIGMLFIDGNHEHDMVEQDFLLWSRFVVDGGIIAFHDSTSSPFNQLMGYLGPKRVVDKY
FT                   LFQSKDFKHIGFTGTTTYATKSSAQTVTDALGRWSMRFKKTFPDTLMLLHQYVLLKLPT
FT                   GVLNGIRRLMGYRQLNLGR"
XX
SQ   Sequence 120693 BP; 32737 A; 28284 C; 26533 G; 33139 T; 0 other;
     attgattcct atcatactcg tgtttatatg aacggaagag acctcggctt aaaacaagct        60
     gatgcagctt acattgccga aatatctaca agaaccggac aacgaattga ggccggcacc       120
     catcaaccta atcgcggccg ccttcaggac caacgcaccg ttcccgaccc cttagctgat       180
     gtgtgggaag acgagctaga accaatgctg cgtcgagacc cacgcctcaa acccatgacc       240
     ctgtatgagt acctgcagga taagtatcca ggccagtatc cccaagtcct gcggacccta       300
     caacgtcggg tgagaacgtg gaaagcctta catggaccaa gccctgaagt gatgtttgaa       360
     ttgcgtcatg aaccaggggt acaagggttc tccgatttta cagaactcaa aggcatcacg       420
     attaccattg ccggcaaacc ctttgagcac ctgatttacc attaccgtct gggatacagc       480
     ggctggcgat atgcccagat catcgaagga ggcgaaagct ttgtcgccct ctcagaagga       540
     ttgcaaaatg cctttgcagc ctgtggaggt gttcctacac agcatcgtac tgatagtttg       600
     agtgcagcct atcgcaacat gggcggccgc cggtccaaaa acctcactcg tctgtacgac       660
     gaactgtgtg accactatcg gctagaaccc actcgtaaca acaaaggtgt agcccatgag       720
     aatggctcca ttgaatctcc ccatggtcat ctgaagaacc gaattaagca ggcgatctat       780
     ctgcgcggca gtgcagattt tacgagcgtt gctgagtatc aagccttaat tgatgcacag       840
     gttgccaagt tgaatcagca gtgccaaacc aagtatgagc aagagaaaga ccatctacaa       900
     ccactgccca aatatcgaac ccctgactat gaagtgctca cggctaaagt cagcaaacgc       960
     agcaccatcg atgttcgctg cattctatac accgtccctt ctcgactgat tggtcgtcaa      1020
     ttggaactgc atctatacca tgaccggatt gtcggctatc tggagcgaca cccggtggtg      1080
     gaattgccga ggaagcgcgt cagtggcaaa ggcaaacgtc gcgaccgttg catcaactat      1140
     cgccatgtta ttggttcaat gcgattgaag cctcgtgctt ttatctattg cacctggcaa      1200
     tcagacctac ttcccaatcc tgaataccgc caaatctggg aacagctcaa agcccaattt      1260
     gacctggagc aggctgccaa gatcatcgtg gaagccctgt atattgctgc ggttcaagat      1320
     aaagaacagg ccgtagcagt gtacttacag cagcagcttc gctcatccag ccttaccctc      1380
     aatcgcctga aaaaacagtt tgagccgcct cagatgaagc aggttcctga actcagcatt      1440
     gaacaacatt cacttgaact ttatgacaaa ctcctcccct cctgctcagt ccccgctgag      1500
     cccctaccag cacctgagcc tctatttaaa aaagctcagg ctctcccaca tgttgaccca      1560
     ttgggaatct atcgaatccc aagccatgca ggaaaactgg tcttatgcgg aattcttact      1620
     agccttgtgc gaaacggagg cccaacgaag agaacaagct cgtctaaaac gtgccctcac      1680
     cgaagccagg ctcccaaacg caaaaagttt taccaacttt gactttagcc attgtcccca      1740
     gctcaatcca gctcccttga tgcaattagc cgcagatccg ggttggttgg agcgcgccga      1800
     gaattgcctt attctggggc cctcgggtgt tggaaaaaca catctggcca ctggggtgtc      1860
     caaaaagatg ctggaattcg gtaagcgggt gaagttcttt gcagccaacg cattggtcca      1920
     gcaactgcaa caggcgaagc tccaactgca gctgcatcca atgctcaaaa aactggaccg      1980
     ctatgatctg ttgatcttgg atgacttggg ctattgcaaa aagtcggaag cggaaacgtc      2040
     cgttctgttt gaattaattg cgcatcgcta tgaacgaaaa agtttgttga ttacagcgaa      2100
     tcaacccttc agccaatggg atgacatttt cactgattcg atgatggcgg tggctgccat      2160
     tgatcgctta attcatcatg gcttgattat cgaaattcaa gccgatagtt atcggcgcaa      2220
     atcagcgact cagagaacgg ctcaaactca gtctcaacct caaaaatccc agtccaaata      2280
     atcgagcgat cactggttgt catttcgatc acgggttgtc gttttgttct gaaggtatcg      2340
     tatgaggtct gaaaaagagc taacgcaaag ggagtgtacg ccaaataata cggttcaaat      2400
     ttgggggttg atccgccttg tggttgtcgc gacatcgcct atggggttga catccaatat      2460
     tccacaaaac cactggtcca cccctccagg aaatagttgg tcatctcgtc catccaatta      2520
     ttgatagtgg tcagaaaaca atcgaattcc ttgatgtcac tcttgagtac ttgtttacac      2580
     caagcacgga tggcacattt agctccgtgc ttggtgtacc tgccctcaaa tatctgcgtg      2640
     agtttctctc ggaggttgta cgcctgtttc agttgtggag aataagcaaa caatcgctca      2700
     aggagttgtt gctctgactc tttcagattc tctggtcgtt ttctaaaagg ccacatcgcg      2760
     cctttgatgc tgtcatactc ttgcttagag agctctcgtc gtagacgttt gacctcacgt      2820
     ttacgaaccg tatcagcaca attacgatag gctttggtca catgaaagcg gtcaatgaca      2880
     attttggctt gcggcaattg ttctcggact gcactgacaa atccttggta catgtccgta      2940
     cagacgcgct caatggtttg gcgtaaatca atgggaatcg attgaaggaa atttgccact      3000
     gtctgctgtt tacggtcggc tagaactgcc aatatatcca ccccatccgt cgtaggaatc      3060
     gtgatcaaaa ccacaaaatc acgatggcct cgtttgagag aaatctcatc catccccata      3120
     actttgaggt ctgcatattc gctccagtca acttgagcgg caatccaacg atcaatgatt      3180
     ccactgacga tatcctcact aacgcctagt tttctggcaa catctgagac cgttgaattg      3240
     atcaagattc gcagaagcca acgctcatat gcttttgtat tgggactgcg aggttcgtgc      3300
     cattctaaat gttgagttgt tgtgggatgg tcatcgcaat acttgcatcg ataacgcttg      3360
     ggccgaattt ctaagtaaac ggggacttca aataatggca ggtgacgaat ccgaaaaggc      3420
     tgatcatgac aatggaggtc agtaatctca cgtccgcatt gatgacaggt tgttccttga      3480
     agcgtactct caatcttgat gagccaatcc cctctctcag tcttcgatag ctctagaact      3540
     cgaatatcag gaaggttgag cgggatgcga attgagttat ccattacgcc attgctctga      3600
     agtactacct cagatcattc catagggatg aaaaaggaaa cacactaaat gtaggactgc      3660
     tacacgctaa ttcccagaga gccaaaaatg ttggcagttg ttgctattct tcaacagaga      3720
     aaacttgcat aaatattcca tgcaaaaaac ggccaactct ctaacagaag ttgatcgact      3780
     ccctgcactt tacaagtgtt gacacagagt atttatatgg ggaagctgga attaatttaa      3840
     ttattataaa aagaaaataa atgaaataca agtaaatttt cttaaaaaag aattttaata      3900
     aatcacagcc taactgggtg gaatctatca gagatactga tcaatcggta gtgggtcaaa      3960
     caatgtgggt ttgctcaacc gatagggagt tgagttgttt tatttctccc tgcaatgtcc      4020
     tttatgtagt catccaaaga tctaaaaaca tgacaagatc agctaaggta ttcaccgcta      4080
     acgcagcttg cactgtcaac aaatcttcaa gttagtggag ctatactccc cgctgtttgc      4140
     ggcgaagaaa tgtgattgct atccaaatct acggtttggg agcaaatcgt attccatact      4200
     tcgactgctt gcagcagggt agatgattaa ggattgcact tgttcactaa tacgactgtc      4260
     cgatatcaaa attgatttgc tcactctgta atggcgtggg cttttctttg acaatctgca      4320
     acttgatccg attctgcacc atttcaggca tccgctgatt gaagttaatc ggcttatccg      4380
     agttcatcag ctcttcatag ataggtgaga ctttgtgaat cgccagcaga tacagccgtt      4440
     tctgttctgg ggtggccgcc cgcatatgat ctgactctga gatgaaccga taggcatcat      4500
     tgagttctgc atgttccttg cagtaggcgt aaatctccag gtcaacccgc tccttgggca      4560
     tctcacctag gcgtttttgg acccgcttgg caatggaatt atattgacct ttgtaatggc      4620
     gtttgacttc agcatccggg gaaattgcat tagcaatggc ggcattgtaa tagcgtggtc      4680
     ccaccttcgc gatcacatca tccaacccct tgcctaactt cggattccac ggtgccaatt      4740
     tgcagacgac cccctcagct tgaagcagtt caatggtgcg gaccaaatca cgacgcacat      4800
     tgaagatggc cgatagcttg gtatcttggt caaacgcaaa ggtgattttc cgtcctggtt      4860
     tggctaaggc tttgccatac tccgttagct ctctttgggg aagtcgatta tcgaattcat      4920
     ccttggctcg atatagggca gtcacccctg gtaatcctac cgttagatga ccctgactga      4980
     gggaagccca agttttcttg agtccttccg tcaacacaat cggtaggttg tactgatcgg      5040
     ccacatacca aacccccttg gcccgctcct ctggggtcgg actgatggca ttacgctgat      5100
     aaatcagctc tgtaatttca tccgggatat ggggcaagaa tacctgctgg tcaacgcctt      5160
     tgggtgtctc atatttcact tcttcaccat caaagattcg aggcgtcttc ggctttactt      5220
     ggcaatagga agacggctgt gggttcccct cgataacaga gagtaaatca gtccccccat      5280
     agccaatcca tcccccaccc tcagcaatgc gggtataggc tcgttcagga tcatcgaccc      5340
     acttgccatt cactttgtgg gttccattga gctttcgctt catctcgttg gtgacttctt      5400
     ggcctgctcc atatttaggt ttggtaaact cagctccgag taacgcctct agcaaaacgt      5460
     tgtctcgtat tgacggttca gaactccctg cctcacttct caaatgctct ggggttaaca      5520
     agctgggatg aatgccactg cccttcatct ccgtccaagt gtccgtgtca agctgccagg      5580
     gtttctccac tcccatatag tctggtgtcc agccttcgtg ggggtcgaat agggtctcaa      5640
     tcgcattctc ttgggcgttg gaggtggcga cccactcttt caagtcttct agagattctg      5700
     taaacacaga tatatgcttg gtccgatggc gcgaaatacc gacatagaaa gattctctag      5760
     cagaagaggg attgagactg gcaatgtaga tcgtctctga attggtcccg ccttgcgccc      5820
     ggtaagtcgt tgtcgcccaa tcatggtcaa tttgctgggg cttactcaaa tcaagctgat      5880
     gcagttggcc tttgttgcct tgaactgtgg cgattccctc ttgaatattg atgcactcta      5940
     aataggcatg ggtatagatc ccttctttct tattggttga agtgaatctg agctgatctc      6000
     ctacggcaat atgattcttc tttgccgtgt agacttcagt tctttcatgt tgagcggggt      6060
     taattttgaa ctgtctgccc cctggtgaca ccactcgtag atgctggcct tcaaccgcca      6120
     agactttata agggacatgg gtttgcagtt gggtataggt gcggtgctta cgatggagga      6180
     tgagtaaatc gcctttgcgg tagttctctg ctcgtttctt ctgaactttc gtgagattgc      6240
     gattcttgag ctgtgtgaat tctgtgttct gggtcagctt cccttcttcg atcagtcgaa      6300
     ctctgagttg atccgtgaag gcttctctct cggcattggt cccgattacc actaaggttt      6360
     tgtctcgtcg gctttggggt aatgagatgt actgcttgac tgccgctgag attttagtgt      6420
     cagcatctac gacttcatgg atgtgaccat gcttttctag gacagagagc gcttcaatgc      6480
     catgtccttc agcgatgagt ttgactgccg ttttctgctc tttattctgc tgtctgatga      6540
     tctcactgag cttatggaca gtggccccac tatgcatgag cattcgcacg ggtgcccctg      6600
     cggcgatggc tccgttctgc ccagtgtctc ccacggccca gacccgagcg cccactttgg      6660
     ctgctttatt cataaccatc tcaaagtctt cagatcccac catgcctgat tcatcgagaa      6720
     tccagagctg gttcggttca ggggtgggtt cactgacggc aagttgagcg atggttgctc      6780
     cctctagatc aaaggattca gcaatggcat tcttggcatt gtgggtggct gcaaagactt      6840
     tgatgacggt ttcagggggt agctgctctc tagcgatacc catggcagta gtcttgcccg      6900
     tgcctgcgag tcctttgagg atttggtact gatccggtga gctgagcaat cgcttcatgg      6960
     cttccgactg accgctattg agctgggtat ggctaaagtc agcgttaggg ttgagggggg      7020
     taacgctgtc attacctttg agccagttat caatgatgcg aatatcccga tccactgcgg      7080
     tttgagtggt gtatcgtcca tcccaggcat ctaatagatc ggggtgagta tcaatctctt      7140
     ggttcagggg cttttcatca aagctgcgga ggtgggagaa gacgaaccgc tgaatgtctt      7200
     cacggctgaa agaggattgg cgttcggaga gatggccgat ggcagcatct agaagttctc      7260
     taggggtttc ctggttctgg ggggtgatcg ggtgactggc aggggtgatg ccatggaagc      7320
     cgactacttg catttcagtt ccccatcggt cctgcttgtc ttcaaggctt tccgtgatat      7380
     ctttagcgat ccgagtttca aagacggctt tctgtctatt cgctggggta ttgctccagc      7440
     cttttacttt gaggtagtct tcgatctccg tggagcgctt actaaacgct tcgatttgct      7500
     catccgttac ccccgctagc tcgaatcctg tatctgtttc acggatttca tagcccatct      7560
     cttgaatttt cagggctagc ttctggtggt agatatcacc caggacaccg cttctcgtca      7620
     acagctcttt atagagcgct cgaaattcac catcgggaca aagggtgccg ttgaataaaa      7680
     cgacatgggt atggacatgg gggtcacctg ccctggactc atgatgatga acgagggtgg      7740
     cagcaagact gcccgtttta atgatttgcc gatctccgct ttccatcttc ctggcagcgg      7800
     catattggtc ttcgatgata gtgagaactt ccttgatgga ttccacatgg gctttccaga      7860
     gtcgtttatc tccgttaggt ccgtggattg ccatactcaa ggatttgcct ggaaccttaa      7920
     aagtgaggtc ataggctaag cgctctttgc ctttacctag aaccataccc ctcatgcgtt      7980
     gaccattagg gaggtcaccg tagaacatct ttgtgaatag ctcaggggaa tagggttcat      8040
     ggggtgccat gctgccaaac cattctgatt cagtcatttc ttggacttct tcattctggc      8100
     tgtagtagct ctcttctttg gtgtagtagc gggcaccgtc cttgatgttg gagctgatgg      8160
     tggtgatgtc tagcatttcc ctagtcccaa gaaatggagg ttccaagtag aggataggca      8220
     gaatgctatg tgaagcccaa atggagaaga gctagtaatt ggcaatatgg ttaacgcgca      8280
     gaactacact gctagtattt tgttgttaac gactggcttt tgtgatggcg aatgaggaac      8340
     agctttcttt gctcaagcag ggggttgaag cgtggaatag ttggcgagag gagaatcttg      8400
     atgttgagat agacctcagc agtgccgacc tccgcaatgc cgacctccgc gatgccgacc      8460
     tccgcgatgc cgacctcttc aatgccgacc tcttcaatgc cagcctcagc aatgccagcc      8520
     tcagcggtgc cgacctcacc aatgccaacc tccgcgatgc cagcctcagt aatgccgacc      8580
     tcagcaaggc caacctcaga tttgccagcc tcagatatgc cgacctcagc aaggccaacc      8640
     tcagcaatgc cagcctctat gaagccaaac tctttggagc caacctcagc aatgccgacc      8700
     tcagacttag caaagcaata agaaccaact tcatggacgc tgacttatca ggaacttgca      8760
     ttacagactg gcatattatc cgtggaacta actttgaatg tgttaaatgt agctacattt      8820
     accttggtta taatttagaa caagagaaat tcactgatcg gctaccagta aaccctgatc      8880
     aagaattcaa gccaggggaa tttgaagagt ggatcaaaga cagtgctgaa gcccaacaaa      8940
     ctattgatct aacctttact gagggtattg actggcaagc tttctctcaa tccttgcaag      9000
     gagttcgtca gaaatatcct gacagtggag ttggcctaca agcaatagaa gagaagggta      9060
     cagcatttgt aattcggctg aagacatcac tagatgcaga ccaaggtgta attaaatcat      9120
     cgcagaaaga actgtatgag acacagctac agctccgtga agcccaagga gaaaatagag      9180
     ttttacgaga aatgtcagaa gtcctcgaaa aactggcaag tcggccaaca acaaatgttg      9240
     acttcaatag agaaacacaa ggttctgata agtcaaatct cctcatgact ttcttgtcat      9300
     ggtttcagaa tggtcaagcg atcattgcga tcattgcttt ggtacttgga gtagcatcaa      9360
     cctatttcat ccccaaaatg tttcccaatg gtttcccacc tgttaattct gatcctcaac      9420
     cggaagtgat ccaaagcgca ccaagttcac caagaactga aattgggatt ggaaagagga      9480
     tggctcagca ggtgcatcaa tttctactaa ctagtgaaca ggcagatcgt cacgtaaatg      9540
     ctgagtcctt gaagctaaat cagtaaaata attcttgtaa cacaaaagtt tcaaatacac      9600
     tacaaatttg tagtgtaaaa gtttcaaacg tgttacaaaa aaccagaaaa actgcgtttg      9660
     ccctcaaagt tggtacaaac ccaagtgatg gcggttagcc gtatccgggt ggactccccc      9720
     cacagaagcc tccaaaagcc ctcttaaacc ctctccccgt ataggtttct tgcaggttgg      9780
     gtaccagaag ggtaccacag gggtgccagc cgggtaccag cagggtacca acagggcaac      9840
     gttagggtac caaggccaac caacagggta ccactagggc aacgcttggg taccagaagg      9900
     gtaccaaaat ccaaaaggcc gatttggcac ttttcatgga ccttgcctat gttcccaaaa      9960
     gagccatctt tttggagcaa gttttatgga aactgaatca atcgaagcga tcgtgatcga     10020
     cctggggaca tccctcacga aagttctgta ctaccaacag gggcaatatc acttctttgc     10080
     tcaatcgagt tccgtcctag agctagacca tcgcaagtat caacaacatg cagctcaccc     10140
     ccagaccaag acccatgcca tctggactga aggggcgggc tatctcgtgg ggcgaggggc     10200
     ctctcaaccc tatgaagaag tggacctctc tcaaaccaaa gccacttcag ccatcgctaa     10260
     ggtactcgcc gcaatcggag aaatcaaaga ccgggtgaac agtgacaagg ccatcaaact     10320
     ggagaacgtc atcctgttgc ttcccctcaa agaacgcaaa gaatatgaaa ccctaaagac     10380
     tgccatcgtt aaagcactct atggatttgg gttcaacggc aagaccacaa agttttgggt     10440
     cggacggttc aatatccaat atgaggggta tggcatcacc acgatttcaa cggaagaacg     10500
     agcagccttc gcagtctttg gtcagaaaga tttgaccatt ggggccatga atcagggaga     10560
     cttaacccca aatatgagtc aaaccctcgt gggttggggc atgtccaaag tccttgaaga     10620
     agtgcaatac acctttgagt cggatgtgta tggggccaag tgcgtctact cctataacca     10680
     acgccgcacc aacctcaaga aactgattcc cgccgagaaa gttgaatttg tctccgcttc     10740
     catagaccgg gcgttgtctt cgtcctggta tcaaattgag cgtaaattgg attcctccca     10800
     agccctgatg gatgccgtca ccatctacgt caccgggggc agttctcagc tctggcgcaa     10860
     acagctcaaa ggggtctatg gtcggcggct gaattgccta gatggcatcg cgagagaaat     10920
     cgcagagaca ttcccccaat tggacaaaga ccccatgatt ctgagaatgg ctgatgccta     10980
     tctgacgatt agaggaatgg tggccgcatg agcaatcgca aaaccttgaa cctcaatttc     11040
     agcaccaggc caaccactcg attagcggca acgattgaca cgatgaatga gctgtatggc     11100
     acagacatca aagcagcgac cgctaacttg ctggaataca tgatggctcc aatgactgcg     11160
     gcgctatcag gtgcatccag aagcgaagtt gacgccttga ttgcgaaatc cttggctcgg     11220
     gcgagattgc atcttgaatc ggcccgtttg catctgccct gtgatgagct tccagaaaaa     11280
     gttgcagaac catttgccgc tcaagaggca tcttgcctat cctccccaca agaagactct     11340
     tcaccaccac cactagatga agatgaagag tttgattaca gcaaacccat tggagtattt     11400
     gatgatgatt actagtgaaa tcttagacct actgaaagtt gatgatgctg aactagaaga     11460
     gattctggaa gcttgtgact ggacgggtac cactgagttc acagatgagc aatctgagac     11520
     cttgctggtg atgaaagctc tccatgatga gaaggggcat gactatattg atgcgtacct     11580
     tcgcagcatc ggccagagac tacaagtgaa tgacacactg ttcaatgaaa tttatgccgc     11640
     catagaagca gcgaatggat ttctgattga ctaccgggag cggtttgagg agatttgcca     11700
     actggtgaat gattgtattt ctcccgctga agccatcatc ccccctcagc ccgtggtcga     11760
     ggatacgccc ccagaggtca agaatgaggc tgatcctgaa tcagtccaga tggatagatt     11820
     cattgatgag caggcgaacg ctgccattgc gaccacgatc tctcaaatca aagggtttgc     11880
     agatctggcc tatgaggaac aggaacgact gaagactcta tttatgacca agtatcgcca     11940
     gggcttagcg aaggaactcc tttccgagga attcaaagct gaatttatgg cacggatgac     12000
     cgctagcttg gagggcaagg gagaagaaaa aaagcaggga gaactcactg gagtaaagaa     12060
     ccctacgcca ttgttgtcca gcagcaacta acggcccgga tggatggcct gcttgcagaa     12120
     aacgagaagg ctatcaaaca gcgcattgtt gatttaaagc tcaaagacaa ggaaatcagt     12180
     cagcttgaaa agctccagcg cattaagcgg actgagaggg aaattaaacg ggaagggaca     12240
     tggttcaaag tcgcgtttat tggcatcggt attctcattg gcgtccccgt tgggggcttc     12300
     ctcaatcact tagctgggca gaatgcggct gtgtcttcgc ccattgagca ggtttcaggg     12360
     aagtgatttc gggggtggtg ttggggtttg cgatcgcaaa tcctgatacc aataccccca     12420
     aatcacacct attaaataca ctgagctttt cactttttca gtttctagag agattctata     12480
     ttgcctaact attgaggatt aatcatgttc ttttttgcct ctacaagcct ggtttttggt     12540
     cttatgtcaa tgggtttttg cgggtgggct atgaggaaca atgcagctta caaaaagatt     12600
     gatatccaac tattgggcct tatgctttcc gtggtttgct ccagttccct tggaatcgta     12660
     gcggttctgt acccctacct cgatagcagt ggcagcgtag cggtcaagca ggaattaata     12720
     ggggagatag aaccaaacga ctcatctgag agtttgccac tgtacttgga tgtgttgaac     12780
     aaaacagcta gccaaaaatt cggtgatgag cttgtaactt tattccaaga gccaagcagg     12840
     tatgtcattg tcaaaaaaaa cggactttta aagtctgaga aatctaaaga cttaaataca     12900
     ctggcacaat ctgattgcga tcaaattctt gagattgctg gtagtaaacg aatttatatt     12960
     cgctatatag acgttggagc agcatcaata aaagatttcg attgtgatct cttggcagag     13020
     ctagagcgta atctccccat gaaactgagg cgttagcttt tgatgctgct ctgctttatg     13080
     cgatggttgt cgcttgctat ccgtaggatt tcgagcatcg cactctgata ccaaccccca     13140
     acatcacacc tattaattca cccagtcttt cagcttttca gattctcgac ggattttgtg     13200
     ttacttaatt ggttgcaatt atgaacaata aatttctcaa cggttttttc aggtgcagcc     13260
     ttattgttgc agggattagt gtatgtcagt ggtttaatcc agttaatcgc caaccttcaa     13320
     aagatgcatc agttaagcat cgtactccag ctttatcaga acgggatgag attggtcgat     13380
     tgaaacgggc cattaatatc aatggcaaag ataaactggg tgatcaattc attggcgctt     13440
     caagggtgaa ggaccgtatt gagatatgga aacagaccga cctgattaga tctgggaatc     13500
     ccaaaagcct aaatgctctt gcaaagtctg attgcgacaa agctcttagg atttttggga     13560
     ttggtccggt caatatgttc tcttttgatc caatcgatat tgaatatttc gatgagcagg     13620
     cacctgatgc gaagcggttt cggtgtgatc aaatggcagc gctagaacgt gagagctaca     13680
     tcaggccaaa ggaataactt tcagaatctc tatggatttt gtgttgccaa actcaatttc     13740
     tcactcatcc acccaaacca aaactcagtc ttttgaaatc cctacagaat ctatattacc     13800
     taggcaattt ttactcaacc attcatgaac aaatacccga caacaataaa acgacctccc     13860
     cgatcttcca gtccaagagg tcgttaccaa tcctttccct aaattataac gaggtcaccc     13920
     aatgacgact aacccctttt tcggctacta cgagcaaatc tggatcgact accagaccga     13980
     ctatggccag cacccagacc catgcacaag actgccatca gaccaaatct tagaccgggt     14040
     ttcgtcctgg ctggctgagt ttaacccgct gcttccacct gagtctcagc tatctgagag     14100
     tatccaggtg ggcattgtcc agcgatttta tgggtggcag ctatgacaaa tactcaaaac     14160
     catgatgact cttcaggttg ggagggggag agttttacaa ttgcatgtat tgatgatgtg     14220
     ccgttttgag tattggggtt cgtactgcag ggatgcgatc gcaactcgat actaaaatcc     14280
     tcgacattgc acctagttat atgcctttat attctcaaaa tccgcagaga atctgtattg     14340
     cctaacctat tattgaattt tcctgtaaag aattaatgct tgaactcatg catatagctg     14400
     gcatttatgg tggcttgtgc ctatatactt tgtttctcgg tgtgatatgc caaatccaaa     14460
     ccccaaacat gctcacttga aaccccagcc cagagctgat aattcaacgg gtaagttatc     14520
     taaatcaatt agtattcgtt tggagcaaga cgtttatgaa tcgctctcca agaagtattc     14580
     cggtagtgga gaactcagag cttggctaag gaaagttacg agagaggccg cagaaaaaga     14640
     agggctgtta tagggtaagg aatgatgaat ttcttttcta ggaaaaaaga gccgaccttt     14700
     gaaaactcaa tatttcattc catagaattc tgcaagagag gggatggcta tacttatttt     14760
     ttccgctttt ttgatccgat cgcaaatgaa tatctagtat ctagagtcca ccgtttagtg     14820
     ccatttgaga tcgatgtttt gctacaagaa cagctgggta aacaagttct atcctgtgat     14880
     ttccttgagg gtggttctgt atttcatttt gaaggctaca cgttgaaatt gggcagtacg     14940
