Dbfetch

ID   CP000844; SV 1; circular; genomic DNA; STD; PRO; 155110 BP.
XX
AC   CP000844;
XX
PR   Project:PRJNA12997;
XX
DT   29-OCT-2007 (Rel. 93, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Acaryochloris marina MBIC11017 plasmid pREB7, complete sequence.
XX
KW   .
XX
OS   Acaryochloris marina MBIC11017
OC   Bacteria; Cyanobacteria; Synechococcales; Acaryochloridaceae;
OC   Acaryochloris.
OG   Plasmid pREB7
XX
RN   [1]
RP   1-155110
RX   DOI; 10.1073/pnas.0709772105.
RX   PUBMED; 18252824.
RA   Swingley W.D., Chen M., Cheung P.C., Conrad A.L., Dejesa L.C., Hao J.,
RA   Honchak B.M., Karbach L.E., Kurdoglu A., Lahiri S., Mastrian S.D.,
RA   Miyashita H., Page L., Ramakrishna P., Satoh S., Sattley W.M., Shimada Y.,
RA   Taylor H.L., Tomo T., Tsuchiya T., Wang Z.T., Raymond J., Mimuro M.,
RA   Blankenship R.E., Touchman J.W.;
RT   "Niche adaptation and genome expansion in the chlorophyll d-producing
RT   cyanobacterium Acaryochloris marina";
RL   Proc. Natl. Acad. Sci. U.S.A. 105(6):2005-2010(2008).
XX
RN   [2]
RP   1-155110
RA   Touchman J.;
RT   ;
RL   Submitted (25-SEP-2007) to the INSDC.
RL   Translational Genomics Research Institute, 13208 E Shea Blvd, Scottsdale,
RL   AZ 85004, USA
XX
DR   MD5; 856d344c85b6811042b54cc92f6e2653.
DR   BioSample; SAMN02604308.
DR   EuropePMC; PMC2538872; 18252824.
DR   RFAM; RF00442; ykkC-yxkD.
DR   StrainInfo; 373281; 0.
DR   PubMed; 18252824.
XX
CC   Source bacteria from Marine Biotechnology Institute Culture
CC   Collection, Marine Biotechnology Institute, 3-75-1 Heita, Kamaishi,
CC   Iwate 026-0001, Japan.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..155110
FT                   /organism="Acaryochloris marina MBIC11017"
FT                   /plasmid="pREB7"
FT                   /strain="MBIC11017"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Acaryochloris marina"
FT                   /db_xref="taxon:329726"
FT   gene            complement(join(154917..155110,1..1117))
FT                   /locus_tag="AM1_G0001"
FT   CDS             complement(join(154917..155110,1..1117))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33181"
FT                   /db_xref="GOA:A8ZM10"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM10"
FT                   /protein_id="ABW33181.1"
FT                   /translation="MSASRSPEPTIGFVDEYCQLFAELFPQVRSYEAFKHLHLGMISDI
FT                   KRKSLPAIARAVGLENHQSLHHFLSESPWVASHLSDKRLDIILKILDGRRLILLIDETG
FT                   DCKKGKSTDYVKRQYIGNVGKKENGIVAVTAYGLFQGMILPLSFEVYKPRERLKEEDEY
FT                   LSKPQIAAGMIRQLQGMGFCFELVLADSLYGEAQTNFVNVLEELKLPYILAIRSNHAVW
FT                   LPAEQAVFAEPWQSFERTFSNGTTETRYRQEIIYGQRHHQKRYWLLTTDPQTLPENSTS
FT                   YVMAAAPEIKLDEIGDCYGFRTWIEYGLKQSKDTLGWADFRMTHYEQIEKWWEIVMSAF
FT                   LMVSLFADVFNDSCPVAHQHFAQHPWWDNQNGWKNLLNNVRLIIQPLISWNLLKRWLEV
FT                   FPSRALKKGFEQLTSKMEAFCCPLVRKLLKHPDFLSV"
FT   gene            complement(1279..1422)
FT                   /locus_tag="AM1_G0002"
FT   CDS             complement(1279..1422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33182"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ96"
FT                   /protein_id="ABW33182.1"
FT                   /translation="MHFNNELKKPVFISRVTINQIPLHNVSGPKPSVLFRWHQTKGKRD
FT                   TR"
FT   gene            complement(1612..2733)
FT                   /locus_tag="AM1_G0003"
FT   CDS             complement(1612..2733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33183"
FT                   /db_xref="GOA:A8ZQ97"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ97"
FT                   /protein_id="ABW33183.1"
FT                   /translation="MKYIVDISNILLLIYCAKVLKELIEQRKEFCDDKITYNDLKLAKQ
FT                   VVIFFLLPLSVPIHEFGHCLAVWHFGGIVTDFQWRFFWGYIKKIGIFYQTDQWWVSLFG
FT                   NLLSFFTAIICIPFFQRIRKRIIAEIIYFYIYIQLIFVLIVYPISSILLQFGDWLIIYN
FT                   FEIQPHASLIVIAQIILLICFWCFDSSRWVVNWRLSRESHIKTGLEKIIRKLEDSGDIE
FT                   NHLNLIYFYFSYDEHRAAKRHARKVCHTWNKDKRIEILKVIIKYHNKKYKKAIKDCWSL
FT                   LEKNYVDKDKVTLYRVLSLSMSELEQYSNALTCIDRGLEIDPNDFKLRYYRAFVLEDIG
FT                   EFEAVKESLIFAREVAQSDRDKEMIDQWLKKYE"
FT   gene            complement(3094..6879)
FT                   /locus_tag="AM1_G0004"
FT   CDS             complement(3094..6879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0004"
FT                   /product="haemagglutination activity domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33184"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ98"
FT                   /protein_id="ABW33184.1"
FT                   /translation="MQPAHAQSIVTEPNGTQTIVTADGKRFNISGGSLSGDGANLFHSF
FT                   KKFGLSQGEIATFLSNPGIQNILGRVNGGDASIINGMIQVQGSNANLYLMNPAGIVFGP
FT                   NATINVPADFRATTADGIGFEKGWFNAVGDNDYAALEGTPQSLLFNTDQPGSIVNAGHL
FT                   AVAKGQNLSLIGGTVVNTGSLSAEGGQVTLAAVPGQRRVRINHPDMLLSLEVNQLDPDT
FT                   TENARAVSLSELLTGGDIPVATGVEVDAEGRTWLLNTPVVNGDVAIAGDVTGNQVQLAA
FT                   ANRINVMGDSEKLITTHNGQHSAPIVTRFNADGTNANELVFLDTTVPDYQRLLFGTEAG
FT                   TTTVAIPVSENGIERVTSVLQQVGAVDAVHIVSEGDEGEFWLGNAYVSNETLDKYKAHF
FT                   QQWGGLLSTEADILIYACLTARGPEGLALLNKIAELTHADVAGSTDLTGDTARGGNWIL
FT                   EQSIGSIETGSAFEATTLADYTGLLQVFTATDAASLIAAINTANGNTETDTINLANNIT
FT                   LAAVDNATNGANGLPSITAPEKLTINGMGNTLARDTTAPDFRLIHVALGAELEVNDITL
FT                   TGGIANSGGQGDDGGAIHNRGTLTVNNSIITGNTAADDGGAISSFNTTANAVTVTINNS
FT                   TLSGNTAMGNGGALSNTSFTGAGPNSTVMTVNNSTITGNNANVGGGIAQLGQNANNSAV
FT                   VIVNNSTISGNTVVFGGGGIYNRGQTSLLGATITITNSTIVQNEVTNPGSSSGGILNLN
FT                   FLGGANTARVTVANSIIALNTATVFPDVRRASATNSPIIDGGNNLIGVDNQGIFTTSTL
FT                   VGSVATPLDPMLLPLGDYGGPTQTHAFFLDSPALNAGSDALAMAATLTTDQRGANRFNG
FT                   TVDIGAVESQGYSLAVTAGNNQTTTVNTAFTTALEAQVTENFANSPLPVSGLNVTFTAT
FT                   PSPTGATGSFNGNPTTTVVTNATGVATAPTLTANTVAGSYVISSSSGTLTPASFNLTNT
FT                   PDVPALLTISGGNDQSTTVNTAFADTLDVTVTDQFGNLVPNTTLNYSAPNTGASSTLSA
FT                   TTATTDSNGVASVSATGNTVAGSYVISSSSGTLAPVSFNLTNTPDVPALLTISGGNNQS
FT                   TTVNTAFANTLDVTVTDQFGNLVPNTTLNYSAPSTGASSTLSATTVTTDNNGVASVSAT
FT                   ANDTAGTFTVTATGVGVTAGNFTLTNSPIAPTTPDIPATEFLGFWTDLQELSKTSDVAC
FT                   GAVPTVNLEVDIDIPDVQGQTPPPEESQQALGADCP"
FT   gene            complement(6845..7018)
FT                   /locus_tag="AM1_G0005"
FT   CDS             complement(6845..7018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33185"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ99"
FT                   /protein_id="ABW33185.1"
FT                   /translation="MSIQICFHNGHTQAQLRSKSSLSKGCYETLAYTQTSIATVFGSVL
FT                   MDAASPRPIDCH"
FT   gene            complement(7106..7222)
FT                   /locus_tag="AM1_G0006"
FT   CDS             complement(7106..7222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33186"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQA0"
FT                   /protein_id="ABW33186.1"
FT                   /translation="MQLVSATLQLGQSDKNLGLLPKLRGFYAQKLAIKTHYI"
FT   gene            7752..10820
FT                   /locus_tag="AM1_G0007"
FT   CDS             7752..10820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33187"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQA1"
FT                   /protein_id="ABW33187.1"
FT                   /translation="MALFCDRIAITAITLTVFYSLPTIAEPQPSTQASDLRFSPRFGIG
FT                   ANSPSSGTNTTTRLETFVPVWQKPGRALTFFEGRLLLDDQGNPGGNILFGFRQYSDDLK
FT                   RIFGGHLGFDIRNTDNNTFQQLSLGIESLGKDIDLHLNGYWPVGSTRRQTRQRIFEVLQ
FT                   LNGDPRFTGNILLLDLLRRRLITRQFEEALAGVDFEVGKQLLSFKNGGDLRAYLGPYFL
FT                   HSSIRGNTIGGRLRLQVRPTPNISGGIGIQHDDFFGTHVLGNITFTLSVNQPQSPVSPA
FT                   NNVVARMGDSVIRNNSIIVDTPNTTELLETETQTVAAMNPTTGEPWFFHHVNLGLGNSD
FT                   GTFESPFPSLEDALGVIRGDGNDIVYVANGINSGIEGFTIPDKVQVRSRGAVQQIDVNP
FT                   ISFPLRPESVLRLGQVQLPFSGDSSFPRITSTVSLGNNTLLSGFDVQVTGAPALVANNI
FT                   TTATVIDNSLASTNSTTNGISINGISGSLNLDNNAINIDNPAMAGVDISNVSASTGSVR
FT                   IVGTSGSRIQRTGRDGVVLGNNTTIANLNIAPLPNNVDFSGNRGIFGRNVRNVRVQNNQ
FT                   IIVIGRDFSPGIKLENITGSAEIINNQITRNPIFVDPAAPGISHGISLSLSNINLDRVV
FT                   ISENTIKTTGISTDGIVIQSLNDSAIQSVTISGNTIETNGVQSDGIVVQSSNNSTIQSA
FT                   NISGNTVETAGLNSQGISVRPIYNSVITTATISGNTVSTDRIFSYGILVEPFNKSTITT
FT                   ATISENTVSTTGIADGILLRPGYNSAITTTTISGNKISTAGLISDDMVLRPFFTIPSTT
FT                   ASINIRPTTNSVISTAIISGNTVSTTGLAYGINVQPSQNGTITVATISGNTVSTDRFNA
FT                   AGIRVQPYIDSTINKATISGNTVSTSGKNADGILVRPVGNGAIQSATISNNKILQAGRD
FT                   SVRIQARQDSLRIGNYDVNPICAAISGNRSDNPNVAMAGGLDFNLISARSPFQVESLTT
FT                   VSLDNNNAIFSFDGTLVPPGTPSSPFTNVVSCP"
FT   gene            10957..11115
FT                   /locus_tag="AM1_G0008"
FT   CDS             10957..11115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33188"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQA2"
FT                   /protein_id="ABW33188.1"
FT                   /translation="MFKTRVTEHPSFLHNLKTTFQKPSYSSKGILVVISTPNNPSYLYY
FT                   TKTYTKK"
FT   gene            complement(11186..13147)
FT                   /locus_tag="AM1_G0009"
FT   CDS             complement(11186..13147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0009"
FT                   /product="TPR repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33189"
FT                   /db_xref="GOA:A8ZQA3"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQA3"
FT                   /protein_id="ABW33189.1"
FT                   /translation="MGGIGKTELALQYAISQLNQGHYPGGLCWLRVKGQELAAQIIEFA
FT                   RTKLVLTFPDGLDEEKQVSYIWGHWPTGKVLIIFDDVMDLETIEPYLPPSDPQYKVLIT
FT                   TRQDLGLSVHSLPITELSDTSALSLLRTLVGAERIDPQLDDAQALCRWVGNLPLGLELV
FT                   GRYLANKPDWSLHKLIKRLESKRLDAKALTERESGMTAQFGIAAALELSWVELSEAEQE
FT                   LACFLGMFAVAPIPWTLVESCLSEQDPDALEDTRDDGLIARNLLKRVVQGTYKLHQIVQ
FT                   EYFRIKLNQRPDQGKPLKAAFCIGMVVAAKEIDESPTIDVIAQMSAKIPHLEELINQWV
FT                   DSLNDDELIWPYVGISRFYAGQGNYGLSLPWRQKCLEQTRQRLGSEHSDVATSLNNLAF
FT                   LYVNQGRYIEAEPLLVQALEMSQKLLGSEHPDVAQSLNNLALLYFNQGRYSEAEPLYVQ
FT                   GLEMSKKLLGSEHPDVALSLNNLAGLYKNQGRYSEAEPLNVQALEMRQKLLGSEHPDVA
FT                   QSLNNLAGLYYNQGRCSEAEPLNVQALEMRQKLLGSEHPDVAQSLNNLALLYNNQERYS
FT                   EAEPLYVQALEMKQKLLGSEHPSVVISLNNLAGLYNNQGRYEEAISCFQQALSIAVVTL
FT                   GLEHSTTMAIRNNLESLL"
FT   gene            complement(13351..14448)
FT                   /locus_tag="AM1_G0010"
FT   CDS             complement(13351..14448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33190"
FT                   /db_xref="GOA:A8ZQA4"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQA4"
FT                   /protein_id="ABW33190.1"
FT                   /translation="MTAQTILVLAANPKDTQPLRLDQELRDIDEGLQRAQHRDEFQLEQ
FT                   RLAVRPRDIQRAMLDLNPQIVHFSGHGEGDEGLVFEDVSGNTQLVSGEAIADLFSLFAD
FT                   QLRCVVLNGCYTEVQAKAISEHIPYVIGMKRAIQDKAAISFAVGFYDALGSGRDVEFAF
FT                   NLGCASIRMEGIEEHLTPVLIKKPVTEETKNQDKSNAQTPPTPTPSPMNPDANNPLEVF
FT                   ISYSHEDDDLRKELVTHLSNLKRQGKIADWHDRDIEAGEEWKTKIDSHLESAQIILLLV
FT                   SPPFMASDYCYDIEMQRAMDRHNEGTARVIPIILRPSDWQGSPFSKLQILPKDAKPVTK
FT                   WADRDEAFLDVVNGIRRAVESLTKK"
FT   gene            complement(14584..18279)
FT                   /locus_tag="AM1_G0011"
FT   CDS             complement(14584..18279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0011"
FT                   /product="WD-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33191"
FT                   /db_xref="GOA:A8ZQA5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQA5"
FT                   /protein_id="ABW33191.1"
FT                   /translation="MDETPQIIHFAGRGEGEAGLFFEDELGNPKLVTGAALAGLFTLFA
FT                   EDIHCVILNGCYTQEQAQAIAQHIDYVVGMQQEISNEAAQAFAVGFYDALGAGRDIEFA
FT                   FELGRSAIQIEGFPESHTPVLVQKSSIQTEPLQPLSEQPPPEKLWRVPELPPHFLPRPQ
FT                   TLKALREKVLNNLAQPVVMTGHQQRIGVQGMGGIGKSVLAAALAYDPQVQAAFPDGIYW
FT                   LTVGIEPNLLAQQTDLAEALCGERQVFEDINEGKTRLQTLWQGRQSLLILDDVWRIDDA
FT                   EVFNVLGHQSTLVVTTRDSELITGLGATDFSLSVLNDDQALELLAAWVGVSISELPSQA
FT                   QAVARECGNLPLALAQCGAMVRDLTPWPHVLSALQDSDLEFIQKQFSHYSYPDVFKALH
FT                   VSATVLAETNPIAAERYQELAVFPADELIPEAVIVRLWQYTGALKERDAGKILTTLSSK
FT                   GMLRLEGDYPQRQVSLHDLQQDYLQAQQADEKALHQELLEAYQQSCTEGWHRGPKDGYF
FT                   YEHLAHHLKQAERTDELRQLLWDYRWMQRKLGVTDINALLLDYETLPRDKDLNIVQSGL
FT                   RLSSHVLNQHPEQLRSQLYGRLLSQNSPDMTALTQSLAQGQGECWIRCLFPHLNQAGGA
FT                   LVRTLTGHTDSVTGVSISPDGQTVVSASRDHTLKVWDLATGEELRTLTGHTNFVRRVSI
FT                   SPCGQTVVSASRDKTLKVWDLETGRELRTLTGHTSSVTGVSISPDGQTVVSASSDNTLK
FT                   VWELETGEEQRTLIGHTSSVTGVSISPDGQTVVSASLDKTLKVWDLETGNEQRTLKGHT
FT                   SSVFDVSISPDSQTIVSASRDKTLKVWVLETGNEQRTLTGHTDFVYSMSISLDGQTVVS
FT                   ASLDNTIRVWSLKTGNEHGTLTGHTDFVRDVSICPNGQTIVSSSSDNTLKVWSLKTGNE
FT                   HHTLKGHTSSVTGVSISPDGQTVVSASRDNTLKVWNLKTGKKLCTLIGHTEYVTGVSIS
FT                   PDGQTVVSASRDNTLKVWNLKTGKKLCTLIGHTGSVTGESISPDSQTVVSASGDNTLKV
FT                   WDLATRQEQRTLTGHTSLVTGVSISPDGETVVSASGDNTLKVWGLETGEEQRTLTGHTS
FT                   LVTGVSISPDGQTVVSGSWDNTLKVWDLATGQEQRTLIGHTSLVTGVSISPDGQTVVSA
FT                   SGDSTLKVWDLETGMEVMSFTGEGAFRCCEIALDGCTVVAGDYGGQLYFLRLEGPNFTG
FT                   DGEVIS"
FT   gene            18778..19305
FT                   /locus_tag="AM1_G0012"
FT   CDS             18778..19305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33192"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQA6"
FT                   /protein_id="ABW33192.1"
FT                   /translation="MPLPPNPICLQCIDYSRREAKRVHGPQGDGCWTDNRCDRKRHHYR
FT                   HRKESNAKRRGEYANQKAITTPAKTTETFSIPVQAPPVALLYLYKEKPKDAHLHALAVS
FT                   VWQGSEKLAEIETVHCMGMTNTQVNRYLKEVLQVLRERYGITEFEPPIRMEPSECEISD
FT                   CPLKDKLHVQTA"
FT   gene            19289..19474
FT                   /locus_tag="AM1_G0013"