     gaattaagcc agaattgaga gatcgcactc ctgataccaa tcccaaaacc cgcacccatc     15000
     ccgcaagatt ccgacaatgc agcattccca agtaaaggca gggagcagag caaagccatt     15060
     gctttgcgag agcgacattg ccgatctgag gtacgctaca ctcttgctcg tttcgggggt     15120
     gcccacttcc gcatcatctc agcctgatcc tcgatccaat accagccccc ggaacctgcc     15180
     cagcggcgag cgtcttctct tcttttagca tcgtcaccga tagacccgca ttgccattct     15240
     caaactgctc ggagacttcc cgccaaccta gctcccggta aaaccttgca gagctgaccc     15300
     tagcgttaga ccaaatcggc cttgcttgat tggactcttg caaatcctca agcaagtatc     15360
     ggatcagtcc tgtgccaatg ccctgatttc tccagcctgg agctgtcgcc attgctctaa     15420
     gtcgccacgc aggttctccg tgccaggttg agggaatgag ggtagcgcag cagatgattt     15480
     ctccatgctg gtgtattgcc ccataatgac gggtttcctg gtcttggtct tctgcaaaga     15540
     tgacctcagc gataggcaaa cctggccgta aaacttggtg gcgaagtttg aggatatgat     15600
     ctgcggtcgt cctggtgagg gtgatcatgg tgggtggggt tgcgattctc ggagagcagt     15660
     ctaagtctta ctgacagcaa gcaacagcca tcataaattt tgatgctaat ttcttggacc     15720
     tcatacctaa aatttcggat tgagaccaat actataattt tcaaaatctg ccgagattct     15780
     gagttgccta tctcaatcac aagacctgag aattataatg tttgagcagc aatcttcaat     15840
     tgagtggagt gtttgatgca aaaaacacta aggataatag ctatacattc gagcatagca     15900
     atggctttga tgattccgcc aaaatgcttg gtttcttctg cagcaacttt aacgacactt     15960
     gatccatctg atttttctgg agaaccccaa attacttttg atgctctgcc taatcagact     16020
     tcactgaatg gaagggtaat caatggggtc agatttagct ttggaatcgg aacaagtcca     16080
     ggtacagatg ctccatttca aggagtgggg agtgtagagt atggctttca atttagtaga     16140
     caaagacata tcacttctcc ctatgttaat tttgcagggc ctttgatttt gcaattcccc     16200
     aagaaattaa cgcagtttgg ttacggcttt gcgataggta ctaatagcga tgttatccct     16260
     tcccttacaa ctgttgagct ttttaaaggg acaacatctt taggatcttt aagtttcgat     16320
     gggagacggg atggaccaaa tatcttcgga agcactaacg gaggttttgc aggagttgca     16380
     agcgatattc cttttgatag agcaaaaatt aagataaatg ctctttctcc atatgctgta     16440
     gataatattc gctatgtttc agtacctttc aaaggtttgt gaatagagtt tgaacaactg     16500
     ggtgtgctga aagataacgt ttcagttttg gggcagcttg ggtaatactt ttcctttaat     16560
     gtgagtcttt gagaagcata aataggaaga attctattga taatatacga acacctacct     16620
     tgttgggtgg atcaataatc cagattcaat gaatagcttt ttataaaatt caaagaatct     16680
     gttagctcat atttacaggg gggaaataag gttatgattt ggcgatcaag attgctatta     16740
     ctcactttta gcagtattgt cttaactggc aatattcagc ttcaatcagt cagagccgcc     16800
     aacattaaat atgacttcac agtagatttt ccaccattac ctttccgaca gcctttgcaa     16860
     ggccagaaag gagctggatt tcttaccata gatgatactt ctcagccgat tttctcagat     16920
     actaggagtg gtattcctct tgatttttat gaagttgagc agctaaattt tagtcttcta     16980
     ggacaaacat ttaccaagca ggatgacata gcagccaata gaccattaca acgctttcca     17040
     cttgtcgcgt ttcaaggtga acgacttcaa ggtcttgact ttgctgtaaa ccgaaaaagt     17100
     cgaacagggc ttggattcat atttcaagtg gacactttaa gtttgtcaga tgaatttttc     17160
     tcaccctcag atggagattt tactggtaat atcggcgcta ttgtaggtcc tggtttttca     17220
     aggagtattg ttgctgctca aggttctgga ctatcacttg ggcgcgtaaa atttaggcga     17280
     gttcctctag atgatggtgc cgtaagcatt gttttaagta tcttcctaag ttccctgatc     17340
     gttgtatata ggcaacgtaa acaacaacaa ccattaccct gatacgccat gcaacttcct     17400
     cgtgccaggt cgaggaaatg agggtgacgc agcaaatgat ttctccctgc tggtttaatc     17460
     ccccataatg ccgggtttca ttgtcctggt cttctgcaaa gatgacctgt ccattatttc     17520
     tttgtgtgca cagctttaag gaattagatg aacaatttat gaatttgcgt tgtttcgata     17580
     attagcagat aaagaaaata aaaatctcca gttttaaagt tttatatgca cagctcctta     17640
     atttttcata cctaaatgaa aggaacgtca gctctttcaa cccctagtac ttgttgacag     17700
     ccattgcaaa aattactgaa gttaatccaa tcaatccaaa agaatcagac tttgacttgg     17760
     ccttgaggtt ctggggttcc cccttgctcg ggggcaattt agtagctgcc acgacaggtt     17820
     tatcctgtat tctcaaacta gacgcggtgg cctagtttaa gaacattgct cccggcataa     17880
     ggtgcgacct taccaccaca ctcagacaag tccgagtaga agcggacaac tacttgcatg     17940
     tgaacacgaa catttgtgaa acacatgggc actggaaagt aatgaaactg gaccttcatt     18000
     tatcacaaat actttgatgc acctgcgcgc gatagttttt attctactcc tgtcgctaag     18060
     accttctcag gctattcatt aaacgaagta aatcaaactt tgaaaaagac ttaactcacc     18120
     tgcctatcaa cgatttgatg cctttattgc ttgtcggcat acatctaaat tattttgaac     18180
     tgcggcagta tcggggtgtt cgttgcccaa gagcttctgt gtcatctcca aggcttgtac     18240
     atagaggggt tcggcttcgc tgtaccgtct ttggtaggcg tagaggtatg ccaagttatt     18300
     aaggctttga gcgacatcgg ggtgtttgtt gcccaagtgt ttctgtctca tctccaaggc     18360
     ttgtacatag aggggttcgg cttcgctgca ccgtctttgg caggcgtaga gtcctgctag     18420
     gttattgagg ctactcgcga gaaaaggatg ttcgttgccc aagagcttct ggttaatctc     18480
     tagggcttgt ttgtagaggg gttccgcctc cctataacgc ctttgattgg aatagattaa     18540
     tgccaagtta ttgaggctac tcgcgacatc agggtgttca tccccaaata gctgctgtct     18600
     catctctaag gcttgtttat ggaggggttc cgcctcctca taacgccttt ggtttctgta     18660
     aagttctgct aggttattga ggctatttgc tacatcggag tgctcatggc ccagtagctt     18720
     tagtctcatt tgtagggctt gtttatagag gggttccgcc tcctcataac gcccttggtc     18780
     atctaaaagt ccagccaaaa cattgagact ttgagcgaca tcgggatgtt cattcccaaa     18840
     tagcttcttt ctcatctcta aggcttggat aaagagaggt tctgcctccg cataacgtcc     18900
     ttggttatcg tatagtgttg ccaggttatt gagactttga gcgacatcgg ggtgttcatt     18960
     cccaaatagc ttctgtctca tctctaaggc ttggataaag agaggttctg cctcctcata     19020
     acgcccttgg ttgtcgtaaa ggttggccag gctattgagg ccttgagcga cattggggtg     19080
     ttcattacac aataatttct ggaatatttt cagtgcttga gtacagaggg gttctgcctc     19140
     cttataccgt ccttggttgc agtagaggtt tgccaggtta ctcaggctag cagcgacatc     19200
     gggatgttcg tcacccaata gtttatggaa tatttccaat gctcgagtat agaggggttc     19260
     ggcatccaaa tactgctctt gcaagtaata gagagctgct aaattattca gactcttagc     19320
     gacatcggga tgttcatcac ccaatagtct ttgtttcatt tccaatgatt ggataaagaa     19380
     ggtttcagcc tctgcatagc gtctttgatg gccgtagatt gttgccaggt taccaaggct     19440
     ttttgcgata ttgggatgtt cattgcccaa tagcctcttg tacatattta gagcttgggt     19500
     attgagagat tctgcctcct cataacgtcc ttggttatcg tatagtgttg ccaggttatt     19560
     gagactttga gcaatatcgg gatgttcatt gcccaatagc ctcttgtaca tatttagagc     19620
     ttggatattg agagattctg cctcctcata acgtccttgg ttatcgtata gtgatgccag     19680
     attcgagagg ccaagagcga aatcggggtg ttcgttgccc aagagcttct gatacatctg     19740
     caacgcttgc aaatagagag gttctgcctc cttataacgt ccctggtctg tataaaggtt     19800
     tgccaggtta ttgagacttt gagcaatatc gggatgttca ttgcctaata gcctcttgta     19860
     catatttaga gcttggatat tgagagattc tgcctcctca taacgtcctt gatagtaata     19920
     gagggcagcc aggtcattaa gactagtagc agtattttta tgctcactac caaatttatg     19980
     ttgacactgt ttgagacatc tttgcctcca aggcaatgct aaatcataat taccttgtcc     20040
     ttcataaaat cgaccgatac cgacataagg ccaaatcaat tcatcatcac tgagatggtc     20100
     aatccattgt ctgatgagtt cctcgagatg aggaatgctg ccttgtatct cagcaattac     20160
     atcaatcgtt gatctgccat caatcctctg agcaatacca accattgcat tgcaataagc     20220
     cgttttgagg gattccccct tttcagtaag ctcatccaat ttgagtcgaa agaactcctg     20280
     cacaatttga tgaagttgat aggtgccctt tcctattcgc ttgagaaggt tccgcttcaa     20340
     taacccttta tttctagcct ttacgatttc cctgacagat gtctctggca aacaagattc     20400
     aacatgcttc cacgggatag gagctataga aaatattcct aacaaacagg ctaattcttt     20460
     ctcaaaatcc ttaagtttct tccaactcaa ctccaatgct gcagcaactc caagttgggc     20520
     tgtcatgccg tcttctctct cacataaagc ttcagcatgt agccgcattg attcgagttc     20580
     ttggattaaa tcgtggatgg ttagatcttg gtcgttagac aggtatcgtc ctaatagttc     20640
     caggcctaat ggcagattac ccacccaagc acacaacgat ttagcatcct ctagttgaat     20700
     ttgaattcga tcttgtccaa ctaaggatcc cagtagttct aacgcacttt cattatcgag     20760
     ttcctccagg caaagagagc ggacagaccg accaaaatca agtcgggtgg tgatcagggc     20820
     tttaaaccgt gggttccata ggggaagaca ggaggcaaca agctcatact caactacatc     20880
     gtcaacaacg attaagacct cccctttggg ccatcgttgc caaatgaaac tgacctgggc     20940
     ctttgcttcg agatcatctg ggggtttcat tcccagatgg cttttagaaa aatcaatgat     21000
     ttgagtggcg atttcttgat ctcgtgaccg tagccaacaa atcccacctg ggtaaatctt     21060
     ctggcttaag gaccgttgag catattccca ggccagctca gttttcccaa tccctcccat     21120
     cccttcaaga gcagtgatgg cgattcgctg gttactttgc agttgctcat gcagttggtt     21180
     gatctgggag tctcgaccaa cgaaggcaac agcgccactt ggagggaggt tatttggtgt     21240
     atcagttggg ggatgtaact ttgtccggtc ccagtcggac gactctagtc aattctgaat     21300
     attgatagtt tctgcttggt ttactactcc accagaaatc ttattttgat aatttgtccc     21360
     accatagtta ttttgaacct ggctactgtt gtcttctatg acatgcaaat tgatttcatg     21420
     ggctaactgc tgaatctctt tagcaaagtc ctcagactct aacatctcca cattcaaata     21480
     tgagatgacc gcattcaagg cttcagtatt gcctgcatct gctttttgga gagcggcttc     21540
     agctttctct ttccctttga attttgacca tattttggtc cgtagttgat caattaatgc     21600
     ataagctgat gttgcaaact ttttcccagt ttctgaacca gcggcttcaa tggctttttg     21660
     aaaggccaat gagacaatgg ctgctgctgt gaaagtcaat ggttcagtca tagcacttag     21720
     aataaaggca tccaatagat tatcaggtga ttttctagga tttacgctca ccttcagcaa     21780
     gttttgagaa tcagttgatc aatcgagaat cggctgatgg gaagaaatag tgcaactaat     21840
     tccttaaaga atttattttt ctctcagaaa tagtgcatcc atctcttgaa aaatcattct     21900
     tgagtatcat tacctataaa tcagtaaatc actttctgaa tatagtttat agcgtttcaa     21960
     agttgtgcag ctatttctat aaattgctca ttcttgtgcg tttagcgaaa taatggacac     22020
     ttttcaaatt cattagttgt tgtacagtac atcgctattt gcacagatgt acatattttg     22080
     tccattattt ctttatttgc acagctttaa ggaattagat gaacaattaa tgaatttgcg     22140
     ccgtttcgtt aattagcaga ttaagaaaat aaaaacctcc agttttaaag ttttaaacgc     22200
     acaaaagctc ttcagaaaat tgaagaaatc aaaaattggg aagctgacgt tcttttcaac     22260
     ctttaccaac cctcaaatgt cattgcaacc caggaccagg aaacccggca ttatggggca     22320
     ttactttcaa cccataccaa ccctcaaatg tcattacaac ccaccttgaa attagcctag     22380
     tcctggtaag actttgagcg attaaattgc ggatcacaat catattgagt gatcttggta     22440
     aagaggcatc caaaagcatt aggggctatt tgcccaagtc cttactcata gggggggttg     22500
     aagaatgcgc caatccatct aaagaaatta gaatttgatt tggccttgag gttctggggt     22560
     tcccccttgc tcgggggcaa tttaagcgct gccacgacag gtattcctgt attctcaagc     22620
     tagtgcaaaa gcctagtcct agattttgaa gataacccat cagttatgca aaattgtaca     22680
     gacatcagat agtttcagag aaaccctctt gttcaagatc ctttctctgc caatgccaac     22740
     tcccaaagcc actcctattg agctatcaca gcaacaacac cattgtttgc tccaaatcgt     22800
     tcgacaaacc accaatcctt atcgcttggt gcgtcgagcg agcatcatcc tatcagccgc     22860
     ctcaggcaaa agtaacaccc agattagccg tcaatggcaa ctcgaccgca accaagttcg     22920
     ctattggcgt cagcgctggg tagataacca agagcgtctt gccctttgtg agcaagtaga     22980
     cgacagcaaa ccagcattga accagcaagt gttggcgacc ttaacagatg ccccacgtcc     23040
     aggtgtccca cccaccttta ccccagagca ggtggtccaa attgtggcca ttgcctgtga     23100
     atctcctcag aactcagccc ggcctgtgag tcaatggacg cctgaagaga ttgctgatga     23160
     agcgattaaa cgcggcatcg tccctcacct gtcggccagc agtgtgagac gttttttggg     23220
     gagaggctga gctgcagcct catcggagtc gctattggct caatgctaac cctgaggacc     23280
     cagaagcgtt cgaggcgaaa gtgcgccagg tttgccaact gtatgaatca gcagctgaac     23340
     tggaagctca ccagattcac cttgttagta cggatgaaat gactggcatt caggcgcttg     23400
     aacgactgca cccagaccaa gctatgcaac caggtcaacc gcgtcgtttg gaatttgaat     23460
     atgagcggca tggtaccctc agtctcatcg ccaactggca tgtggctctg ggaaaggtga     23520
     ttgcgccttc tatcggaccc acgcgaaaag aatttgactt tgccaatcat attgccaaga     23580
     cagttgaaac agcaccggac gatgggtggg tttttctgct cgaccagctc aatacccatc     23640
     gatctgcttc ccttgtgcga tgggtcgctg tctgttgcgg tattgattca gatttaggcg     23700
     ttaagggtca atctggtatc cttcaatcga tggaaactcg cacggccttc ttgagcgacc     23760
     ccagccatcg gatccgattt gtttatatcc ccaaacatac ctcctggctc aatcagattg     23820
     aatgctggtt tagtattttg gtgcgtcgat tgattcgtcg aggaaatttc acctccacgg     23880
     atgatttgca acagcgcatc ctcgatttta ttgaatattt caatcacact atggccaaac     23940
     ctttccagtg gcaatttaag ggattcacgc cgcatggata actgatgaac tatttacaga     24000
     tctatggact aggacgcgag tagagtcagt acgctgctgc cctctggctt taaccagtcc     24060
     tttgttctga cagcattgca gcaatttgtc tagtagtaga tgctctagtt caccagccat     24120
     aaggcggtct cgaaattcgc tcaggacgct gaagtcaaag ccttcgtcag ttagatccag     24180
     gcctagcaga tatttccaat caatgcgaga tcgtactgct tcagctgctt ggcggtcaga     24240
     taggttttcc cgaaattgaa gcacggttac caaagccagt cgccatggcg gtagccctgg     24300
     ctgaccagta acagaaaaca gggcttggaa gtcagcatcg tcaaatactg ggccgatttc     24360
     atctcgcaac gtcaggtatg gattgccttt gggaaaagcg gctttagcga cgcgaaccgt     24420
     ttctgacggc actgggttaa tggactgcgg actcagggac atcgttcatc gcctccaagt     24480
     attgatacac cgcctttagg ctagctctgg tccgatactt ttgagttcgc caacagtatc     24540
     cgaccgtttt ctttgcactc tcgttttcat ggcattggag ccttgattag cataaagaaa     24600
     ctcgtctaaa attcaaaact agataaaccc tttatgattt atctttctta gcttccagca     24660
     ggggacgata tgctgattgg ctacgcacga gtatcgaagg ttgatggctc tcaggttctc     24720
     gatctgcaga tggatgcatt gcttgaagcc ggtgtgccag aaaataggat ttacaaggac     24780
     agagtttctg gcaagacggc tcgacgacca gggctaaagg cttgtctcaa ggcgctgcaa     24840
     cctggcaata cgctggtggt ttggaagtta gaccgtttgg ggcgagatct caagcatctc     24900
     gtcgatgttg ttggtgagct acggcaacgg gaggtaggat ttaaggtact cgcaggtgct     24960
     ggtgcagaga ttgataccac cactgccaat gggcgcttgt tctttgcggt ctttgcggcg     25020
     ctggcagagt atgaacgaga attaattgct gaacgaacac gggctggatt gaaggcggca     25080
     cgagcgagag ggcggatggg cggacgaccg cgcaaaatgg atgttgctac gcttcagatg     25140
     gcgatgagtg ccatgagtga cccaagagcg tgtgctaagg agatagctca gaagcttggg     25200
     atgacgacag cgacgcttta cacctatgtc aacggagacg gttccgcaaa ggccgctggt     25260
     ctacgtttgc ttgataggtc gcgagaagtc caatagagag gctttttagc tcaccgttgc     25320
     cgacgaatgc cttgctgttt caactgttat ggataaacag acgccacttt caatatggaa     25380
     tcagctaaac tcccggcagc agaagtactt ggagctgatt tatcaggctg accaatcggc     25440
     tgagcggttt gaaaagatga gttggaataa cggtcggcgt tctcgaccag catctgtctg     25500
     gcgatggctg tactacggcg atatcgatga taggcccagt cctctaaaga gccgattgtt     25560
     aagagctgag ctggttgaca acggtactgg cagtacccta aatgctttag agcgtcgaac     25620
     gttaattgag tgtgatggaa ctgtcccaga gctgtacatc aaggtcactc gcttaggccg     25680
     caaggctgtc cggacgggaa ctaatgagtc tgtttttaaa gcacctagaa cgccaaaagg     25740
     gatgcttagt tacaaagcat ggcaggcgat ggtccttgtc ttcaaagcag ggaaagaagg     25800
     ggtccagcat gacggatata gcaaatatac cgaaggcatc cacatgtata cctggagaca     25860
     tttggaacag ctagcccctc cgctaataca gggttatagt tgttcgcgtt tcacagcctt     25920
     cggcttcatt tattacagtc gccattacga gcagtatcga gagacttacc cagatataga     25980
     cacacctgag tcacgactga cgatagatga catcattaac aaactcagag ctttcaggat     26040
     gcagacactt gttcaactgg tgcagatgaa gcgaggggta aaagggatcc aagaagcggc     26100
     tgatgaaatc ggtacacctg ttagttttgc tgctctcagc cagtttgagg acggacagac     26160
     gattaagctt gaacaactgg agaagataat tgactggcta gttcaatgaa accactggga     26220
     aagtgtttca gccgaaaccg taactttctg ttcaaatgcc cccgctggtc caagtgcttt     26280
     gatatctcag ggttgtgctt ttccagtagt tccagtcggg aaaaggtaga gttaattgca     26340
     gactggtctt tactggtgag cttcccatca gggctagcac caaatcggtc gatcaggtca     26400
     gctagcagtt cccagccctc atccaggcaa gccacacgag actgttgcac tgcttgggca     26460
     ataccattga gcatgagctg actggttttg atccgctctt gaatctcctg agcttctttc     26520
     ttttgcttgg ctgtcagccg cttcttttgg gctaactcag cttgcaagtc agcatcggcc     26580
     ttgagcttat ttttaaggga ggtgagctgg acggggccat cgataatcac ctggaggcta     26640
     cctgagaaat cgtcaatact ggggaattct ccagcatagt aaatcagggc tttttcaatc     26700
     tgcttctttt ttccgggaat ggtttcattg agtttctgct ctagctccac taagaaggtt     26760
     ttgagctgat ccgtgtaggt atcgactaag ccttggcgca aggatgccgc ttccttcttg     26820
     atttcttgag cgaagtcaac ggcgtcattg atgatgcttc catcaataaa ccggaagggc     26880
     ttcacgtaga tggtgaattt cttgttgaac tttttctgta ggccagagag ttgatttcga     26940
     gccttagtga atgcctcaga gaaggctttg cggtagcctc ccgctagttc atcgacaaca     27000
     tgaggatcta agcccaagtc ttcggcatct aaacgggttg agagccttaa gcctgaatca     27060
     atttcgatgg agagccgata caggtcacga tctgccaggg tatcccagat atcttcaacc     27120
     gagagttgcg gagcggaatc aatctgggga ttagctgaca agtcgccttg tgggtctgag     27180
     gtcttggctg agactaatct ggtgattaat ttagtcatga gaaatactca ctttctctat     27240
     ggattgtata ttgcctagta aagatttcgg acaaaggagg gcttgctata attcacctgg     27300
     ctttgaaacc ttaaaactct gggtgtgatg gatttacgag attttcagga taagagtttg     27360
     gctgagctgg aagaaatatt tttagaaccc cctgaaactg gatctgatgc tctgctgtct     27420
     tctgggttgg cgttgaaaac aattcaagac aacaagttgt atttgccaga ctccaagggc     27480
     ttcaaggtct atgtggaagc gaatctggga gttacctaca tccatgcttt tcgctgtatt     27540
     caagcggctg aactcgtatt gttcttgcag cagcatttta gtgtgctgcc tcagtctgag     27600
     agtgctgctc ggccattggt gaaactgtcg agggcaaatc agcttaaggc ttggggggaa     27660
     gtggtgagga ttactgccgg ggataagtgg gcaccgggga aagacaggat aaagaagact     27720
     attgcggggc tggggttgga gaaggtctag ttatctgatt ctcgatgaat accgaaaaat     27780
     tataatttct gatatctgaa ctatggatta caagttgcta ggctgaacaa actgaacatc     27840
     tacctcacgt atccaaacat tactgaattg cttgaagcta ctccctggaa tcatcagaga     27900
     gtctattcct tcctccttgc gggccataaa acttctgcgc catagttccc agtcttcttg     27960
     agtcggatgg tcaataccta cacaatattt cgcccagctc tcttgctgat actctgaagc     28020
     tctcaaaaaa gatcctttga cctgtacaga gatcaaacct gcatcaataa gcccttgaat     28080
     caatgcagga tgccccatcg gtgactctaa gtcattgtta acaggagatt cataggcaag     28140
     ctcaaattct tcaacagaat atcgtttggc aagtctaagg atttctaatt gatccaggga     28200
     tagagatgga atactgatca tcttaaaaac tctctacatg cagtacaaat ttactgattc     28260
     aagtaagtta taagggcata aaccaggttc taccaaggat ttgaataact gactatcttc     28320
     ttccacgtca ctagctgatt actccaagat ctccctttgt cacaggcggc aacatacgct     28380
     ttctcaggat cgaagatgtc catgtggtca attgtcagat cgagccagtc atcgtttggc     28440
     tcacctccag acttagcaaa gtctacgctg agggtatgag gacgaaagtc gagaaagata     28500
     tgggatttcg tcacatgctt gcaggctatg ggaacctcaa atctttgcat cggtttgcag     28560
     tgttcatcaa tgagggttaa ttctagggta tcgccaaccc taagctggtg cgatattggt     28620
     tctaaatcct gattcttgtc catagaagct taaacaagac tatatacaag tttccactaa     28680
     tataaaggat gaattatcac aaaaaaagta tcttttcaga ccaatcacta cgttttttgt     28740
     ttactcacaa tcttggcatc aggatatttt ttgagaacgg gtgtcctgct ttcaccctga     28800
     caaatccacc ctagcaacca atcacgctca tatcgtggat gattcttgcc aggatcaacc     28860
     atgacacgaa tcggcttgcg atagtagcgg atgataattt caacacgttc cataggcatt     28920
     actgccttat acgctactgc taccgtctat tgcatctaca cgtcttttaa gtgcttgcag     28980
     atcttctcga acagtctgga tatcgccttc ttgattgata gagtatccca ccaagtctga     29040
     agttatagat cttagatcgg aaactgtttg ccccaatgac gaaatttgct cagcattcgc     29100
     taaaacaaca tcctttaggt ctgcaatatt tgatatgagc tgcatctggc tttgttgtag     29160
     ctctttttgt ccagcaaaaa gctgctgcat gttggcctcg aaagattgtt gccagtttga     29220
     tccgttggtc atgactttct agtgtccttt tcccatttca ttaatagccc cggttgtatt     29280
     tcgtatgtat cacaaatctt cctgagaacg tccggggaag gcagttgatc aggattctta     29340
     tagagagcgt aagcggttgt cttagagatg ccagcatctc ctccgagagc atagggagtt     29400
     attcctcgcg agtccaaaaa ctccttcact gtattaatca tgggcatagt ttctggaatt     29460
     accaccttaa tcatactaac caactagttg acaatgccag ctagataaaa caattctatc     29520
     tccaagcgaa gaatgcataa gtagttgtta ttatcaagta gttgaaatgt tgccatctag     29580
     ttgatattat taatacataa agcaaaggca ccgcttctaa ccgtggaaag ttcaagcgat     29640
     gccctagtta aaacccgata gaggccataa ctatgacaac tttaaccgaa gcacccacca     29700
     ccgtcactga actgcttcag cttgttgact ctcaagtcac tgatcccctt catcctgaag     29760
     tgattgcagt cgagatgcag atcgagaaat atcccggtgt ttgtgagggt ggcgatttgt     29820
     ttgaagtcta tgcacccgtc aaatctaagc caggtctgat ccagcctcgc ctagagagtt     29880
     gggtcaagac tttctatggt gatgaccact ggctagctga ttggcgcacc atccccacca     29940
     ctcgccagat taaagccgaa aacgaagaat tctagaaatg cccaggggca ccctagcccc     30000
     tcccacacca cacataccca ctcgctacac aggggctaaa taccatgatt accgctgaag     30060
     atcttcaggc tgaactcgcg cattgtcatt gcagtgaatc tcactatcag cattggctgg     30120
     gcatccgata cacagaaggc gtcaaaacac tcgcagagaa aggggaatgt ttctggctcc     30180
     tcgacgcgat cgcaagttat caacgggtgc gactcatcaa gtgcaatccc aacctccaag     30240
     aattccagct ttggttgctg accgtaaacg acggccatag cgctgtctta gcctgctacg     30300
     aagacagccc cagcacttgt agccctgtca ttacccaaga tattcctttc actgatttcg     30360
     tcctgccaga aatcaagctg tatgtggaat acggcgttgt gctgctgccg tcagagcatt     30420
     aatctccctg gcctgggtgg tgcctaacca cccgccgcta cattccaact tcaacgagat     30480
     ttcaacaatg aaccctaaag actatgatcg gacgatcatc atgttctctg gtggcaaaga     30540
     ttctttggcc tgcatcctct gggccatcga gaacaactgc cccaaaattg agctttggca     30600
     tcaccttgta gacgggttgc ccgtgcaagg ccagaccgct tccaccctaa tggattggcc     30660
     gatcacatca ggctactgca aggctgtggc ccgtttgctt tctctcccaa tatatttttc     30720
     ttggctggaa ggtggttttg agcgtgagat gaatcgctcc aaccaagcca aagcaaaaac     30780
     ttggtttgaa acgcctgatg gactgcactc tgctgggggc aatggtggta agcaatctac     30840
     tcgccagaaa tttcctcaaa tctccgctga tttaagcgtc cgttggtgtt cggcatatct     30900
     caaggttgat gtcggtgcga tcgcaatccg aaaccaatcc cgattcaacg attccaaaac     30960
     tttggtgatt actggggaac gggccgagga atcacccgca cgagccaatt atgcagagtt     31020
     tgagccagac cgcacagaca accgtgatgg taaatccaat cgccatgtgg atcgatttcg     31080
     cccgatccat ggctggaagg aatcggaggt ctgggccatc atccaacgac atggcatcat     31140
     cccccatcct gcctatcatc tcggctgggg ccgattgtcc tgtatgagct gcatctttgg     31200
     tagtcctaac cagtgggcga ccattcgcaa gattgcgcca gcgcattttg agcggattgc     31260
     caactatgag cagagatttt gcaccacgat tcaacgcaag cgttcagtgc atgagctggc     31320
     taatctgggc acaccttacg ccgaagccaa taatagccaa ctcgtgaaaa tggctctctc     31380
     tagtgagtgg ggggattatc ccatctggac ccatccccaa gcatgggctt tgcctgccgg     31440
     ggcttatggc gagagcaatg gaccgactta aagggcagct ttgaacgctt acacaattct     31500
     ctattgcctg atcgggcaat ccatctattt ctcactcttt ctctatttct tcatcccatt     31560
     cgcttcagag ggccaatcat gaacaaacca accacgcgat accaactcat tccacgagtc     31620
     cagttcacca caacgattga actccacgac cagcagacgg caatccttaa ccgcctggtg     31680
     ctgagtagca aagatttgac cgatgacgaa gctctagacc tgtggctgtc aattaacccc     31740
     tatgtccaca ccttccaaca ttccaccccc agagatatct tttcttcttt gagatatgca     31800
     gccctcgctg ctctaccaaa taatcccaag ccttcttacc ccgtggagct actgaactca     31860
     gttcgttcag agattgaggc cgatggtcag gacttcattt gctgctaagg gtcaatctgc     31920
     ctacgtttct tatagaaccc atttgagatc tttttatgat gtcgtcaatc ctctaaagcc     31980
     cagctaggaa aggcatggaa acaatttagc tttggcctag atttagggct cgttgaaaaa     32040
     ctcttttatc tttctctacc atcgttagaa ccctgaatcc cccttcaccg tggatgattt     32100
     tcgacgattg gtctatttga tttgaggtaa cggcagtttt attaagggtc atcctaaatc     32160
     cttggagttg ttgctgtaaa aggttcttag gctacaacga aaatcactaa gatctcaaat     32220
     gggttctata accactcaaa cctcattcac tttttggaga aaatcatgac cgccactcta     32280
     gacaacaacg ccactcgcaa cgctctaacc aaagccatca aagagcatat cgatcctgct     32340
     aagcctgaga aggtcaacat caaaaaatac atcgtcaaac agtacaaacc tgatgacccc     32400
     acaggacaag acaagctggc taagtttgcc tgggaattac accatggcaa tcgcaatctg     32460
     cgcaaccggg atcatgtcct tgaactcttc ggattgctaa ccctggaagc gacgggacta     32520
     gaacagcgaa aaaccaataa ggccaaatgc tctcccctga aagaggctgt attcaaagtg     32580
     cttaaacagg ttgcaggcca agacatttta atgatcgttg ccctgaatga actgatggat     32640
     caactcacgg tcactcgcat caatagctgg gagaccttct ttaagcaact ggctattaag     32700
     cgaactgaac tcgaatctct ggctgatacc gtgtatgaac tctcgggggt ttctcctggt     32760
     gcggttgaag acctcgacgc tgtgattgtg cccctctaca acgaggcgaa aggccaagac     32820
     attaaagcca ttaactggga acgccgctct tggtgggact gggcacatac ccatttactt     32880
     gagcgggtta gcaaagcagc ttaatcctct ccccctgtat gtacctgggt cagccctgtg     32940
     gcgatatccc cccaaccatc ggggctggct tttccttatt cctattccct tggagaaatc     33000
     ccatgcaagc tcatcacctt aacttggcag aatttctgct caacccgcct acggttaact     33060
     tggcctattc tccggtggcc gttatgacgg tagcgacggc aaaaaacttg atgcaatccc     33120
     aggaattatt actcagtggt gcccagaaac tgtttaatcc agcagtctgg ccccagctag     33180
     aaccagagat tgagcggatt ccttttgacc gacagaaagc ccaatgcttc cgtgattgtg     33240
     tcgcctatct gatggctgag gcgacgacgc tgaggtcgga gcggcgacat gtcgatgccc     33300
     tcaaacatat ggaggcggcg ttgatgctgg aggcactgac ccatagcggt tatgacgagg     33360
     ggccatttgt ttcagaacag taaaaggcat cgccaaattc gggacaagtc aaacgatgcc     33420
     tttcattgaa cgaaccattc aacgaggtta ttcaaaatga atcatacaac tcttccccga     33480
     ctagttatcg acagcattga tctgccttac tatgaactcc acactagatc cactgctgat     33540
     aatgaccgca agctcaatgt gttcttcggc agtcggctga tcgggtatgt ctacatcaac     33600
     tttatccagg gccaatccaa ttacgtcggc accactctcc gacatcagtc cttcggcccc     33660
     ttctctcgca ggatggaagc ggctgaagca gtcctagaag cgttcaatgc aggactcacg     33720
     gatgagcaac ggttgagggt cgctcttgct catgagatgg ccgagaactt gaccgtcatt     33780
     gcttgctaat tcgtaactgc tagagatttg gagtattcat catgcctact atccacattg     33840
     ccaatctgag aaagtcccgg cagcttcaac ccggtgttcg atgtgatcgg gggactcctt     33900
     tgggcaatcc ttttcatatg ttcgctgaat cagagcgaga tcgctgcatt gcggctttcc     33960
     gagtcttctt gtatgaggtt gccattcttg gaaatgaacc tagccaagac ttgattcgca     34020
     ggattgctga gcagcacaag attatgccca gcggtagtta taaaccattc ggtcgaggtg     34080
     caatgatggc ggtgctggag gctctgggtc agaagtctga agtaacgttg ctgtgctggt     34140
     gtcatcccaa gccctgtcac tgtgatgtga tcaaggcttt ccttgaatgg aagtgcccag     34200
     ccccccagca acaaacattg gaggttctgt gatgccgatg atccgggaac gttaccccga     34260
     taactgggac gagattgcgt tgcaggtcaa ggaagcggcc aactggtgct gtaccgagtg     34320
     cggtaaacct tgtcgcaaac cgggtgttga gtggttgcac ttcgctttct ggctgatgat     34380
     tatccaccct gaatggttcc cgaacacttc agagggagag gaacagaagc ctcagcgatt     34440
     caccctcacg gtggcccacc ttgaccaaga tcctcagaac aatcacccag acaatctcaa     34500
     ggccctgtgt gcgccctgcc acttgaaatt tgatgcgccg ttccgaaaag ccaatgcgta     34560
     cacaaagcag gaatggtttg ggcagttaac tttagatgga ttgagaaacg aagagtaaaa     34620
     gggcatattg gagtgctgat atacctgaac ttaagaatca aacttcatcc agccaagaca     34680
     tagctttttc atacaattcc cccaaactag caagccaata cccatccact cgactttttt     34740
     gccatcaata gaaccaccat ctctaaggtt aataccggca ttccaatcaa tcgctaactc     34800
     ttcacgcatt tcatcagtga ccatttcatg atcaatgaat tcttgagcca tacaatcaca     34860
     catttctgag gccatcgatt cactcatgaa ttttaatgag tgatccatac aggattggga     34920
     taatttcgac ttcattgatg gatcgtcgga aaatgatgat tcattcattt cattcttaag     34980
     aatgcagcaa gggtttagat cccaaaaact aactgaacct gtcgcccctc cctagcccct     35040
     tccggtagag gttctggttt ctccgtcttg gcgggacagt aacgctgata cccacagcga     35100
     tcgcaatgtt gtcccacctc cggttcccct tcttgatcca ccctgagctt ccctgctaag     35160
     tccccaatca gctcctgacc ccgctagcga tgcggtgaag tgacttcaaa cgtgattttt     35220
     gggccatatc acaaataaat cagactcaat cttcgaaggt cctggtaatt agctctaaaa     35280
     cctaagatca ccctctaaat caccgattat cacgcctagc ttgtgatcca gcttagagaa     35340
     aatctttgac agagccgata gtttacttac agagagaaaa acaaatccaa aacaagcaat     35400
     ctaattcatt agaaagtttg aaatgattct ctcttatcag taccgatcaa cgttcatttt     35460
     cttatcaatt gcaggataat ccatcatgct aaagccaatc aaagtaacgc tgctaggcat     35520
     tatggcagca acgacagcaa caattgccat cccccaagca aacgcttact cttctttggt     35580
     tgggcaacag tctgaagcca tagagcagaa tgatagttca ctcgttgcct ctcatcgccg     35640
     tttccgcaga ggtcgtagag ttcgacgaat tcgctggcgc agaaagtggg tttgctatcg     35700
     acgcccccat gtgttctatc gtcatggacg taaaatcgtg aagttcaagc gtcattgctt     35760
     ctggaaaaag tatcgccatt ctggccatca tttctaagta gatacggact gaatttacac     35820
     cttagctacg attaacccgc actcctccca tatagcgatc tgtggactga tctaaaggac     35880
     taaccctgaa agggcagttc atcgattttg gagtgaagat tttggatcgc tagattgaag     35940
     aaacaggtgg cggctatgaa cagaaccaat caggacttta aagaatttct atggtccttc     36000
     atttgagtat tcgttgctat cccccagtaa gatgagcgct catcgggtga taccactgct     36060
     ccaatcccgt ctcatccccc actacaggat caaagaatgc acgaatgact gaaattatcg     36120
     tgtatttgtg ccaggggaaa cagcatgttt gccactctaa atcggaccga gcttgccgag     36180
     gtggccgcaa tatccaactg taagtctttg caacattgga ctttaatgat cctacaaatg     36240
     aggtggtatg agccttggct ttcagttgtg ttgagcattt gagctatttc ccatcaccac     36300
     tgacgattca ttacagaaag ttggagaagt catcgccaca caaccatcaa cagtttgtgg     36360
     agaatttcta tgtttaaaaa cccaccagaa ctcaatcttg agtacggcat actctgtata     36420
     ggacttcgag cagtggtaaa acctttatta ctttgaattt ttttactgaa ctttccactg     36480
     aataaatctg aacttttcag gattttatct gccaagaata ttggcgatat tgagggcatc     36540
     aaagttaaag gaaacaagct aaaccattaa atctactggg ttacagagtt tacaacttag     36600
     ttgttgcctc ctggcaaaca actcttacca ccaagcttag ccctgacttc agtactcagt     36660
     acttactcat ccagataaca tttctggttt tcaaatggca gatgagaaat ggtctgcaag     36720
     cttgtcatgc ctaatttttg atttttcact cacatgttga ctcaaatact aaactccgat     36780
     gctattagaa acatcttctt cagctcaaga aatcattgtc atcaatctag gctttgcatt     36840
     ttgtggtgga gcaataaaat acattgatga tgcttttgat tctagtgatc atggaaaaac     36900
     tttagcgatg atttttgctc caattacagg agttatatgt tatttgctca tagcaactga     36960
     tattgcagca gcgacaattc tattagctat tatgctagga gtcgccctca aagggaaaat     37020
     cgatacagta ggtcatttac tagcattagc cattgttctt ttacttttat atgtaaatcc     37080
     tcctgaaatc atgttacttc cctggctagt tttaggtctc gcgggtttcg ctgatgaaat     37140
     agggaacgat tttgttgact ctcggcctaa tctcttaaaa agagcttctt tttggagtgg     37200
     aacgaaattc acctactttt ttcttgaata ccgttgcttc atgaaggtga tgatgataat     37260
     tctcttcttt atgaatatat taagctggca ctatttagtc gctttcctgt tctttgatct     37320
     tgcatatcat cttacgggta cttggtcaga acactggata gcctaagcca atatttactt     37380
     ggaacatatt ttgttccagt aaaactctaa gttatgcaat gagaagtaag gacatctaga     37440
     atacctattt ctctaaatgt cctttaaaaa aaccgaagca acgtgatatt gcataaaaga     37500
     caatgacaac tatcaaaaaa ttagttaata catgaataaa gacaactgca atagtgagct     37560
     attagtcatg ctcaaccatg aactctaaag ataagaattt ggattataaa tctacttttt     37620
     atatcaccaa ccacatcatg ctttatgtct agaaatataa cgattgaaga gcaaggtata     37680
     aggttaagca tattgggcaa cttcttcatg gcaacccttg gcctttgttt tgctagctta     37740
     tcccactcag aaatgattct tctagatgga gtattttctt taattaatct agttattgct     37800
     tatctatctc tcaagatatt aagacgatcc aaacagtcaa acgattacta taattctatt     37860
     cccccaattt attttgaacc attgataaac ttagtaaaag gcgtcatctt aactattgtc     37920
     tgcctcttag cttttgggtc ttcagtaatt attatcctaa acggtggtca tgctatatct     37980
     acaggaaaag ccatttggta tgcactattg gcaacattag tctgtatgac tattgcgatc     38040
     aagcaaggaa aaagagcaaa cgcatgtagt tcttcactca ttgaagtaga tgccaaaagt     38100
     tggttcatcg atggtttgtt gagcggagtt gtagtcttag tttttacaat tgtgtttttc     38160
     ttgcaaaata caacattagc aatattctta ccttacgctg atcctattct agttattttc     38220
     ttgtgtttaa tagtagctcc tattcctgtg gagattataa aggagaactg gcctaaatta     38280
     gtaggggaaa aatatgatgt ccagcttgaa tataaaatca ttgatattat agacaaacat     38340
     attccaaaga caacaataca agactactat gttagtcatg gatacttagg tgataagctt     38400
     tacgtgcaat gtcatctttt agtaattgaa gaaataagtc agaagttaag tttagccgag     38460
     caggataaaa ttcgtgcttt tctttatcag aagctaagag atgactttcc tagcctagcc     38520
     attgatataa atttcatatg tgatccaata tgggttgaaa gaaggatatt gcatgtgagt     38580
     aaagcttgac tgatccaaat atctttataa tgaagttctc tagtatctca ttggataagt     38640
     caagatatct cgaccatgaa gccggcacac gatgtcctgg tatccactga atatgtttca     38700
     tcagaaccca gcgttatgca accgtgtcag caataagcat ctgaaactgt tcgtactgaa     38760
     acttataaat tcaaaaaaat cacaatccca aagccaactg cacttgcgta acctccttag     38820
     cctcttgcgg taggggttct ggtctagtat ttttcgcggg gcaatatttc tgatacccgc     38880
     agcgatcgca atgctgtccc gccacgggtt tccattcctg atcacatctg agcttcatcg     38940
     ccatatcttc aatcagagac tgggcttgct ggtgatggtc aggtgtgacc tcatagatca     39000
     gtttctcatt agaacgcaag tagattagac tcagacgttt gagcgctttc ttgtagatct     39060
     gttccagtat cagataataa aaacccaatt ggatatccac ggatggagga ggattgacgg     39120
     atttactggt cttgtaatca atcaattcca gaccatcatc aatataatcc aagcggtcat     39180
     accgaccaga cagggtaaat tcgatgttgc ggacttggag ggttgccctg acttttgtct     39240
     ctatccccag cggtttacgg atttgaggaa gtggggcaat gtaccgctcg tagtaaagct     39300
     gcaatgctgc ccacccctca tggatctgcg tcggagtcaa ttcactggta tggtgctgcc     39360
     aacaaacagc aaaccagtcc agggaaggaa gagggtaagc gtagttccaa tccttgtaga     39420
     cattggctaa cgctgcatgg agagcattgc caagcttggt ggagccgaat atggttggtg     39480
     aaggtaattt atgctcatac ctaaattgat aggattttgg gcactgtccg taggttttga     39540
     gcttggtggc tgacagggaa taggacatgg gcgtgtgtta gcgcatgaac ctatggtaga     39600
     tcagatgtat taagtctcaa tcatcgattc agttttatcg tctcttcctc agcggcaata     39660
     tactgatctg ctgccgctga aaagccataa agtaacggtg actaaacttg ccaaaactct     39720
     ttagggattt ccgatcttgg ctctccctga actgtcttgc tagcatggtt cactgaacac     39780
     catttattca tcctttccac gcttaatgtc agagcaagat aaatacgccc cagcccccac     39840
     tcgaaatacg gaggagattc agaagaacta caacagcgat gccaaggcaa tgcgggctaa     39900
     agctgctagg gccaggattg ctgctcgaca gaaagcggaa cgagatgcac ggcagagagc     39960
     ggcgattgag aagattccgc tagagcatcg atacgtgcct gatcaggcta gttagcatat     40020
     agaacccatt tgagatcttt ttatgatgtc gtcaatcctc taaagcccag ctaggaaagg     40080
     catggaaaca atttagcttt ggcctagatt tagggctcgt tgaaaaactc ttttatcttt     40140
     ctctaccatc gttagaaccc tgaatccccc ttcaccgtgg atgattttcg acgattggtc     40200
     tatttgattt gaggtaacgg cagttttatt aagggtcatc ctgaatcctt ggagttgttg     40260
     ctgtaaaagg ttcttaggct acaacgaaaa tcactaagat ctcaaatggg ttctatagga     40320
     ctttctttat caatactgag gtagatctgc tttgtgctaa tgtttacagc cattctgaat     40380
     gttctggtgt agagagggta ccgaaaagtt caacttatct gaatcctggc caaagccttt     40440
     aggctcgtag tttagaaccc attctcaaca tcaattacag ttgtaatttt aaattttgct     40500
     ctacgttcat caaactgtgg aatctgtttc tatccaatcg ggtaaatatt cagagtgcag     40560
     attgtcataa gttgataagg tctcatgatc atgaatagat gggagctgaa ggaaaggaag     40620
     ctttccagaa gatggcatag tattttttgc agataccaaa ggcaaagcct ttttcttcgg     40680
     gggtaaaggc tctgcgactt cgtcagcagc tttgtttaat cgctcctgtc catatctctg     40740
     ggaagatagc ttcgatgggt aggcagcatc tacagttttt ttagccaaag ttcgctgggg     40800
     tagaatcaca ttttgaaata cgaattcaac cgtttcaaat ttgagccagc cccgagacac     40860
     caagatttct ccaaatcgca tttccgtaga atcttgatcc gataagacaa cttctacttg     40920
     agccaaggac aataagcctg cgtcaactag gtaactacca atgcgtttaa tgccaggata     40980
     gcgggatgca tctgtccgac gatgtactgt ttgtttttgt ctcaaacggt tttggcgttt     41040
     ttttgactga gttttattaa agtgcttttt cggtttggag ggtgtggtga gagagggttt     41100
     ttctgtactt ttcagccaac tcaacatatt caatgggttt aatcgcatcc aatggcccga     41160
     aatttgaatc gcgatgatac ctcgctcaca ggccaagttt tggataggat ataaaacacc     41220
     tcgatagagg ataagtaaac tcattaaaga gcgctgttta ttctcttttt catacctcca     41280
     ccaggcttgt aataagtcta gggaattagt aaagtgaaca ctatagtttt taggaatatc     41340
     aataggttca tattcataaa aacctgaaat gtttgactgg cggatgggca aacatttttg     41400
     cttggccata gattcatgca actgtgacca aaagctagac ttataacgaa ttgagctaaa     41460
     gcgtcgttta ccagataatt tagctgtagc aattaatcct tcagatttag ctaatagttg     41520
     caaagtatct ccaattggct caaacctaag ctcagcattg ctctcaaatg ctgagtagcc     41580
     tgaaagataa cttgatacaa atacttttaa aagttcggca ttgttcataa gggtaaagta     41640
     tgaactttag ttaagataat agaagccatt ccatcatacg attgttctca aacgggttga     41700
     gtgatctata tcagtgactg ttatagattt tatctctcgt gaaatatatt agggaaacca     41760
     ctcaataaaa ttctcagatt tcaaactaaa tagcagaacg cttaagatca tggaatagct     41820
     tgataaaaat gagaaataat taatttaacc ccagcgacac ccctataatc tctccctgaa     41880
     gattcttcca attattgtcg tatctaagca ccgttttaga ttcgttaaaa caccagccat     41940
     gcaatcaccc tctccaccta tcggtgacct caagataccc ctacaatgcg gccagcgtcc     42000
     tgtgccttga gattcgctga atattcttcg tcggcattca agcgttatgc atccgcacca     42060
     aagctgtgca tctgagggaa aataggtgcg agttggaaaa gggcataagc cactaaatag     42120
     tcatgtagct gaggatgcat cggcacttct cgcgtatccc gctagccatt catctgatgc     42180
     cagtgaaaca acaccgtgga ctcgggacca ctggtgttga ccacatcact ggtgagtaat     42240
     atacagactt cacagatcct gaatccggta tagaggcaga caccgagcaa ggctgataat     42300
     ctcacttaaa ttcaagatca aagcactctt gaacatggga ataatggcga aagagtttca     42360
     caaaatatct acatcgcact gccatttaaa ccccgtttca tattgaccat aaatcgtcca     42420
     ctgatgttga tctcagtacg atgttttcag ttcgaaatta cttgagaaac cctttattgt     42480
     tatttgccta agaaagtaaa taattaggct actcataact aaggaaaatc atctttcatt     42540
     tagtaacttg aaaccaagat gtaaaccatg aagtcctcta acattgagag tataaaatcc     42600
     tcccattgct ggaaaataat tgttgttgat gataaagaac aagttcatgc cgttactcgt     42660
     ctggcactcc aaaattttca atataagcac aaatctctag agcttatttc agcctattct     42720
     agtagtgaag ggcaacaact attagagcaa aatccagata cagccgtgct gttgctggat     42780
     atagtcatgg aaagagaaga tgctggttta gatctagtta aatatactcg tgagaaactc     42840
     cataatcggt ttattcgtat aattctacgg acaggtcaac catggattgc tcccgaacag     42900
     tccattattg aagaatatga catcaatggg tatattttaa agactgaatt aacccagcac     42960
     aaactctttt gttttctatt aacagcaatc cgaaactatc acaacttact aactgtagaa     43020
     gaggctcgtc agcatatatc tgcccaaaac caagaactag agaactctaa tctcattttg     43080
     gaaaagaaag tgcaagagta tacccagata ttacaaaaac aaactttagc acttgtagaa     43140
     aataataaaa agctcgaatt agaagttcag gctaagctcc atgctcaaca aaatctagaa     43200
     ataatcaatg aaaagctttt tgaggcgaat aagaagctct ccttacttgc caaccaagat     43260
     gcattgacag gtttggctaa tcgtcgttat ttcgatgtgt atttgcaaca agtttgggaa     43320
     tctgctcaag aaaacaagca tccattgagt atattgattt gtgatattga tttttttaag     43380
     ggttataacg atagttatgg acatccagag ggtgatcatt gccttcaaag agtctcccaa     43440
     atcattcacc gagttgctgg gaaatccgag ggctttgctg cacgttttgg tggtgaagag     43500
     tttgctatag ttctacccaa taccaacctc atagacagtc aaacaatagc tgatatgtta     43560
     aggtcagaga ttcataacgc tcgtctccct catcgagctt caacagttag tgagtatgta     43620
     acagtgagta ttggtgtgac ctcgatacaa tttcagtcag atggatcaat aaatgacttg     43680
     atccttcggg ccgatcaggc cctctatgaa gctaaaaaac taggacgtaa tcagttcgtt     43740
     acccttcact agaatctata aggttaccca attgaaaagt tactaactga atctccttgt     43800
     ttaacaaccc tgcccccata acctcttcct gaagatcctt ccagttatcg tcgtactaca     43860
     tcaccgttgc tgctttcact tggcgtgaaa gctgctgaaa cgttcaaata tcttcgccac     43920
     ttggtacttc atcatgcacc tcatagaatt cctgctctgc cttcagctca attcctcgat     43980
     ctgaataccg gacaaaagac tgttccgaag catgacaggt aatccgccga gccagaactg     44040
     aatccatgtc cttcatcacc agctgagtcg ctagggtatg ccgtccccgg tgcggatggg     44100
     cattctccac ctcggcaatc tctgctatcg ccttaaagat cttgtagatg ccccagtact     44160
     gtaatcgctg acccttactg ttgttggagt gagagacaaa caacggtgaa tcattttcca     44220
     gaacatcccc ctgttgctct cgccattgct tgtactggtc aatcgctttt cgagctttct     44280
     tcagcagtgg cacggtgccc acactgtctg ctttagcgac tcgaatggtg atgcgctgcc     44340
     cgtcatagtc cccgacgttt agcctgtgaa tctccgatgc cctcagccca tgatcaatca     44400
     ggtgcagcaa ggcccgatct cggaaggcat ggaagccgcg atcgcaaatg gcttgatata     44460
     gtttatccac ttcatcctgg ctgaattctt ggggcagcac tggatcggcc ttaagctttt     44520
     ctagtagcaa agttgggtct ttggggatgt agtctcggac ggtcagccat ttgaagaagc     44580
     tctgtaatgc ggccaagttg cggttaatgg tcgcgttcct tcggagttgg ccccgttgat     44640
     tgggttccgt cttcagatga ttcttgtacc gatccaaatc cctggctgtt atctcatgcc     44700
     atcccttatc cgtccagtcc atgaactgct tcaagtctcg ctcgtatgct ttgcgggtgt     44760
     tggagctaat ctcgcgagac ctcataaact ctcccactcg catccatagc agatctgctg     44820
     gggtggtttg aggggggtga gtccgggacc gggcagtatc gatgggggta atggcctggt     44880
     ctgccaatac aatgagtttt acttcgggga cggtcatgag gagaagccta ggagcgagac     44940
     gctgtgatgg ttaaggatgc catcaatgga gattctactc cagataaatg agcggttgtt     45000
     tcgcaccaac ataagatatg gccccaatat cttttattga ttccattagg ttcaaaggac     45060
     aagagccatt ttagtctgta tcgatgaaag gatatgcagt gaaagggttt tagataatta     45120
     gacccatgga ataaaacccg aaatgagtgt atgggaagac aagtgcaata aagttgggaa     45180