FT   CDS             19289..19474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33193"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQA7"
FT                   /protein_id="ABW33193.1"
FT                   /translation="MFKQLELDFASTLASALDEPEQADISLMCASLDQHLQGRSTHEQL
FT                   RLAGKKLSRVQTPRMD"
FT   gene            19687..19806
FT                   /locus_tag="AM1_G0014"
FT   CDS             19687..19806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33194"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQA8"
FT                   /protein_id="ABW33194.1"
FT                   /translation="MFVAKRQKNKGIHCSEASADALAAMKTVKLNQTWEHLLG"
FT   gene            complement(19881..20285)
FT                   /locus_tag="AM1_G0015"
FT   CDS             complement(19881..20285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33195"
FT                   /db_xref="GOA:A8ZQA9"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQA9"
FT                   /protein_id="ABW33195.1"
FT                   /translation="MASVYSKLDLAPKGKRLTNLILDYIFFFLFAFIVGLLFGIMGLEE
FT                   VILNMNDVLLGLILYTTYYVSLECLFGKTIAKFITKTKVVTISGKKPGFSSIFVRTLCR
FT                   LIPFEAFSFLGDDLYGWHDSFSKTRVVAFR"
FT   gene            20423..20548
FT                   /locus_tag="AM1_G0016"
FT   CDS             20423..20548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33196"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQB0"
FT                   /protein_id="ABW33196.1"
FT                   /translation="MGNNSGFSIKKQYYRCQNQNFSRVTFFLKLLLSNDISIHKF"
FT   gene            20852..20965
FT                   /locus_tag="AM1_G0017"
FT   CDS             20852..20965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33197"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQB1"
FT                   /protein_id="ABW33197.1"
FT                   /translation="MAGFAFSSYVDRSIAGWLSGGATRMFLRGRGWSMSTF"
FT   gene            21228..21578
FT                   /locus_tag="AM1_G0018"
FT   CDS             21228..21578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33198"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQB2"
FT                   /protein_id="ABW33198.1"
FT                   /translation="MNKKAIAQFHLVNGTEVLFEVPKPSSDVKYKEVANGDFKQKVIEI
FT                   ADGAEGTLEAALSKVAPVADTVLSRLKEGLTTPANEVEVKFGVNLTAEGGVIFSTVGGQ
FT                   VSLEVTLKWTQN"
FT   gene            21592..23472
FT                   /locus_tag="AM1_G0019"
FT   CDS             21592..23472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33199"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQB3"
FT                   /protein_id="ABW33199.1"
FT                   /translation="MTEPAVHPDYRQGIVRIVRVSDDDDKVIEKVIGTGFYLSGRYIIT
FT                   CAHVVKETLHIDTATEFTSVEVAEGRDIYVQFNCIERNADPLATRVVPYSWRLHDEDLV
FT                   LLKLQVSPPPGVSPSPITPTITSYYDHPFKVFGYPNEDGHWAQGKLSGENDRQWIEMYG
FT                   EDEQCIRIQPGYSGSPVWDVTLSTIVGMTVATLVEEDSELYDNPESKIGYMIPYRRLLP
FT                   LIQEIEVQLLLDLLKPHQKAVEDHLQEAYGIYHPISEDPPSALADKLRAAMKAKKLPHL
FT                   MACLLLPEAQAPETLNQSLRQWFSDRGYDIEQYKFQADQDYKAHSPEDHEDKQPHLLFW
FT                   VQDQGALYNVQALLIKDAESYNPRKSLGCDRLLAPGQFDEALPYEKLEELLIACLQECS
FT                   VRGVPANQKLIVELLLPIKLLNKAVEHWQAESAGEDDFLCLPESIGFRTQVVIRAADRL
FT                   RASQDRKRRDYWYAEWKNYQKLKEKRAENCLSSGDDLPPQQLMARLNTIQQVGLYLTEP
FT                   PTEMAPKTSWTGVLFSSVAPIAALWPRQKPKNIDCSQECCELLSHPLCELPFQIHCCRS
FT                   QAHGTDTEDHLGHHLSLMWENPHMIPPKVAQRDPEPDPALTPTIDHPSEV"
FT   gene            23476..24447
FT                   /locus_tag="AM1_G0020"
FT   CDS             23476..24447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0020"
FT                   /product="ATPase, AAA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33200"
FT                   /db_xref="GOA:A8ZQB4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQB4"
FT                   /protein_id="ABW33200.1"
FT                   /translation="MSDWKIFKGDRQKKPMAINSLPAPPPWRSFTGKESVSSTQKERRG
FT                   KNFYPREDEIEMVNAALYLRRPLLVTGKPGTGKTSLAYAITYELDLGEVLTWSITTRST
FT                   LSQGLYSYDAVGRLQDAKLQGQDSHKRLGKYLRLGPLGTALLPTDKPRVLLIDEIDKSD
FT                   IDFPNDLLHVFEDGEYVIEELARIADEAPTIDVQTALRDEQEESYQETVSIHKGLVRCT
FT                   TFPLVIMTSNGERDFPPAFLRRCLRLDMGEPTPERLRDIIEAQLGKSLADEAGKMIDDF
FT                   DQKRRSGDGDLATDQLLNAVYLIGKEGAPEKLKEQLLQYLNR"
FT   gene            24456..27323
FT                   /locus_tag="AM1_G0021"
FT   CDS             24456..27323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33201"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQB5"
FT                   /protein_id="ABW33201.1"
FT                   /translation="MSSAQPSPDPIRGFATLLKGAGVELDVTDLADTLWLASKIGPSAR
FT                   QGLVESPIPEDPQLPLIPEEVGSSVPPTENLPEAALPTPPDIPLVSPSQTVETEMKPEG
FT                   FPLQVPAAPSLRGRLNLSRALRPLKRKIPSPTQRVFDEAATVHQYAEQEILSPVMTPAK
FT                   ERWLDLTLLIEDHPSTFLWEDTLLELKQILERQGAFRQIHTWQIQLQVGRVRLSPRRYG
FT                   QTISERHYSNPRILQDPTQRQVIWIVSDCTSNLWETAQFQEWLGLWGRSSPLALFQLLP
FT                   ERLWDSTHLGQGRPIQLSATSAGVANSRLKWERLLADWDKEDEFGDLDLEPTPETESSQ
FT                   ATEEPSSDLDVYLETGTASDDDPLEQGNGQSKIALNNIYKNQVLCLPVITLEPEPLNQL
FT                   SRVIAGQVGFQVAGVELHWQDIAEYKSVLERISNHKMSPEERVRKFHTNASPTASKLAG
FT                   MMAAVPVSLPVVQLIRQTLLPQSRQVHIAEIYMSGLLELQQKAPGPGNPHSPEQPEYDF
FT                   LPGIRSLLLETVFRDTTEAVLDAVSAYISKRLGLSTRSFEALIAKAPDLAPDQQAVAIP
FT                   FARVATQTLRQLGGYYRDIAEQLDPNPEPVQPENTNPEPEEAFPPLQILHFETAQLIDE
FT                   IETNFPAQLQSEEFVVKTLAIRTGPTIQSFEYQTAQLTYSSGQLFPPQLAGWKIQSQQR
FT                   RGQFYCETLSDDLVLRMVSISGGQFMMGSPDDESQRRDWEVPRHPIKIPAFFMGRYPVT
FT                   QAQWKIVASYPEINLGLNPNPSNFKGDNRPVEQVNWHEAVEFCARLSATTKRPYRLPSE
FT                   AEWEYACRAGTTTPFYFGETLTTDIANYNGGYTYNNGPKGKYRKATTPVDHFQYANAYG
FT                   LNDMHGNVWEWCQDTWHRSYNGAPEDGSAWIGENDNNSSKVRRGGSWIYNPRYCRSASR
FT                   SDAYPGDRNYFIGFRVVCSAPSPFP"
FT   gene            27364..28242
FT                   /locus_tag="AM1_G0022"
FT   CDS             27364..28242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0022"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33202"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQB6"
FT                   /protein_id="ABW33202.1"
FT                   /translation="MSQATAKEWIIQEATHRNSFYLENLGNDQALKMMDIPKGEFQMGS
FT                   PDGEVDRKDDEGPQHLVKISRFFMSKTPISQAQWQVVAKMPTINIELEESPSNFKGVKL
FT                   PVEHVSWHEAVEFCDRMTQQTKSQYRLPTEAEWEYACRAGTSTPFHFGETITTDLANYR
FT                   GTDWEEYKWSGSYGGGPKGEYRQQTTPVDQFQAPNRYGLCDMYGNVREWCQDIWHSNYN
FT                   NAPENGSAWIYKNDNESSKVLRGGSWLDLPGYCRSASRYYVQPHYRDNSIGFRVVCSSP
FT                   RILHTKKMGKN"
FT   gene            28388..29206
FT                   /locus_tag="AM1_G0023"
FT   CDS             28388..29206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="contains DUF323 domain"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33203"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQB7"
FT                   /protein_id="ABW33203.1"
FT                   /translation="MPELILRPEPKMVQYFIEDLTNEKGLSMVLIPVGKFLMGSPEDEP
FT                   ERREREGPQHPVDVSTFFMGRYPVTQAQWEIVASYPEINLELNPDPSNFKGDNRPVEQV
FT                   NWHEAVEFCARLSAKTNRTYRLPSEAEWEYACRAGTTTPFYFGKTLTTDIANFDGNYIY
FT                   NDGPKGKYREETTPVDHFKYANAYGLHDMHSNVAEWCQDTWHDNYTGAPEDGSAWIDEN
FT                   DTNPNKVLRGGSWYLDPRHCRSASRGTDESDIRSYVFGFRIVCSAPSSLP"
FT   gene            complement(29346..29972)
FT                   /locus_tag="AM1_G0024"
FT   CDS             complement(29346..29972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33204"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQB8"
FT                   /protein_id="ABW33204.1"
FT                   /translation="MVRKMDKVFTDWVTVKNLDSQNRSLLFRMGGQDRAGVVAKVTGLL
FT                   ELQHLYVEAIQFNLILPEQNQFEMEILAKGALEDLTCIQGRIQANQFLQPVSSSQNTCL
FT                   YWPQAYMMHLALNTPDQEGLIARISNIVSTPRNTNIPFSAGNFVYLVGITHNSDGPQGG
FT                   TAYFSVRANIASQSLEVQHQIQNHLLEWAKESCIEDDLWIRDLNP"
FT   gene            complement(30035..30163)
FT                   /locus_tag="AM1_G0025"
FT   CDS             complement(30035..30163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33205"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQB9"
FT                   /protein_id="ABW33205.1"
FT                   /translation="MELEATFDIQQVIEQRPTEAMERIAEMVGDFLDRERVALSWG"
FT   gene            complement(30271..30510)
FT                   /locus_tag="AM1_G0026"
FT   CDS             complement(30271..30510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33206"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQC0"
FT                   /protein_id="ABW33206.1"
FT                   /translation="MNSSTTLLKPKLVLQKTSSPIIQIPSKHYKSVPLPTIQPRTNQQR
FT                   SLKPSASLERRFQRLDLTKSELLKRPGNEPSLSA"
FT   gene            complement(30585..31031)
FT                   /locus_tag="AM1_G0027"
FT   CDS             complement(30585..31031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0027"
FT                   /product="double-stranded RNA binding motif domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33207"
FT                   /db_xref="GOA:A8ZQC1"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQC1"
FT                   /protein_id="ABW33207.1"
FT                   /translation="MRSQHSHNLNIHITEEQIGFLAYLFPNDDPEDALVKLLERARKQA
FT                   IRQAEKQIRVLHLGQESEENQGEIPEKPISQGDDWVENPIGQLQELCQKQQITLPRYGF
FT                   SERPNGFSCNVQAMGLQENGEGSSKQEAKTKAARELLSKINSRL"
FT   gene            31357..31998
FT                   /locus_tag="AM1_G0028"
FT   CDS             31357..31998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0028"
FT                   /product="ParA protein, putative"
FT                   /note="A conserved hypothetical protein (COG1192)"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33208"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQC2"
FT                   /protein_id="ABW33208.1"
FT                   /translation="MGKIISLVNEKGGSTKSTTCVHLATWLKNADYNVCVIDADPQKSS
FT                   SVWIESLELDIPCTLMFSADDLIDKTGDLADEFDYVVIDSPGKTDEITRAILLVSDFAL
FT                   LPVPPAGLDLHPSQKTVRLVKQAQKVRGGLPKGALFINRAGKNTRLKDETKQALKDIKE
FT                   VDTLETIVHFKQVIIDSFGQGQTVFSMKGRAAKDAAREFNKLFTELLEIM"
FT   gene            31998..32303
FT                   /locus_tag="AM1_G0029"
FT   CDS             31998..32303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33209"
FT                   /db_xref="GOA:A8ZQC3"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQC3"
FT                   /protein_id="ABW33209.1"
FT                   /translation="MARKPLNQAAKAFLSGEATDVEASVETVTPTTTTPTEVKDDAPNG
FT                   LIDSLSLTPQEKPAPMTITILPSRKNKLQQLSQSTGRNMSELIGIALDRMFNDANI"
FT   gene            complement(32427..32543)
FT                   /locus_tag="AM1_G0030"
FT   CDS             complement(32427..32543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33210"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQC4"
FT                   /protein_id="ABW33210.1"
FT                   /translation="MENTFDVLQVLSLRPGETIERIEEMIGVWLDRERVSRV"
FT   gene            complement(32590..33879)
FT                   /locus_tag="AM1_G0031"
FT   CDS             complement(32590..33879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33211"
FT                   /db_xref="InterPro:IPR025295"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQC5"
FT                   /protein_id="ABW33211.1"
FT                   /translation="MKRTHAYKPEKSKSQPIPQPISSDQAQSATPVPPPLQAKTNEEGL
FT                   AEWKAQQEKWERFGTPWKDKVPNPSGELVQPWIQRKLTLGQPGDKYEQEADRVASQVVQ
FT                   QINAPSLSQFNQGQSVQQEKELEGGMQAKSLRAAIQRRQAMTDEEASADLESAINSARG
FT                   SGKSLDARLQRSMGQVMGADFSEVKVHTDTQSDQLNQSIQARAFTTGQDVFFREGAYQP
FT                   GDRGGQELIAHELTHVVQQVGTGNPINSKNSQKSGTGGFTQKSLSDELIQRALWTNAPA
FT                   KFRTDNGNDQIPNSEYKVGSGGYQRYAPINIHRNILNQVYHEGPRSFVYIRGETEQSIK
FT                   GKAFDALWDNPWVTGKTGDEVYFNNDNQTEAKVTAYITPQEGDTVYDLNVAEDGKGSGQ
FT                   HVGHEVEDLGQALPTLDDSNEHAKVKKQYG"
FT   gene            complement(34037..35554)
FT                   /locus_tag="AM1_G0032"
FT   CDS             complement(34037..35554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0032"
FT                   /product="TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33212"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQC6"
FT                   /protein_id="ABW33212.1"
FT                   /translation="MRFDYRLQVFTLGIAALVATPFQSAQALSAREVGKIAQGVTVRIE
FT                   GQNPGSGVLVKKQGETYTVLTAAHVVETEDEYEIITHDGQSYSLDYQRVKKFPGVDLAL
FT                   VEFESQTSYTIAEIGDSTQALSGTPIFVSGFPAPTTAITDRVFNFTQGSITANAKRPLA
FT                   DGYALVYSNSTLPGMSGGAVLDEQGSLIGIHGRADAEQQQQLTGAVYLKTGFNLGIPIS
FT                   TYLSFTDQGKTVPSSPSPSISESAELTADDWFLRAEKARQQNDNKAAIELYTRAIRLNA
FT                   DYANAYNNRGLLRQNFNDNKGAIADFEKAIQLNPDDSFAYNNRGNALSELGDREGAIAD
FT                   YSKAIQLNPVNAGAYYNRGIDRYRLGDNRGAIADFEKTIQLNPDNALAYNNRGNALSEL
FT                   GDLNGAIADYDKAIQLNPDYPGAYYNRGNTRFRLSDPNGAITDYDKAIQLNPDHAGAYY
FT                   NRAIVRRSLGDRKGAIADMTEAAQLYKQLKNQKGYEDAMSMLEALPP"
FT   gene            complement(35765..36232)
FT                   /locus_tag="AM1_G0033"
FT   CDS             complement(35765..36232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33213"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQC7"
FT                   /protein_id="ABW33213.1"
FT                   /translation="MEFINYVSNLKSLLFPAVYPREIQELPDELCMLFTRKTGITSRYA
FT                   LAITLWDGSNSGHEFLEERRRLVSKKLSSMWMFAEVGLFLVVLGENADWQDRLAEMSPD
FT                   QTGLHATTIQGIHYVNTLNGEFEVKQSAWGPVTFGNAEVLSDLIASIPIEG"
FT   gene            complement(36305..37024)
FT                   /locus_tag="AM1_G0034"
FT   CDS             complement(36305..37024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33214"
FT                   /db_xref="GOA:A8ZQC8"
FT                   /db_xref="InterPro:IPR007593"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQC8"
FT                   /protein_id="ABW33214.1"
FT                   /translation="MLQAQQRLDLRFSEDIYLEGRSWRESPRYYRGDLNGNHLSMIGPK