     tagctttaca tacgagattt catattgcta tcccttagca ttgatagtaa ttgttgacca     45240
     gattttaatg gttgcgtcac tgcctgagct aatcaacttt tttccatcag ggctaaattg     45300
     aatagatctt acagatttag tatgtccaat taaattacct aaaggcttac ccgatagggg     45360
     ttgccagagc ttaatagatc ggtcataact gccacttgcc aagctacgtc catctggact     45420
     aaaggcaaca gataaaactg gctcagtatg cccctttaaa atctttaata gcttcccttg     45480
     atggcgttgc cagaccttta cactttggtc ttgacttcca ctagctaaat attgaccatc     45540
     aggactgaag gagacagatt ttacagcact tttatgtccc tctaaagaaa aagttagagc     45600
     aagctgttct ctctgccaaa agcgaataac accatctcga cttccgctag ctaacgtctg     45660
     gccatcaggg ctaaaagcga gagatagaac atcttcaggg gtaggctgaa tacgaatcag     45720
     ttcaccagtc tttaaattcc aaagcctcaa atttttatca gcagcactcg ctgccaaata     45780
     cttaccatca ggagttaggg caattgcact gacatcatct tcagcttcat caagggtatg     45840
     aagatgttct ccagtctgca agttccataa atcaatgcga ttatcccaac taccgctgac     45900
     caacgtctgg ccatccgaac tgatggctaa tgacgacacc gcatcttcat gggcattcag     45960
     agtagctctt aatttccccg tctgtagatt ccagagatta attttgccat catagcttcc     46020
     gctggctaaa gtttcaccat ccggactaat agagatggca tagacccatt tattatgact     46080
     ctttaaagtc tgcatagcca tgtgagtggt gatacccgct aataaaggat catggggata     46140
     tgtagaactc actcctaatt gttcatgagc attaagggca tataaagccg ctgtagtgga     46200
     taagattagg aacataaccc agttgcgttt ctgaggtatt ttggccattc tatttttcct     46260
     tttcattgaa gttgactaaa gtaatgagaa ctgggagtgc tattcctcat caattcttat     46320
     ttgaaggttc tggagatttt ggcttttcag gtgcttgttt tggtgccttt ttcaataaat     46380
     tgttttcata caatattcga attagaaata aaaaagtcac aattcctatc attaataaag     46440
     aagggggtgt taaccatgtc caatgccccc acatcttgtc aatgatgtgc caaagtaaca     46500
     aaaacattgc caagtaagtc aattggtgta gctttttcca attctttttt agttttttta     46560
     cgctccaatc attcgatgtg aaagctagta acaagaaaat agtgaacgta aaaattcctt     46620
     gactatagat ccaataggtt tgaatatcta gaaagtcaat ttctcttttt ataatcatca     46680
     aatatccatg aacaatggat agtatgaatg caactaaacc taatagacgg cgctgcaaaa     46740
     gaagtttttt agggatgcct gtttctttta gagatggaaa gacaatcctt aaaattgtag     46800
     gtaatagggt aacaacataa agcaatgcag ccccaaaacc tagccaattt gcataaggtg     46860
     gagaatcaag tatagacata gaaatgacca catagaaata tttaagataa aaaagccgat     46920
     gattaccgct atttatctct ttttctacta ctattttttt agtttgatct tctgatagtt     46980
     ataaagctag gtttattacg aaagtgtctt tctctaaagt aatattgttc tcaccacaga     47040
     acttattgat aagcatcttt agaatagaaa attaatctct ttagaaaata aatacagagc     47100
     tttgaatact gctataggta agagagtatc gactaggcta tggcttttac gaaatttata     47160
     aatcctctta cttatatatc tgaacaaatc agtataaata cgcgcctcaa ctaaactttt     47220
     ttcaaaaaaa cttaagctat tagtttacta atatctagta gatttatatg taaataaaat     47280
     attttttggt aaattaaaaa acttaaattc aatgtatgta tatattgtgg agattttgca     47340
     aatctattca aggcatagtt tgaaagaaat aaatctttta gaaaaaaatc atatttgatt     47400
     tatttaatgt attttaaatc acgaaaaaca tgtgttacgt taatcattaa gccagtagta     47460
     tttttcctat ttatctacaa atttaaatgc ataattttta tcacgattac agatagatat     47520
     atacatggag taactagtta tttccaaacg gcgaatatca gaatttcgca aaatgtacaa     47580
     attttttaga tatattctag ggaaaattat gacagcctac ccacctgtac gagattttgc     47640
     tgaacgtttg aatcaagcta atgagattcg agatcttact cgcgatgatg cctcaaatga     47700
     tttttcaact gaacaaccgc cgacgaatga tgatgaagct agattcaagc aacttggatt     47760
     gccaggtttc gcctctttta ctaaagcttt aggtcatcaa gataatggat tggttcaaga     47820
     gcagtccttt aactcgttac taacagcaat tcaggaaggt acccaaatag cattcgaagg     47880
     tgttcagttg ggaggtggca tccgaaaact tgcgaatcct ctgaatgctt tttcgttcca     47940
     attgattgga aatgattctc atggagcaag aatggctgca gcaccatcct tctctagcag     48000
     gaactcagca gttgatttgg tagagcgata ttggatggcg ctctgtcgtg atatcccttt     48060
     tgatcagtat tttttaagtc cgttgattgc tgatgcttgt gaagatctga acaacctcgg     48120
     atttgaacag gaatttggat ttacctgtac ccctcagact atcttcagag gcccatatac     48180
     tggatgtgac ataggtcctc acgtttccca gtttctcctc caagattttg atttcggaaa     48240
     tcaacctatt cggcagcttc aacgctatcc gcaagagggg cttgattacc tcactgactt     48300
     tgatggttgg tttcaggtga ataatggcaa tattgatccc actggaactg atttcttagt     48360
     gggtgaacgc cgcatcatca ccctgagaga tgctggtcaa tgggttcaca tcgatttccc     48420
     ttaccaatca gctctttggt ctactattat tttgcttgga ttaggtgctg aaatatccga     48480
     ggcgagtccc tacgccaatg gggatattcg ttcttctgaa ccttttggta gcttgggtgg     48540
     tccagatgtg actattcagc ctgctttagc agcggtatat gctctaaaac atgcatggtt     48600
     ccaaaagtgg tgtgttcatc gtcgtctcag gccagaagtt tatgcccaac gcttagagct     48660
     gttccgtaga ggtctattag aacccactgc cagtgatccg cttaacaacg gtttatttaa     48720
     tcaactattt ggtgctggag cagatgtatg gagacagact caagtattag aacgcatctt     48780
     ggagcacaac aagatgcaga atcaggttaa ttttagaact gatccagagg gaacctggtt     48840
     gctacctatt gcttttccgg agggctctcc aactcatcca gcttatccag gtgggcattc     48900
     tgcatttgtt gctgctgcgg caaccactgc aaaagctttg tttcaagatg ctcctttccc     48960
     taatccagtg atcccaacga gcaatggtca aggattagtt ccttacactg gaccagcttt     49020
     aacgattcat ggtgagctga ataagctaat tgctaatatc actcttttcc gtgatggagc     49080
     tggaatgcat tggcgaactg acggtactgc atcaggtatt aatactccac cagatcgaat     49140
     gggtgtagga attccaactg gtgggaatct attgggcgaa atgctagcag tcagtatgct     49200
     cagggatatc aaacgtacat atcgtgaaga acttggtctc tttaagtttc aaggacttga     49260
     tggtggcccg attgagattt agttctattg ctagccttcc aaaagtaatc aatagaatca     49320
     aataaatgcc aacttgctcc ccataatctc aaaaccgagt ttcaaacccc ttcacctgac     49380
     tgaaggggta ttttaggagt tatttctact ccaaataata ctcattatct gtattacacg     49440
     aaaacttaca ctaaaaaaag actgtttcac tctagactct ggaattcttg ctacgactga     49500
     cttttggatt tctgatgttt gctggggcta gctagagcaa tgactctaag ttattccgga     49560
     taaccaaagt ggtaggatgc tcaggaccca aggcgacctc tgcgatactt aaagcttgct     49620
     gaaagtcaga aatagcttct tcataacgcc cttggttgtc gtagaggaat gccaagttat     49680
     tgaggctacg agcgacatcg gggtgttcgc tgcccaagag cttctgactc atttctaacg     49740
     cttgcacata gagcggttcg gcttctgtgt atcgtccttg ctcgtagtag aggaatgcca     49800
     ggttattgag gctagtggca acagaggggt gttcgctacc caagagcttc tgtctcatct     49860
     ccaacgcttg cacataaagc ggttcggctt cgctgtaccg tccttggttt ttgtagagta     49920
     ctgccaagtt attgaggctc gttgcgacta aggggtgttc gctgcccaag agcttctgac     49980
     tcatctccaa cgcctgcaca taaagcggtt cggcttcgct gtaccgtcct tgttttttgt     50040
     atagtaatgc caggttattg aggctaagag cgacatcgga gtgttcgcta cccaagagct     50100
     tctgtctcat ctccaacgct tgcacataga ggggtttggc ttctgtgtat cgtccttggt     50160
     tgtcgtagag tgctgccagg ttattgaggc tacgagcgac atcggggtgt tcgctgccca     50220
     agagcttctt ttgcatctcc aacgcttgca catagagcgg ttctgcttct gtgtagcgcc     50280
     cttgctcgtc gtagaggaat gccaggttat tgaggctacg agcgacatcg gggtgttcgc     50340
     tgcccaatct ctgtcgagtt tgttctaagc acttttgtct ccagggcaga gctaatccat     50400
     agttcccctg cccttcatag aatcgactga tgccaacata gggccatgtc aattcaccgt     50460
     catttagtga gtcaatccgt tgattgatca gttcctctaa gtgaggaatt tttgcagtca     50520
     tctgggcaat cacttcagtc gttagactgt aatcaatctc ttgagctgca actaccattc     50580
     ctctgcaata ggctgcttta agagattccc cctgatcagg acgctgatgt aattgaatcc     50640
     gaaagtactc ctgaacaatt tgatggagct ggtaagtacc ctggtctact cgtttgagta     50700
     agtttctagc gattaaacct ttatctctgg tgtcttctaa gtcatctgga tcctgttcag     50760
     ataggcagct ttcaaccaag gtccaaggaa taggagcaac cgcaaacatc cctagaaagc     50820
     aggccagttc ttcttctgtc tcactcaact ctacccagct taattccaac gcagcagcga     50880
     ctccaaactg tgcggtcatt cctgattctc tttctgtcag tgctttagca tcaagccgct     50940
     tggattcaag tcgcttaatc aatttatgga gggaccagtc gggcttattg gctagatacc     51000
     gccccactaa ctctagtccc aagggcaagt tccccaccca tctgcataag gcttgggcat     51060
     cgtcgagctg aggatcaatg cgcttggctc caactaaggt tctcagtagg aataaggcac     51120
     tggtatcatt cagttcggtg atggagaggg gatttacgga tagacctaaa ttctgacggg     51180
     tagtgattag aactttatac cgtgggtctg atggcggtaa atacggttcg atggtctcaa     51240
     ggtccatcac gtcatcaaaa atgatcagca cttttccagc cggccattgc ccccagatat     51300
     aactcacttg ttggtcttca tcgagtccat ccggtagagc cagtgccaac ttggtccggg     51360
     caaattcgat aatttgggca gctagctcct ggcctttcac tcgcagccag cagagtccac     51420
     ccaaataatg acccagattg agctgggaga tggcatattg cagggcaagt tctgtctttc     51480
     cgatcccacc catgcctgct aaggcggtga gggctaccgg gttgttcttt tggaggagct     51540
     ggtgcaattc cagcagcgtt tggtcacgac cgacaaattc aacgacaccg ctgcgaggga     51600
     ggttatgagg aggacttgcc tgccgggatg atggtgcttc ttgtccctga tatggatgac     51660
     tctccgttgg tggactgtgc cctgacgaag aggtgtctac ttttttgtca gggtctctac     51720
     cgccctccgt attccattga caacatccaa gaatgcttca tcgcgattgg tccattgcgt     51780
     tacaggtttc gcatttttcg gcaatccctg aagtttactg aagggggaac ctaaccaatc     51840
     acaaggacgc aaaataatag gaatgacttg ggctgtacct tcatcatggc gggcaatcgc     51900
     tctttgcatc tcaatgtcgt agcaatagtc agacgcgata aagtccgggc tgaccagtag     51960
     caaaatcatt tgagcggatt ctagcttgct gtcgatttga gatttccatt cctcccctgc     52020
     ttcaatcgcc cgatcatgcc aagctgcaat tttcccctgg cgtttcagat tggcaagatg     52080
     ggtgactaac tcttctcgca aatcatcgtc tttatgggaa taggaaataa agacctttaa     52140
     ggggtcatcg gcgtctggaa tcatgggaga aggtgcgggt gttggaggcg tttgagcctt     52200
     gggttgatcc tgatccttag tttcctctgt agtgggcttt ttgatcagaa tgggggtgag     52260
     atgttcttca atgccttcca agcggatggc agcacaaccc aacttgaagg caaactccac     52320
     atctcgtcca gaaccgaggg catcatagaa tcccacggca aaggagatcg ccgctttatc     52380
     ctggatcgcc cgtttcatcc cgatcacata gggaatatgt tctgagatgg cctttgcctg     52440
     cacctcggta tagcaaccat tgaggaccac acagcgcagt tgatcggcaa acagactaaa     52500
     caggtctgca attgcttcac cactgaccaa ctgggtgttg ccactgacat cctcaaagac     52560
     caagccctca tccccttccc catgccctga gaaatgaacg atctggggat ttagatccag     52620
     catggcccgc tgaatatcac gggggcgaac tgccaggcgc tgttcaagct ggaactcatc     52680
     tcgatgttgt gcccgcttca aaccctcatc aatatccctc aactcctgat ccaatcgaag     52740
     aggctgagta tctttgggat tcgcagcgag aaagagaatg gtttgggcag tcatgatggc     52800
     agggcagata cattcgggca gggatagtgg aacgctcaat gattgaaatg cgacgtggat     52860
     agcctgcggt tctggagaac accccaaact ttgaggcagg aattgaaggg agattagaac     52920
     ggtttaagtc atgagatgac ctccccaccg cctgaaaagc tgggtccttc tagccgcaga     52980
     aagtaaagct gtcccccagc atctccagca atgatggtgc gaccatctag ggcaatctca     53040
     caacattgaa atccgccttc tccggtgaaa ctcatcactt ccatgcccgt cgccaggtcc     53100
     cacaccttca gggtcttgtc ccaagacccg gagaccacgg tttggccatc cgggctgatg     53160
     ctcacgccag tgacagagtc agtatggcct gtgagggtgt gctgctcctc gcccgtcgcc     53220
     aggtcccaca ccttcagggt cttgtcccaa aacccggaga ccacggtttg gccatccggg     53280
     ctgatgctca cactcctgac agagacagta tgtcctgtga gggtgcgctg ctcctcgccc     53340
     gtcgccaggt cccacacctt cagggtcttg tcactagacc cggagaccac ggtttggcca     53400
     tccgggctga tgctcacgcc atagacagag ttagtatgtc ctgtgagggt gcgctgctcc     53460
     tcgcccgtcg ccaggtccca caccttcagg gtcttgtccc aagacccgga gaccacggtt     53520
     tggccatccg ggctgatgct cacgccctcg acaggggaag tatgtcctgt gagggtgcgc     53580
     tgctcctcgc ccgtcgccag gtcccacacc ttcagggtct tgtccaaaga cccggagacc     53640
     acggtttggc catccgggct gatgctcacg ccatagacag agttagtatg tcctgtgagg     53700
     gtgcgctgct cctcgcccgt cgccaggtcc cacaccttca gggtcttgtc actagacccg     53760
     gagaccacgg tttggccatc cgggctgatg ctcacgccat agacagagtt agtatgtcct     53820
     gtgagggtgc gctgctcctc gcccgtcgcc aggtcccaca ccttcagggt cttgccccaa     53880
     gacgcggaga ccacggtttg gccatcgggg ctgatgctca cgccagtgac agtggatgta     53940
     tgtcctgtga gggtgcgctg ctcctcgccc gtcgccaggt cccacacctt cagggtatgg     54000
     tcataagacg cggagaccac ggtttggcca tccgggctga tgctcacgcc agtgacagag     54060
     tcagtatggc ctgtgagggt gtgctgctcc tcgcccgtcg ccaggtccca caccttcagg     54120
     gtatggtcat aagacgcgga gaccacggtt tggccatccg ggctgatgct cacgccctcg     54180
     acaggggaag tatgtcctgt gagggtgcgc tgctcctggc ccgtcgccag gtcccacacc     54240
     ttcagggtat tgtccaaaga cccggagacc acggtttggc catcggggct gatgctcacg     54300
     ccatagacag agttagtatg tcctgtgagg gtgcgctgct cctcgcccgt cgccaggtcc     54360
     cacaccttca gggtcttgtc ccaagacccg gagaccacgg tttggccatc cgggctgatg     54420
     ctcacgccct cgacagggga agtatgtcct gtgagggtgc gctgctcctc gcccgtcgcc     54480
     aggtcccaca ccttcagggt attgtccaaa gacccggaga ccacggtttg gccatccggg     54540
     ctgatgctca cgccctcgac aggggaagta tgtcctgtga gggtgcgctg ctcctcgccc     54600
     gtcgccaggt cccacacctt cagggtatgg tcataagacg cggagaccac ggtttggcca     54660
     tcggggctga tgctcacgcc cctgacattg gatgtatgtc cgctgagggt gcgcactaat     54720
     gctccccccg cttggttgag gtgggggaat agacaccgta tccagcactc ttccggtccc     54780
     tgagctaaag attgagtcaa agcggtcaca tccggtgagt cttgactcaa caaacgccca     54840
     tagagctgac tgcgaagctg ctcaggatgc tgatttaaga catggctaga taaccgcaac     54900
     ccactttgga cgatgtttag gtctttgtcc ttgggtaacg tttcatagtc caatagcagc     54960
     gcattgatat cggtgattct caacttgcgt tgcatccagc gataatccaa aagtaattgg     55020
     cgtaactcat cggtgcgttc tgcctgcttg aggtgatggg ccaaatgttc atagaaatat     55080
     ccatccttcg gtcccttatg ccacccttct aaacagctct gctgataagc ctccaaaagt     55140
     tgctgatgca atgccccctt gttggcccgc tgggcttgta aataatcctg ctgtaagtca     55200
     tggaggctga cttgccgctg gggatagtcc ccctctagcc gcagcatgcc tttcctcgat     55260
     aaggttgtta ggattttgcc cgcatctcgc tcctttaatg ctccggtata ttgccataga     55320
     cgaacaatga ctgcttcagg aatcaattca tcggctggaa acactgccag ttcttgatac     55380
     cgttctgcag cgatggggtt ggtttctgct aagaccgttg cactgatatg cagggctttg     55440
     aaaacatcgg ggtagggata atgactgaat tgttcttgga taaattcaag atctgaatct     55500
     tgtaaagcac tgagaacatg aggccaaggg gttaaatccc gcaccattgc accgcattgg     55560
     gctagggcta agggcaaatt tccacattct ttcgctaccg cctgggcttg ggaaggcaaa     55620
     tctgagatgg ggacacccac ccaggcagct aataactcta acgcctggtc atcgttgagt     55680
     accgacaggg aaaagtcagt ggcccctaat cttgtgatta atcctgagtc acgggttgtt     55740
     accaccaagg tactttgatg tcccagaaca ttgaagactt cagcatcagc gatgcgccag     55800
     acatcatcta gaatcaatag actttggcgt ccttgccata ggatttgaag tcgatttttt     55860
     ccttcattga tatcttcaaa tacctggcgt tctccacaga gggcttctgc tagatcagtt     55920
     tgctgggcta gcaggtttgg gtctatcccc acggtcagcc agtaaatccc atccgggaag     55980
     gctgcttggg cttgggggtc ataggctagg gctgcggcta acaccgattt gccaataccg     56040
     cccatgccct ggacaccaat gcgttgctgg tgccccgtca ttactacggg ctgggctaga     56100
     ttgttgagga ctttctctct cagggctttt agggtctgag gacgaggtaa aaagtagggg     56160
     ggtaactctg gcactctcca gagtttttca ggagggtgtt gttctgaaaa gggttggatg     56220
     ggttcggtat gaatactgga tttctggact aagactgggg tgtgggattc agggaagccc     56280
     tcgatttgaa tggcactgaa tcctaattta aaagcaaatt caatgtctcg gcctgcaccc     56340
     aaagcatcgt agaaacccac ggcaaaggcc agggccgctt cattgctgat ggcttgctgc     56400
     atacccacca catagtcaat atgttgagca atggcttgag cttgcgcctg ggtataacac     56460
     ccattcagaa ttacgcagtg gatatcttca gcaaacagag caaacagtcc ggctagggct     56520
     gcacctgtga cgagttggga gttgcctgct tgatcttcaa agacgagtcc tgcttctctt     56580
     ttgccactgc cagcaaagtg aataatctga ggcgtttcat ccagtaaggc ccgttgaata     56640
     tctcttaccc ttacagccag ggaggatttg agtttgaatt gttttcgatg ctttgaccgc     56700
     tgtatcccgt cttcaatatc gcgtaattct tgggctgctt ggcgcaatcc atctgggttg     56760
     ctggcaagga atagaatggt ttgctgttct ggtggattct gactcgtcat tcagcgttaa     56820
     tctaagggat attttggtgt cttttttcca ttgggttgag cgtttaaaac tgacagcctg     56880
     cgatagattg ctaatgacga tggagacgtt attttgaaat ttaatttaat cgcatctaaa     56940
     attatcggca cttttgatat gctttacgca attattaagg atatttctgt aatctaggac     57000
     gttggtgggg atggaaataa ttgccttttt aagggctttt taatggctca cagatttgat     57060
     tgagtcctat cagcccctcg attttgatga tctatcacga gttttgatct aaaaagaacg     57120
     aaccatgcca ctgcccccga acccaatctg tcttcaatgc atcgactatt cccgagggga     57180
     agcaaagcgg attcatgggc cgcaagggga tggttgctgg acggataatc ggtgcgatcg     57240
     caaacgacat cactaccgct accgcaagga aagcaatgct aagcgccgag gagaatacgc     57300
     tagtcagaaa gcaataacaa cctcaacaga aacgactgaa accttctcga ttcccgtcca     57360
     aaccccagcc gtggcgttgc tctatctcta caaagataag cccaaggatg cccatctcca     57420
     tgctctggct gtcagtgtct ggcaggggag tgagaagtta gcggaaattg aggccgtcca     57480
     ctgcatgggc atgaccaata ctcaggtgaa tcggtatttg aaagaggtgc tgagggtact     57540
     aaaagtaagg tacggcatca cagagtttga gccgccgatt cgcatggagc cttctgagtg     57600
     cgaaattgct gactgtcccc tgaaggataa gcgccatgtt caaacagctt gagctagatt     57660
     ttgctagtgc tttggcttct gctttaaatg aaccggagca ggctgatatt tctctgatgt     57720
     gtgcatcgtt ggatcaacat ttacagggtc gttctcctca tgaacagctt cgagtagctg     57780
     gggatgcgat caaggatatg gctgaggttt gtcttcaacg ggcagagcta atgatccagg     57840
     gttgggaaga acgatacaac tctgaaggtc cagtgctgga tgaggatttt ttagctggga     57900
     tggtgcagca gaccatgttt ttggatatct ctgatctttg tcgtcagccg aaatcacgga     57960
     aaagtcgcca ggggttcacg ggggagcctg ttgagtcagt tgtgggtgat gttagcaagg     58020
     aatcagtgct ggagtttgtg gatgaactgg agagtgggaa ggaagtggca ctgaaggtca     58080
     gtcacgtcga tgatgttgga gcatgggtga atgcgatcgc acagtatttg gagagggctt     58140
     cggaggcgtt gtcgtttgcg gaattggtga aggggctggg gatgcctact gttgttgtgc     58200
     tgatcggggt gcttttaggg ggctttcaga tcgagcaaac cagagatttt tatgggagta     58260
     gcatttggat taaaatttga aatttttgaa aatgcaagtg ggtcaagaca aagcaagttg     58320
     ggactggtcg tatggatgca ttcaaatatt taggctgctg ctggagggcg cagggcaatt     58380
     aattctgatg ctcttttctt acccaagatg ctggaaagtt ggagttctga acaagtccaa     58440
     acatcctgac ttgacttaac accattgttt aagagggcaa gatattcacc acggtacaga     58500
     cgcaaaggaa ccgacagaag cccaagagcc tctgttggga gacctacctc aagctgctgc     58560
     tgcattctgt ctacctcctc atcagaagga ttattcccaa tatgtatcag agcagctagc     58620
     tgatgtgctg agcgtaaata aagccgagtt gcatcggcaa atttttggat atcaccatac     58680
     ccaatttttc cttgatatgg attaggggta tatagccgtt ctatctcctc gatggctact     58740
     ccatgcaccc agtcccaaag caatgaagca cgtttacacc ttgcaaaata gtcaagctct     58800
     ccttgtgcta ggtgttgcag aagtctaaca acttcagttc catagcgctc tgaagcttgt     58860
     tgagggcgga tagattcact tctgcctttc ttcatcattg gagtatagcc accatctgac     58920
     tctggaagct gctgcagaag agcgaccaat gtaattacag ataaatcatc agtttgaata     58980
     ctacgcacta agcggattag gcgcatggct gagtcaaacg acagagcaga ctcaccaacg     59040
     gcccgaccga gaagagtcaa ctgaatataa acatcctctt cttcgatcaa gtcctgttcc     59100
     atcattaact caatcagttc ctccagatgt tgtttcatac gatctcgcca actgggatct     59160
     gaacgattgg caagataccc tccataggta ttggaaagaa cagccacaat ctcagctctt     59220
     tgaactctct ccatctgtgc tagcaatctg acaagccacg tctttagact ttgtgaatct     59280
     aacgaagatc ggataggctc caactgccct tgaacgtatt gccggaacaa gctctgcctt     59340
     tcgtagctgt tgtcagccag tagaatggct tgccctcgtg aattacttgt atgtcccggt     59400
     ctaccagcac gccctgccat attcttgtat tcagccacag tgaattgtcg tccatcttgg     59460
     ccaacgaatt catgttcagc caatattaca gttgaggcag gggtattaat ccctgctgca     59520
     acagttgttg tggccgatag tactctgacc tgtccatcta gacttctgaa agcttgctca     59580
     acgacttctt tctcttcccg tgtcaagttg cgattatgaa atgcagtgcc cccatgtagg     59640
     cattcccgga gagcttgaga cgttgtagga aggtcatatt ggggtaggac tgagatcgct     59700
     tcggttgcag gagacaaccc taactctttc gccagataat tggcacatcc ttgtgctggc     59760
     cctttctgat tacgaaaaac aataacgttc tctccctgct gcactaactt ctggaccaat     59820
     ggcacgatga catcttgact actcgctttt tttcttctga cctgtatttc actgggagag     59880
     agaagctgag tgacctgctc atttccatcg gtatcaacaa actggaatat acctgaccga     59940
     tctagggcac cctcaaccag cggtactggc cgctcttgag aaattaattt gtcacagtct     60000
     agccattcat caaaatggtt aacatcaccc actactgcag aaagagtgat gagctgtatc     60060
     tgaaaacctc gctgcttggc agatagaaga tatgtgagca gaagttccac gcttattcca     60120
     cgagttggat ccgttataaa ctgagcctca tcaaggacga ctagaccaag ctgattaagc     60180
     accccagtat tgctcacaac caagttcaga aacatttcgt aagtcagtaa ggctaaatcg     60240