FT                   KINSDSFWFRAQGELTSHSNQTILHFKIQLNHPYLYILIWVSMIASLIAFLVPKFGLVG
FT                   YNLTLFCVGFFYVMVQWYLQYYSNEICQLIKNVITDSPINSSLDQLQKSSLNPYLARQH
FT                   KIPNYLPQAILVTIFCCAPLGSIAITYAARAISKYRTGDYRGAMKASIVSRNWCWAAFL
FT                   FGILAYVLITLLVTNSF"
FT   gene            complement(37151..37951)
FT                   /locus_tag="AM1_G0035"
FT   CDS             complement(37151..37951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33215"
FT                   /db_xref="GOA:A8ZQC9"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQC9"
FT                   /protein_id="ABW33215.1"
FT                   /translation="MELAYQISSAIDKLSMPSTKEPLLSSLSKPVRLALYYFMSVIALS
FT                   IVGGFGVNYELWGYWYKRPGILDEAKTIEKIERYVLVRTSDCRKPKECSFIVDPDLRLS
FT                   DILNYSSDKDLYKRLQSYLQSKGVLPTFSDRDLKGVPDLYTAMVKTPIVVTPSKNFSHH
FT                   KISGIILIGKTSFGEKRAFISAIGSQISDGYIPYYEAIFKIGANNQSVQYLEGQRFFFD
FT                   TEMDEGFLTVAVVFIMILMFGGIPTVIAIIIDDILSQRKKLFMK"
FT   gene            38029..38268
FT                   /locus_tag="AM1_G0036"
FT   CDS             38029..38268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33216"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQD0"
FT                   /protein_id="ABW33216.1"
FT                   /translation="MISISHLSDICHLAQKVSSDSRENPTSLALNTPISYSDPWPNSTI
FT                   SDCFSDSAIKVLTEVSLVMPEKRNNDEHFQSVVI"
FT   gene            complement(38405..38989)
FT                   /locus_tag="AM1_G0037"
FT   CDS             complement(38405..38989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0037"
FT                   /product="exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33217"
FT                   /db_xref="GOA:A8ZQD1"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQD1"
FT                   /protein_id="ABW33217.1"
FT                   /translation="MNIGFFRYDYYLIVDLEATCCNTFSIPHKETETIEIGAVIVESVG
FT                   LEIIDEFTVFIKPIRHPKLTDFCTELTTIKQTDLEDAPTFPQAVGTFKRWFEQYENSVF
FT                   CSWGDYDKNQLERESKYHKIPYPMGEEHFNLKKQFSLALRTKKHYGMAKALMTVGLSLD
FT                   GTHHRGIDDARNLAKLMPFIIGRKRIPKLGS"
FT   gene            39348..40058
FT                   /locus_tag="AM1_G0038"
FT   CDS             39348..40058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0038"
FT                   /product="integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33218"
FT                   /db_xref="GOA:A8ZQD2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQD2"
FT                   /protein_id="ABW33218.1"
FT                   /translation="MKTADLFKWRHYQSEIILLNVRLYCRYPLSYRNLEEMMMERGLEV
FT                   DHSTINRWVLQYSPELDKRCRRHLKPTNDSWRVDETYVKIRKKWRYLYRAVDSDGYTLD
FT                   FLLTAKRDTKAAKRFLTKALNAVHTHEPRVINVDKNPAYPPAVEQLQEEERIPEGETVR
FT                   QVKYLNNIVEQDHRGIKRLVNPGMSFGSFNSARRTLKGYEAMNMIRKGQINNVGKDDVM
FT                   GQISFINQIFGLAA"
FT   gene            40139..40300
FT                   /locus_tag="AM1_G0039"
FT   CDS             40139..40300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33219"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQD3"
FT                   /protein_id="ABW33219.1"
FT                   /translation="MVGDDVTADVEAAINANLQGCLVRTRKYLPRDELKAPNQAFILNS
FT                   IADLIHLL"
FT   gene            40512..41570
FT                   /locus_tag="AM1_G0040"
FT   CDS             40512..41570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0040"
FT                   /product="potassium uptake protein, TrkA family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33220"
FT                   /db_xref="GOA:A8ZQD4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQD4"
FT                   /protein_id="ABW33220.1"
FT                   /translation="MHRAFQRIRTGVTLFAIAILTSVIGYVALGWPVMDAIYMVVITIF
FT                   GVGYGEVRPLETPAERYFTIFVIVAGTSSVVYIVGGFVQMITEGELNRAFDTQRKSRII
FT                   AKLKDHAIICGYGRIGQVLAKQLDQAQQAFVIIDNNSERIQTAETKGYLVQTGSATDEV
FT                   TLEAAGINQAKVLATVLPDDATNVFIALTARGLNPQLLILARGESAETEKKLRLAGADH
FT                   VVLPSSVSGHRIANLITQPTVVDVLSQTTERHALNEMLTQLNLKIDELMIQENCFLLGK
FT                   TIGEVEVRGKGRFVVIALRRRDGTTINHPEYGLVLVLGDVLIVLGHQGDLPKFASRYEL
FT                   RSELSNPKVETR"
FT   gene            41567..43381
FT                   /gene="amtB"
FT                   /locus_tag="AM1_G0041"
FT   CDS             41567..43381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="AM1_G0041"
FT                   /product="ammonium transporter"
FT                   /note="Has similarity to a domain of adenylate/guanylate
FT                   cyclase."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33221"
FT                   /db_xref="GOA:A8ZQD5"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQD5"
FT                   /protein_id="ABW33221.1"
FT                   /translation="MIDLLWMLLCTGLVFLMQAGFMCVESGLTRSKNSINVAVKNMADF
FT                   GLSVALFWCFGYALMFGASQGGWLGGSRYFPSSESSPKLIVFFLYQAMFCGTATTIISG
FT                   AVAERLQFVAYLIIASLVSSLIYPLFGHWAWNSLVENNTGGWLENLGFIDFAGSTVVHS
FT                   VGAWVSLATLIIVGSRQGRFSDQGATQIQGSNLPFSVLGALLLWFGWIGFNGGSTLALN
FT                   EQVPGIILNTMIAGIAGMVTAALLSWLQHRLLAVESLINGTLAGLVAITACCHVVATPL
FT                   AFVVGSTGAAVALWVSYGLHRLRIDDAVDAVAVHGGAGAWGTLCVALFGQLSETGMNRA
FT                   SQLLVQLLGIGVCFAWAFGLSWLLLSAVNRFVPLRVSAEDERLGLNISEHHAKTDTYEL
FT                   FQVMDQQAKTSDLSLRVPVEPFTEVGHIATRYNQVIDSLARNHQESAETLAQIYMITAA
FT                   SAAVVENQLFDPHALDLDEICDRDDELGTLAQVLQQLVTAVHQRDQELATLKTQFSPEN
FT                   GQTSDLRIGSKESIGGAIVEILMVRFGAVSPQIIEEVAAISDANQLKILLKWAMATDSI
FT                   VVFQAGIRRQLDTVSDKATLNKSQEILE"
FT   gene            43545..43667
FT                   /locus_tag="AM1_G0042"
FT   CDS             43545..43667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33222"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQD6"
FT                   /protein_id="ABW33222.1"
FT                   /translation="MVGEDKAKGVECLTNKETTDSHCSSKPPSSDIHKSSEQQP"
FT   gene            44110..45612
FT                   /locus_tag="AM1_G0043"
FT   CDS             44110..45612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0043"
FT                   /product="Na+/solute symporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33223"
FT                   /db_xref="GOA:A8ZQD7"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQD7"
FT                   /protein_id="ABW33223.1"
FT                   /translation="MEHSVFSWGIIIFLLGTLGIGVWASQQIKGDSVNFLVAGRGLALP
FT                   LAAATLMAQSVDSNATLGNTDLSAEFGFWAGAALPIGLSLCLFLTGTFLAKPMNRMGLI
FT                   TIPDFYRVKYGRRVELIASCIMSISFSFLLAGNLVAGGFMFQTFLGTSYVGGITLLATL
FT                   VFAYTVSGGLFAVAYTDAMQILIALVGALGLLAFVLVNFGLDIAPGTGPLALEQLTSVG
FT                   SGAAVNWASLLALGFGNMVAIDFMARIFAAESPETARRSCYVASAGTLIVGIPFSVIAL
FT                   SANSILEGANVVADGPVLFALLQNVVPPVLGLLVLVAILSASLSTADGAILGTSSVLAH
FT                   NVFGIRHGGTHGRGGGDRLLLVTRLLSLVITLLGVFLGLRVPQTGVLLLLGFDLGFAGL
FT                   VVPLLGGLFWSYSTRQGALACIFAGSTTRLILFALMPTMFGIENTLLYIPNSLFTSNFD
FT                   GFPTLISPVVGFIAFVVVSKLTYKPIPVELERVKLREGVQAL"
FT   gene            complement(45664..46284)
FT                   /locus_tag="AM1_G0044"
FT   CDS             complement(45664..46284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33224"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQD8"
FT                   /protein_id="ABW33224.1"
FT                   /translation="MAPQLISLKPKPPAQPTLKTPTNIESNSAYSGKTAFPTIARKDDL
FT                   PLKRKPSPDAGDDERKRESAPIHIHREPDFARRTQRGYTARHTTSRTQPPRVSRAFESK
FT                   FNALERRQKNLIQQTKQKGQLEYLTVSQSSLGNFWITIEGSGKPFIKISFETPEFCFEC
FT                   ALELENTFDVLQVIKLRPGETIERIEEMIGVWLDRERVCRVWG"
FT   gene            complement(46575..47561)
FT                   /locus_tag="AM1_G0045"
FT   CDS             complement(46575..47561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33225"
FT                   /db_xref="GOA:A8ZQD9"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQD9"
FT                   /protein_id="ABW33225.1"
FT                   /translation="MPGLQNILLEFYNYFGELPFIGVTLILVGLVSFRAIPRSTDLATS
FT                   SAAGLVGLIWGNSQRTLVINSTTNLPELGIMLVSLFGLGRLGGIATPLGSNLSNVYLIF
FT                   IVSPIVLICKWILIKNPNHIKNLMLLAKLEKQLILWHVFMSLLMFFFASFTYLILTGNV
FT                   QFIQHSGANTELDIMSLVIAIIVSLCGVIVFLIFESKLKKRRPELFEDIDDTNFEASWS
FT                   RFFLGVIMLCLSCYILNDLFAVWTELFQNHFVEFSLFPTIHYFIGSLISSLPEMSVAVG
FT                   NYERLSSPDLNTALGSASQSCMTNLLIAGLGSVIALVLSMNGLLRRI"
FT   gene            47860..49326
FT                   /locus_tag="AM1_G0046"
FT   CDS             47860..49326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0046"
FT                   /product="polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33226"
FT                   /db_xref="GOA:A8ZQE0"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQE0"
FT                   /protein_id="ABW33226.1"
FT                   /translation="MSTMIRSLQTIAFITILSTMSPSLAMAEISPKEKLNSSIRSNSIA
FT                   QNPNTQAGDTLINQQAYILGPGDEIQLTMFGQPNLFTTNYRVLVDGTVSLPLIGRVLVK
FT                   GRSIGIAEREIAKRYIRFYRRPFITIVLVDARVVTLAISGEVRHPGTYPVESPTQIPTV
FT                   TQLIQLAGGASQSADISQIKVRRPQENGKEQFISVNLLQLLQEGDLSQNLQLRDKDTVI
FT                   IPTTTTVDFSNALLIRNASFSSDRSEPINIAIIGEVYRPGPHTIRPGSADVQEAGTLGN
FT                   AKAASTELPTVTQAIQTAGGIKPEADIRQVKVIRRPHNGNPQEIIVNLWELLKAGDLSQ
FT                   DIALQAGDTIVVPKAVGLSAAELTELSTISFAPATIDVNVVGEVKRPGIIKIQPNTPLN
FT                   TAMLAAGGFDDRRANKSKVKLIRLNPDGTVTQREIKIDLEQPLNEENNPALRNNDVVVV
FT                   GRSGLTKVGDNLRNILAPITSSFGIFRILF"
FT   gene            complement(49505..51040)
FT                   /locus_tag="AM1_G0047"
FT   CDS             complement(49505..51040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0047"
FT                   /product="protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33227"
FT                   /db_xref="GOA:A8ZQE1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQE1"
FT                   /protein_id="ABW33227.1"
FT                   /translation="MHNPISRHFKKVVLSLLIINLMVSCFIFKAGNTEPYNEQRIRGAI
FT                   VKVYSVRNKPDYQKPWETVIKRSTGSGFIIADNKILTNAHVVADQTFVEVRRHGQAKRY
FT                   RAQVVSVAHEVDLAILSVKNNAFFSGVTPLEFADLPEIRQEVAVYGFPTGGNALSTTRG
FT                   IVSRIEHQFYTHSSEYFLAAQIDAAINSGNSGGPVLDGNGQIVGVAMQARKSADNIGYM
FT                   VPVPVIRHFLQDLEDKTFNGFPGLGLVYQKMENPGMKRSYGISENLTGILVRHILSESP
FT                   AEGFIRAGDVIHAIDGHAIADDGTVVFRQGDRTNFNYYIDIHQVGETVSIEFFRNSKLK
FT                   TVMLTLNKQKKDFRLVPLEQYNELPRYFIFGGIVFSPLTKNLIKSWGINWSKTAPKELL
FT                   IELSNWPSREKIEIVVATRVLGSEVNRGYHGIAGWIVKEVNGKKFKDFSEFCQLVTTSN
FT                   SPFVAFKGARNFQIVIDKKEAEESLDEILKNYRIGAAYSEDLKILSAVGEPNS"
FT   gene            51316..52026
FT                   /locus_tag="AM1_G0048"
FT   CDS             51316..52026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33228"
FT                   /db_xref="GOA:A8ZQE2"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQE2"
FT                   /protein_id="ABW33228.1"
FT                   /translation="MNKTTKITNLIIFSLIIGIIPGIIDLYILKCFTPQSAVAIPNTAG
FT                   SLRPPKLVASDLPPGFREVPTPISSLIRGAISSTISDHFGSNEIQIRDLVTYMNLNQWT
FT                   LIIGFVTPLNNENAVQMFDLGLEQPSALEKFVTGIKKSNYYLGSVNIVEQRVAPSLSQK
FT                   IGQVSTGMAVIAKARNVSLFSEMVAFRRNNLGAMLIVGRLNDNIPLMTTSKLAQKFDSQ
FT                   LLNFQSYPHPSNQQ"
FT   gene            52309..53514
FT                   /locus_tag="AM1_G0049"
FT   CDS             52309..53514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33229"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQE3"
FT                   /protein_id="ABW33229.1"
FT                   /translation="MRVFHRLIHVVLLFSLSLCLVFSDFVFADGCALAEELKVVTFNVE
FT                   SGNDTDPNMVARDMQAIPDVDLWGLSEVENQSAADTFLQAAGDSNFESILGTSGGSDRL
FT                   QIIYDKSKLNKLNSSPMELTGIGGDRKPLVEEFEVISDNTKFLFAVNHFNRGSARKRQE
FT                   QARKFRDWAGRQTLPVVAVGDYNFDFDISAMDGNPAFEIFFEEPVFSWARQTCLSSNTC
FT                   PSTGTQCNECFDGLLDFIFLSGDAKKWSNQSEILFKGSSFCDNDPTGASDHFPVQAIID
FT                   LDGDFQPFQPNILKGPHIASLLPNPSGRDDTNESVTLVNTGTEAINLVNWILRDKDGNT
FT                   LKLDELDTLFPRERKNILRDGRDLSLNNSCDTVELVDPAGEIVDSVSYIRPEEGEELEF
FT                   IF"
FT   gene            complement(53853..53969)
FT                   /locus_tag="AM1_G0050"
FT   CDS             complement(53853..53969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33230"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQE4"
FT                   /protein_id="ABW33230.1"
FT                   /translation="MTSKYISVPKIGLLSKVSREFPERLDSVDRKHHQIAGK"
FT   gene            complement(53966..57277)
FT                   /locus_tag="AM1_G0051"
FT   CDS             complement(53966..57277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33231"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQE5"
FT                   /protein_id="ABW33231.1"
FT                   /translation="MSSNEISGFGAVSVGQFQRVKDLSPDLPGVLPGGILNSQGGYLWP
FT                   LYNVHDQIVALQLRKRNVHEDNRYIWLSSSTRRNPNGNGPHVNGEIPLAVYKSFGPYSR
FT                   IALVEGTGVKPYLLSQRLQLPTIGAAGGLWASSPETLRETLTVLSKGAEQTPIITLYPD
FT                   AGAVRNLNVFRQYQRVIRLLEEWGYAVEVAWWGQTYKENACDIDELTPVELAQIGFKPT
FT                   WFFNSLGLEYELGQLFLKLNGLSDQATAVINKRYIELSDLGTIDPGSVVAIASMCGTGK
FT                   TEMLKSLVGQVKGQVIMPGYRNNLLFNTEDRFTSKDANGNTLYNLIHLFRLNKEYQGNI
FT                   SMGFRSERSILLCFDSLLKIELDDIEPDSCIILDEADAALFHVLSGQTLGDRQNQILEH
FT                   FHAIANRVLETRGNIILLEDSLSQIPIDYIKGITGGKYNTKIVVNEFKPDDNFPTKVFS
FT                   GQTSQFLERILNAVANDERFIVVATSQEFLEKLERMISDVNPEFAKGILRHDRKTSERP
FT                   ENKFFQANPTEFVKDYQPTALFLSPTAESGVSIDEPRLIPYFSRVFCYASSNHARSVYQ
FT                   QLWRYRAKVTREIYVTRKAHIPDIPSIKSVEQVIMLQSKYGQDVAASIDLEQQLIHDQS
FT                   PETAQQLAALKAYQQNPNNCHNVSFARYQTRSIASLLALRESLMLLLRDHGHPIEMEEL
FT                   RDRNADIVESFSKVRKQMEVETAVMLGTADGERFTVEQAIRVMGSSSATYKDTLDAKKV
FT                   LLQDELPGVELTDEFIHQVCVEHRGRLKSATKLHWMSYHPEVAEELDRRNFMKQLNSQF
FT                   VLTHRLTNNRIQVQLLRDLGVFDLVDTYNVTSADYEAYDKALEKGRQVQRQRQSLRLEV
FT                   KGLSGQIREIVQEQKAIQAKLTALGRKAHPRKATLKGELEQLEQQKQGLKDQKLGLVER
FT                   IEQQSQAFTQARYEQVEARMRMEILVMNEADQRLEDIKVKALEYRYQIYRHFRNVISEG
FT                   QSAVAIVNKLIKRVAHELVKVGSEESVSLYVIRYSGNEAYKDQMLKAFQSKWNQRLEKN
FT                   RPSCEICKKETDLITEMEKRTEIDEYGGGNDQEIGQWEGSDDGFSGGSELKLGCD"
FT   gene            57356..57652
FT                   /locus_tag="AM1_G0052"
FT   CDS             57356..57652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33232"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQE6"
FT                   /protein_id="ABW33232.1"
FT                   /translation="MAYGQLLGNPLTPFFLSLLITDGLAGLPINRVVVVITCVRCPDPP
FT                   VTIFRKLSELIAVDDTDIIGFGEAKDDIATFAASSIIRAADGAMILSFERNQL"
FT   gene            57847..58116
FT                   /locus_tag="AM1_G0053"
FT   CDS             57847..58116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33233"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQE7"
FT                   /protein_id="ABW33233.1"
FT                   /translation="MVGKVQLQNSCSKKSAALELEHTPWVTNACLPKLLLDPAISKKYL
FT                   VFSWSPGYFSSRDSFFLGHRHLLGKNTKILSEPYYASALNTQRL"
FT   gene            58163..58294
FT                   /locus_tag="AM1_G0055"
FT   CDS             58163..58294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33235"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQE8"
FT                   /protein_id="ABW33235.1"
FT                   /translation="MRETWVSSSNENEEICCLIRENLNWYLGINLVAEGVLSYIHPQ"
FT   gene            complement(58248..59519)
FT                   /gene="fliA"
FT                   /locus_tag="AM1_G0054"
FT   CDS             complement(58248..59519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliA"
FT                   /locus_tag="AM1_G0054"
FT                   /product="RNA polymerase sigma-24 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33234"
FT                   /db_xref="GOA:A8ZQE9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQE9"
FT                   /protein_id="ABW33234.1"
FT                   /translation="MVYTNVFNSQSLETGPFSRKVQYPQIERAQAGDRRAEDRFIRKNQ
FT                   RLVFKEAKRYRGLVDWDDLVNAGTLGLSIAIQKFDLSRGFQFSTYAVKPIRTEIRQLIC
FT                   EQRGLSREITKHLKKIDEAEQDLELELERKPTLDELAERTGYSHRVITNAWNKARVVDT
FT                   SSLNVLTGTEQGIECLDFVEDFEQLDSWDFAESINMKDYIAQLPDRESFIVRARRDGHS
FT                   YREIGTMLKLSGERIRQLYQKALEYLKHLITYGSCLVRFPQPDKTQLIHPEGIEKPTVK
FT                   RVDASRLGGKIGRAIQKIFKQTNKESHIHEPGELTNAQKHILVCRRRSSRGAANVAGHR
FT                   LTSENQRCHQLERTQDDWRGHLGFSPVILNIILLPLALVSQSIRGLQDNDRPSERRSIM
FT                   SSITSGVSKVIEGGYRKEHPRPPN"
FT   gene            60430..60705
FT                   /locus_tag="AM1_G0056"
FT   CDS             60430..60705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33236"
FT                   /db_xref="GOA:A8ZQF0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQF0"
FT                   /protein_id="ABW33236.1"
FT                   /translation="MVKQLITWKLKEHMAANKISVPQLAARLGISENAVINMRRSEMPR
FT                   INGERLNQIIVALNAMRKKGKKRIQVQDLIVLTFSMDEADEARIHE"
FT   gene            60766..61629
FT                   /locus_tag="AM1_G0057"
FT   CDS             60766..61629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33237"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQF1"
FT                   /protein_id="ABW33237.1"
FT                   /translation="MLKTTLLSLGLLAITSVSALANPATIPIDQAFKQTQKLEVSDVDH
FT                   LLDFTDTRYRVIKAFPSNPQQLRALSLSRNDHQQLLLKWTPNGTAKKASVFLRVMGPGG
FT                   EQTITLLVKRSGNEPDNIRTAFVPSQTVSKDAVIGEVSQVSIKPTVAPIPTQLIRPNRT
FT                   TQNPPKTAQPVKPPLTLTHPKSPPVIKLRSSPKPILQIAKVSTTGRPLIDRSTLDNKAL
FT                   ANYLIRGLHTPKGRKQANRHHDHYWFAQSMARYLKRGVSIDKALRWSRLPEKTFNDLLG
FT                   HGGVSR"
FT   gene            61714..62370
FT                   /locus_tag="AM1_G0058"
FT   CDS             61714..62370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33238"
FT                   /db_xref="GOA:A8ZQF2"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQF2"
FT                   /protein_id="ABW33238.1"
FT                   /translation="MLSPCLQTARHYAHKHGPPWSAPLLCILLTLCPFILPLPPGTQIA
FT                   GLEIMAMVWSTALFLHLYQTLNIQTKLGLYLFFSGMIALTPSMVKAQNVGNAPSSACNS
FT                   GFFLIGPMLGAVDTSLGWFLGGVLAYSLCAFMIALIIVFFLVVIVGLVMAGAESHNSKR
FT                   TLFEVLSQYLNVIITMMVIASLVTVFNLQLSNNGNAAPIPVGGQNQPQGATSVLN"
FT   gene            62382..65507
FT                   /locus_tag="AM1_G0059"
FT   CDS             62382..65507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33239"
FT                   /db_xref="GOA:A8ZQF3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQF3"
FT                   /protein_id="ABW33239.1"
FT                   /translation="MNQTEQIEKELRYGKINPYIGPTQFQLLSGQQIITLAASGCICFI
FT                   LGFSIGWFMAAFLWLGIFVLTVLALGKDYSRIFARMSKQRRYYSDRPNYQVKAGIPLMV
FT                   IELPEPFKLSQLFRRQTKQKTLKKIEPEFDLRAYGEMLLGEDIGFYLVHQDKQDRAMVI
FT                   FGFTLQGIDPTLSEQEAMDWLQAIVMALQKIPGIELKFFWDVEGSADQVLLHQHDLVTH
FT                   HDLDPLSEKLIKSEAQVAVDLAADGKLVHSVIRVYAKYRLSLADDYAVKEDRLDKLLAH
FT                   TQPLVGTFQEYLNPQPEGFSSKQAWEKVLDRAYQAGYIPTAKALTQMGVKPQPMTKEDL
FT                   WAIDWEDTHAEPADPCPQSITYSEAGLSPFSENQPLPYHILGELFSPERGLPAVPTPYL
FT                   YTLYHPIKNQWAALVKINQLSTYNKIDNFLSIGYMKFLLQALEGFHGYRLISEITQIEP
FT                   DSRLKLVNSAIKERNRKAIDAQLLHSTRNVQAEADVNELVDASRELSSGRWPLKVSLGI
FT                   WVYRKDKASLTAAVQDLIRRLPTSKTEQVSNHLMTHWISSHPFHWQSLFSKPQLRREEY
FT                   QCNQGVPLMPLVHPQTIDQQGIPFVSRGVAIPVHLNTALKKNLIAIFGPMGVGKSVLMN
FT                   RMILENIIHRIFTVVIDVPPGNGKSTYQPFMIQLQRIGVSAAYFDVKSHIINGLDEIDT
FT                   SWAGDLLSVQLLKKIKQNHLSLLRALVLGDDLDHPLYKTIKSVLALSYQDWRALADIDQ
FT                   RYRIAKAAAFGSEDSKRMPILQDFVDYFPQWVKQYKQDKDCEDLELQAIAMIRTELEAV
FT                   LTTDLGASINGINTFNFDLQTLVIGLTDLQDPQESVIYSMAAINLMELQSFRYPRSAIF
FT                   GDEISTTFKYRSISIRFAETCTRGRKEAKNVVIAGTEENTLVQSEGGRDILSNLDAVFY
FT                   GHCNPTAVENAAKHLRLKPEILSKYVRAEYAPNLAELCTSWYLRKGNQHYELLFYTSAL
FT                   MIALVCTQPEETAARDRILALYPDNPLQGYIKFGHLLKRAYKLNLPLSLIGA"
FT   gene            complement(65604..65753)
FT                   /locus_tag="AM1_G0060"
FT   CDS             complement(65604..65753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33240"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQF4"
FT                   /protein_id="ABW33240.1"
FT                   /translation="MNRSIVARTQEDVFEEVGFGAIVKGIILGDTDIPGGIGNTRWEGG
FT                   GIRR"
FT   gene            65769..66656
FT                   /locus_tag="AM1_G0061"
FT   CDS             65769..66656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33241"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQF5"
FT                   /protein_id="ABW33241.1"
FT                   /translation="MFDILGKAQKGLQTYKNVKKVYDGIRGKNANSITDGVFNVLEQYG
FT                   IIDPQKATTASNRSTPILIGQGNQGPAYATAGSIGALELEPKEPYEWRVKALNENIVYK
FT                   NAIQKTGDFIYSPEAQEILKVQDQVAADARDAAAAAAQGELESVLASTQVKDQSIYAST
FT                   VVGEYGTSAQSAKSTQAVNKLETKQNTEIANILAGNAFQLNAINESMVRNTSALGNIVT
FT                   TQSILVDKQTVSQYLDAAQLRQSGQIFTTLNNQYSYEKRKDMYRHLAAADTSNLLHFPG
FT                   LVEPQPNLSGQTQP"
FT   gene            66700..67959
FT                   /locus_tag="AM1_G0062"
FT   CDS             66700..67959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33242"
FT                   /db_xref="GOA:A8ZQF6"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQF6"
FT                   /protein_id="ABW33242.1"
FT                   /translation="MASHAHADFAEDLISDLEPSVAHDAFWDDLWNATFDRSTVISGDT
FT                   RRIAFGSVSTVVRWVTLIALFVVLLHYGSGMMFSGTSLRKGNEFTIKSVFPVVIILALL
FT                   ANQFAGVHAVGLFVNQARLGVMGEAYAQTEFATTFRSAIKDAYLSEKYRESLAFRAKQC
FT                   NLIETPITTIPSLEEPTNPETPLTDEQRQYYKKLQCIQSMVTYIQSLQAQVAAECEKGC
FT                   VGTNVAIVKDLKKYGVDGVPGVVAENLDIFVIPIQKLGELAADGARHGAQETYRLIFRA
FT                   IQWAWTSFLNMGFYLTAVGAPITYAISLMPTKRHFLFDLNLFALLMFSLAEFANIFCIG
FT                   IVALMLQRPTLVDLGGYIFPLTYGLLAPIVSGSIFLGGFKAAASFRGGALGVASAAGGI
FT                   AGGIATSVMISARNRREQYY"
FT   gene            68026..68505
FT                   /locus_tag="AM1_G0063"
FT   CDS             68026..68505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33243"
FT                   /db_xref="GOA:A8ZQF7"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQF7"
FT                   /protein_id="ABW33243.1"
FT                   /translation="MPLYPTIAVVFIVFAVLLIIIRGVFADLTPLGGLMACTVLTLFAG
FT                   YHRIFAGADQLAGVDSFFTLGFGLIICQLFVPDFRFWWSDFRFIYGMTVLFYFAFCWTF
FT                   DHVYILWFWFTGFVLLLLAVQLLFSAVSSGGRPPLHPDLDKDFMLYEDEWLFDDD"
FT   gene            68498..68926
FT                   /locus_tag="AM1_G0065"
FT   CDS             68498..68926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33245"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQF8"
FT                   /protein_id="ABW33245.1"
FT                   /translation="MTKKISRFLPLLVVSALLLNILVCFSWFTQGARAQAPSQVYIQTD
FT                   SGLVVKGQPVDPLYRSDEVVMRFAQEFVSVAYTWPMNGEGHREGKLIYPLPMYTQAFKI
FT                   HPDIRSQWLGRQHVAYAKAKDPFANYVGQSHHTPLLSL"
FT   gene            complement(68923..70233)
FT                   /locus_tag="AM1_G0064"
FT   CDS             complement(68923..70233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0064"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33244"
FT                   /db_xref="GOA:A8ZM10"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM10"
FT                   /protein_id="ABW33244.1"
FT                   /translation="MSASRSPEPTIGFVDEYCQLFAELFPQVRSYEAFKHLHLGMISDI
FT                   KRKSLPAIARAVGLENHQSLHHFLSESPWVASHLSDKRLDIILKILDGRRLILLIDETG
FT                   DCKKGKSTDYVKRQYIGNVGKKENGIVAVTAYGLFQGMILPLSFEVYKPRERLKEEDEY
FT                   LSKPQIAAGMIRQLQGMGFCFELVLADSLYGEAQTNFVNVLEELKLPYILAIRSNHAVW
FT                   LPAEQAVFAEPWQSFERTFSNGTTETRYRQEIIYGQRHHQKRYWLLTTDPQTLPENSTS
FT                   YVMAAAPEIKLDEIGDCYGFRTWIEYGLKQSKDTLGWADFRMTHYEQIEKWWEIVMSAF
FT                   LMVSLFADVFNDSCPVAHQHFAQHPWWDNQNGWKNLLNNVRLIIQPLISWNLLKRWLEV
FT                   FPSRALKKGFEQLTSKMEAFCCPLVRKLLKHPDFLSV"
FT   gene            70443..70571
FT                   /locus_tag="AM1_G0066"
FT   CDS             70443..70571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33246"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQG0"
FT                   /protein_id="ABW33246.1"
FT                   /translation="MTLRAVQGFRPNWQIADTDLGRMIDDALHSELLITNIVDLPT"
FT   gene            70605..71981
FT                   /locus_tag="AM1_G0067"
FT   CDS             70605..71981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33247"
FT                   /db_xref="GOA:A8ZQG1"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQG1"
FT                   /protein_id="ABW33247.1"
FT                   /translation="MPTDKRQVEEAKAILLDDPELNELLEENKISEGRPINDLEKMVDP
FT                   GDKVKHPYYLQPWFRIGSIAIPLIIMGFVGYKIWGPKPQKVMALGDKDKQIIELTEKLQ
FT                   QSELEKAQLTQDNMGLTQAAELEPFKQQQKQLKQQQLKQQAQKQQAKQKKPVPVRGKPI
FT                   QRQNTVSIPRRLYRNPTPKRSYTPAKPSPSLLANSKPSGPSLSECVGYVERNINVPGCN
FT                   RYQISQKPQSSSQTASIGKNPTIPRPAYTPRPQTKPVKLAFASQSKAKPRTKVKPDYQV
FT                   NFMAGEIQTVDQFEAEFYGAGQSAAAPTRTSMKAKVIDHVEWISPQEAQQMVIPLKITS
FT                   GPHKGQTAEAKIQQMNGLQFTAYVTRINGQEIEPGTMEVRRKNTKYLRSQLKRQGGESF
FT                   GDRVMGTVAAIGGEIATDQLADVRGGNHISRLVSNPQRRTREVTQYWRFDGEVELVPVG
FT                   "
FT   gene            72155..72649
FT                   /locus_tag="AM1_G0068"
FT   CDS             72155..72649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33248"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQG2"
FT                   /protein_id="ABW33248.1"
FT                   /translation="MARKSKDFSELIHQKQRQEQKNADSFERLQNKVKEIAGEDVSRNM
FT                   VFNPPDVNKMSEVLQELVAPYVQTTPSISELDNFLKIAVLAWNIALTSPEERQVALKQI
FT                   FSEMASSTDQDIIEGLKSLVEELIERKDHYFWSCQRSITSFDLQDQGDSYFLSVASTLE
FT                   E"
FT   gene            73112..73234
FT                   /locus_tag="AM1_G0069"
FT   CDS             73112..73234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33249"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQG3"
FT                   /protein_id="ABW33249.1"
FT                   /translation="MFGWFVLNFQGTPRSPCQARWGISRYQIYRTFELLHPLNS"
FT   gene            73915..74370
FT                   /locus_tag="AM1_G0070"
FT   CDS             73915..74370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33250"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQG4"
FT                   /protein_id="ABW33250.1"
FT                   /translation="MAYNIQTLYETDVVKWSLKQAKLLKARKFDLVDLENLIEEIEDVA
FT                   RRYKDVIEGQIENLLVLILTVKYKPQKQTKSWDKDVLTSQAEIHKWIEKEPSLHRHALS
FT                   SFNFCYKYARIKVSILHQISLASIPEECPEDVRITAWELINRDDGMD"
FT   gene            74456..75244
FT                   /locus_tag="AM1_G0071"
FT   CDS             74456..75244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0071"
FT                   /product="methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33251"
FT                   /db_xref="GOA:A8ZQG5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQG5"
FT                   /protein_id="ABW33251.1"
FT                   /translation="MSSPSHVRIHRMPILAMSNDGYFGEAVAETYDNDVDSFNPDVIEP
FT                   VVDCLKELAGNGRVLEFGIGIGRIALPLAKRGVEVHGIDLSGAMLSKLAEKTGGDRIPV
FT                   IQGDFATTKCEGSFSLVYLIFNTIMNLTTQDAQVQCFQNAAAHLEPGGHFIIEVIVPSL
FT                   QRIPFGETKHVFEFGDDHWGIDDYDFVSQTLESHHMMVRDSKIELSCIPCRYVWPSELD
FT                   LMARIANLELKGRWGGWKNEPFTNTSRSHVSVWEKSSDGD"
FT   gene            75258..75407
FT                   /locus_tag="AM1_G0072"
FT   CDS             75258..75407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33252"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQG6"
FT                   /protein_id="ABW33252.1"
FT                   /translation="MLASTPDISTHLHLKGHPAYVSSVAHLQGISVSDPHCFQAMPYSH