     tatttgcctc gaacaaagag atcggtttga tctacataat caccacagca gcggataacc     60300
     cgcattccga ggccatcacc atacacttga gagaactgct catatttttc atttgtgagc     60360
     gctcggtatg gaagtaaaaa tacagcctta cggccttcgc atattgcctg gattgcagcc     60420
     agctcaccca caaatgtttt ccccgaacca gtgggtgcga tcgctaatag tgatgaacca     60480
     tcaagaattc gataatcatt gatcgcttga agctggaggt cattcagggt gggaaactgc     60540
     ttggcccact ggttcaagat tgttagggga aggccaaacc cggctaattc ttgaatatca     60600
     gcatctactc ttaacccccc tttttgaggg aacttagtat agaaatgcgg ccccggttta     60660
     atgggtggaa gaaccagccc tccagtaaca tggccaaaga ggaccggagt ttgcgcgatt     60720
     ctcatcttaa tcgcaacgct tctggccttc tcaacgacct gggcactcat ttctactaaa     60780
     tcaatggtcg gggatgttgt ttctatgaac gtatcaatca atgccttggt gagtaaccca     60840
     tgcccttcac caggaacctc ataagcctct tcactctccc tagatgccgc aagtaatatt     60900
     cttccctctc cagccaaggt agaaacggac atgctgatgc tccttgatac tgggatatct     60960
     cctaaaactt ttgctggtgc ccctccacta aaacaacagt caaggataaa cagcactgct     61020
     ttagcttgag tttcccgaaa atagtgtgct agctcctcca tcgggattgt ggtgtctgct     61080
     ggatcagtgc ggctcgtgtc atgagccacg atttgatgat tggaagtacc atgccccgag     61140
     aaagaaagga tcacggtatc gtctgaagtt gccgctccca aagtggactg cagcagttga     61200
     cgaattccat gtaaagaagc gtccttatcg gtgatgagtt ttgcttgaat gtcagggatg     61260
     gagtcactga acaaggccca cagtgcctca gcatctcgtc tagcacctgt caattcagga     61320
     attgtgatgt ctgcgaagcg atctacaccg ataaatccag ccagaagagc cattttgatg     61380
     aaccaagcaa tgcgaaccta tatatagtag tcaaaaataa tttattctgc cttcaaacac     61440
     tatatatgga ctaaataatt cttgctatca tcaaatctgt ctcctgtgac taactccggc     61500
     atagctcgcc ggaaactcag attgatggga aatggcaatc agtatttttt tgcttttgat     61560
     tcgagctgac acaggcaaag ccggaataac agtctgacta tgggtaccat atacctgaag     61620
     taacccacta ttctttaatg cccagcctta ccaaagtcgc tgaactcact gagatcgcaa     61680
     cctcaaccct tggtgagttc gcaactgtga agtcatgatt atgcagcaaa atcaatgatg     61740
     gaaacgtaac agatatgcct gcttatgctg caactccgag ggcagtcatc accgtgggtt     61800
     gccattattg tgaagataca tatttcatcc aagcctgaag cagttcatct tcagatatac     61860
     ctctgagttg atctgtgtgt tccagcattg cagcaatagc aacccgaatt agtgtatttt     61920
     ctgtaatcct ctccccagag ttttttctgg ccctattgag ctgccttgca agcattgtca     61980
     attgatctaa gtgctcttga ggtaagcgaa tctcttttcg ctccattgtc agatactttg     62040
     gaacttcgtt acttacagac tcaggaagtt cttgagttcc tttagctagt tctacctgat     62100
     ggctagacac ataattatct ttgacttcag aactttgtga gttagattct ttggaactaa     62160
     cagagttcgt aagttcgtta cttagtaaat ctgttatttt gcgtttagcc attatttttg     62220
     acccttcaac tctcttacaa gttcatcaac cacttttcga tagtcgtttg cagcttcttt     62280
     cccaccagaa cctttgtatt cagtaatgag tttgccatct agtattgccc tttcatgagc     62340
     taccaaatag cgcactacag cgttaaaaac tggaatatct tcatccatta gttgtgactg     62400
     catgtctagt gcctcattga tccgacgact atctacacgc gaaagcaata cacggtaggc     62460
     agtttctgaa ggaactacca cttgcccaat agttctagtt agctctctaa tatctaacgg     62520
     ggaaggaggt gatggaagta tcgcaaaatc agaaagctta agagtgatgg tcagtgtctc     62580
     attatccaag ccaggaggtg tgtcgcagag tatatagtca tacccaccta ttttccttag     62640
     cttagatatg acattgtgat cagtttcatg agccacatca aatcctggtg atgctcgatc     62700
     acttatccaa gacaagctac cctgtgggtc agtgtctata actaaaacct ttgtcttacg     62760
     cttttttgag aggaatgctg caacactcaa tgccgtagtt gtcttacagc tccccccttt     62820
     tcctgaagcg attgtgatga tttgcattac cacctaatta aagatacttg cagttttaca     62880
     taaagtctgt aagtttgtaa cccatagaat tcctggctta caaacttaca gacttataag     62940
     cctttggact atgcagcaga ttgtatgtat ccatgcctag tcaatgatct acagacttac     63000
     gaatttacga acttcggaac ttactgagat actgagttgt aaactttgga gactacaaag     63060
     catgtgactt tgttacccac aagtttgtga gcatataaga tactaactta tatagttacg     63120
     agcttacaga cttccatagt gacaagccta caaatttaaa agctgccaga tataaacaat     63180
     caacttacga gtttactgac tttgaaagta acaaacttac agagttgctg atttacagag     63240
     aatatagctc aggtatctat aaacaagcac aagctttact catttcaatc aaacaaacga     63300
     agttacgaac ttacggacta acatagttac gagcttaaaa agttaaaaac tgtcagacag     63360
     aaacaaccaa catactgatt ttcaggcttt ggagacaact agcttacaga gttcgtaact     63420
     ctgatacctg taaacttatg tacttagtta gttacagagt tactaactta cggagtcttg     63480
     aactttacac actacaatct aaggaagtta cggacttaca gactaatcta gctacagact     63540
     tacaaagttt ttaaccatca gctatgaaca accagcaaac agacttacgg actccgaaaa     63600
     taacagactt acagaatatc aagcttacga aatatttctc acccctagac ccaagctacc     63660
     cgctctcgat ccaggtatat gcatactgtc ttttcaatta actctgtctt ttcaattaac     63720
     tgggcttaat catagagtta tacctaggaa cggtaaacct caacaagagc aattacaaac     63780
     aggttaagca gtcaataaat caacaagctc agccttcttg ataccctttg gtactgtaat     63840
     ttctcgctgt atagcctctt ttttcagatc agaaactttc atctgttcga gtagataccg     63900
     cacattatta agataaggtg gagcgcatgg cttcaaatga agtatctgat ctagtccttt     63960
     aagctttgaa ggagttaaac cacacttcag tttggtcaaa ggcttgtaat catgccaata     64020
     gagacgttct ttagatgaaa aaatagcact ggcaagcttt gtaagattta catctactaa     64080
     cttacactga ggtaaacacg ctgctgtctc aaaggcttct aataactcag cttctgatgc     64140
     agtatttaaa atgattgggt ttatttcaat gggtaaagga gctgcatcaa acacttctga     64200
     taatacttga agcttactct tcgtaagacc acacttaagc ttcgtcaaag gtgtgagcga     64260
     agaccatccc cgccggccag cagcctggta aattcgatct gctactagtg caatgtctaa     64320
     cttacctaat tttccacgca gatgctgtaa cgcagcaaaa atcatgtcat actcagcgct     64380
     acagatattg attgtgagag gtatttgacc agttaatagc ttcacttgtt cttccgctga     64440
     agcatcttct ggaacaacag caacccatac atactcttgt ccagcagctt ccattgctag     64500
     aagaatatgc tcattactta tcgcctgata ttgtcgaggt tccggttctt gcactattac     64560
     tgggatccaa tttcgtaaat ctggctcctg caatattgag gaaagtgctg caatctgaaa     64620
     accggacccc tgtgattcat cagaaacttg gacttgttca ataggtactt gaataagctg     64680
     tccaatatct ttaaggctta acattagagc aatacctccc gaatcagatg ttcataaacc     64740
     tgcttagcac gccgatatct caatggggca ggaacatatt tggggccttc caatggggca     64800
     cgacaaatct caattttgta tggcaattca aagcagtgtt gacctcttct aaatcttttt     64860
     ggtggcatat aaaagaagtt attaaaagca tctttccact cattgttctt tgcaactata     64920
     tctgctaaat atctataaca gtttcgggct tgtgcatcag tatgctgata ttggttaagc     64980
     acaaggggaa gtaagttcgg ccctccttcc tcaagagcag cccgcctctg attaacttga     65040
     gggatgaaat tggttactag agcttctaaa ttcctgagag atgcacggtc aatatgacta     65100
     gctgggacta acaaggtgtc agacgcctga acacctgctt gggcaaacca tctccaattg     65160
     ggcggcatat caatcagaat atagtcatag tcttttgata attcttttag gcgatttcta     65220
     agaaactcaa gacgaatttc ttgctgaatt tttacatcat gtgactctag aaagctttta     65280
     tcagcaggta taaggtcaaa ttgtacctgt tgttttcctt ggctgaaaga acaatgctga     65340
     ataatggctt taccgggtac ttttcctttt aagaaattcc atactttccc ttcaacaact     65400
     ggttgttgaa gggaatccgt aagatctgct tggttaggat cgaagtcaac tagcaaaacc     65460
     tttttctgac tttgtgctag aacaataccc aaattagtgg taagagtagt tttcccaatt     65520
     ccacctttgt tgttgtagac accaataatg attccacgct tatcttcttg aagaattctc     65580
     aataagcagt ttgaaacttc ctgagcgttt tgagtattta acgaaagaat agatgttgca     65640
     gggtgaacaa ccttgtgaaa tcgcttaaat agttgtaatt cccaaccgtt agatattaat     65700
     ccaaagtgag cactcattgc attgttacca agcagttgct ctttcaattg tgcaaaggct     65760
     ttccagtaat gagggctgtt aagagacagt tgttggcctg ttgatttcag ctcaaccagt     65820
     aaaaagggat ctttttgttg ctgaaagaaa ttattgcctt ctttatctgg gtaacggcaa     65880
     gcgatatcag attttcgtga tgggcttgaa ttagccttga attgtgggac tcgatcaagc     65940
     tgtccaaact caagagttac cagtagcttc tctatgatag gggttacaac attaccttca     66000
     tctccagacc ctctaactgt tggtcttgaa tctagctgta atttcaattc tgctagtgca     66060
     tgttcactga tctttggcat taatttaagc attccctgaa aaatcgatta tttccgctgc     66120
     tcgaattgaa ataattttct gagttagcta caacaaacca tgcacaaaat ttaaatattt     66180
     gaaatttgag atggattatt ttttagtgct ttaaaaatta tgcccagtaa agaatactta     66240
     ttcatacact caattaactt tgtatagcta agtacctttg gacgattgtg ggaaggtaaa     66300
     gatgatctgc ttgaggcacg aagaaataaa gtatcaaagc ttaagtcatg tcaaagccta     66360
     aatcgattcc aacctttcgc ttaaatgccc gtatagtaaa ggttataatc aacatcgact     66420
     aaaacttgtc atttttttaa aggggtttgc aagctactca atagcgactt acacaacaac     66480
     cagtcacccc caaaccatac tcacccgctc ccgatccaac tacaccccga tcatctcctc     66540
     gatccgctca atggtttccc ctggccgcag acttaaaacc tgcaacacgt cgaatgtgta     66600
     ctccaattca agggtgtact cgaaacaaaa ttcaggcgtt gcaaatgaaa ttttgatgaa     66660
     tggcttacta ctgccttcga cggtgatcca ttaattccct gagctgcttc gggacaccgt     66720
     gagatactca agttgaccct tttgcctgat ctgctgaacc aagttctttg tttgtcatca     66780
     agctcaatga tttttcgatc agcaccttgc ctaacaatcg aggatgagtt ttatgccatg     66840
     gattggacaa acagggattt cgtcttctcg attcgtgcga taccaatact gattgcattt     66900
     ttcgacgtga cagacatacc gagggtatta gacgacaatc gagctgacgg attaatgacg     66960
     atgtcacgtc ggctatagct atgaagaaac caggcatccc ctgagaagga taaaactaga     67020
     tctcaattcc ctagaaatga tgtgtgagat cgcgtttcta gaattcaatc tcaagaaaaa     67080
     agacactttt tacatcccta atcaatagag ggctgtacaa gtgcctaaca aaagaattga     67140
     ttcctatcat actcgtgttt atatgaacgg aagagacctc ggcttaaaac aagctgatgc     67200
     agcttacatt gccgaaatat ctacaagaac cggacaacga attgaggccg gcacccatca     67260
     acctaatcgc ggccgccttc aggaccaacg caccgttccc gaccccttag ctgatgtgtg     67320
     ggaagacgag ctagaaccaa tgctgcgtcg agacccacgc ctcaaaccca tgaccctgta     67380
     tgagtacctg caggataagt atccaggcca gtatccccaa gtcctgcgga ccctacaacg     67440
     tcgggtgaga acgtggaaag ccttacatgg accaagccct gaagtgatgt ttgaattgcg     67500
     tcatgaacca ggggtacaag ggttctccga ttttacagaa ctcaaaggca tcacgattac     67560
     cattgccggc aaaccctttg agcacctgat ttaccattac cgtctgggat acagcggctg     67620
     gcgatatgcc cagatcatcg aaggaggcga aagctttgtc gccctctcag aaggattgca     67680
     aaatgccttt gcagcctgtg gaggtgttcc tacacagcat cgtactgata gtttgagtgc     67740
     agcctatcgc aacatgggcg gccgccggtc caaaaacctc actcgtctgt acgacgaact     67800
     gtgtgaccac tatcggctag aacccactcg taacaacaaa ggtgtagccc atgagaatgg     67860
     ctccattgaa tctccccatg gtcatctgaa gaaccgaatt aagcaggcga tctatctgcg     67920
     cggcagtgca gattttacga gcgttgctga gtatcaagcc ttaattgatg cacaggttgc     67980
     caagttgaat cagcagtgcc aaaccaagta tgagcaagag aaagaccatc tacaaccact     68040
     gcccaaatat cgaacccctg actatgaagt gctcacggct aaagtcagca aacgcagcac     68100
     catcgatgtt cgctgcattc tatacaccgt cccttctcga ctgattggtc gtcaattgga     68160
     actgcatcta taccatgacc ggattgtcgg ctatctggag cgacacccgg tggtggaatt     68220
     gccgaggaag cgcgtcagtg gcaaaggcaa acgtcgcgac cgttgcatca actatcgcca     68280
     tgttattggt tcaatgcgat tgaagcctcg tgcttttatc tattgcacct ggcaatcaga     68340
     cctacttccc aatcctgaat accgccaaat ctgggaacag ctcaaagccc aatttgacct     68400
     ggagcaggct gccaagatca tcgtggaagc cctgtatatt gctgcggttc aagataaaga     68460
     acaggccgta gcagtgtact tacagcagca gcttcgctca tccagcctta ccctcaatcg     68520
     cctgaaaaaa cagtttgagc cgcctcagat gaagcaggtt cctgaactca gcattgaaca     68580
     acattcactt gaactttatg acaaactcct cccctcctgc tcagtccccg ctgagcccct     68640
     accagcacct gagcctctat ttaaaaaagc tcaggctctc ccacatgttg acccattggg     68700
     aatctatcga atcccaagcc atgcaggaaa actggtctta tgcggaattc ttactagcct     68760
     tgtgcgaaac ggaggcccaa cgaagagaac aagctcgtct aaaacgtgcc ctcaccgaag     68820
     ccaggctccc aaacgcaaaa agttttacca actttgactt tagccattgt ccccagctca     68880
     atccagctcc cttgatgcaa ttagccgcag atccgggttg gttggagcgc gccgagaatt     68940
     gccttattct ggggccctcg ggtgttggaa aaacacatct ggccactggg gtgtccaaaa     69000
     agatgctgga attcggtaag cgggtgaagt tctttgcagc caacgcattg gtccagcaac     69060
     tgcaacaggc gaagctccaa ctgcagctgc atccaatgct caaaaaactg gaccgctatg     69120
     atctgttgat cttggatgac ttgggctatt gcaaaaagtc ggaagcggaa acgtccgttc     69180
     tgtttgaatt aattgcgcat cgctatgaac gaaaaagttt gttgattaca gcgaatcaac     69240
     ccttcagcca atgggatgac attttcactg attcgatgat ggcggtggct gccattgatc     69300
     gcttaattca tcatggcttg attatcgaaa ttcaagccga tagttatcgg cgcaaatcag     69360
     cgactcagag aacggctcaa actcagtctc aacctcaaaa atcccagtcc aaataatcga     69420
     gcgatcactg gttgtcattt cgatcacggg ttgtcgtttt gttctgaagg tatcgtatga     69480
     ggtctgaaaa agagctaacg caaagggagt gtacgccaaa taatacggtt caaatttggg     69540
     ggttgatccg ccttgtggtt gtcgcgacat cgcctatggg gttgacatcc aatacgaggg     69600
     ctttcgacag gattcttaat tcctgagaga ggataataga ttctaagggc tttgagaata     69660
     tcttcagcag gatgcccttc ttctagatat aatctcaacc aatcgcgggt ggattcattt     69720
     tcagccaata ggcttgagag ttgaatatga ctcccttgtt ggatggagta atcagtcatc     69780
     agcccctcta actgcctctc tagtcgttga gcactcggag catcaagaag ttctgaaata     69840
     tagggttgga tcgccttagc tgctttacag atttcatcag gtgaatattt cattattcgc     69900
     tatgctcgat tactcgttga atctttttta gattgcccca aagatgacaa tcgcttctta     69960
     ttcgttcatc aatcacttga taactcttgc ccccagatct gagccaccct ctctcgatcc     70020
     agatatactc caatcatctc ctcaatccgc tccattgtct ccggtggcca aaacttagtt     70080
     acttcaacaa attaaagtct cttttagttc tgatactgcc tcaaagcaat atccagacag     70140
     ctttccagtg tttttgagca aatatactct cttcagtaaa aatactggat tttctccctt     70200
     tttcgggtca agtttattct ctgatttcag tatttttagc gtattacctc taaaaaagaa     70260
     aaactattct tactcttggc tcattaactg gttctggttc aagtcaacta tttcggtgaa     70320
     tgagtcgcat ataaacgtgc tattcattca ctaattgggg ggatcacttt ttatgtcagt     70380
     tgcagtaaat tccaacaaag agcattcatc atttctaaat ttcattccaa aatttaggag     70440
     aaccttaaga acatttcatc atactcttga tagcaatagt ccagaatttt ttattgactc     70500
     aattgatgat caaccgggct tctatcagat gacatctcaa gggccaaggc tcaggattgg     70560
     gcagtccatt gaagtcgagc attctggaca atatcagact tatcaagtgg atgatatcga     70620
     attctacaat gaactttcag atatttggac ggcagtattg catagaatct agctaatttg     70680
     cctaaatcgg ttgggagtaa gcgagaaagt aatcctttgc attatcaccc ccaaacccta     70740
     ctcactcgct cccgctccaa ccacaccccg atcatttcct cgatccgctc aatagtctcc     70800
     cctggccgca gacttaaaac ctgcaacacg tcgaacgtat tctctaactc caaagcgcac     70860
     tcgaagcaaa actcgggcgt ttcaaatgga attctgatga agggcttgcc aattttaaga     70920
     aatagatcct cagctcaaga gccttcagca tctatccatc ccctaactgt ctcaatgggt     70980
     attccgatgg gtgcaaacaa aactttcaga gtctctactc ctccctcctt caaggcattc     71040
     tgtaaacgct gccgaaaagt tggatctatc tttattctct gctcaaccac agtctgtata     71100
     tctgtcggat tagttttctg caactgactc agtaaatcct gaatttcttt tgccgattca     71160
     gccggggttt gttttatttc tggagcgtag ttgtgttgag tggtttgttg aattccctca     71220
     tttactccag ccacattccc aactggagca ttgatgtttt gagtaacttt atctttgttt     71280
     gccatggtct ggaccattga aagtaactgg gcattttttt ggcgttcaaa agctagagat     71340
     tcttttgcta aatctaatgt tgcaccttgg agcttcattt tctcaataaa ttgttcttca     71400
     agaaccttta gttgtttacc atataactct ttagctttag tttctatcgc actcttgtta     71460
     gcctcaggtg gtgcctccag tcgaacaaca aaggctgcgc ctttcttttc aatagcttga     71520
     atgccaacct catattcatt gaacttggat cggagtagct gaaaagactg aaaaaaggct     71580
     tgccagtcaa taccatcaac aaaaataaga tcaatcgttt caagagactt ctggactaaa     71640
     gcaacaaatt cacctgggca gaagtttcct tggaaggggc gacgttcttc ttgatttact     71700
     ttgagataga tgtaatcaca caccacacct tcaaagccag tcttagaatt aatactccaa     71760
     tcctgaatac aagcccctgt caatattgca ttttgaagtt tgctgcccag gaaatttgct     71820
     cggtaaagat ttgagtttct aaggttaaca ccactgaggt tagcatcatt aaggtcggta     71880
     ccactgaggt cttttccttc cccaccttta tttaccaatt cgtgaaccaa cttccattta     71940
     gcgtcaatct ttgtttcagc agaaattttg gtattcctga ggtcggcacc actgaggtcg     72000
     gcatcactga ggttggcatc actgaggtcg gcaccactga ggtcggcatc actgaggtcg     72060
     gcaccactga ggtcggcacc actgaggtcg gtaccactga gatcttttcc ttccccacct     72120
     ttatttacca attcgtgaac caacttccat ttagcgtcaa tctttgtttc agcagaaatt     72180
     ttggtattcc tgaggtcggc atcactgagg tcggcatcac tgaggtcggt accactgagg     72240
     ttggtatcac tgaggtcggt accactgagg tcggcatcac tgaggtcggc accactgagg     72300
     ttggcatcac tgaggtcggt accactgagg ttggcatcac tgaggtcggt accactgagg     72360
     ttggcatcac tgaggtcggt actactgagg tcttttcctt ccccaccttt atttaccaat     72420
     tcgtgaacca acttccattt agcgtcaatc tttgtttcag cagaaatttt ggtattcctg     72480
     aggttggtat tcctgaggtc ggcatcactg aggtcggcat cactgaggtc ggcaccactg     72540
     aggtcggcat cactgaggtc ggcatcactg aggttggcac cactgaggtc ggtaccactg     72600
     aggtcttttc cttccccacc tttatttacc aattcgtgaa ccaacttcca tttagcatca     72660
     atctttgttg cagcagaaat tttggtattc ctgaggtcgg caccactgag gtcggcatca     72720
     ctgaggttgg caccattgag ggcggcacca atgagggcgg caccaatgag ggcggcacca     72780
     atgagggtag cacccctgag gtcggcataa atgagggtag cacccctgag gtcggcataa     72840
     gtgaggttgg catcccagag gttggcacca ctgagggtag cacccccgag gtcggcacca     72900
     ctgaggttgg cacccccgag gtcggcaccc cagaggtata tagactcacc tgtattcttt     72960
     tctctccatt gattccaagc ctcagcaccc tgcttcaata aatcaacttg ttcttgatta     73020
     gccatcacac tctcaagaca ttcctggatc agtcaatacc actcagctca tttaccaaac     73080
     tgatgaatga tacccacata ttctgaattg tactagcccc aaaaagatag aatcctggtt     73140
     agaaagtcaa tgatttatga gctgatccat catctccacc caaaatcacc ccagatttcc     73200
     cctcgattcc atcatcaccc ctctctttct gcccgatttc ctgatcattt ccacaaccaa     73260
     actcatcgtt ttcagttcgc ttttccattt ctgtaattag atcactgtct ttcttacaga     73320
     tttcacaact tggtctattc ttctccaatc gttgattcca tttcgcctga aacgccttca     73380
     gcatctggtc tttgtacgct tcattacctg aatagcgaat cacatataga ctcacggatt     73440
     cctcactgcc caccttgacc aattcatggg ccactcgctt aaccaacttg ttgacaatgg     73500
     caacggcact ctgaccttca caaaccacat tacggaagtg tcgataaatc tgatagcgat     73560
     attccaatgc cttcaccttg atgtcttcca accgctgatc ggcctccgac atcaccatga     73620
     tttccatccg catccgggcc tccacctgct cattcagaaa cctaacattg ctctgtcatt     73680
     ggaaagctaa cgtaaagtat caccactgaa ctgctacttc aaaatcatca ataagcctaa     73740
     aaatcaccta ctgcgctgca agcagacagg gtacggaata ctatttcctt caaaaccgta     73800
     gatttggatt ggaatcccat ttattcactt gaaacggcgg gaaatctccc ccccccacta     73860
     gattaaaaaa tagtgcctaa cttttgtact tagccattat gttggcaata ctcttccccg     73920
     caatttcgca accttcagat aaacaaagct atcatcatga agaaatcagg ataatcaata     73980
     tcaacaatga aatctatcaa gggattttgg ctttttctgg acactgctat aaaagatatc     74040
     ccttggggag atgtagccct gcacggtatt gaagccatga aggcgttgcc ggatgcttca     74100
     aaagcttggc aagacaatgc tgataagatt caacagcttg ccccttttgt gcaaaaggca     74160
     gaaccactga tcaaagccct tgatattcca gtgacaaagt tggttatttc tgggctgcca     74220
     tttatatctg ctggcattaa cttgctgaaa attgggattg aactggcaaa agtggagtca     74280
     actttcgaaa gttcagtcac aattgtcgcc caactcgcct atctccagag tttagaaata     74340
     gtgttggtga aacaggatga gacgatcaaa gcgaaactag cgcagctatc tctcaaggat     74400
     gttgtcgaga aacagctttc caaattttat agaacggaac tgaccctcac tgaggcaaag     74460
     acagccacta cccagtttcg agagtccata ttagtcgaga agtttggaga agcactgaca     74520
     gagcagttgc aacaggtcgg gctggacaac agccaaactc agcgattaac agatcaggtt     74580
     atttggggga gtcatcggta tttccatctg gcgattgtag aagctgggga gagtgtagaa     74640
     cctctagcag agttttaccg tactggtgga cagcaagagc tagaacgcta cacagctatc     74700
     gacgagtatt tagaaacgca gattaaacca acaccgctgg agcaagtctt tgatgagagt     74760
     gcccccagag taagctttca agatatctac gtacaactgg aggtgcagcc tttaactcaa     74820
     gaaggtgagg taaaacgtgg tgctagcccc atctgtagtc atgaatggac caagaaaatc     74880
     ctagaacagt cagccaacca gacccgcaaa gtgatgttta tggaaggtga agcaggtcgg     74940
     ggtaaatccg tattttgtcg catgattgct gattgggtgt attcggaatt tggagatgct     75000
     tttattccct tgcggattag gctgcgagac ttacgggcac tagctaacaa cttaactgaa     75060
     actctagaag actgcccaga tttagagcag gcaaaattcg tgcgtgggga atcaaactgg     75120
     ttagcggata aaaacacgcg atttttcctt attttggatg gctttgacga aatactgctt     75180
     gaagggcgta ccagcggagg tttaaaagag tttttgcagc aggtgacaga ttttcagcga     75240
     cgtagccatc atcagttgtt agtaacagga cgacccttag cactgcaagg aatcgataga     75300
     cttatcaccc aaaacaagga cttggaacgg gtgcgtctga aacctatgag tgatgagttg     75360
     agagaactct ggctgataaa atggcaagcc atatttggaa cgaatcaggt caatcaattc     75420
     cggcagtttc tgacggcctg tcctcaagac atcactgata ctctggcccg tgagccgcta     75480
     ctgctctatt tgctggctcg gctgaatcgc gaggggcatc tgacccaaga gatgtttgca     75540
     gatacacaaa agggcttcaa tagcgaaact caggccaagc tgcagattta tcgggaatcg     75600
     gtgaattggg tactaaagaa acagcggcag gatgagaact tacggctttc agggttggac     75660
     accttggatg atttacggga ggtattacag gaagcagctt tgtgtgtggt gcagtcgggg     75720
     aatgaaacgg ctcgactgga aatggtgaaa cagcggttta aaggcagcag caaccctgta     75780
     gctgacttgc tgaagcaagc ccaagaaacc actgggcaat cagaaaataa ggcactaaac     75840
     aacttactga caacctttta tctaaagccg ggcgaaaaag ataaacgagg ttcagtggaa     75900
     tttgcccaca agagctttgg ggaatattta ttcgcagagc gattactgat cgcctttgaa     75960
     acgtggacag agttagataa acgaaaacgg ttccggctag atgaacgatc actgaatgag     76020
     caaatttacg atgtatttgg ccatggcggc ctgactcaag aaattgtcgc ctacgtgatg     76080
     gtgctacttg aggagggtaa cattgaccgt ttacagctgt tcacacgact cagtcatttc     76140
     tatgaccgct ggtgccaaaa tgagttttta gatgctcttc cacatgagaa tattccgcag     76200
     aagaaaatga tacaacttct ggatcaggat atcactaccg gattaaagca agtggatgta     76260
     tttacgggct taaatgcgat gatttttctg tttaggctac atgcatctac ccagcccaag     76320
     gactatccct atcttggaga cgatacatct caacacgaaa tctattttta cccctgtggt     76380
     aaacctgagc ctgaaggctt gcaagcagac cgtcttctca aaatcattcg ttacgcagat     76440
     tcactcgtac cagggatttt taacgaaacc gttggacctt acctaagcag cgccaacctc     76500
     agcagcgcca acctcagctt cgccgacctc agcagcgcca acctcagctt cgccgacctc     76560
     agcttcgccg accttaccaa caccgacctc ctcagcgcca acctcaacgg cgccgacctc     76620
     cgcaacgcca atctcaacaa cgctgacctt cgcagcgccg acctcaacag cgccaacctc     76680
     aacggcgccg acctccgcga tgccaatctc aacagcgcta acctcagcag cgccaacctc     76740
     agcttcgccg acctcagctt tgccaacctc agctttgcca acctcagctt cgccgacctc     76800
     agcagctcca acctcagccg agccctggtt tctgacttaa cacagatcga ttatgagtgg     76860
     ctatcaggtt ctaatgatga atatcttatt gttcttagaa ctcatcaaaa ctttaatata     76920
     agaattttcg attcagatat aaactctaat gatctttccc aacttcaaac tgcattagat     76980
     gaatttacta aaatctctgg gtatgaagaa gtaactgtaa cacgagaaga attaggttcc     77040
     ttcttcaagg atattcgata taaaatcgcc cgattgtttt atgatgatgt gcaaagagaa     77100
     gcaatagaaa caggacaaga gctttatcgc acaggtaaag cgaatatctt aactcgattg     77160
     gagtggaaag gagttgaatc ttccaaacaa ctggctgaag caacagctgc attattggaa     77220
     aatgttgata aattcgacaa tgttgtttta caagctggga aaattatcgt agtaaaaatt     77280
     actgatgaaa atgggaaatc aaccctttgt tcaagaaccg tttcttcaga gattaaattc     77340
     ctactagaac gaacccctca actgatagat aatccccaag ctttatacga tttgctgact     77400
     aagaacccag aacaactaca accaagcatt gagaatcgga cgactttacc agctccctcc     77460
     gaacccctca agtaactccc gtgatcaccc ccaggacatg gccactcgct cccgatccaa     77520
     ccacaccccg atcatctcct cgatccgctc catagtttcc cctggccgca gcttgattac     77580
     ctgcaacaca tcgaacgtgt cctccaactc caaggcgcac tcatagcaaa actcgggcgt     77640
     ttcaaacgga attgtgatga atggcttacc agtaatttcc acggtgatcc agaatttccc     77700
     tgaattgctt atggaaacgg tcagatattc aagctgaccc ttctgcttgg tctgctgaac     77760
     cagattcttt tgtctgcgct caagtgcgtg aaacttagac tcaaatgctc tggagactct     77820
     ggggggtctg actcttcctg gtgtttcccg agctgtatat cctcgctgtg ttctccgcac     77880
     aaaatcgggt tctcggtgaa tgtggatagg ggctgattca cgcttgcgct catctgtacc     77940
     aacatctgga gatggcttgc gtcttactgg ctgatcatct ttcctggcaa tcgttgggaa     78000
     cgcagtcttg tctgaatatg cagggtttga ttcgatgttt attgggggtt tcccagtcga     78060
     tgagattgtt ggcttgggct tcagtgagac aagtttgggg ttcatacaac tatcctctgc     78120
     caagataaaa tcagtgtagc ttctggggat atgctctggt ggatttcagg ggaaagctta     78180
     atttgggggt aggtgattta cagtggggaa actagaggta aagattatgc tgcgatgact     78240
     aaccaagtgc tagttgaatt actgaaacgc ggtattggag tttggaattc gtggagagaa     78300
     gaaaacttat atgaaaacct agactttcga agagttcaac tcagtggttc atatctcagt     78360
     gaagttgact tcagtcatgc caattttgaa attgcgtacc tcagtagtgc aaagctcagt     78420
     tgcgcaaacc ttgaaggcat caaccttaat cgtgcctacc ttggtggtgc cgacctctac     78480
     agtgccaacc ttagaggagc taatctcatt cgagcaaact tcaatgacgc ccatcttaaa     78540
     gaagccgacc tgactaatgc taatctctct ggtgcccatc ttaggggtgc caatctcttg     78600
     aacgcaaacc taagcggtgc cttactcagt cgtgccaacc ttgaaaacgc tgacctaagc     78660
     tacgccaacc tcgaaaacgc tgacctaagc tacgccaacc tcgaaaacgc tgacctaagc     78720
     cacgccaacc ttaagaacgc tgacctaagc agtacccact taaaaagagt aattgccctg     78780
     gatacaagtt ttctaaaatc aacattaact ggaatctgca tacaagactg gaatatcaac     78840
     attaacacga actttgatga tgttatttgc gaatactttt ttcgttcata taatcctgac     78900
     ttaacccaac caagtaaccg ccatccactc agcagaaact tcgatcccgg tgaatttgct     78960
     atcttgatta aaatgtcctt agagaccata gacttaattt ttgtagatgg aattgattgg     79020
     caagcatttc tccagtcatt tcaagactta cgttctcaat ttagtgaaca agaaatcgct     79080
     atacaggcta tcgagaagaa gggtacagca tttgtcgttc gcctggagac acgacctgaa     79140
     gctgacaaga atgctattga agctaaagca aaggagttat acagtggaaa gcttttgaga     79200
     atggagcaaa agtacaaatc tgatttatta gcaaaagaga gtgaaatagc tatctataaa     79260
     aaacaaagcg cagttttact tgaaattgtt aagttacagg caacaagacc tatagcagtc     79320
     gaggctacag ccgtggcaga gaaagcaact aaccaaacta aaattaaaga cagtactatc     79380
     ggtgccatgc acagcggaag cggcaacatc accaactttt ctcaggctat tggcagtaat     79440
     ctccatgaaa tcactaaaat aatcaagaaa ttaaaaaaat cggcaaaaaa tatacctgaa     79500
     gaatatcaag aggatctttc agaagatttt gacgatttgg tagatgctat caataactct     79560
     gaaaagcgaa ctgagaaaag attacgaaaa cgaatcatgg ctttatgggc tatcgtttgt     79620
     gccatcgctg taggagtcgc tggagcgact gactttagca acaatcttgt cgatttagct     79680
     caaaagttaa atgtgccctt aactgtcgaa gtaataaaac aaaatccaca tgttcttcag     79740
     gaaccaaatc aaccttaagt tcagtacttg atttcactag caagatccat gaatttactg     79800
     aagctattga aagatacttc tctttactag tgctgattca agcattacca gtcaaccaag     79860
     ctttgattgt cgctttgatt actttgagat atctgttctc caatacaaat tcctctaggg     79920
     ccttttctcc accagcttgc atggctgaaa caaccctctg tttaaattcg ggttttgtag     79980
     ctatattgac gtactgaatc tgatcagttt cgctagctgc gggattgctt tgttcaagtt     80040
     gttgtaagta ttgctgtatt tcagtagcaa cttctactag cacttgctgt tcaggtgaag     80100
     catagttgtt gacgtttcca ctaccagaat gaaggttttc aatcttttca gcgtttatag     80160
     tggtttgact tataacctgc tcattattca tttcaccttc attatgagcc gctacattgc     80220
     caacttgcgc attgaagttt tgagtggttt ccatcggttt acccgcaaga gttttgataa     80280
     catcagacat ttctctatac actctcaatt ctccatgagc ttcacttagc tggagctttg     80340
     ttttgtaaag ttctttttga actgactcta ttgcaccttt gtttgcctca tatgaagttt     80400
     ccagacgaac aataaaagca ttacctttct tttcgatggc ttgtatacca atttcctgac     80460
     caacaaactg ggagcggagt tgttgaaaag aatagaaaaa ggcttgccag tcaattccat     80520
     caataaatat gagatctata gtttcaagag acttctggac tagagcaaca aattcgcctg     80580
     gactgaaatt tccattaagc gggcgacgtt cttgctgatt ttctctaaga tagatgtaat     80640
     cacagacaac attatcaaaa cttgtatcac cgttaatttg ccagtcttga atacaagccc     80700
     ctgttaggtt tgcatacttg agattgctac taaggaaatt ggttccgatg agattggtcc     80760
     ttttaagctt aactctgctg agattagcat ggccgagatt ggcataactg agattagccc     80820
     ccataagaat cgcagaactg agattggcat taactagatt tgcaccccat agattagaag     80880
     atgtgagttg ggcacaggtg agatctgcgt tgctaaagtt tgcccctttt agattagttg     80940
     cactgagatt tgtactagtg agtttggtgc cactgaggtt gacactcttt agatcggcac     81000
     cactaaggtt agcaccacct aagtcaagct ccacagtagc attcatttgc ctccaagaat     81060
     tccaaacttt cacatccccg attaataaat taagtaaccc ttgatcaatc atcttattac     81120
     cttaagaagt tactgctcag gctgatgcgc cagtctactt taggattgct agcaaaaata     81180
     actctgaatg cgttcagtaa agggatatct tgctttctca aggttgaaat ataaccgtga     81240
     acgcggcaga actgctggcc acccgccaat gaacggaagc agcccgatat cttctgcttc     81300
     aacttcatca tgcggatatc ccgttcagcc tgattgttat caaaaggcac ttgaaaatca     81360
     tacataaacg ccaagacggc agcttggtgc ttttgaagtc agtctagcaa gtttttcggt     81420
     gctctctgct ttggtttgcc tcgtttcttg ggtgcattct catcgacggt tggcattgga     81480
     ttcgccatga ttccattggc taacacttga cgataacgct gctcgtaata attctgatga     81540
     cattagccct gaatttttta ttgactctat tgaagatcag cctggcttct atcagataac     81600
     agcccaagga ccaagactcg gacctggtga gtccatcaaa atcgggcagt ctggacaata     81660
     tctggtttat cagatggaca acatcgaata ctacagtgag ccttctgtta tgtgtatggc     81720
     tgtgttgcgt aaagtctaac tcgtttttct agagggcttg ggagtggaaa agaattccct     81780
     ggctcattca ccccctacac tttgccaccc gctcccgatc caggtatttt cccaccatcg     81840
     cctcaatccg ttcgatagtc tccggtggcc gcacctcgat aacctgcaaa atctcaaatg     81900
     tgtcctctta gtccaaagcg cactcaaaac aattcttagg ggtttcaaac ggaattctga     81960
     cgaaggggtt accgctgcct tccacgccta tccaagattg cccagaaatg cttagggaaa     82020
     ccgttagaac ctcaagctaa ccctctagat tggtttgttg aatgaagttc ttttgcctgc     82080
     gtttaagggc atggagcctg aacgcaaaag ctctatagac tctgaggaat gagattcttt     82140
     ctgatgtgtg ctgaattaat tgccctagct ttgtttgtgt tctccaagta tccgcgaata     82200
     gtttcttttg tttaagctta tatctcactg atacctagtt gcttcaacca cttgactggt     82260
     ttatttatat attctgaaac cgacaactgc acttttacta gagcattaat atctttatcg     82320
     atcttgatta atgtttttgt ctcctctcga agacgctcgt taaattgcga gtaaactgca     82380
     ataagcttaa gtttattcaa aggatttgga tcaattgcca cattgtacat gtcgtataat     82440
     tgtgctttag tactttgaat agcagttata tctggataaa ttagcgtaat ttcctttagt     82500
     gaattcttag aatttttaca atctcctaag cggtaatggc acaatgaaag gcctaggtaa     82560
     gcaactgcta gacgaaaatt cttctctaat cctattgctc gattgaagct taagcgtgat     82620
     tctcgtagta aactaattgt ctctttttcc gaagagcttg cttgatctaa tgaaatcaag     82680
     gcagcggata aatcagcttt tgtaagtctg tctaacttag catccactga gtcaattaat     82740
     ccagttaaag cagctatcga agaagcaacc tttcctgcag aaaatattaa tcctatatcc     82800
     aatagtagtt atcctctttt attgattaaa aaaattttat taatttatca atatttcatt     82860
     taaacaaaaa tataaattta atattttcta gatttaaaat ctaacatcat tcaaatccca     82920
     ctattcaatt ttaaggaatt gcagctcaac tcaagattct taagcatcta tccatcctct     82980
     caccatctca ataggtattc ctatcggcgc aaataaaact ttcagcgtct ccattcctcc     83040
     ttccttcaaa gcgttccgta aacgctgacg gaaagttaga tctgacttaa ttttctgctc     83100
     aaccacagcc tgaatatctg tggggttttc ctcctgcaac tgagccagta aatcctgaat     83160
     ttcttttgcc gattcagccg gggtttgttt tatttctgac gcatagttgt gttgagcagc     83220
     ttgttgaatc ccttcgttta ctccagctac attcccaact tgagcattga aattttgggt     83280
     aactttatct ctgtttgcca tagtcttgac tattgaaagt aactgagtgt tttttttgcg     83340
     ttcaaaagct agagattctt ttactaaatc taacgttaaa tcttggagat ccattttctc     83400
     tatatattgc tcttcaagaa ccttaaggtg ctcaccatat aattctttag cttttgtttc     83460
     aattgcactt ttgtcagcat ctggtgatgt ttccaagcga ataacaaagg ctaagctttt     83520
     cttttcgata gcctggatat aaatttcctg gtcattaaac tgggagcgga gtttctggaa     83580
     agactgagaa aatgcttccc agtcaaaatt gtctaaaaag atcagatcaa ttgtatccaa     83640
     ggatttttgt attagtgcgg caaactcacc tgaaacaaat gccttatctg gatcaatagg     83700
     acgcctttca gttggaacta tttcattagt tgcatcatta aaaattgact ttaaaaaaat     83760
     aaagtcacat acaacctctt caaaattagt cctattattg atattccaat cttgaatgca     83820
     cccaccgctt aggattgcac gttgaaaatt tgcacccaaa gcaactgttc taatcatttt     83880
     agaatttttg agttcagcca tactcaaatc tgcatcaatg aaattcgcat ttaagaggac     83940
     cgcctcattg agattagcag tgctaagatt ggccttataa aaatttgcct gggtgagatt     84000
     agaattactg aggtttgcac ctataaggct agctttacca agatctgcat tcagaagatc     84060
     tgtattttgc aggtttgcgt tcttgaggtt agcacctcga agatcggcat ctccgagatc     84120
     taaattactg aggtttgcct cttcaagatt accgccagat ccaattaacc acaatttttc     84180
     tacttgttta ggattaaagc ccctatccca tgttgtaagt tctgagtaaa aggcttcact     84240
     gagatttgct tcttcaagtt tagcgccacc gagattcgca ccacgaaggt cagctcgaca     84300
     aagaatactt ctattgagat tggctacgat aagactagct tttctaagat cggtgccgga     84360
     aagattggca tcttcaaggt tcgctcgaac aaggtcagcc cccttgagat tcgcaccact     84420
     aaggtctatt ggttcattag gattttccca tctccactta ttccaaagtg aagttccctg     84480
     ccttattaaa tcaacctgat cctgattagc cattatgatt tctcaagaaa tcctttaagc     84540
     agtttattgt actcaaactt atcaccaata aattgtctgt tctactatta ccaaaacata     84600
     gcagttctaa cctctagata tattttccag agatttagtc gaaatcgctt aattcgagga     84660
     aagaaaatct aggtctgatc aattaacacc caaaatcacc tcagatcccc cctcaattcc     84720
     atcatttccc accttcaatt gcccgatttc ctgatcattt ccaccatcaa actcatcaat     84780
     atcagatcgc ttttcagttt ctgtaattag atcactgtct ttattacaaa gttcacaaac     84840
     tggtctattt ttctctaatc tctgatccca tttcgcctga aacgctttca gcatctggtc     84900
     tttgtacact tcattgcccg aatatcgaat cacatagaga ctcacggatt cctcactgcc     84960
     caccttcacc aactcatggg cgactcgctt gatcagctta ttgacgatag ctacggcact     85020
     ttgcccatca ctgatgacat tccgaaaatg gcggtaaatc tgatatcgat attccaacgc     85080
     cttcactttg atgtcttcta atcgctggtc cccctccgtc atcaccatga tttccatccg     85140
     catccgggcc tcaacctgct catagcgggc ctgagtaaac gcctgagact gctgctcaat     85200
     ggcttccact aaaccttgct tttggtactt aagagcctgc ttttgctgct ccaactgctc     85260
     cagctccccc ttcagctttg ccttcctggg atgggccttt ctgcccaaag ccgtcaactt     85320
     cgcttggatg gccttctgct cctgaatgac ttccctgatc tgcccagcca gtcccttggc     85380
     ttccaatctc aaagactgtc gttgtctttg cacctggcga cccttttcca acgctttgtc     85440
     atacgcctca taatcagcgc tggtgacgtt gtaggtatcc actaaatcaa atacccccaa     85500
     gtcacgaagt aactgtacct ggatgcgatt attggttaac cgatgagtga gaacgaactg     85560
     actattgagc tgtttcataa aattcctccg gtctaattcc tcagcaactt cagggtgata     85620
     cgacatccaa tgcaacttcg tggcactctt taagcgtcct cgatgctcaa cacagacttg     85680
     atgaataaac tcatccgtta ggtccacacc gggtaactca tcttgtaata agactttctt     85740
     ggcatccaac gtatctttat aggtggcaga agaactcccc atcactcgga tggcctgctc     85800
     caccgtgaac cgctccccgt cagccgtccc cagcattacc gccgtttcca cctccatctg     85860
     cttccgcact ttactgaagg actcgacgat atcggcattg cgttcactca gctcctccat     85920
     ctcaatcgga tgcccatgat ctgccagcaa caaggtcagg gactctctta gagctaacag     85980
     tgaggcaatt gagcgggtct gatatcgagc aaaactgacg ttgtgacagt tgttggggtt     86040
     ctgctggtat gcctttagtg ctgccaactg ctgagctgtt tccggtgact ggtcatggat     86100
     gagctgctgt tctaaatcaa tggacgcagc cacatcttgt ccatacttgg actgcagcat     86160
     gatgacctgt tccacagact taatcgaagg aatatctggg atatgcgcct tcctggttac     86220
     atagatttca cgagtgacct ttgctcgata tctccagagc tgctgataga cactgcgggc     86280
     atgattggat gaggcgtagc aaaacactcg actgaaatag ggaatcaatc tcggttcatc     86340
     aatgctgacc ccactctcag cggtgggact gaggaacaat gccgtgggtt gatactcttt     86400
     gacaaactca gtgggattgg cctggaatat cttattctca gtgcgctccg atgtcttgcg     86460
     gtcatggcgc agaatacctt tggcaaactc cgggttcatg tctgcaatca tccgctccag     86520
     cttctcaagg aattcctgag aagtggcaac aacaataaac cgctcatcgc aggccacggc     86580
     attgaggatt ctctctagaa actgagaggt ctgaccagaa aacaccttcg tgggaaagtt     86640
     atcatcaggc ttgtactcat tgacgacaat cttggtgttg tacttcccgc ctgtaatgcc     86700
     cttgatatag tcaatgggaa tttgagacag ggaatcttct aagagaatga tattgccccg     86760
     agtttctaag acccggtttg cgatcgcatg aaaatgttcc aagatctgat tctgccgatc     86820
     ccccagagtc tgaccactga gaacatggaa cagagcagca tcggcttcat ccaagatgat     86880
     gcagctatcg ggttcaatat catcgagttc aatcttgaga agactatcaa aacagagcaa     86940
     gatagaccgc tcagagcgaa agcccatgct gatattgccc tggtattcct tattgagacg     87000
     gaataagtga atgagcttat agagggtgtt cccggcatca tccttctcag tgaatcggtc     87060
     ttcggtatta aacagcaggt tattccggta accgggcata atcacctggc ccttgacctg     87120
     gctcaccagg gacttcagca tctccgtctt gcccgtgcca cacatggaag cgatggcgac     87180
     gacagacccc ggatcaatgg tgcctagatc tgagagttca atgtatcgct tattgataac     87240
     cgtcgtggct tgatccgata ggccattgag cttcagaaag agctgaccca gttcatattc     87300
     cagacccaga ctattgaaga accaagtggg cttgaacaca atctgagcca attccactgg     87360
     ggtgagttca tcgatatcgc aggaattttc cttgtaggtc tgtccccacc aggccacctc     87420
     gacgatatag ccccattctt ccagcaagcg aatgactcgc tgatactgac ggaaaacatt     87480
     gaggttccgt actgcccccg catcaggata gagggtgatg atcggggatt gctcagcatc     87540
     tttcgataag acggtcagag tttctctcaa agtgtcagga gatgaggccc agagtccccc     87600
     cgctgcccca atcgtgggga gctgtaatcg ttgagagagg agatagggtt tgacccctgt     87660
     tccttcaacg agggcaatcc gagaataggg accaaaagac ttgtagatgg ctaaaggaat     87720
     ctcaccgtga acatgaggac cattaccgtt gggattgcgg cgggtagaac tggacaacca     87780
     gatgtagcgg ttgtcttcat gaacattgcg cttccgcaat tgcaaggcca cgatttgatc     87840
     gtggacatca tagagaggcc agagatagcc cccttgagaa ttgaggatgc caccgggaag     87900
     gacaccgggc agatctgggg ataggtcttt gactctctgg aactggccga cagacacagc     87960
     atcaaaccca tcgatttcag cctgggacat gcctcgtcgg cccatgtctc ctcgatccat     88020
     tgagcagagg gatagatcag agaggagttg tcgatacagg taatcgcgtt ggcctacggg     88080
     caactccttg gcaatccgtt gacgccgttc ttccttagct tgttgatcac ggatggcctt     88140
     gcgggcctgc caattaatag agttgtagtt gtcatcaccc gtgtgaggtg cccagatccc     88200
     ccagttacta tctttcgaaa gctttctgaa cttatagccg ttgatgatac caacatcata     88260
     ggtttcggtg aggcaaagga tgatatcgcc gcctttgctg catcttccat cattagagcc     88320
     gcagatgggg caatgatttt gtcttttgaa aggaatcagc tttgaagtat atcgggtagg     88380
     tgtaccaaag cctagatgag gtgagttcag agtgagtgat ggtgtggagg tcattgatgg     88440
     cctccttgat gatgcataga tatatgagtc gatttccaaa ccattagcag ttcggggaat     88500
     aaaaatgtag aaatcattga aagtccctct atcagttgtc cgtagcgaga tagagaggtg     88560
     tggctaggtt aatttaaatt acaaaattct tgccagcaca aagtcggctg ttctagaatc     88620
     agaacacacc actcctgtgg ggcactaact ttctggctcg tccaaagctc tcggttagat     88680
     tccacaatct cgaaaaaata tttagttttt tcctggatcc ctagctattc gcgtagctgg     88740
     gattcctttt ttttagggca tcgtcacctc ctggggggaa atacaaagat tcttagtgaa     88800
     ccatactacg cttcagccct caatacgcaa aggctttaaa acaaaagatc atcaagggtt     88860
     tcagaatcct gggcagcatg attcgatgag gaaaaaatgg gtcaattcct cgaatgagaa     88920
     tgaagaaatt tgttgcttga tcagagaaaa tctaaattgg tatctgggaa ttaatttggt     88980
     ggccgagggt gttctttcct atatccaccc tcaatgactt tagatacacc tgaagtaatg     89040
     gacgacatta ttgacctcct ttcgttcggt ctatcattgt cctgtaatct tctaacagac     89100
     tgagatacaa gcgctaatgg cagcaagatt atattgagaa ttactgggct gaatcccaga     89160
     tgtcctcgcc aatcgtcttg agttctctcc agttgatggc atcgctgatt ctctggggta     89220
     agtcgatgcc tcgcgacatt agcagcctcg tgactgctac gccgacgaaa aaccagaatg     89280
     tgtttctgag cattggtcag ttctccaggc tcatgaatat gactctcctt attggtttgt     89340
     ttgaaaatct gttgaatagc tctgccgatt ttcccgccca gccgtgaggc gtcaaccctt     89400
     tttacagtag gcttctcgat tccttcggga tgaattagct gggtcttgtc aggttgtggg     89460
     aatcgaacta ggcaagatcc ataagtgata aggtgcttga gatattcaag agccttttga     89520
     taaagctgcc taattctttc gccagaaagc ttgagcattg tcccaatctc gcgatagcta     89580
     tgaccgtctc tccttgcacg gacaataaaa ctttcgcgat cagggagctg agcaatgtag     89640
     tctttcatat tgatactctc ggcaaaatcc caagaatcta gctgttcaag atcttcaaca     89700
     aaatcaagac attcaatccc ttgctctgtc ccagtcaaga cattgaggct agaggtatca     89760
     actactcgtg ctttactcca ggcgttagta attactcgat gtgaatatcc tgtacgttca     89820
     gccagttcat ctagagtggg ttttcgttct aactccagct ttaagtcttg ttcagcttca     89880
     tcaatttttt ttaggtgttt cgtaatttct ctactgagtc ctctttgttc acaaatcaac     89940
     tgcctgattt cagttctgat aggcttaaca gcgtaggtac tgaattgaaa gcccctcgat     90000
     agatcaaatt tttgaatagc aatggatagt cctagggttc cagcattcac taaatcgtcc     90060
     cagtcaacta atccgcgata tcgtttagct tcattgaaga ctaaccgctg attctttcgt     90120
     ataaaacggt cttcagccct tctgtcacca gcctgagcgc gttcaatctg tgggtactgg     90180
     actttgcggc taaaaggtcc ggtctccagg gattgcgaat tgaaaacatt ggtgtatacc     90240
     attgtttaaa ccttcagatc cgtaatctgt gtctaaggtt ttcggaccct ctggttgttt     90300
     gatcgcggtt agagggtctt ttagtttttt catcaaaggc taacggtgca gttagcctca     90360
     atcggtgttt aaggtttcgg accctctggt tgtttgatcg cggttagagg gcaatagtaa     90420
     tcttgtgtcg tcggcaatct aggtagcgaa gatcgaaata ccctattacc taaaacgtgt     90480