FT                   RFSD"
FT   gene            complement(75446..76066)
FT                   /locus_tag="AM1_G0073"
FT   CDS             complement(75446..76066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33253"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQG7"
FT                   /protein_id="ABW33253.1"
FT                   /translation="MVVANQKNGTISTSPSNHQSCFLFQPIMLADKVESKFPPGVIMPR
FT                   PIRCLCDFLDNHGYPISGCFEISTIGDDDMAAWFPNDVAMQQQFAVFGRGSTGSVYALW
FT                   LRDNLDTELAPVIVLGSEGELLVLATNSLEFCRLLGCGYDELEWDDLTQKASGWNATQP
FT                   LRNWLATNLSIDCPPTGDSIVSAAKQQFSGFPDFIQQWQRENL"
FT   gene            76222..76716
FT                   /locus_tag="AM1_G0074"
FT   CDS             76222..76716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33254"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQG8"
FT                   /protein_id="ABW33254.1"
FT                   /translation="MARKSKGFSELLHQQQDDEQTTVQSFKRLQKKVQKTTGKDLIKDI
FT                   ATSPKGVAKMSDVLEEFIDPYKETTSSFEDVKSLLSIAVFAWNIALLPDEDRQEAIEII
FT                   LSEAASGMNQKNRMELQTLIHQMIERKDCYFSSFQRYIANFDLQPQGDSYFLSVASSLK
FT                   E"
FT   gene            77211..80411
FT                   /gene="dacB"
FT                   /locus_tag="AM1_G0075"
FT   CDS             77211..80411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="AM1_G0075"
FT                   /product="D-alanyl-D-alanine carboxypeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33255"
FT                   /db_xref="GOA:A8ZQG9"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQG9"
FT                   /protein_id="ABW33255.1"
FT                   /translation="MTLTALKRCPTLIASILIAASQTLPVWSQTQQVGYYPAPELANVP
FT                   GLIYDPPPEAQEVSFSSLPGASSPGWVVVDDPNLTYDPNRAWPAGATPDRIIKFGDLKQ
FT                   NPQFAGFTKHSLRDFNNAIGTDIGGVPIGQVELVNGLNLEQVKDIYNNGDIKLKDSAPL
FT                   FQAVVGVVLDPTGAQKQLQRNALSTGKKALINELNKNPALKDIPFEDLLDGNWKGAIKE
FT                   GEQVLLREIGNDIPAELRRLPVGSLTIEVIEGNWETARQRAQNYAINEIQNFTLNEIIK
FT                   EFPELKRVPIGGIVHIANQPLDQALPQLADMALEQFPGIEDKILGSVPGLGDTALGSIV
FT                   APVIITLFNRDILGKFDAAHSGQDGPEEHYGRPISGGTPDAKFKPEHGIKSATSRSKRP
FT                   ERGFPRFEMAPLEPGTTILGDPLLGKEWMSRDQEVPGCKGFLCLFGNKERAGIKPFGNG
FT                   SLTKFSLGDITEYDDKPAEARLWIDFQICVTILFEKHCTAHIFSFKTPWKVKVGGIFPI
FT                   LARRRVQDYFPGINEKTRTIDFCQVPDFLGGTTTAGNSPPPNNNALYGHFVYAETTGQL
FT                   VNVTSVDGVQETLAPDAAQAFEQMVADAAAQGLDIKAISGFRDNQTQQQLFDLQTQRQG
FT                   SPEAAAKVSAPAGHSEHHTGLAVDVGTNANPTLETRFANTPEYAWMQQNAGKYGFELSF
FT                   PENNRQGINFEPWHWRFVGTSQAQQTFANAAGSHTDHNQGNTSTPSDPQHRLRQYLARI
FT                   ALGESSGGTDIDAHPNTGAYGEYQFIPETRKIILDRYGLDAWSTNKAERDQATVALIQA
FT                   FGDEIGTDILGLIEAGEFEQADQLLGQHVYSRAGNVIRYGQFTSLPGGAEQHDIWKDPA
FT                   ILAQYGPNGNAGQNPLLAAINTNSQRCNPTLLVSNSPFVQGSGVASGELQDPLSGQQYK
FT                   VTSDYGYRTDPVYGGTGFHSGIDLAWDAGTPIKAADGGVVVRSEWFGGYGNYILIDHGN
FT                   GLATWYGHNQNNYVSVGDKVDPGQVIGTVGSTGKSTGPHIDFGVKEGFVTGDPNSGTIV
FT                   NPRKYVNLPPLGGYSQPF"
FT   gene            80422..80802
FT                   /locus_tag="AM1_G0076"
FT   CDS             80422..80802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33256"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQH0"
FT                   /protein_id="ABW33256.1"
FT                   /translation="MRKTLIFTTFLIAGLANLSPAKANPAAEQCLNQIRLSQEEGSPSD
FT                   SAKLLASIEHNGSQYHLIREGYNLPGVPNARTYLRTNAQGDCQEVLSYLEGSYPSQKVY
FT                   EDRLGTAVFNKLRQAARSQSGK"
FT   gene            80862..81080
FT                   /locus_tag="AM1_G0077"
FT   CDS             80862..81080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33257"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQH1"
FT                   /protein_id="ABW33257.1"
FT                   /translation="MQITVQSLMLPKEQVGLCQTICCSDSERGHAEIRVKTCKMVPEAI
FT                   YISAFEDLAFRLLDRLIGCQTAPKSFA"
FT   gene            complement(81082..81267)
FT                   /locus_tag="AM1_G0078"
FT   CDS             complement(81082..81267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0078"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33258"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQH2"
FT                   /protein_id="ABW33258.1"
FT                   /translation="MSLALQQLSAEGYPIDREALATMSPYLTEQLKRFGDFVLDLETVP
FT                   VPFEQAIQLPIKFDEI"
FT   gene            81484..82140
FT                   /locus_tag="AM1_G0079"
FT   CDS             81484..82140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0079"
FT                   /product="transcriptional regulator, TetR family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33259"
FT                   /db_xref="GOA:A8ZQH3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQH3"
FT                   /protein_id="ABW33259.1"
FT                   /translation="MSWARARSQSQKAARREEILEAAQSLFSELAYEEISLNGIAREAG
FT                   ISKANIYRYFSTREEIFLVIYEAEQIVFVRALINRLQQMASVDNVSEMTQVWVETLLQH
FT                   ETLLNLIPQLSISMERNSSVEQLIKFKKQGYTTYQELLESLVSVFPRLNQQQWIMVIQC
FT                   TYSMIAGLWPLSNPSENLLEALRHPEVNQPPWEFESTMTYGLSALIHGAIAINNE"
FT   gene            82203..83048
FT                   /locus_tag="AM1_G0080"
FT   CDS             82203..83048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0080"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33260"
FT                   /db_xref="GOA:A8ZQH4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQH4"
FT                   /protein_id="ABW33260.1"
FT                   /translation="MNQKTVLITGASSGFGKLAALKFQQSGWNVVATMRSPERETDLTQ
FT                   LENVVVTRLDVTEPASIEVAVKLTITTFGTIDVLVNNAGYGGHSLFEQATDENIRAMFE
FT                   TNVFGVMNVSRAVLPFMRQQKSGCIINVTSMAGMLAAPTISIYASTKHAVQGLTEGMAF
FT                   DYKPFNIRVKSVLPGAYPTTRFNANTSDILKAGDAELVAHAEKLHTHLQDVAQKMANQG
FT                   GQVADPQEVADKIFECATQDTPINNPVGSDAEMLAGMIAKADSRQAFIDQVTPLLMPPV
FT                   "
FT   gene            83113..83988
FT                   /locus_tag="AM1_G0081"
FT   CDS             83113..83988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33261"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQH5"
FT                   /protein_id="ABW33261.1"
FT                   /translation="MFGNMVSNMMVKPSQSPLFDSPTDYGLNYENVEFKARDGVTLRGW
FT                   LIKGGTDRVIVQSHFGVQCNRGGWSPKGRGPIAPWKEDIKFLRQAKYLAEQGYSVLMYD
FT                   LRGHGESDLGTIPWVSWGPEEAKDVVAAVDFVSARPEFANASVGLLSICMGAASTTYAY
FT                   GLADGLASRDKVKALVNVQPLLYSYFVKALGMPGFMERAGAKVSRDRLGFNMAEPNFIN
FT                   DAPKISVPTLVLQNQNDPWTNLDMVRSYYDALTVEKDLRMLDLEASRFAGYDYLGRSPE
FT                   AFVGWFDQHI"
FT   gene            84049..84312
FT                   /locus_tag="AM1_G0082"
FT   CDS             84049..84312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33262"
FT                   /db_xref="GOA:A8ZQH6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQH6"
FT                   /protein_id="ABW33262.1"
FT                   /translation="MRLGQGLNQKELTAKANVHLQSIGKIERGKTTKLNHKTKNGLAYA
FT                   LGVPAEYFEAVCRGIAVEAASRLKFCQLAECWERSRIHYGCL"
FT   gene            complement(84465..85463)
FT                   /locus_tag="AM1_G0083"
FT   CDS             complement(84465..85463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0083"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33263"
FT                   /db_xref="GOA:A8ZQH7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQH7"
FT                   /protein_id="ABW33263.1"
FT                   /translation="MNPTNHKFVLDSGWQVLLKDLGVSPQAILRQANLPLDLFCQPTPA
FT                   LTSTEYFRFWEGLETLLLKDPTFPLRIAQSITVESFSPPIFACICSENLNQGIQRLALY
FT                   KRLIGPFRLDVTQTIHDTQIALGELPGHPPIPQSLIAMELALLVHLTRLATRAFIIPLK
FT                   VQSTFTIPGSKEYEAFFGVPLDNGELDGVVFSAADAQKPFLTANAGMWSIFEPELHKRM
FT                   QHLEVDAHFRDRVRACLMEILASGQCTMADVAKRLAVSTRTLQRRLQDENTSFKQELSS
FT                   LRAELANHYLVNTPYSSAEISLLLGYSEPSSFFRAFHLWTGKTPDIVREMS"
FT   gene            complement(85500..86318)
FT                   /locus_tag="AM1_G0084"
FT   CDS             complement(85500..86318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0084"
FT                   /product="short chain dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33264"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQH8"
FT                   /protein_id="ABW33264.1"
FT                   /translation="MSKVILITGASSGMGLETAKLLAQEGHKVYAGARRIERMESLRSL
FT                   GIIPVQMDVTNRENNQKIVDQIIADAGRIDVLINNAGFGLYGPVEDVPLDDAQYQFDVN
FT                   LFGLAHLTQIVLPYMRQQKSGRIINTSSMGGKIYTPLGAWYHATKHALEGWSDCLRIET
FT                   KPFNIQVVLVEPGGIKTEFGDVVGKQLQKYYDSSAYQKQMDPYLRMMADPKAMDNATEP
FT                   IVLARVFVEAVNSKNPKRRYVKGSMAKPLMFIRKWLGDGTFEFIINRAFG"
FT   gene            complement(86342..87181)
FT                   /locus_tag="AM1_G0085"
FT   CDS             complement(86342..87181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0085"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33265"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQH9"
FT                   /protein_id="ABW33265.1"
FT                   /translation="MDNFSNKVIVITGGTTGIGFGYAKAFGKEGAKVVISGRRENRLQE
FT                   AITALNNNGIEAKAILADASSLEDTEKLADFAWDSFGKVDVLINNAGMMVHHAPVLDMP
FT                   LEDIHAIFNVNLFGVVIGSKVFGKRFVDQGTPAAIYNIGSENSLFHGTPFNGAYVATKH
FT                   GVLAFTHSLREELPDFIDVSLICPGFVVSELGPPENMQYGMPTDQFVSITIPQLKANEF
FT                   YVVSHAYNVVMLHQKQKALAAAYATYAPRYEGDVRYDVRTNLSPVLQQQVGQSLREF"
FT   gene            complement(87205..87366)
FT                   /locus_tag="AM1_G0086"
FT   CDS             complement(87205..87366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33266"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQI0"
FT                   /protein_id="ABW33266.1"
FT                   /translation="MACNATKLTHYVTPQKTFSPYAVLKKSELALNPKVTGSNITKRKH
FT                   LQLSISQQ"
FT   gene            87337..87465
FT                   /locus_tag="AM1_G0088"
FT   CDS             87337..87465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33268"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQI1"
FT                   /protein_id="ABW33268.1"
FT                   /translation="MRQFCSITRQLFILSNQQRKATRNIVLFNTFEQSLLLGLEHQ"
FT   gene            complement(87419..87535)
FT                   /locus_tag="AM1_G0087"
FT   CDS             complement(87419..87535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33267"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQI2"
FT                   /protein_id="ABW33267.1"
FT                   /translation="MWQRVVKPRNHFQLETTLLNARDVIDVLSQVARIAQKY"
FT   gene            87497..87649
FT                   /locus_tag="AM1_G0089"
FT   CDS             87497..87649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0089"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33269"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQI3"
FT                   /protein_id="ABW33269.1"
FT                   /translation="MKVIPWFHNSLPHPYLTEQLKRFGDFVLDLETVPVPFEQAIQLPI
FT                   KFDEI"
FT   gene            87945..89747
FT                   /locus_tag="AM1_G0090"
FT   CDS             87945..89747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33270"
FT                   /db_xref="GOA:A8ZQI4"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQI4"
FT                   /protein_id="ABW33270.1"
FT                   /translation="MPQQTTQPSPEYRGFHNIPINYGWLTVGFLSIVFIIWLSTLNRCR
FT                   TQIPEGMPNAREATPKEIKEGSNKAKLIRAEGDIEKSAIQLNPETGITLGPINPGGIVS
FT                   GKSGGGKTESFALRLIESLAEDGASLMISDIKGELMEKTAAYLHDLGYDLHFLAPGIKE
FT                   TSKYSADKLPFSGGLNLLDLIANDEDLAGTLELTRGININAAENYERRHQYFGPQSDLL
FT                   QQSMMLGAKSSEYADMLMVWELMGLNNIAERLAAAKDNDKMGKGLPYFMTHLSRGLRTV
FT                   ANSSSSANPGPTIQSTASQNWVQFLDPEIAKCMTKTTIPLDLTGKQAIFFRINEDQLEA
FT                   TKTYLAAAQHMLIKRNISYTRRRQNNLGVIIEEASFTLYPNAKKWSALGRQNGLLMWMV
FT                   YQQEEQMQELYGEKRWESIAANLPTRIYMNQGSYKSNQVIANRLGKKTIISTTENESFG
FT                   SNHSRSRNDSFQQVDLMTADRLDAMKKPGQCIIVDASTNGHPIIYEKKQLPYNENSRQA
FT                   RIRKQCKVAWREDILPSLQEEHQKHFGEINIQVAMENRAAAAEDLLPPPEYYAIEEEAA
FT                   EIDAEEGTEDATDVNEMEEMDDAA"
FT   gene            89737..90174
FT                   /locus_tag="AM1_G0091"
FT   CDS             89737..90174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33271"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQI5"
FT                   /protein_id="ABW33271.1"
FT                   /translation="MQPSQDQTLERDAEKGMHLAEEGVEKAARLTAETLRILKAQLAKY
FT                   NNRVSIKFESRADDIANVKAGMQGGLKGVQLRQIVRAGDSIKEVAQRTQSAEKVKLYED
FT                   RVLSRAQHELNREKVEHRRSQQTDQSQKQSQRQSQSQDLGL"
FT   gene            complement(90183..90332)
FT                   /locus_tag="AM1_G0092"
FT   CDS             complement(90183..90332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33272"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQI6"
FT                   /protein_id="ABW33272.1"
FT                   /translation="MGFMSINNSINITEKSFGDKLNIEQSHNAELHAIGCHPIYNPQAC
FT                   KFGN"
FT   gene            90897..92420
FT                   /locus_tag="AM1_G0093"
FT   CDS             90897..92420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33273"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQI7"
FT                   /protein_id="ABW33273.1"
FT                   /translation="MSTFKDLYNTAKEAEDVAFAVSPIPLGFIKSGIQNVGVPLVVAAA
FT                   ATHTPFVAPLAGTAIKWGSDAFQSGTHSLAQQAMSNFGESVMSGLPAFGGIQTSFNWIS
FT                   SESSQVILAGQDMVTHAVGSVGTSLMLGRTVANSAVVAFQKIRPMTINEILANGQQALE
FT                   RSQEFLTSVASHIRQIGIHAELFVEQEFAKLSNSEEQTTQVQPTESPEQATVLAMDKTQ
FT                   VEAEPQLKAAAQVESNGTQPEINVQPSENGNGQSERGTQANIFEAAVETAANMVNPIRS
FT                   ESSQEAEDYVLGLVDKLAAGNMNVDRLYIKMDGIDIFKMKNGAPDPSTSITDSQRDALQ
FT                   QALEDPAAFGGNLVIKQGNKVLLNIKKGRILHNPMGLAKQSLSAEMETKEHLQQQQPEA
FT                   KQATVPNNPAEGLWSKYGANVSPGLKGVKLAADNALKDGIKPKEVRAMLGQSAHFKGLT
FT                   ADKGASVAEKVIARTVKTAQARVAQQQRPKQKVQQKEEQKQAAVMAPGL"
FT   gene            92664..92900
FT                   /locus_tag="AM1_G0094"
FT   CDS             92664..92900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33274"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQI8"
FT                   /protein_id="ABW33274.1"
FT                   /translation="MSPPLLRQLWQMIEEIPQHSLEKLDDSGLVGWVLSHLEQHKSLQT
FT                   DERKAAEDYLYDHILLIRDIAESHQLHHCPLAG"
FT   gene            complement(92905..93078)
FT                   /locus_tag="AM1_G0095"
FT   CDS             complement(92905..93078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33275"
FT                   /db_xref="GOA:A8ZQI9"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQI9"
FT                   /protein_id="ABW33275.1"
FT                   /translation="MVTKTTDLIHQISRLTWFFAILFVILSGLFMSLYGFIRWRFCVDG
FT                   VLCTLLLHPIHF"
FT   gene            complement(93461..93871)
FT                   /locus_tag="AM1_G0096"
FT   CDS             complement(93461..93871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33276"
FT                   /db_xref="GOA:A8ZQJ0"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQJ0"
FT                   /protein_id="ABW33276.1"
FT                   /translation="MAKVYTGKVVIPANQMNEYLEAMQAAEEARAPFRKSLEQLNRDFA
FT                   GFLSQKYSKKTVRKHTNIVELFIHFICGYTDVEAIDEITKGMVNSHFRKWYKRKVWDSS
FT                   TESDLRVALKKFFQFLATEKGITNEKVLAALK"
FT   gene            complement(94060..97989)
FT                   /locus_tag="AM1_G0097"
FT   CDS             complement(94060..97989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="Shows homology to DNA helicase but no HMM support"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33277"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR024385"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQJ1"
FT                   /protein_id="ABW33277.1"
FT                   /translation="MLDITTINSNIKDGARYYTKEESYYSQDEEVQEMTESEWFGSMAP
FT                   NEPYSAERFTKMFYGDLPNGQRMRGEVNGKGKERLAYDLTFTVPGKSLSMAIHGPNGDK
FT                   RLWEAHVEAVKEVMVIVENRYAGARVQANGKRQAIKTGNIAATLVNHHESRAGDPHVHT
FT                   HVVLFNGTLCPDGEYRALWYEPLRNSGVLGDLYHQKLALKVQALGYEIRETATGFDLAG
FT                   VTDEQIEVFSKRSTEIEDYLKEKGWSNTPANRQKAVFETRIAKNITESLEQKQERWGHE
FT                   MEAVGFTGLTPANHPITPKSTETPRELLDAAIGHLAERQSSFSLEDIQRFVFSHLRSFD
FT                   EKPLNQEIDHHPDLLTAWDGRYTTQTAVDRDIRIINHWLKGNNSVTPLNPIADFSHTIL
FT                   NSGQSEAMKRLLSSPDQYQILKGLAGTGKTTALGIARQQLPPETVIKVFAATHNAKNEI
FT                   AESFDLEGATIAQLAVSEPTTESNQLWILDESGMVGSDDFEMVMNKATKVGARVWAVGD
FT                   TGQNGAIAAGAPVRMLMHSGATVHKLSEIIRQQNKEQKTAVKLIAEGHGIEALNVLEKQ
FT                   GHIHEVEDADTKISAAVKQYISLPQSRRDKTLVVIGTNAEREAFTDQLRVRLIEEGKLT
FT                   NNTEFTQLKNRNLTKVQKKRAENYRKGDLLVLHRKHRTYTQLQTHVPYKVLAVEGQHLR
FT                   VTSPGGRQFKINPAQHERTEVFTAKQNHIAVGDKLRFTSTNKKEGIYTHAYLECIRIQE
FT                   GIATVQGNKGQVHQLDLSKPQQIDHDWATTTYRAQGGTNSETIYIASLNPTSARESFYV
FT                   GISRHRTKHISVFTESLEDLKEWVATSNAQENAIETLFDPHEGWTPDYTGVEKPWQLDM
FT                   DTWAEMKSSGIHPSLLTPEHLRSEAGSSEPSIRDNVLLEALLGAEFTKPKYGAGQEVTH
FT                   EMKRKLNGTHKVNGKWVDDPERAYTRIAEGGGWIGYGGTDLLSVIEGNPQPSSYCQVKP
FT                   KTPRIFDGEEVKYETPKGVDQQVFLPHIPDEITELIYQRNAISPTPEERAKGVWYVADQ
FT                   YNLPIVLTEGLKKTWASLSQGHLTVGLPGVTALYRAKDDFDHRLPQRELSEYGKALAKP
FT                   GRKITFAFDQDTKLSAIFNVRRDLVRTIELLQAEGVVCKLAPWNPKLGKGLDDVIAKVG
FT                   PRYYNAAIANAISPDAEVKRHYKGQYNSIAKRVQKRLGEMPKERVDLEVYAYCKEHTEL
FT                   NDAYRFISESDHMRAATPEQKRLYLLAIHKVSPIYEELMDSDKPINFNQRMPEMVQNRV
FT                   KLQIVKEKPTPLQSEQINFDIGQSY"
FT   gene            98190..100454
FT                   /locus_tag="AM1_G0098"
FT   CDS             98190..100454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0098"
FT                   /product="phosphate transporter binding protein"
FT                   /note="may contain protein kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33278"
FT                   /db_xref="GOA:A8ZQJ2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQJ2"
FT                   /protein_id="ABW33278.1"
FT                   /translation="MVCCLNPDCEKPLNQDSSKFCQSCGTELIPLLRHRFKIIKPLGRG
FT                   GFGKTYLAEDADKLNEKCVVKQLVYQAQGSHANKLVVELFMREAEQLQQLWENPQIPSL
FT                   FAYFEEGGYLYLVQQYVKGQDLLKELKEQGCFDDQKILALLKDLLPVFSAIHSRKVIHR
FT                   DIKPENIMRRENDGRLILIDFGVSKQLSKSIVSMAGTMVGSLGYAAPEQMESGIAQPNS
FT                   DLYSLGASCFHLMTGINPWSLWRKQGYGWLAEWRKHLQQPICSELGTVLDKLLQLEVED
FT                   RYQSADEVLADLDGAKAQAEAEQLQRYEAEFSNAVQSAYPLEAHVRDGLKQFQQSLGLA
FT                   DAEVDQIEQPILKQAEAKRQERIKQQAEVQRQAQQKQHEKKLKQEADQREEKAAILSTK
FT                   NLVSQTPRSTRKTLISVGLFGLIVVPLSLYGLSTISRDPDPIPTVSSDLSTTSINLKGS
FT                   IAIDGSSSVFPISEVIAEEFQSVNKDVKITVGISGTGGGFKKFCSGETEISDASRPIKQ
FT                   REIALCAKNNIEYIELPVAYDVLSVVVHKDNDWADCMTTNELKTAWSKSAQGNISKWNQ
FT                   VNPNYPDVPLTLYGPGTDSGTFDYFNEAITGEEGSRGDFATSEDNNTIVRGVSGDKNAM
FT                   GYLGYVYYEENKDSLKAVQIDDGDGCIAPSDETISKGTYSPLARPMFIYVSKVAIDRPE
FT                   VKSFIEFYLNPKNRQLVANVGYIPLSDEIYAKALARFQEGKTGTVFPNGKTNNVELTDV
FT                   L"
FT   gene            complement(100572..100958)
FT                   /locus_tag="AM1_G0099"
FT   CDS             complement(100572..100958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33279"
FT                   /db_xref="GOA:A8ZQJ3"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQJ3"
FT                   /protein_id="ABW33279.1"
FT                   /translation="MTSEVQTKNPVFLRFSTVSYSRIQLITVELLANGQIPRCARVQEV
FT                   AEGRLRGSPTWIHLFATTWGCIILQWDFLLQFFVARLQYFDYKTVTRLKLLHYRVVVHL
FT                   KLLYYKIFLLTLVESIPNTLEKSC"
FT   gene            100999..102054
FT                   /locus_tag="AM1_G0100"
FT   CDS             100999..102054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33280"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQJ4"
FT                   /protein_id="ABW33280.1"
FT                   /translation="MVYTLTVAADMGSSLGKGCYTIDKGPPNDAEGFVGGFQRDTPRKG
FT                   WITQANAVDEEKHRDLTPDSCTIEVRGKAWTVGESARYALHETRVRAAKSNTASIRVLG
FT                   MLGKIIEQEDFTEGSLDLRVLLPVGERKTFKQLEANLTKALYEVRLNGVKPSLRINRVR
FT                   VYPEGAGVAQRVTVPDALVLMFGHKDISIVPVRNQVIQAHACQTITGMGMIALINEFPC
FT                   YINDELLLAEFLHLEAVGKGGLKRLVGEDSLEKARMNFEQAKKRTWRRILQQLMLEPKV
FT                   NTVSKIYVTGGSMRVWLPELKAIFGGRLAFFADSLKSMIAAYPDMQEPKNKEIKPRFTD
FT                   SFLLMEGATHG"
FT   gene            102062..102460
FT                   /locus_tag="AM1_G0101"
FT   CDS             102062..102460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33281"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQJ5"
FT                   /protein_id="ABW33281.1"
FT                   /translation="MKIQLQYPDQSLNGRRLEALRGYFGDNLERVMIQAMWSVVGPLGS
FT                   TLADLPEKEVQGHINSGKLTIKGFHQEALDMIGGGGVTPEVTPEVTEKVPPAVTSEVTQ
FT                   EQPPSAAQESVYSASPPEQSGDPLNNLF"
FT   gene            102524..103213
FT                   /locus_tag="AM1_G0102"
FT   CDS             102524..103213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33282"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQJ6"
FT                   /protein_id="ABW33282.1"
FT                   /translation="MHNIGDILEILKTSKEHLEPMLEACGWTDQTEFTDEQAETLLAMK
FT                   VSHEEKGRDYIEGYTRNIAHNVGITGTQFDEIHQCIIDAGGSLIDYRERFEEICQLVND
FT                   CVSPAEAIIPPQPVVEDTHPVVEAEADPESVQMDRFIDEQANAAIATTISQIKGFADLA
FT                   YEEQERLKTLFMTKYRQGLAKELLSEEFKAEFMARMTASLEGKGAEKKQGELTGVQNPT
FT                   PLLSSSN"
FT   gene            103222..103488
FT                   /locus_tag="AM1_G0103"
FT   CDS             103222..103488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33283"
FT                   /db_xref="GOA:A8ZQJ7"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQJ7"
FT                   /protein_id="ABW33283.1"
FT                   /translation="MDGLLAENEKAIKQRIVDLKLKDKEISQLEKLQRIKRTEREIKRE
FT                   GTWFKIAFIGIGILIGLPVGVFLNHLAGQNAAVSSPIEQVSGK"
FT   gene            103768..103890
FT                   /locus_tag="AM1_G0104"
FT   CDS             103768..103890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33284"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQJ8"
FT                   /protein_id="ABW33284.1"
FT                   /translation="MDFVLPNYRDSAMKVTLDQPEQELETIARMLTENYIMEVI"
FT   gene            104254..104478
FT                   /locus_tag="AM1_G0105"
FT   CDS             104254..104478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33285"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQJ9"
FT                   /protein_id="ABW33285.1"
FT                   /translation="MTTNPYFGHFEQAWIDHQTDYGQHPDPCKEFPPDQILDRVASWLS
FT                   EFNPLIPPESQLSKAIRVGIVHRFYGWQL"
FT   gene            104475..105380
FT                   /locus_tag="AM1_G0106"
FT   CDS             104475..105380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33286"
FT                   /db_xref="GOA:A8ZQK0"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQK0"
FT                   /protein_id="ABW33286.1"
FT                   /translation="MTNTQNHDESPGWEWESLAIACFIVIAISTLVGLIALPKKERENL
FT                   SWSFWALTIPFTISFSVVGCWLLKPREGCPLEDKKPNSVTGNSEARRGARADDPQVHTH
FT                   AILDTSFDEKLAIVTKDVAEIAQRVGALDMALVKRVRPLQTKATTVREKEQQARTALIA
FT                   RLSDLGTETSPIDALQGAIQICSDARLWEHPARIATVHIDTQRFYNEGKIWPTIRDNHI
FT                   VWSLDPDHDPPDETDEIEQTLFRPFRCCSRCKYIGKYYDCCAVVPFDCGTGNPSEQCRE
FT                   FECEDGGTPIPELTIDDVPF"
FT   gene            105520..106062
FT                   /locus_tag="AM1_G0107"
FT   CDS             105520..106062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33287"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQK1"
FT                   /protein_id="ABW33287.1"
FT                   /translation="MPLLNIHYRTTLDPLTDPDHAEKALNEIKKFWVLNVQSDLDSIET
FT                   AFKEEFPTYKIFLPDVDHLKLAHPIPEKKTLEYQNSFEYISKNYLETYTDTYDKSEYPD
FT                   LIPWDEQFAWDGSYNRKPVTHPLHKYPQWDKLALLVDDEEGKANDIFLRGLFEQVLPCL
FT                   DDEGNPQFKGDDYHILG"
FT   gene            complement(106238..106354)
FT                   /locus_tag="AM1_G0108"
FT   CDS             complement(106238..106354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33288"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQK2"
FT                   /protein_id="ABW33288.1"
FT                   /translation="MVLARLREPKSRSRFIVFADLVQSPDIGNTKSTGNLKT"
FT   gene            complement(106487..106663)
FT                   /locus_tag="AM1_G0109"
FT   CDS             complement(106487..106663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33289"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQK3"
FT                   /protein_id="ABW33289.1"
FT                   /translation="MQKAATVSSTTSKKDTMISKLPCKWWTTSINLQPWPAQHPAKETT
FT                   LLCTLFELFMLED"
FT   gene            106575..106958
FT                   /locus_tag="AM1_G0110"
FT   CDS             106575..106958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33290"
FT                   /db_xref="GOA:A8ZQK4"
FT                   /db_xref="InterPro:IPR012427"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQK4"
FT                   /protein_id="ABW33290.1"
FT                   /translation="MEVVHHLQGNLEIIVSFLEVVLETVAAFCIVLGLLVSIKLSVALR
FT                   RRRNSIQFPLGRLRLTFGRWLALALEFQLGADVLATTVAPTFEALGKLGAIAIIRTFLN
FT                   YFLNKELIEVFEMQKHLDEDETN"
FT   gene            107628..108473
FT                   /locus_tag="AM1_G0111"
FT   CDS             107628..108473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0111"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33291"
FT                   /db_xref="GOA:A8ZQK5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQK5"
FT                   /protein_id="ABW33291.1"
FT                   /translation="MLIQNQYRIIKQLGEQNGGITYLAEDLHHPSKQLCVVKQTKPFVL
FT                   NPTVNQRTPKQIKLVQERLNQEAVSLVEVSSENDQISKLYTCFEKEGQFYWVREWIEGQ
FT                   SLAKWEYPVEPGIIIEILCQTLLALDSLHSQRILHLNLKPSNIIWRKGDSKVVLTDFGV
FT                   FKEITSLLNLHDEPGPRIVPFSYRSPEQSKGSRTGPFSDYYSLGLTMIILMIGNSFNQF
FT                   EQEFHFYGEVSWRQYVPEINPVLADILERAIHYDPGQRFVTAREMLVALQEVPVEPSTM
FT                   "
FT   gene            complement(108486..108641)
FT                   /locus_tag="AM1_G0112"
FT   CDS             complement(108486..108641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33292"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQK6"
FT                   /protein_id="ABW33292.1"
FT                   /translation="MITLTGRTADYILQLRHQVLRLGLPITEVIFPEDHDQGQNREQTT
FT                   RHYGAF"
FT   gene            complement(109085..109210)
FT                   /locus_tag="AM1_G0113"
FT   CDS             complement(109085..109210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33293"
FT                   /db_xref="GOA:A8ZQK7"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQK7"
FT                   /protein_id="ABW33293.1"
FT                   /translation="MFEANPPIRALIYPFKIILSILYITTRILFNLGQIESIGMI"
FT   gene            109940..110383
FT                   /gene="psbU"
FT                   /locus_tag="AM1_G0114"
FT   CDS             109940..110383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbU"
FT                   /locus_tag="AM1_G0114"
FT                   /product="photosystem II 12 kDa extrinsic protein PsbU"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33294"
FT                   /db_xref="GOA:A8ZQK8"
FT                   /db_xref="InterPro:IPR010527"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQK8"
FT                   /protein_id="ABW33294.1"
FT                   /translation="MRLFIRRFALLTLVVASCLSLMGWLQPVSALDIQGQSNSPGLLAA
FT                   AYRNPVDAKLETDYGQKIDLNNTNVIAFSQYKGLYPTIAGKVVQNAPYSSVEEVLNIDG
FT                   LTEPQKKLLQQHMGDFTVTDPDPALVGGQDRYNTGAYYPVRRS"
FT   gene            110541..111731
FT                   /locus_tag="AM1_G0115"