     ttgcagtgga gaaatcgttg atacttcatg tcaccccccg ataagcattt gttttaattg     90540
     cttgttctgt ttgttttcag tccagaggac agattgagaa ttgtgtagct agatagtaaa     90600
     aattctcatt aaatatagta catatgtatc aaaaatatca atcattcacc tctttgtaaa     90660
     tggattctta gggtgtgctt gtcgagaatc agggataagg aagaaattgt ggctcggtga     90720
     agaacagttt ctttgcctca agaactattt gaaagacgcg ttaattcttg ctgcacatga     90780
     cttagttcct tccaggtcta gctttgtttt gtaggcaatg aaggaagcta caggacaaag     90840
     aatgagggtc cattgcacaa attaactacc tgatttgtgg attgagtctc cctgagccgt     90900
     tttgacggta aattaggaag ccaatttttt cgcttcttaa ttggtataga taaatattac     90960
     atgttacaca tggattatgc aattaatgat gaaatgctag cctaaagttt gaatctatac     91020
     gtattcagtt gtaaatatag ctttaccaat aaatgatgta atttttggaa gaagtatgaa     91080
     caatgaaaaa agtagtgatc aactggaaac tcgctgaagt aatgcaagct aatggtatta     91140
     gcccaaccga ccttgctgct gagatgaaaa ttagtcggaa tgccatatca aaaatgagaa     91200
     agcattacat gccacgcatg gatggtgaaa agctaaataa tttattgata tccttaaaca     91260
     ctttgagaaa gcctggaaag aggccaatac gagtaagcca cttgatagtt gagagctata     91320
     cgttggagga aatggagcgg gcaaaagttg gtgagtctac atagattttg atctcatagc     91380
     tactctccct acccttcctg tgtagctcat cggccacaca gaaaatgctc aaaaccacat     91440
     tattgtcact tggattgttg gcgatcacat tctcgtcagc cctcgccaat cccgctacaa     91500
     ttcccataga caaggcattt aaacacactc agaagctaga agtttcagat gtagatcatc     91560
     tattagactt cacggatacc cgctaccggg ttatcaaagc ctttcccagt aaccctcaac     91620
     agttgcgggc cttaagcctg tctcgtaacg atcatcagca actccttctc aagtggactc     91680
     ccaacggcac agccaaaaag gccagtgtct tcctacgagt catgggtcca gggggagagc     91740
     aaaccatcac cctcttggtg aagcggtctg gtaatgaacc ggacaatatc agaacagcgt     91800
     ttgtccccag ccaaaccgtc tccaaagatg ccgtgatcgg ggaagtagct gaaattcccc     91860
     ccaagccaac tgttgcaccc atccctaacc aactcattcg ccccaactgg aaatcccaca     91920
     attcacccaa aaccgcacag cctgttaaag ctcccttaac cctcactcac ccgaaatccc     91980
     cacccgtcct caaactcagg gcgacaccca aacccattcc cagaattgcc aaggtcacta     92040
     ctacaggtcg gccccttatc gaccgcacaa cgctagacaa caaagcctta gccaactacc     92100
     tgttgagagg actacaccgg gccagaggac tgcggcaaat caaccgccat cacgacaact     92160
     actggttcgc tcaatcaatg gcccgctatc tcaaacgagg agtgtccgtt gataaggccc     92220
     tgcgctggtc ccgactgcct gaaaaaacct tcaacgacct cctcggccac ggtggtgtca     92280
     gtcgctgaaa gtactgctgt taaggcaaat ttgcaccttc aaagccatct tacctatgtt     92340
     tctatcgtcc ccccatcgga gattgaatcg tcatgcaatc ccccttcctc caacacactc     92400
     ggcactatgc ccataaatac ggacctcaat ggtctgctcc agtcctcctc gtcatcctca     92460
     ccctctgccc cgtttttctg ccattaaatc caggcaccca aatcgcctgg ttagaaatca     92520
     tggcactggt ctggtccacc gccctcttcc tgcatctcta tcaactcctc aatattcaaa     92580
     ccaagctggg cctctacctc ttcttctccg ggatgattgc cttggttccc tctatggtga     92640
     aagcccaaaa cgtcggcaat gccccttcca gtgcctgtaa ctccggcttc ttcctgatcg     92700
     gccccatgct cggagccgtg gatacttcct tgggctggtt tctgggtggc gtcctcgctt     92760
     actccctttg cgcctttatg attgccttga tgattgtctt cttccttgtc gtcatcgtcg     92820
     gtttagtgat ggctggggca gaatcccaca acagcaaacg caccctgttt gaagtcctct     92880
     cccaatatct gaacgtgatc atcaccatga tggtgatcgc ctcattggtg accgtcttta     92940
     acctgcaatt gagtaataac ggcaacgccg ctcctatccc cgtcggtgga cagaatcagc     93000
     cccaaggcgc gacctctgtg ttgaactagg aggacattac atgacccaga ccgaacagat     93060
     tgaaaaagaa ctgcgctacg gcaaaatcaa cccctacatc ggccccactc aattccaagt     93120
     cctaagtgga cagcagatta tcaccctagc ggccagtggc tgcatctgct ttatcctcgg     93180
     cttctccatc ggctggttta tggctgtatt cctctggtta ggaatctttg tcctcactgt     93240
     gttggccttg ggcaaagact actcccgcat ctttgcccgc atgagcaaac agcgacggta     93300
     ctacagtgac cgtccgaact accaagtcaa gggaggagtc cccctgatgg tgattgaact     93360
     acctgaaccc ttcaaactca gtcagctttt ccgccgacag actaagcaga aagccttgaa     93420
     gaaaatagag cctgaatttg acctcagagc ctatggagaa atgctcctcg gtgaagacat     93480
     cggcttctat cttgtccatc aagacaagca tgaccgagcc atgctcattt ttggcttcac     93540
     cctaaaaggg attgacccca ccctgtcaga gcaagatgca atggacagat tgcagaccat     93600
     tgtcatggcc ctccagaaaa ttcctggcat cgaactcaaa ttcttctggg acgtggaagg     93660
     ttctgctgat gcagtcctcc ttcatcaaca tgatctcgtc acccacaacg atctagatct     93720
     tctcagtgaa aagctgatca aaagtgaggc tcaagtcgcc gttgacctcg ccgcagaagg     93780
     taaacttgtc cattccgtca tccgtgtcta tgccaagtat cgcctcagct tagccgatga     93840
     ctatgccgtc aaagaagacc gcttagataa actcctcgcc catacccagc ccctagtcgg     93900
     caccttccaa gaatatctca acccccaacc cgaaggcttt agctccaaac aagcctggga     93960
     gaaagtctta gaccgggcct atcaagccgg gtatatcccc accgtcaaag ccttgactca     94020
     aatgggcgtc aaaccccagc ctatgagcaa agaagacctg tgggccatcg actgggaaga     94080
     cacccatgca gaacccgctg acccctgtcc tcaatcgatt acctacagtg aagcgggcct     94140
     gtctcccttt aatgaagatc agcctctgcc ctatcacatc ctcggagaac tgttcagccc     94200
     cgagcgaggc ttacccgccg ttcccacccc ctacctctac accctctatc accccatcaa     94260
     ggatcaatgg gctgctctcg tcaaaatcaa ccagcttagt acctacaaca aaatcgataa     94320
     cttcctctct attggttaca tgaaattcct cctccaagcc ctagagggat ttcatggcta     94380
     tcgcctgatc tcagaaatca cccagattga acctgactcc cgcctgaagc tcgtcaactc     94440
     cgccatcaaa gaacgcaacc gcaaagccat cgatgctcaa ctcctgcaca gcacccgcaa     94500
     cgtccaggca gagacggatg tgaatgaact cgtcgatgcc tcccgtgaac ttagttccgg     94560
     tcgctggccc ctcaaagtca gcctcggaat ctgggtctat cgagctgaca aagccagcct     94620
     taccgctgcc gttcaagacc tgattcgccg actgcccacc agcaaaaccg agcaagtcag     94680
     caatcacctg atgactcatt ggatctccag tcatcccttc cactggcaaa gcttgttctc     94740
     caaaccccaa ctgcggcgag aagaatacca atgcaatcag ggggttccct tgatgcccct     94800
     agtccatccc caaaccatcg ataaacaggg tatccccttt gtctctcgcg gcgttgccat     94860
     tcctgtccat ctcaacacag ccttaaagaa gaatctgata gccatctttg gacccatggg     94920
     agtgggtaaa tccgtattga tgaaccggat gatcctagag aacatcatcc accgcatctt     94980
     taccgtcgtg attgatgtcc cccctggaaa cggcaagagt acctatcagc cgtttttgaa     95040
     gcagcttcag gccatcaatg ttgctgcagc ctacttcaat atcaaagaac acatcatcaa     95100
     cgtcctcgct gaaatcgata caagctgggc aggcgatctc ctcagtgtcc aactcctgaa     95160
     gaaaatcaag caaaaccacc tcagtctcct gcgggcctta gtcctaggag atgacctcga     95220
     ccatcccctc tacaaaacca tcaagtctgt cctggcattg agctatcaag actggcgggc     95280
     cttatcggag attgatcaac gctatcgcat cgccaaagcc gctgcctttg ggtctgagcc     95340
     atcccaacga atgcctatcc tccaagactt cgtagattac tttccccagt gggtgagaca     95400
     gtacaaacaa gacaaagact gtgaggattt ggaactgcaa gccatcgcca tgatccgcac     95460
     ggaactggaa gccgtcctca ctacggatct aggagcttcc atcaatggca tcaacacttt     95520
     taacttcgac ctccaaaccc tcgtcattgg cctgacggac ctgcaagacc cccaagagag     95580
     cgtcatctat tccatggctg cgattaactt gatggagctg caatcgttcc gctatcctcg     95640
     ctccgccatc tttggcgatg aaatctccac cacctttaag taccgctcca tctccatccg     95700
     cttcgctgag atctgcacga agggaaggaa agaagccaag aacgtggtta ttgctggaac     95760
     tgaagagaac accctcgttc agtcagaagg aggccgagat atccttaaca acctggatgc     95820
     tgtcttctat ggacattgca atcccactgc cgttgagaat gcctctaagc atctgcgcct     95880
     caagcctgaa gtcctctcca aatatgtccg agctgaatat gcccccaacc tcgcggaact     95940
     ctgcacctcc tggtatctgc ggaaagggaa tcaacactat gaactgctgt tctacacctc     96000
     agccctgatg attgccctgc tctgtaccca acctgaagaa actgcagcca gggaccggat     96060
     cctggctctc tatcctgaca atcccctcca gggctatatc aaatttgggc atctgctgaa     96120
     acgggcttac aaactcaacc tacccctgtc tcatatcgga gcctaagtca tgaaccgtaa     96180
     ccaagctgtt ctcttgtccc tgatcattgt tttttctagc ccccagctta cccaagccca     96240
     agtcttctct gatgacataa ccctaccgaa gaatgccccc accttcccat cgggtagtcc     96300
     cagtaccaca ggggatgtca gtgtaaccca ggataatccc tttgacgata gccctaaacc     96360
     aaacttcctc aaagatatct tcttgggtcc gagcaacaat agaccgattc attccagcac     96420
     cttgaagctg ttcgatattc tcggaaaagc ccagaaaggc ttaaagagct acaagtttgc     96480
     tgaacaggtc tataagggca ttacggggaa aaacgctaac agcatcaccg atggagtatt     96540
     tggaattcta gagcagtacg gcattattga cccccagaaa gccaccactg cctcaaatcg     96600
     ctccaccccc atcctgattg gtcaagggaa tcaaggtccc gcctatgcca cggctggctc     96660
     aatcggagcc ttaaagctgg aacccaaaga accttatgaa tggcgggtca aagccttaaa     96720
     cgaaaacatc gtctacaaaa acgccatcca aaagaccggg gacttcgtgt actccccaga     96780
     agctcaagag atcctcaaag tccaagatca agtcgccgct gatgccagag acgctgccgc     96840
     tgccgccgct caaggggggc tagaatccgt cctcgcctct acccaagtca aagaccagag     96900
     catctatgcc agtaccgttg tcggtgaata tggcacctcc gctcaaagcg ccaaatccac     96960
     ccaagccgtc aacaaacttg agacgaagca aaacaccgag attgccaaca tcttggcggg     97020
     caatgccttt caactgaatg ccatcaacga atcaatggtc cgcaacactt cagccttggg     97080
     caatatcgtc accacccaat ccatcctcgt agacaaacag accgtttctc aatatctaga     97140
     tgccgctcaa ctgcgacaaa acggtcagat atttaccacc ctcaacaacc actattccta     97200
     tgaaaagcgc aaggatatgt atcaacacct ggccgcagcc gacaccagta acctgcttca     97260
     tttcccaaac ttggtggaac ctcagccaaa tccttcagga caaacgcaac cgtaggatag     97320
     ccatcgctct ggtcttgggg gtgatcatcg tcctctatca agcgacccat gcccatgcgg     97380
     attttgccga agacctgatc agcgatttag aaccctccgt tgcccatgac gcattttggg     97440
     atgacctctg gaacgccacc tttgaccgct ccacgggtat tagtggtgat acccaaagaa     97500
     ttgcctttgg agctgtgggt acagttgtcc gatgggtgac cctgattgcc ttattcgtgg     97560
     tccttctcca ttacgggtcg gggatgatgt ccagcggcac cagcttgcga aaaggcaatg     97620
     agttcaccat taaaagtgtc ttccccgtcg tggtcatcct cgccctcctc gccaatcagt     97680
     ttgctggggt ccatgccgtg gggatgttcg tcaatcaggc ccgcttaggg attacgggag     97740
     aagcctatgc tcaatctgag tttgccacca ccttccgcag tgcgattaag gatgcctatt     97800
     tctcagagaa gtatcgagag aatgtggcct ttcgcgccaa gcaatgcaac cagattgaga     97860
     cccccatcac caccattccc tccttagaag aacccacgaa tcccgagacg cccctcacgg     97920
     atgagcagcg tcagtactac aagaaggttc ggtgtattca gtcgatggtg gactatatca     97980
     aaaccctgca agccaaagtc gaggctgaat gtgccgatgg ctgtgtcggt acaagggtgg     98040
     gtatcgtcaa agacttgaag aggtacgggg tccaaggtgt gcctgcgatt gtggcggaaa     98100
     acctggatac cttcgtcatc cccattcaaa aactaggaga actcgcggca gatgccgcta     98160
     agcatggggc acaggagacc taccgcctaa tcttccgagc cattcaatgg gcctggacct     98220
     cgtttttgaa tatggggttc tatctgacgg cagtcggcgc accgattacc tatgccattt     98280
     ccctgatgcc caccaagcga cattttctct ttgatttgaa cctgttctcc ctgctgatgt     98340
     tttccctagc ggagtttgcc aatatcttct gcattggaat cgtggccctg atgctgcaac     98400
     gacccaccct agttgacttg ggcgggtata tcttcccttt gacctatgga ttgctcgccc     98460
     ccttggtgtc cggttcaatc ttcctcggtg ggtttaaggc cgctgctagt tttcgagggg     98520
     gtgccttggg tgttgccagt gcagcggggg gcattgcagg gggcattgcc acctcagcga     98580
     tgatttcagc ccggaaccgc cgagagcaat attactaaac taatttgctg ctccttcctc     98640
     attctgtcta tgttcacact aagcccatga ggtcattgag aggtcaataa aaaatgccct     98700
     tatatctcac cctaatcgtc gtctttgttg cttttgccat tctgctgatg gtcattcgag     98760
     gtggaatggc tgaactcaat cccctatcag gcttgatggc ctgtgttgtc ttgacgctgt     98820
     ttgccgctta tcaccgcatc tttgctgggg cagaccagct ttcggggtta gattcttttt     98880
     tcaccttggg ttgtgggtta attacctgtc agctctttat ccctgagttt cgattctggt     98940
     ggtcggactt ccggtttatc tatggcatga ccgtgctgtt ctatttcgcc ttctgctgga     99000
     cctttgacca tatatacatc gtttggtttt ggtttacggg atttgtgctg tttctactgt     99060
     tggtgcaatt cctttttgga gtggcgagtt ctggtggtgg gagaaggatt agaggggttt     99120
     gtgatcctga ttccgagttt gattattcga tctacgacga gtggtaatga acgatgacta     99180
     agaaactctc tcgcttcctc cccctactgg tggtatccgc cttactgctg aatatcctcg     99240
     tatgcttttc ctggtttact caaggagcta gagcgcaagc cccctctcag gtgtatatcc     99300
     aaaccgactc tgggttggtg gtcaaaggta agcccgtgga tcccctctac cggagtgatg     99360
     aggtggtgat gcggtttgcc caggaatttg tctccgtggc ctacacctgg ccgatgaatg     99420
     gcgaaggtca aaatgaaggc aagctaatct atcccctgcc catgtacacc caagctttca     99480
     aaatccatcc tgatatccgg gcagagtggt tagggcgtca gcatatcacc tatgccaaag     99540
     ccaaagaccc ttttgctaac tatgtgggca agccccagca tacaaagacg accattacgg     99600
     gagccaagat tgagcgtatg gacccagagg cccatgaatg ggatgtgcgc ttgtatgcca     99660
     cccaataccg ctttgatggt caaaacaacc tgatctttaa ccccgtcaag gtcaacaaga     99720
     tattgaccct gagagccgtc caaggctttc gacccaactg gcaaattgcc gatacggacc     99780
     tgggccgcat gattgatgat gccctgcatt cagagctact gattaccaac attgtggatc     99840
     tgcccaccta gaacaaccca gagagcaaag acaaggagcg agacatgccg acagacaaac     99900
     gccaggtcga ggaagccaaa gcggcattgt tggatgaccc ggaactcaat gaactcttag     99960
     aagagaacaa gattgctgaa ggtcggccca tcaacgatct agagaaactg gtcgatccag    100020
     gggataaagt caaacatccc tactatctcc agccctggtt caggattggg agtatcgcca    100080
     tccccctgat catcctggga tttgtgggct ataagatttg ggggccaaaa cccccggtgg    100140
     tgatggcctt gggggacaag gataagcaga ttatcgagct gacggaaaaa cttcagcagt    100200
     ctgaattaga gaaagcccag cttacccaag acaatatggg attgactcag gccgcagagt    100260
     tagagccatt tcaacagcga caaaagcggc tcaagcagca ggctcagaaa gctcgacaag    100320
     ccaaacaaaa gaagcctgtg cctgtggggg gtaaacccgt tcagcgccag aataccgtta    100380
     gccttcctcg tcggctctat cgcagtccat ctcccaaaag cagctttacc ccagctaacc    100440
     ccagcccctc cttgcttgcg aagggtccct cattgagtga atgtgtgggc tatgtggagc    100500
     ggaatattaa cgttccaggc tgtaaacgct atcagattag ccagaaaccc cagtcatcac    100560
     ctcagaccaa ttccattgtc aaaaacccaa cagtccctcg tcccgcctat acgccaaggc    100620
     cccagactaa gcctgttaag ttggcctttg ccagtaagag caagtccaaa cctcggaaaa    100680
     aagtaacgcc tgactatcag gtgaacttta tggcaggtga gattcaaacg gtggatcagt    100740
     ttgaggcgga gttctatggt gcaggccaga gcgctactgc accgacgcgc acctcaatga    100800
     aggccaaagt gattgatcat gtggaatggt tatcccctca agaggctcaa cagatggtca    100860
     tccctttgaa aattaccagt ggtccccaca aaggtcagat ggctgaggcc aagattcagc    100920
     agatgaatgg cttgcagttc acggctcatg tggtcagcat caatggtcaa gcgattgaac    100980
     cagggacgat ggaggtcagg cgcaagaata ccaagtacct gagagcgcaa ctgaagcgtc    101040
     agggaggaga gtcttttggg gatagagtga tggggacggt agctgcaata ggtggggaga    101100
     ttgccacgga tcagttagtg gatgtgcggg gtgggagtca catttcgagg ctcgtatcta    101160
     atcctcagcg taggaccagg gaagtgacgc agtactggcg gttcgatgga gaggttgagt    101220
     tggtgccagt gggttgatgc ggtgtgtatc aaagttactg aattgtttac agaaaacatc    101280
     aaactgcagc aacgatttca gctcaattca ccacatgtac tgagctgaaa gcctgatagt    101340
     gatttgaatt aggctttaga tccctcggga ctgtattgct tcgtaagttt atcatgcaat    101400
     ttaaaccagc ctgaaagcct caatctcatc cataaaccac ttagaatcat ttttgcagga    101460
     ccgttaataa tactaagatc cttaatgctc tcccaaatag ttattccggc agctttgcga    101520
     tagtcagtac cagtaataac gcctaaaaaa gttggcatgt tatcacgaga gataccatac    101580
     ttaatacaaa aatcagctaa ttcattgcaa tattgaacgt attctaagac atcttggttg    101640
     gtaatttttt ttatttgaat atctgccaaa atagctcttg cctctaaaaa agtaggggca    101700
     gttgttgatt tttgagcaca attaaaggct tctttgttat agtccatatt tcgataaatt    101760
     aacgacttaa attaattttg gaaatgaaat tacagtttgc agctttataa tttgagtaac    101820
     taatttatca tatgcttttg gtgaaatatc aatttcaaga atttaattta tgcgaatgct    101880
     tatatttctt cacattagca actctcatat tactttttta tacaattaaa aaaatcataa    101940
     actacagctt ttgtatgcct cttagaatat tcgtttcatg atgtgctatt agctcaattt    102000
     atgccacgat ctggcctaga attttagtca tgaaccatat cgttagcttg atgttgaaag    102060
     aggtcttgtc cctgttatat caaacgattt tcaccgcata agttatcatg cctatgtttc    102120
     ctttgtagcc catctacagg ggattcctgt ttgtaaccct cactgttctc aagcgatgcc    102180
     ctaccctcat cgcctccatc cttattgcag cctttcagac ccttagtaaa aaggaatttt    102240
     ccagagtatt tctaaagaaa attagtagaa taatctgttg tttctcgtca gttattcaaa    102300
     ttagaatcga gttaaaatat ttcaatttta tgttgggata aataccaaag cctgttgaac    102360
     caaagttctt tgtttcttgc cgggaaagat ttttggctct gatgtaaacc agccatcacc    102420
     atggtaaata gcccaaaatg taccttccca accatcaaca tctgcatcat ctttcaaaag    102480
     accaattttt gagtattgtg gttcagatgc aaaaaaatta aatttactag caataccaga    102540
     tttgataggc cgtctagcat tatcaataaa ccaacgcaat atttcaccgt gttcatcatt    102600
     tgggtttata cctggaatgt caacccagta gctttcatgc gtaagtgtat ctcttgttcc    102660
     gagcttagaa gtactaccgt actgtataga gtaattggaa acttcatcaa acctgggtgc    102720
     attttccaaa atatcgatag gttctttata ctctggcgga ttgtatgttg ctgcaggatc    102780
     taataaagtc atggtattta caccaccaag gaactttgca gcataggctc ctacatagct    102840
     acctaagcta tgggcaatta tgtttatctg ctttgtttcc acacgagctt gtttcagtat    102900
     ctctgacagg gcatgaccaa cacgttcaac agttagtgag acagaaatat agtttagtgg    102960
     tatccccttt aaagtgctgc tttttgcagc agtactccag tccatgatta aaatctgatc    103020
     ggatggacta attccgtata gattttcagt attgacatgt ggtattactt cgccttgttt    103080
     agatcgaatt atttcatcaa ggctatttac aaagtgttca atcctactag atttaggact    103140
     actattaaat ccgtgtataa ctatccatat atttggtgca ttagcatcta ttttgtagcc    103200
     tctttctttg tggttatatg gaaaaagaga tactttataa ttgatactga cttcatattc    103260
     tagacttgtt ttaagctggt ctaaatcagg atgattattc atttgatttt tagagatact    103320
     cttgaattgt gatagttaga actatttatt taaaagattg tttgctctta gctctataac    103380
     ttaacttgta ttttgaaaag actattagca cttttaaagt caatctttaa aattatttaa    103440
     tatctttcta aaatttctgt gactcatttt ctcttaactc aaaaaccctt actgacaaac    103500
     tcttgaattg aattcatcat ttcttcaaaa aaaggatttt taggttccaa tggagagcca    103560
     tttaaagcca agacaggttc tttcagtaca acactggcgt gaggaacatt gaagtgcttg    103620
     ccaatcctat agaactcagt gttcttatta ttctttgtag ttttgaaaat tagttcctct    103680
     accccctcaa tatccgccgc ctggtcgcat tcagagtgag ctacgaatag aggttggctt    103740
     aaaggacttt ttttaccaag ttttccagtt attttttcta cttcttgaat aagattagac    103800
     agcattttag cgccacctgt atccatcctt gagtatcggt aggggttatc gccaatgagg    103860
     ggttcacccc atctatcctc caccaagtca acaattgatg aaattggggt gcgtagtaaa    103920
     aattccttaa gattaccctt cttccccgca atatctaacg cagcagagaa cagaaatatg    103980
     cctccattga tatcatcaga atctttcatt gccataaaga cacttaaaga acccccagtt    104040
     gaaagcccac caatggatac tttcttccct ttagtttttg cgtattcaac cgcaaattct    104100
     acatttcgct tccattcttc taaagaaaca cctttcatcc cattcggatt aagtaggcca    104160
     tgaccttgga gtaatggaat ataaacattg aaccctaaag tcttgtggaa gaactcacca    104220
     attgccctca tgaaataggg agagtcggtc aaaccatgga ttagaacaat tgcttgatca    104280
     cgctgatctt cccattccat aattacggga tgacattctg gtctaatatc tgcttcagta    104340
     atataactga aattcttata atattcttcc cagattttga aattattttt tgaataatct    104400
     aacatgctat atatccaaat cttaaaaatg aatataggaa tatattcgag tatataaaaa    104460
     catattcaat tttagttgtt ttggcaaatg aaatacattt ttctttgcct tatggactat    104520
     ttgtgatact caataataat atttctttca ggttgcataa aatatcaatt tcgatctgat    104580
     atatactgaa tttattgaga ttaagtctaa ttatttagaa aaatttaata ggtgtaagtt    104640
     tctatgtctt tgtattactg gttaatgatt tatcacaaat ttacgagctt taatcgatat    104700
     ttaggttgat aataagcctc tgtcctaaaa ataaatgtat gttacttgcc ctttcacgat    104760
     ttaaggtcaa attatgtcac aatgccttga ttaaagatga gatcaataaa gaatgatatc    104820
     ctgacctaaa accttgatag gatcctctct actcgatctt aaatttcata ttaaattgat    104880
     tactaattgg taaaagtaat catgttggtt acttttacct tagtggtgcg taaactttct    104940
     tatgctgaaa atagaagagc ctaaagaatt gatatcaatg gtagaaacca tcactttcgt    105000
     tgaattttcc tgaagaaccc tcacccataa tcctttatag aatcctttgc tcgtaagtga    105060
     tacaaaggta agcaaccttg aattttggaa taagttacac atgtgtagcc aaaattttgt    105120
     gttgctaata ctgattagtg gcttttcctg atatcaagtc tgcatctttg gtaaaggtga    105180
     cttcccaagc tatgcaggca acagcctcaa cccctgacat atcaacccat ttgcacctca    105240
     aaggtcatcc tgcctatgtt tcctctgtag cccatctaca ggggattctt gtttgtgacc    105300
     ctccatgttc tcaagcgatg ccctaccctc atcgcctcca tcctgattgc agcctctcag    105360
     actcttcccg tctggagtca aactcaacaa gtcgggtact atcccgccct agaactcgcc    105420
     aatgttcctg ggttaatcta cgaaccaccc ccggaagctc aaggggtttc cttctccagt    105480
     ctccccggtg ccagctctcc cggttgggtt gtcgtgaatg accccaacct caactatgac    105540
     cccaaccggg cttggcccgc tggagccaca ccagatcgga tcatcaagtt tggagactta    105600