FT   CDS             110541..111731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0115"
FT                   /product="peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin-type"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33295"
FT                   /db_xref="GOA:A8ZQK9"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR023222"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQK9"
FT                   /protein_id="ABW33295.1"
FT                   /translation="MGQLWNSIFHRFTLLVVGIIFSWGVMSMGWLNNDVGIGWAALPQG
FT                   DAFTNPMSILRLALPVDSQAIHTIHQYLEEMPPQLDDPTARMQPKQWSEVGNQISKAIK
FT                   TFNREASDLLSDIPTPYRPQALVRMNQINAALADLKILSDEQSKDLFVAKRTQAWNSID
FT                   LLAASMVPEYSVNIPEDYQTLPQLNGRAVVALDTSKGPITIMVDGYNAPITAGNFLDLV
FT                   QREFYDDLTFTREDEAYVVQTGNPEGPQAGFIDPDTGQYRSIPLEVMVKGDSEAVYGAT
FT                   LEELGLSLSEPVLPFSAYGTVAMGHPQGDPNGGSSQFFFHLFEPDLTPAGLNLLDGRYA
FT                   VFGYVIAGQEVLAQLQQGDLLRSAKVVDISPPNAFTFRYLDWILVQRLSSSLKGMA"
FT   gene            complement(111771..112067)
FT                   /locus_tag="AM1_G0116"
FT   CDS             complement(111771..112067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33296"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQL0"
FT                   /protein_id="ABW33296.1"
FT                   /translation="MDNSQTILDLLTQVQEKGTSLCASEFQQESWTEYCDEIDYPKQTD
FT                   WDRWRQGFIVQLSEGFESLMTPGKSLGQFSKVWIREIGFEGFSQVVCEWGLHL"
FT   gene            112436..112651
FT                   /locus_tag="AM1_G0117"
FT   CDS             112436..112651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33297"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQL1"
FT                   /protein_id="ABW33297.1"
FT                   /translation="MSGHKTKPLSPLFKAQRFKPEGDEPRTAQVTFRLDQRLKDAIVEH
FT                   VDNQSEWMRMVLAQAAKEQGWLRDWD"
FT   gene            113092..114828
FT                   /locus_tag="AM1_G0118"
FT   CDS             113092..114828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0118"
FT                   /product="transposase, putative"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33298"
FT                   /db_xref="GOA:A8ZLS0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLS0"
FT                   /protein_id="ABW33298.1"
FT                   /translation="MPNKRIDSYHTRVYMNGRDLGLKQADAAYIAEISTRTGQRIEAGT
FT                   HQPNRGRLQDQRTVPDPLADVWEDELEPMLRRDPRLKPMTLYEYLQDKYPGQYPQVLRT
FT                   LQRRVRTWKALHGPSPEVMFELRHEPGVQGFSDFTELKGITITIAGKPFEHLIYHYRLG
FT                   YSGWRYAQIIEGGESFVALSEGLQNAFAACGGVPTQHRTDSLSAAYRNMGGRRSKNLTR
FT                   LYDELCDHYRLEPTRNNKGVAHENGSIESPHGHLKNRIKQAIYLRGSADFTSVAEYQAL
FT                   IDAQVAKLNQQCQTKYEQEKDHLQPLPKYRTPDYEVLTAKVSKRSTIDVRCILYTVPSR
FT                   LIGRQLELHLYHDRIVGYLERHPVVELPRKRVSGKGKRRDRCINYRHVIGSMRLKPRAF
FT                   IYCTWQSDLLPNPEYRQIWEQLKAQFDLEQAAKIIVEALYIAAVQDKEQAVAVYLQQQL
FT                   RSSSLTLNRLKKQFEPPQMKQVPELSIEQHSLELYDKLLPSCSVPAEPLPAPEPLFKKA
FT                   QALPHVDPLGIYRIPSHAGKLVLCGILTSLVRNGGPTKRTSSSKTCPHRSQAPKRKKFY
FT                   QL"
FT   gene            114692..115387
FT                   /locus_tag="AM1_G0119"
FT   CDS             114692..115387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0119"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33299"
FT                   /db_xref="GOA:A8ZQL3"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQL3"
FT                   /protein_id="ABW33299.1"
FT                   /translation="MQENWSYAEFLLALCETEAQRREQARLKRALTEARLPNAKSFTNF
FT                   DFSHCPQLNPAPLMQLAADPGWLERAENCLILGPSGVGKTHLATGVSKKMLEFGKRVKF
FT                   FAANALVQQLQQAKLQLQLHPMLKKLDRYDLLILDDLGYCKKSEAETSVLFELIAHRYE
FT                   RKSLLITANQPFSQWDDIFTDSMMAVAAIDRLIHHGLIIEIQADSYRRKSATQRTAQTQ
FT                   SQPQKSQSK"
FT   gene            complement(115621..115734)
FT                   /locus_tag="AM1_G0120"
FT   CDS             complement(115621..115734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33300"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQL4"
FT                   /protein_id="ABW33300.1"
FT                   /translation="MLSEFTRMTVLMLVMFLNSCKLLTMRSDEVIAVNKQG"
FT   gene            complement(115813..115944)
FT                   /locus_tag="AM1_G0121"
FT   CDS             complement(115813..115944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33301"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQL5"
FT                   /protein_id="ABW33301.1"
FT                   /translation="MEVVSKISLHLLKNGFSISTQKRTLNLTTDIDLKIPKFLDISK"
FT   gene            116093..117244
FT                   /locus_tag="AM1_G0122"
FT   CDS             116093..117244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33302"
FT                   /db_xref="GOA:A8ZQL6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQL6"
FT                   /protein_id="ABW33302.1"
FT                   /translation="MSTPLLYRQLQTQLSQWISPKDHRHLTVFSENIAAILQAQSGCMS
FT                   HWLSYLSHRSCQARSQMERLSYFLHNPRILSETFYAPLLKQFLHAWEGMSMTLTLDTSM
FT                   LWDTYCLIEVCLAWGGRSFPLAQKVMEHGSATVAFVDYCSVLSMTQGVLPPRCHITLLA
FT                   DRGFEHGELIRWLRSSEWSWAIRAKSDLQITLANGRSKPVSKLLPEVEQASLFRDVMIL
FT                   EDIHCHLATASVSTTQEAWAVITDTPPSLQTFAVYGQRFGGIEPHFKDYKSAAFEVPRS
FT                   HIRDTAALERLLMLLAAATLIAISVAFQVIAQDALKTIDWHTHRGLSFLQIGLRQINQL
FT                   CYLRLPLPPLAMLPRQNPPPAYASLKKRAAMKTCIEFAKVTVI"
FT   gene            complement(117362..118033)
FT                   /locus_tag="AM1_G0123"
FT   CDS             complement(117362..118033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0123"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33303"
FT                   /db_xref="GOA:A8ZQL7"
FT                   /db_xref="InterPro:IPR026634"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQL7"
FT                   /protein_id="ABW33303.1"
FT                   /translation="MKLRTFFALKLVYDRHTFRPNILINHFILRRQIYSYLEKTIANCF
FT                   HLEALKRMFPDAFYIHLVRDGRANVSSMIEGWEKIVNVNADLPSSDSNKIQHWSYPMPP
FT                   NWQSQVKHSIEEICAWSWVEHNRVVLEEFEREKSSNYMRIRYENFIENPRTVLEAISKN
FT                   TGLTISADCINYLNSNPHSRTTISPPQKDKWRKKYPNKIRRITPYIEPMMERLGYACSR
FT                   V"
FT   gene            complement(117993..118115)
FT                   /locus_tag="AM1_G0124"
FT   CDS             complement(117993..118115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33304"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQL8"
FT                   /protein_id="ABW33304.1"
FT                   /translation="MAKSISAKKIGISVGIYIRQGMYFWKFNEAKNILCFEVSV"
FT   gene            complement(118407..118523)
FT                   /locus_tag="AM1_G0125"
FT   CDS             complement(118407..118523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33305"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQL9"
FT                   /protein_id="ABW33305.1"
FT                   /translation="MKNTKNSQIASLILANYGIDKLYHPELTHRRGTQVKKK"
FT   gene            complement(118664..118825)
FT                   /locus_tag="AM1_G0126"
FT   CDS             complement(118664..118825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33306"
FT                   /db_xref="GOA:A8ZQM0"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQM0"
FT                   /protein_id="ABW33306.1"
FT                   /translation="MRLKDGLDGLRRNLTAIIEGIKGLTEGLLAVGATVTLAAFTGFTV
FT                   FVGLWMTT"
FT   gene            118886..119029
FT                   /locus_tag="AM1_G0127"
FT   CDS             118886..119029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33307"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQM1"
FT                   /protein_id="ABW33307.1"
FT                   /translation="MSVVRSASHKAQMIHNQDVQAVSTDVINADELWSFVKKSKSTVNR
FT                   KN"
FT   gene            118981..119481
FT                   /locus_tag="AM1_G0128"
FT   CDS             118981..119481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33308"
FT                   /db_xref="GOA:A8ZQM2"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQM2"
FT                   /protein_id="ABW33308.1"
FT                   /translation="MVFCQKKQKHCEPEELSVGDCWIALSLAKDSGLVLSGRIGKHTDE
FT                   LAQELIENTEGKTACHHWQTDGWEGYSRQFPDEVIHQVSKALTQRLERTNGILRQQTGR
FT                   WHRRQNKFGKVWQQSAVTLRLVLAYFNWIWRHSRFKNTAAQRAGLTEHPWEWQNLATYP
FT                   TLC"
FT   gene            complement(119489..120538)
FT                   /locus_tag="AM1_G0129"
FT   CDS             complement(119489..120538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0129"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33309"
FT                   /db_xref="GOA:A8ZQM3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQM3"
FT                   /protein_id="ABW33309.1"
FT                   /translation="MKVLVTGSSGLIGSEAVEYYDHEGCQVFGVDNNMRAEFFGAQGDT
FT                   LWNLSRLKEGTQNFSHHSIDIRDRQSIFELFEAEKFDLIIHCAAQPSHDKACQIPLLDF
FT                   EVNALGTVNLLEATRQFSPEAVFIHMSTNKVYGDAPNEVPRIELEKRYDYANPEDHNGI
FT                   PETCRVDRCLHSLFGASKAAADIVAQEYGRYFGMKVGIFRGGCLTGPSHSGVELHGFLS
FT                   YLVKVAVSGRTYKVFGYQGKQVRDNIHSYDVIQAFEAYRKNPRPGEVYNLGGGRDNSVS
FT                   VLEAFDRVEAITGQKVQWEYVETNRIGDHLCYISDLSKLKSHFPDWGITRSLDNIFQEI
FT                   VEAEQSRQN"
FT   gene            complement(120581..121837)
FT                   /locus_tag="AM1_G0130"
FT   CDS             complement(120581..121837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33310"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQM4"
FT                   /protein_id="ABW33310.1"
FT                   /translation="MKTIALIETNSGNGHHLTYLRLFSKTLLEQQYQVMAFYPRPVDLT
FT                   DWIEEHCPAYRDRLWTFEMHKHKRRRVPVLGTVPGPIAVIERWQHLAKSIRNASEEIGH
FT                   SPDYVFFNWLDNYLSYYLVHHIIDAVFPYNWAGLYFRPGILRFGQRSLKGLSKPLAHYA
FT                   IARSPRCYALAMLNEELVDDIQEDLGKTVVAFPDITDETQPQTDYELIKEIRQKAGDRK
FT                   IVGLIGALSKRKGILTLLEVARQSVQENWFFVFAGALDETMFHQDFDQRFGDEFQQIKK
FT                   MRDEPPSNCYFHFEFVPDGYAFNSMIDTCDVLFAAYENFPYSSNLLTKAALFKKPIIVS
FT                   EGYCMAARIEKFRLGVTMPEGDVARCIDALRYLCDCSDQALSELNPDFEGYYRLHSIEQ
FT                   IRTVFSEILNEANVLPAVV"
FT   gene            121949..122062
FT                   /locus_tag="AM1_G0131"
FT   CDS             121949..122062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33311"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQM5"
FT                   /protein_id="ABW33311.1"
FT                   /translation="MKYNTDSVDITLKAHVEVSNPPMIRCTVQDDGVGIDS"
FT   gene            complement(122207..122359)
FT                   /locus_tag="AM1_G0132"
FT   CDS             complement(122207..122359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33312"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQM6"
FT                   /protein_id="ABW33312.1"
FT                   /translation="MHDRFYGNILTWRFYSECNPNAGQKTWKNLQVSSFWTDLVKWTIP
FT                   AETKM"
FT   gene            122477..122743
FT                   /locus_tag="AM1_G0133"
FT   CDS             122477..122743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33313"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQM7"
FT                   /protein_id="ABW33313.1"
FT                   /translation="MTNSDSQRWTDDRLDALAASTQSLLDATQANTATIGQVLEQQKVT
FT                   DKKIELLIEGQLAMQTLHGQLAEQTSQLKRAVDYLLSKDGGQF"
FT   gene            122747..122974
FT                   /locus_tag="AM1_G0134"
FT   CDS             122747..122974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33314"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQM8"
FT                   /protein_id="ABW33314.1"
FT                   /translation="MESDEIIIRYYHQPKPVMVDPGKSHPCYEPDLLLGWICKGDSKKP
FT                   VLKKFPDAEIVAKVKPDTKPKTRTKLRRIQ"
FT   gene            123612..124205
FT                   /locus_tag="AM1_G0135"
FT   CDS             123612..124205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33315"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQM9"
FT                   /protein_id="ABW33315.1"
FT                   /translation="MKSTSERYNSLASSYIKLSDEFHQLDVAHMDLKQKLLPAIKAIKN
FT                   YQSLTHQLQQDNTKLEQTIQTLTDQQQRLEEDQRTLKAKEVEQSIIINALTDEKTNLQA
FT                   ALEEFQAKYDALADFESLLQSGPQAVLAEAEQQMLLVEETLQEIALNSDPDLSENEQQL
FT                   IEAYQDEDESLFISTEISKDSSSLKIPNILSFVA"
FT   gene            complement(124297..124524)
FT                   /locus_tag="AM1_G0136"
FT   CDS             complement(124297..124524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0136"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33316"
FT                   /db_xref="GOA:A8ZQN0"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQN0"
FT                   /protein_id="ABW33316.1"
FT                   /translation="MAFLNAVLAAKGMDLDAKGESNEQLRGHNPSYRISVQTDGKLLLG
FT                   SAYTKKMNLQPGDEFEISLGRKHIHLSKVA"
FT   gene            124858..125121
FT                   /locus_tag="AM1_G0137"
FT   CDS             124858..125121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33317"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQN1"
FT                   /protein_id="ABW33317.1"
FT                   /translation="MLYEKTISFEDYKQDKPNILGRQLGISLKFHHSNILQKLSQEAAL
FT                   QAMVEAWQSCHSKQTYECSSKDFTITVPSQEMANILECRNLL"
FT   gene            complement(125266..125679)
FT                   /locus_tag="AM1_G0138"
FT   CDS             complement(125266..125679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33318"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQN2"
FT                   /protein_id="ABW33318.1"
FT                   /translation="MVHIPNLTQQQLELLRIAKKHSVEELQLSYEFPVVDSSELRNGHP
FT                   PFIQELIDLHLIQVREVETSMLASAFQQSSWAEFCEDLDYPTQADWDRWRKRFIAQLGE
FT                   GIEQLMTPGKELGQFTKVWIREIRLQAVQPSNL"
FT   gene            complement(125757..126203)
FT                   /locus_tag="AM1_G0139"
FT   CDS             complement(125757..126203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0139"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33319"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQN3"