     aagcaaaacc ctcagtttgc aggttttact aaacacagtc tcagagactt taacaatgcc    105660
     attggcaccg acatcggagg agtgcccatc ggccagattg aactagtcaa tggcctcaac    105720
     cttgaacagg ttaaagacat ttacaacaac ggcgatatca aactcaaaga ctcagctccc    105780
     ctattccaag ccgtcgtcgg tgtcgttcta gatcccacag gtgcccagaa gcagcttcaa    105840
     cgcaatgccc tgagtacggg caagaaagct ctgattaacg aactgaataa aaacccagcc    105900
     ctcaaagata tcccctttga agacctccta gatggcaatt ggcaaggggt actccaagaa    105960
     ggtgaacagg tcttacttcg agaaattggc aatgacattc ccgcagagct gcgccgctta    106020
     cccgtgggtg ctctcaccat tgaagtcata gaaggcaact ggaaatccgc ccgacaacgc    106080
     gcccagaact atgccattga tgagatccaa aacttcaccc tcaatgaaat catccaagaa    106140
     ttccccgaac tcaagcaagt gcccatcggt ggcatcgtcc atatcgccaa tcagccccta    106200
     gaccaagccc ttcctcaact ggcagatatg gctttagagc aattccccgg cattgaagac    106260
     aagatcctag gctccgtccc tggcctcagt gatacggccc ttgggtctat cgtcgctccc    106320
     gtcgtcttca accttctagc aggggatata tttggtcggt ttgatattgc ccatagtggt    106380
     caagatgggc cagaagaaca ttatggtagg ccgatcagtg ggggcacccc tgatgcaaaa    106440
     ttcaagccag aacatgggat taagagtgcc acgagcagga gcaagcgacc agagcgaggg    106500
     ttccctcggt ttgagatggc ccctcttgaa ccaggaacta cgatacttgg tgatccactt    106560
     ctaggaaagg aatggatgag tcgggatcag gaagtgccag ggtgtaaagg gtttctctgt    106620
     ctgtttggca ataaggaacg tgcaggtatc aaaccctttg gcaatggctc tctcactaag    106680
     ttcagcctgg ggaatatcac ggaatatgat gacaaacccg cagaagccag actatggatt    106740
     gactttcaga tctgtgtcac catcctattt gagaagcact gcacagctca tatctttagt    106800
     ttcaaaacac catggaaagt caaggtgggg ggcatcttcc cgatcctcgc ccgtcgtaga    106860
     gtccaagatt actttccagg gattaacgag aaggccagaa ccattgactt ctgccaagtc    106920
     cctgacttct tagggggaac gacaacatcg gggaatagtc ccccacccca aggcgaagta    106980
     gaagcctttg aacaattcaa gtcagattca gccgccatag gcttaagctt tgaccgagat    107040
     ccccaaggtc gcttactggt gaatgaagag aatgaggatg cgaccataac ctgggttgct    107100
     caggaagcag gaacctatgg atttgaagtg aatcaagcag acaatggcac gataaccttt    107160
     aattacacgg gtgttacaca tccatcgcca tcccaaagtg caaccaccag taatgatggt    107220
     ttttcgggtg ttttcccagg gacacttcaa caccaacaga gcaacagtgg tttgcaatct    107280
     aaagcccaat ccaatggcgt tcagctccag ccgattgatg ggtcaagtgg tgccccacaa    107340
     ttgacgggca taccgggtag accaggggca gtcagtagcc agggaattac agccaccaaa    107400
     ccctcagatc ctcaacatcg tctgagacag tatctcgccc gcattgcctt gggtgaatca    107460
     tctgggggaa cggatattga cgcccatccg aatacaggag cgtatgggga atatcagttt    107520
     atccctgaga cgaggcaaat aattctggag cgttatggtc tggatgcttg gtcaacgaat    107580
     aaagccgaac gcgatcaggc ggcagtggcc ttgatccaag cctttggtga tgagattggg    107640
     acggacattc tcggcttgat tgaggcgggt gagtttgagc aagcggatca gttgctcggt    107700
     caacatgttt acagtcatgc tgggaatgta cttcggtatg gtcagttcac ctctttaccg    107760
     ggtggagctg aacagcatga gatatggaaa gaccctgcaa ttctgtctca atatggtccg    107820
     aatgggaatg cagggcagaa tccactgctg gcagcaatca atacgaattc acagcggtgt    107880
     aatcctgcgt tgttggcgag caatggaagt gtcaattttc agcaaggatc gggggtggcg    107940
     tctgggaaac tggctaaccc tttagctgac tcatcttacg ttgttacaag taattttgga    108000
     tggcgttacg atccttttac aggggacact gactggcatt ctggaattga tttagcccat    108060
     tccgctggca ccccatttag ggctgcagat ggtggaacag ttgtaatgag tcaatggaat    108120
     ggagattatg ggaatttcat tctgattgac cacggcaacg ggttggcgac ttggtatgct    108180
     cacaatcaaa ccaattatgt aaaagtaggt gataccgtag atccgggaca ggtcattggc    108240
     acagtaggaa gcacaggcag atctactggt ccccatatag attttggagt ggttgaaggc    108300
     tatgtaaaag ggaatatcca ttcagggact aacgttgacc ccagaaaaca tatcaacttc    108360
     aagggattga ggcagtaatc atgaaaaaac tactatttgc ggtagcattt ctgttgttaa    108420
     atgcattacc atcccaggct tcaccccagg ccgaggcttg cctcaataaa accattactc    108480
     agacagaatc tagcgtttca tcggctcagt tagttgcgtc tatcgagcat gatggaagcc    108540
     agtaccatta catagagggg gcatcaagta accccaggat tcctgatgca agaatttttt    108600
     tgagaacgga tcatcaaggc ggatgtgaag agattatgtc ttacctagtt ggttccgctc    108660
     catctgaaaa agttttccgg gaaaggcttg gcagtgaagt tttccttaag cttcagcagc    108720
     aggccaaggc atcaaagtcg aattgataaa cctaatatcg ggtgcgacta ctataaaggt    108780
     atgggcaaag aagttaccaa taaatttatc caaatcttcc tctaacaaga ctgaatttgc    108840
     accccacaat acaatctacc tatgttcctg ttagctccac ctagcaggaa ttttttatgc    108900
     cccaacaaac cacgcaaccc gcaccagaat acagagggtt ccacaacatt cccatcaact    108960
     atggctggct caccgtaggc tttctcagca tcgtctttat catctggctc agcaccctca    109020
     atcgacgcag aactcaaatt ccagagggaa tgccaaatgc cagagaagcc acccccaaag    109080
     aaatcaaaga agggtccaac aaagccagac tgatccgagc tgagggtgat atcgagaagt    109140
     ccgcgatcca actcaaccca gaaacaggca tcacccttgg acctatcaac cccggtggcc    109200
     tcgtctcagg caaaagcggt gggggaaaaa cggaaagctt tgcccttcgc ctgatcgaat    109260
     ccctcgcgga agatggagcc tccctgctga tcagtgacat caaaggcgaa ctcatggaga    109320
     aaaccgccgc ctatctccat gacctcggct atgacatcca ctttctcgcc cctggcatca    109380
     aagaaacctc aaagtactcc gtagaaaaac tccccttctc cggtggcctt aacctcctcg    109440
     acctgatcgc caatgatgaa gacctcgcag gcacccttga gctgacccga ggcatcaaca    109500
     tcaacgccgc cgagaactat gaacgcagac atcaatactt cggtccccag tccgaccttc    109560
     tgcaacagtc catgatgctc ggagccaaaa gcagtgaata tgccgacatg ctgatggtct    109620
     gggaactgat gggcctcaac aacatcgccg aacgcttagc cgcagccaaa gacaacgaca    109680
     agatggggaa aggactcccc tactttatga ctcatctgag ccgaggactc agaaccgtcg    109740
     ctcatagctc cagtagtgcg aatcctggtc ccaccattca atccaccgct agtcagaact    109800
     gggttcaatt cctcgaccct gagatcgcca gatgcatgac caagaccacc atccccttgg    109860
     acctcacggg caaacaagcc atcttcttcc gtatcaatga agaccagcta gaagccacca    109920
     agacctatct cgccgctgcc atccatatgc tggtgaagcg caatatcagg tatacccgta    109980
     aacgtcagaa caacctcggc gtcatcatcg aagaagccag tttcacctta ttcccagatg    110040
     cgaagaaatg gtctgcccta ggacggcaaa atggcctgtt gctgtggatg atttatcagc    110100
     aagaagaaca gatgcaggaa ctctatggcg agaagcgatg ggaaagcact gctgccaacc    110160
     tgccctcccg catctatatg aatcaggggt cctacaagag caatcaagtc attgccagcc    110220
     gcttagggaa gaaaaccatc atcagcacca cggaaaatga gtcctttggt tccaaccgtt    110280
     ctcggagtcg caatgacagc tttcaacaag tggacttgat gaccgcagac cgcttagacg    110340
     ccatgaagaa accagggcag tgcatcatcg tcgatgcctc caccaatggt cacccgatta    110400
     tctatgagaa gaaacagctt ccctatgaca agaacagctc ccaggccaag attagggagc    110460
     agtgcaaaga cgcatggcga gagaacatcc ttcccagcct gcaagaggaa catcagaagc    110520
     actttgggat gatcaatgtc caagtggcaa tggagaacag agccgcagcc gcagaggatc    110580
     tactcccacc ttcagagtat tacgccattg aagaagaagc cgctgagatt gacgcagaag    110640
     aagccactga agacaccaca gatatagacg aacaggagga tattcaagat gcagcatagt    110700
     caagaccaga ccttagagcg ggatgcagag aaaggaatgc acctggccga ggaaggggta    110760
     gaaaaagcag ccagactgac ggctgagact ctacgaatac ttagggcaca actcgctaag    110820
     tacaacaatc gagtgtccat taaatttgag tcacgagcag atgatattgc taacgtcaaa    110880
     gcagggatgc aaggaggact caagggtgta cagctcaggc agattgtcag ggcgggtgac    110940
     tcgatcaagg aagtggctca gcgagcccag tcagcggaga aagtgaagct gtatgaggac    111000
     cgggtcatgt ccagggcaca acatgagttg aatcgagaga aggtggaaca tcgtcgttcc    111060
     cagcagtcgc agcagtccca gaaacagagt caaaggcagt ctcagtctca gaatctggga    111120
     ttgtagtcgg tatcaatcta agttttaaag tcagaaataa caaatcaact accccgctgc    111180
     aagcagacga ggtatgaaat acgacttgct accaaaccgt agatttggat cgcaattcca    111240
     tttcttcgct gtaagcagcg gggaatcaac ccctactaga ttgaattata tagtctaaga    111300
     aaattgaaat attgcaagtt tacttgccag agagttcgca agtgaaaaac gacaattcct    111360
     gattctagca gcagttattt tcgatttatg gttaattagt tcagtaaaat actcaatttc    111420
     atttaaaata ctccttttaa aatcttttga atgccttatt aaacttagcc tttaagattt    111480
     ttatcatccc tattacaacc tatttagctt ccagagaatg cttaaaattg cctcaaataa    111540
     tttttaataa tatcctggtt aaataatagg taaaatattt taactaaaaa tataattttt    111600
     ctaggagttg aaatacatag ttatgccaat agtgtatgga aatgctggta aattttttgg    111660
     aaattactgg tatatgaatt ttaactttga ttttgagctt ggtgatgcat cagaagcttc    111720
     tggaaatagt ggattttatc taattcatgc cagcagatta gtttctgtta agcctatagg    111780
     gttttgccta gaattatctg aaaagccatt aaaatatcaa gttgtttatt ctagtggaca    111840
     tactattcaa tcgtatggtg atcagtattt ctacgataag tcaccttcag tttatagatt    111900
     agagaaaaaa gccgattttg actactcttt acttatgcct gaagaaggag gcaatgggtt    111960
     tcaagcacag cctcatgtag taggagatgg tttagtggta tacggaacta gcacaggtaa    112020
     tgcatttgtg ctaacgggta cagagggagg aaacccccat ttaaccttga agatatcacc    112080
     attaggtgtc gaagttggaa atggctagaa aaataacaag gtctttgaaa tatcttcttc    112140
     taaaatgaag aatggtttta ataactttat tataatgaag tgagaaaatt agattcctta    112200
     aaatattgtc aatgacctaa attagacctc ttgtagaatt gatctaacga tctgatttaa    112260
     gatagaaaac ctaaatttag atcgcagtat aaattttttt gttagctcat cactaaacaa    112320
     acattgcaag aggtctattg tccaaggcgt aacatgaact gaattgcgag aaggttgaac    112380
     atcgtcgatc ctagcaacca gaacagtccc agaagcagaa tcaaaagcag tcccagcccc    112440
     aggattttgg gttgtagatt tagggctttg taatcgattg ctgctgtact tgggaaatct    112500
     aaggatgcag atgcgggaac taactaaatt aaaagcctga cgtcactagc ttggaaaatc    112560
     acttcacaaa aatttaaggc taaatatcgc cttaaatatt tgcatatagg ggtttcaatt    112620
     atcaggtgtc ttataaccgt agttttacga agattaacgc gatgaagcaa ccgaaatttg    112680
     atgaaaatag tagtgaccaa gagacctttg caccatttat ccttgataat tgcatgaatt    112740
     cagaatggaa agatgtgagg cttatctttg gagaatggga atggtttgag gagaactttg    112800
     gaactgaaac attcgacgga tactatttca acggctatgg gctgcaaggg ctggtgatgg    112860
     cagtacgtct tgatgcaaac ttggatgttg agccagagac cattcactac aattcagaag    112920
     gagacatttg caatatccac ttcacagaaa tggcggaagc gatcacaact gccaaccttg    112980
     cctcggaaat gattaaggac aaggcgcaat tgaaacgagc gatccaagtt gcgagagaaa    113040
     atggttttga agattgaaag cagtaagcga aaagcttctt aaatagtgaa ttttcgaagt    113100
     ggtaaagatg aaaagggttt tagacgacaa ttttcattga ttacctctat gttcagagtg    113160
     atatacgtca ggtttcgtat aaatatagcg agcattcaag tatgaccgat aagatcgacc    113220
     tgacttctca aattttagaa ttcaggaaca ttggactgcc cttgatagcg atccgatagc    113280
     tgcattcacc taatcaagac atgtatcaat gaatattctt aaaaagataa ttggatttgg    113340
     tttattaatt tatagcgttc caagagttgt gcatgtaatg aagcaggtta tcgagagtgg    113400
     tggtgatcct caagcaattg gagccgctac cgcgtccgtt ttatttgtcg ccattggcct    113460
     ttggctactg ttctcaaagg ataaggatag aaacccttca tgaaggaagg ttgtgactac    113520
     ccctcagaat tctcataaaa cccttatagc cttctcagtc aattacaggg aatcacccag    113580
     ttcgtcatca ttccagcttc agacacccct cgtacattga agtcattgaa gttggagaac    113640
     aaacatgaaa cgcattcatc aaaccgcttt ttcagtctta acaagcttta ccgtcctcag    113700
     tattggcctt gcttcctccg ccctagctga aaccatcacc gtgacccgtg gccccaatgg    113760
     tgcagcccat caggtcaaag tagaccgtat tcctcaagat gctcaagtac gatctgaaac    113820
     tcctaccacc ggatttccta acattgtcac ccgtggctct catggtgcgg ctcacatcgc    113880
     taaaacggac tcagaccgtg acacaactgc tcagtcttcg gtaagacgtc aagttatcac    113940
     tcgtggcccg aatggtgcag cctacattgc caattaggtc atgagagcaa caacgagctg    114000
     acccagagtc cttcattccc cccaagagct gattgcaagt tcacctcacg ttgcagtcag    114060
     ctcttctctt cgtcacaatc tccctttttt ctccaacaga ccccttacga ctgaggggac    114120
     aactccttag tcgtgggttt ttctttaaac cttcattaca cagatccaaa tatcctcgca    114180
     ccttaagtac aaaaggctga aacctcaaac acagttccca aataacgatt tgtccctccc    114240
     aggtcatctt gcctatgttt cataggtaaa cctcgcgagg gttttaaatg tctaccttca    114300
     aagacctata caacacggcg aaggaggccg aggatgtcgc ctttgccctg tccccgatcc    114360
     cccttggatt cgtcaagagt gggattcaaa acgtcggtgt gcccttagtc gtatcggctg    114420
     cggccaccca tactccattt atcgccccag tcgcaggtgc tgccattcaa tgggggagtg    114480
     atgcccttca gtcaggcacc catactctag cccaacaggc catgagtaac tttggggaat    114540
     ccgtcatgtc tggcctaccc gcctttggtg ggattcaaac cagctttgat tggatatcat    114600
     ctcagtccgc tcaagtcgcc ctagcaggtc aggatatggt cacccatgcc gtgggtgccg    114660
     tggggtcctc cgtcatgttg ggtcgcaccg tcaccaattc agccgtattg acctttcaaa    114720
     aagtcaggca tataaccgtg ggcgaagtga tcgctagtgg tcaacgggcc ttagagcggt    114780
     cccaagaatt cttggagaat gccgccagtt atgttcgcca aaccgggata cgagccgaat    114840
     tatttgtaga acaggagttt gcaaaattgt ctaacaccga agaacagacc actaacgttc    114900
     aaccgactga atctccagag caagccaccg tgttcgccac ggataaaacc caaggtgaag    114960
     cagaaactca aatcaaatct gcggcccaag tcgaatcaaa cggcacccag cccgaggtta    115020
     actatcagcc ctctgagaat ggcaatagtc atacagagaa tggcagacag gccaatatct    115080
     ttgaggcggc agtggaaagc gctgttaatg tagtcaatcc gattcgttct gaatcttctc    115140
     aagaggcaga agattatgtg ttgggtctgg tggataagtt agccgctggc aatatgaacg    115200
     tggatcggct gtatatcaag atggatggca ttgacatctt caagatgaag aatggtgccc    115260
     cggatccatc aacctcgatc acggatactc aacgagacgc cttgcagcaa gccttggaag    115320
     accccgcagc ctttgggggg aatctggtga ttaagcaggg caataaagtc ttactgaaca    115380
     tcaaggacgg tcgaatactg cacaacccaa tggggttagc taagcaatct ctgagtgctg    115440
     aaatggaaac gaaggaacac cttcaacagc aacagccaga ggctaaacaa gcggcagtgc    115500
     ccaataatcc tgctgagggt ctgtggtcga agtatggagc caatgtctca cctgatttga    115560
     gaggggctag gctagcgacg gaaaatgcct taaaggatgg actgaaaccc aaagaagcgc    115620
     gggcgatgtt ggcccaatcc gctcacttcc aaggtcttaa agccgataaa ggagcatcag    115680
     ttgcagaaaa agtgattgcc cgcacagtga agactgctca ggctagagta gcccagcaac    115740
     agcgacctaa gcagaaagta cagcagaagg aggagcaaaa gcaggcagca gtgatggcac    115800
     cggggctttg attttcatag atgaattaac tagtgaaaac ccttggctct tcttgagttg    115860
     ggggtttttg tcataaaaag tagtacttag agaagtgctc aagtgacttg ccgtaaagat    115920
     gcttttcttt tgctctaacg aaaatggtca ggctgtatgc ttaagaagct gcgtatctta    115980
     agaaaatctt aaattaaggt ataaatcagc cattataccc atctaaagtt attggtggtt    116040
     ttaaaactat gtctcctccc cttatgcgcc gtctctggca aatgattgaa tcgcttcccc    116100
     aacactccct tgagaaactg gatgactcag gtttggtagc ttggttgcta tcttacttag    116160
     aacgtcatca ccacctaaaa acggacgaac ggaaagccgc tgaaagttat ctgaataacc    116220
     atatcctgtt gattcgtgat attgctgaat cacgtcaaat ccatcactgt cctctcgcgg    116280
     gctgattcac cataaataga ttgggtaaaa gctcaaggtg cacaacagcc catctatgca    116340
     acatcgccag cgaatgaaac cctagaggct caggaatagc cctacaaaaa agctaaacag    116400
     gatcatataa agccataaca acttcatcaa ttgacgtatt ggcgctgtta ttttcctcgc    116460
     catgggcaaa aaagtagatt tatcatcggt agaatgtcat gggaaagagg cataagtttt    116520
     gccgatccat tttggacatt caaccttctt cgctattact ctctagatga gaaataagtt    116580
     aagaaacata aatcatgagc taacactact catctattag tctgtaaggc taccctttta    116640
     gatatccagg ctgtttcatc gaaaatctaa aagtcaatcc ttgaaagcaa gtcttcatca    116700
     gcagaaattg actttggcac aaaattttag actcaatata agatgtagag atcataaaaa    116760
     tattataaag gtactcatta agaaactata gataagttaa tattattgcc ataataaaca    116820
     cgacaaatca ttcttatata gatttgtctt gagagaggga tatccctttc taataaataa    116880
     tgctggccag cttataaatt tttgcttaga ctattcgtca agccagccct aggtactcgg    116940
     atccaagggc tggtttgcca ttaatgatga ttaaaacgct tgagcctaaa cagaaagacc    117000
     tcatattttg cagttaccgt aactcctcgc ctcgggttga ggtggtacgg gtcactaata    117060
     tcgtgaactg gtactttgaa cgggttgttt tcccacaaca gcatctaatg ttcaatgcac    117120
     ctcgaaaagc acaccttgaa atccatagca gtgaaatcgc cacagctatt caggtggatt    117180
     gcattccctg tcagcgatta cgtgtaaaaa cagcttagtt gatctggggg ggaatggaga    117240
     tgaactgtac ccagatgcta acagagtact tgctccatca atttccatgg tggcggggga    117300
     gccaattgcg ctatgaaccc gccagcaaga cggtctatgt ttactgtaag tacatgcgtt    117360
     atctagaaat tttgttgcat gaggtcgaga ctatttcccg actagatatt ggagtggaac    117420
     gattcatcgt cacggtgcct catgagatgg atatggtcgt taagtgtcag ccaaattcgc    117480
     agcctgagat tctgtaagct caggtttcaa agggttttgt aaggttacac aaaatcagaa    117540
     gtgtatttac cctgcataaa aataggcttc tctgtttcca caaatcttat attgagtata    117600
     gaaaccccta tcaataaatg aggagcatta ctttagacac ggatatttat ttgggaaaac    117660
     taaaatcata gaagtatata aataaatatt ttgatgttaa gaggatgtat gaaaagtctc    117720
     atctaacaaa gaaagctctc tcggcataag ctgtaggttc taacaaaccc gcaccgagtg    117780
     agccatgagt aaagcatata gtagcaacct aaccctatcc caatatgaac tgatagcccc    117840
     tctaattccg ccagccaaac ccggtggacg tcctcgctcc gtaaatatgt gggcagtcct    117900
     caacgccata ttttatctag tgtcacaagg ctgtaaatgg cgagacctcc cgggggattt    117960
     tccctgctgg tcaacggtct atacctattt tcgcaattgg cgaatagatg ggacttgggt    118020
     caaaattcat gaccggttgt gcagttgggt cagggctgat aatgatcgtc ctgccagccc    118080
     atcacaagcc attattgatt ctcaaagtgt ccccacagca accatggtca atcaagcggt    118140
     gggctttgat cgtgccaaat acaccaaagg gcgaaaacgg cacacagcag ttgataccct    118200
     cggcttagtt ctacgggtgg tggtcacggc agcaagtctg cctgagcgtg aaggtggcaa    118260
     aaaggtcctc actgcagtcc atcagatggc agaggcggtc caacggctct atttgatttg    118320
     ggcagatggg gggtacagcg gtcaaccttt tctccagtgg gcgatggaca attttcgatg    118380
     ggtgattgcg gttgtactca gacctgagca gaccaagggg tttgttctgc tcaagaaacg    118440
     ctgggttgtg gagagaacgt ttggttggtt caattggtat cgacgattga gtaaagatta    118500
     cgagcgatta actgattcgt cagaagcgat gatttatatc tgcatgattc gactcatggt    118560
     caggcgattg gcctaaaccc tgagaggctg atcacttttc atacatcctc taaagataat    118620
     cgccagtatt ttgtcgggat gtgctgttct gacactagca gtatgtgatg ctcctagttc    118680
     tgtagcttct acacagagca ttgagataac tgagcaaatt caatctaata tctctgaata    118740
     tgacttattt aatcgtgctc ttagaaaata tgagcaagga gattataaag gtgcaattgc    118800
     agattttgac caagctattg ctcttaatcc tcagaacgta atggcctata ttcatcgagg    118860
     gtttacctac gatgatatga aagagtactc caaagccatt gcggattttg accgagcaat    118920
     tgctcttaat cccgaactgc cagcagccta tggaggacgg agtgctactt atttctcttt    118980
     agacaataca tcgcaagcaa agcaagatct ggagactgct gcaaagcttt tgaaggagca    119040
     gggggagcag gcgaaatatc aggcaatgtt ggatattctg gattacctct aaatactcca    119100
     gtatggagtt attctcttca ttcggtttca agaaaatttc tgaactagac cttatcatct    119160
     aacatttgtt ctattgttgc tgataacgcc cagcctgttg gtgcaatagc ccatattgag    119220
     atgcgcaggt ttgaggttaa ccagatagag gacattgcac gagggaatag ggcaattcaa    119280
     ctccctatcg gttgagcaaa cccatacttt tttgatgcat ggcctgaaat ttcaagcatt    119340
     gaaattcaat catgacttga tattttcgat gagtcgcgaa taccagatca tggcctcatt    119400
     gttgcactgc tattgagatc gcaaccaaaa gatgcggatc ccccaaagag cccaggatgg    119460
     ccagtaagat ttagcccatt gtttcgtttc ttgcctatcg ccctgggctt gatcctagtt    119520
     ttttgcgatt actcttggca ggtgaaaccc cagaaatcag cttatcgacc taaattcagt    119580
     tgtcgataac ccatcagtct tcgaattcca tttagaaccc cagtcggtaa cttaagaagc    119640
     acatactgat ggagtagcat cagggtatca gggaaggttt ttttaaagcg catcgaccat    119700
     cgacccaagg catcggtcac cgtttgagca ctacttttcg ttgcataagt tgtggtcccc    119760
     gtgaagccaa tatgcttgaa atccttggat tggaataaat atttatccac aacccgtttg    119820
     ggtcctaaat aacccatcag ctgattgaac ggactactgg ttgaatcatg aaatgcaatg    119880
     attcccccat ccacaacaaa tcgagaccaa agcagaaaat cttgctctac catgtcatgt    119940
     tcatggttgc catcaataaa cagcataccg ataggttgtg tccatccttc acaggcatct    120000
     gctgatgttt tcacaatggg agtgactaac tctctaatcc cagcactcga cacattatgt    120060
     tcaaactctg gataagaatc ttcttgatgt gggtcgatcg catagatatg aacgttgtta    120120
     cctgccgctg agccttggct gaggcaaatc gttgacttac ctttccaaga accaatttcc    120180
     acgatcaccg tgccaggagg acaggccttc gcctgcgagt acaggaattg agcttctgaa    120240
     tcagtaagcc atccctttac atagtcagga atgtttggag taatcatttt tcaaactttt    120300
     tgattaataa aaatgtggct ctccgggaat tagcgtggta gccgctagat atagtgttta    120360
     ggtcacagcg aatgtctgat acccattgag gtcaagagaa atcctttgga agagtctttc    120420
     aatatcgaaa ataccgtagc atcgtctttt taagactttg actcggttat taaatccttc    120480
     cactattaga cgacaatcga gctgacggat taatgacgat gtcacgtcgg ctatagctat    120540
     gaagaaacca ggcatcccct gagaaggata aaactagatc tcaattccct agaaatgatg    120600
     tgtgagatcg cgtttctaga attcaatctc aagaaaaaag acacttttta catccctaat    120660
     caatagaggg ctgtacaagt gcctaacaaa aga                                 120693
//