FT                   /protein_id="ABW33319.1"
FT                   /translation="MTTNTRTLYDRDVVEWADRQAQLLRDGRFDLLDLENLIEEVEDVG
FT                   NRHRDKVKSQLKRMLWHLLKIKYQPSKHTDSWDITIVDAANQIKDEFEDRPSLRRHLEE
FT                   SFDLCYKRARRDAANETRLDISTFPMQCPESIRVKAWELINSDD"
FT   gene            complement(126200..126439)
FT                   /locus_tag="AM1_G0140"
FT   CDS             complement(126200..126439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33320"
FT                   /db_xref="GOA:A8ZQN4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQN4"
FT                   /protein_id="ABW33320.1"
FT                   /translation="MMKTMHQAVIKWKLHELLSIQRKTSRDLAQFMGIHENSVYRLRKS
FT                   EVMPRLTHETLDKICEFLDCSPGDLLIREKEDKP"
FT   gene            126597..126971
FT                   /locus_tag="AM1_G0141"
FT   CDS             126597..126971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33321"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQN5"
FT                   /protein_id="ABW33321.1"
FT                   /translation="MYSTVLKPLTTQQQTQPDMWLVQTEADGIAFINEHTEDPLCPPYT
FT                   LACVLLKDCGPFDSDIDIDFDEHWVLMVTRKPTPEERTTQTRIENWVLYHHELKGALSD
FT                   WYTVQADQTVRAENDYDDEF"
FT   gene            127042..127419
FT                   /locus_tag="AM1_G0142"
FT   CDS             127042..127419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33322"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQN6"
FT                   /protein_id="ABW33322.1"
FT                   /translation="MITAEDLQIELAHCHCSESHYQHWLGIRYTEGVKTLAEKGECFWL
FT                   LDVIASYQRVRLIKCNPNLQEFQLWLLTVNDDHSAVLACYEDSASTCSPVITQDIPFTD
FT                   FVLPEIKLYVEYGVVLLPSEH"
FT   gene            127485..128468
FT                   /locus_tag="AM1_G0143"
FT   CDS             127485..128468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0143"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33323"
FT                   /db_xref="GOA:A8ZQN7"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQN7"
FT                   /protein_id="ABW33323.1"
FT                   /translation="MNPQDYDRTIIMFSGGKDSLACILWAIENNCPKIELWHHLVDGLP
FT                   VQGQTASTLMDWPITSTYCKAVAQLLSIPIYFSWLDGGFEREMNRSNQAKAKTWFEAPD
FT                   GLRSAGGNGGKQSTRQKFPQISADLSIRWCSAYLKVDVSAIAIRNQPRFNDSKTLVITG
FT                   ERAEESPSRAKYAEFEPDRTDNRNGKSKRHVDRFRPIHGWKESEVWAIIQRHGIIPHPA
FT                   YHLGWGRLSCMSCIFGSANQWATIRKIAPAHFERIANYEQQFDTTIQRQRSVREMANLG
FT                   TPYAEANNSQLVEIALSSEWGDYPIWTHLQAWALPAGAYGESNGPT"
FT   gene            128576..128848
FT                   /locus_tag="AM1_G0144"
FT   CDS             128576..128848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33324"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQN8"
FT                   /protein_id="ABW33324.1"
FT                   /translation="MKPTTRYKLIPQVQFTTTIELHDQQTAILNRLVLGSKDLTDDEAL
FT                   DLWLSLNPYVHTFQHSTPRDIFSSLRYAALAALPDNPKPAYPWSC"
FT   gene            128963..129091
FT                   /locus_tag="AM1_G0145"
FT   CDS             128963..129091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33325"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQN9"
FT                   /protein_id="ABW33325.1"
FT                   /translation="MTATLDNNATRNALTKAIKEHIDPAKPEKVNIKKIHRQTVQT"
FT   gene            129192..129602
FT                   /locus_tag="AM1_G0146"
FT   CDS             129192..129602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33326"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQP0"
FT                   /protein_id="ABW33326.1"
FT                   /translation="MLTLEATGLEQRKTNKAKCSPLKEAVFKVLKQVAGQDILMVVALN
FT                   ELMDQLTVTRINSWETFFKQLAIKRTELESLADTVYELSGVSPGAVEDLDAVIVPLYNE
FT                   AKGQDIKAINWERRSWWDWAHNHLLEQVSKAA"
FT   gene            129701..130081
FT                   /locus_tag="AM1_G0147"
FT   CDS             129701..130081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33327"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQP1"
FT                   /protein_id="ABW33327.1"
FT                   /translation="MQAHHLNLAEFLLNPPTVNLAYSPVAVMTVATAKNLMQSQELLLS
FT                   GAQKLFNPAVWPQLEPEIERIPFDRQKAQCFRDCVAYLMAEATTLRSERRHVDALKHME
FT                   AALMLEALVHGGYDEGPFVSEQ"
FT   gene            130155..130487
FT                   /locus_tag="AM1_G0148"
FT   CDS             130155..130487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33328"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQP2"
FT                   /protein_id="ABW33328.1"
FT                   /translation="MNHTTLPQRVIDSIDLPSYELHTRPTGENDRKLNVFFGSRLIGYV
FT                   YINFIQGQSNYVGTTLRYQSFGPYSRRTEAAEAVLEAFNAGLTDEQRLRVALAHEMAEN
FT                   MTVIAC"
FT   gene            130616..130930
FT                   /locus_tag="AM1_G0149"
FT   CDS             130616..130930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33329"
FT                   /db_xref="InterPro:IPR025475"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQP3"
FT                   /protein_id="ABW33329.1"
FT                   /translation="MFAESERDRCIAAFRVFLYEVAILGNEPSQDLIRRIAEQHKVMPS
FT                   GSYKPFGRGAMMAALEALGQKSEVTLLCWCHPKPCHCDVIKAFLEWKCPAPQQQTLEVL
FT                   "
FT   gene            131149..131307
FT                   /locus_tag="AM1_G0150"
FT   CDS             131149..131307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33330"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQP4"
FT                   /protein_id="ABW33330.1"
FT                   /translation="MAHLDQDPQNNHPDNLKALCAPCHLKFDAPFRKANAYTKQEWFGQ
FT                   MKLEDLS"
FT   gene            131304..131564
FT                   /locus_tag="AM1_G0151"
FT   CDS             131304..131564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33331"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQP5"
FT                   /protein_id="ABW33331.1"
FT                   /translation="MNKQMWNFIQRGRGVLQLKPLGCLSNHSPSFCSGCEPGQYYECQA
FT                   CGYLQPWCKGADDDYPEICDDCWAIAEQLHKTIKTPMESEK"
FT   gene            131561..131866
FT                   /locus_tag="AM1_G0152"
FT   CDS             131561..131866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0152"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33332"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQP6"
FT                   /protein_id="ABW33332.1"
FT                   /translation="MNAATNKLTPSTQPKAVLQPLSQQYQFQSHDPSHERALGFGDSPS
FT                   ALALFCDRSKTSTWYILDKDSEPVELLKPALTGYLISIEFVPKEFRGKPSGRFKSG"
FT   gene            complement(131942..132241)
FT                   /locus_tag="AM1_G0153"
FT   CDS             complement(131942..132241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33333"
FT                   /db_xref="GOA:A8ZQP7"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQP7"
FT                   /protein_id="ABW33333.1"
FT                   /translation="MKTLLIGLIQFYRRFISPLFLPSCRFQPTCSAYAIEAISTWGVLK
FT                   GSWLALKRISRCHPFHPGGYDPVPTAAVKPSAQIDSESADPNKERHGSSSRMSG"
FT   gene            complement(132571..132780)
FT                   /locus_tag="AM1_G0154"
FT   CDS             complement(132571..132780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33334"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQP8"
FT                   /protein_id="ABW33334.1"
FT                   /translation="MFDCPICSHELLPHISHGQICWFCHYCWQDFPNLEEVSVEQPRKA
FT                   VILQDPINAHRLQKRPELLGPLAV"
FT   gene            complement(133334..133981)
FT                   /locus_tag="AM1_G0155"
FT   CDS             complement(133334..133981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33335"
FT                   /db_xref="GOA:A8ZQP9"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQP9"
FT                   /protein_id="ABW33335.1"
FT                   /translation="MSRHVLLVFAVFSIFFMKNKKIGIIGLFFIFLSIFIYYKWEEKIY
FT                   TIKPLTKNILLKSNDSIYFDIETNYDISENRYNVIFKINNSELLEIDCNIIELIKPRLS
FT                   SIKGKNKSTKNKLISEKFSCKKYNDILILSSNTISFSKNNIYRLSVKNEAGLSEYLSFQ
FT                   LNIQSSNSINTHYLWMDVTFLVILGYTTFVIGVIFCLICIVLFIKQRRTSKS"
FT   gene            133970..134098
FT                   /locus_tag="AM1_G0156"
FT   CDS             133970..134098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33336"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQQ0"
FT                   /protein_id="ABW33336.1"
FT                   /translation="MPTHKELVAPGAALADLVVSGEGDVEGTVEKILARFLDLGSV"
FT   gene            complement(134106..134522)
FT                   /locus_tag="AM1_G0157"
FT   CDS             complement(134106..134522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0157"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /EC_number="1.13.11.39"
FT                   /EC_number="1.13.11.27"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33337"
FT                   /db_xref="GOA:A8ZQQ1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQQ1"
FT                   /protein_id="ABW33337.1"
FT                   /translation="MTSTPKESMAQNQFSGLSPILNVSSIPTSIDYYVNVLGFQKDWDW
FT                   GDPPTFASVSRDDVCIFLCQGAQGQPGTWISIFVADVDALFIDYKAKGAKIRQAPTNFS
FT                   WGMREMNIEDPDGHRLRVGSATNEPSDGVPLCED"
FT   gene            134641..135072
FT                   /gene="umuD"
FT                   /locus_tag="AM1_G0158"
FT   CDS             134641..135072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="umuD"
FT                   /locus_tag="AM1_G0158"
FT                   /product="SOS mutagenesis protein UmuD, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33338"
FT                   /db_xref="GOA:A8ZQQ2"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQQ2"
FT                   /protein_id="ABW33338.1"
FT                   /translation="MLIRSVHAVEWADPVCLPIFSAPVSAGFPSPADDHLQKNLNLQDA
FT                   LIPRPAATFLMRVEGDSMEGCGIFSGDLLVVDRSIDPVDGAVVIAVLEGEFTVKRLRKT
FT                   QGKILLTAENPDYPPITVQRGMDFSVWGVVTFVVHGLEA"
FT   gene            135144..136334
FT                   /gene="umuC"
FT                   /locus_tag="AM1_G0159"
FT   CDS             135144..136334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="umuC"
FT                   /locus_tag="AM1_G0159"
FT                   /product="DNA polymerase V, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33339"
FT                   /db_xref="GOA:A8ZQQ3"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQQ3"
FT                   /protein_id="ABW33339.1"
FT                   /translation="MQHKPVVIASNNDGVVVTANAKAKALGLVMGVPLFKVQELIKKHD
FT                   VRVFSSNYALYGDLSSRVMTILETFTPEQEIYSIDECFMRMPEFAEATTYSHKVRKTVL
FT                   QWTGIPVSIGIATSKTLSKIANHVAKKQKQYGGVFDISTARNAEGILATFPVADIWGIG
FT                   RQYNKWLLSQGIETAKELRDANEGLIRKKMGVVGVRMIHELRGISCLPLELVAKPKKET
FT                   CVSRSFGQPVTELADLQEAIAAYASRAAEKLRHQEQVSEAMVVFVRTSPFKPGYFRQSA
FT                   TVQFPIATNYTPTIVESARNAMKRIYEPGREFQKAGVLMVGLCPETTIQGHLWEKDEGW
FT                   EKRKRLMSIMDEVNDRFGRGTLEIAASGLRQTWRMQSKWRSPRYTTCWAELPVVSC"
FT   gene            complement(136399..137514)
FT                   /locus_tag="AM1_G0160"
FT   CDS             complement(136399..137514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0160"
FT                   /product="pentapeptide repeat family protein"
FT                   /note="Member of Ion channel PFAM, PF07885."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33340"
FT                   /db_xref="GOA:A8ZQQ4"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQQ4"
FT                   /protein_id="ABW33340.1"
FT                   /translation="MANPEHVVELKNGVDSWNRWRESHPGVKPDLSQIDLCEKNLSGVK
FT                   LSEANLSQSLLGGTVLTKACLKGANLTGSYLAGAILKKADLRLANLSGIDFWCVDLSEA
FT                   NLSGVDLRGTIFDNVDLCGTIAKFSLVDGKTGITDCRIDDKTNFSAVGLDSARIEEHIK
FT                   SKLKRNIRKIFWNKQYANWRKWKKHYLHWLKRNNKRINILQKIPALILETPGLSLILVF
FT                   AINIFVSAYTQVIRIFWWISDYGSSTTKIICTFVGCSLFFSIAYLIGTPAPDGDSWPTP
FT                   FANPFLVDFSDDILNQSLCKKNLGFICLFELWFRSLYFSVVTMTTLGFGEIHAHPLSIT
FT                   GQFLVMSQVLIGYVLLGALITRLSILFQNVG"
FT   gene            complement(137634..137987)
FT                   /locus_tag="AM1_G0161"
FT   CDS             complement(137634..137987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33341"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQQ5"
FT                   /protein_id="ABW33341.1"
FT                   /translation="MTQLAPIHLNDGTVIYIEAEDDVSAHPQPESEGTTRTSKGMGDVA
FT                   LKNFQAMQGTIRTYTAYTLNAFKEVATANVDKVTLEFGVKVAGEGGVPYITKGSGECNL
FT                   KITVECSFGDREG"
FT   gene            138080..141193
FT                   /locus_tag="AM1_G0162"
FT   CDS             138080..141193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0162"
FT                   /product="peptidase C14, caspase catalytic subunit p20"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33342"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQQ6"
FT                   /protein_id="ABW33342.1"
FT                   /translation="MSRDALIVGINRYQYLPDLKAPALDAEAIAQRLEDDGEFDTLYRL
FT                   PEIIIQGETKKPEIGEKGSVFITKLKQALTQLFLPKSQQIPKTALFYFSGHGLPDQDLV
FT                   GVDKGYLAASDTNKNNPSSGLSLLWLQSLLSKSPIQQQIIWLDCCHSGSILVNVGAANP
FT                   GHGESKDRCFIASSRDFEESWEDLNSPYSVLTKALLDGLDPKPLPGRWIDTFSLVDYVN
FT                   QALKGELQTPVCTNFGEAINLTRSWQVQEESTSVSQVDSGICPYKGLEFFDCNDEDPKY
FT                   FYGREQLVGQLLDQVRTSNFLALVGASGNGKSSVLRAGLLHQLKLGRRISGSEQWRIRI
FT                   ARPDRQPIQNLALAFVEEGLSDGDRAIALDKVVGLLDKGTAGLQRLVQASAAPRTVLVI
FT                   DQFEEVFTRCENPEEREHFFACLMGALLDVDNKLCLIIAMRADFIVKCMEQEYSGLARL
FT                   IDQQMVSVLPMKTNELRAAICRPAEQVDLQVESALVTEILNDIEGAPGSLPLLQYTLKE
FT                   LWNQRQDNQLTFASYQILGGIQGTLDQRATAIYNSFDKAEQQTVQHIFQQLTQLGEGTE
FT                   DTRRRVFQDDLITEPKHPAQRVQQVIERLSSPENRLIVTSEVVSKSDQSTRMSIVDVAH
FT                   EALIRHWKLLRQWIELNRDLLRKQRRIEASAISWRNQGQKSGYLLQGLPLIEAIQFNKD
FT                   KSVTFPLSDNSKAFIQKSVRERRLNQLKAGAWLIVPALLILIVSEYIIRESGVSRNYVQ
FT                   LDGARSTGEKQAVDSLVGGCNAQKEVQWLPSYLAERLFGNCRPLIQAQLEHAKLRHADL
FT                   RSAILIRANLFAADLNFTDFSDADLRYADLRRTDLNFTDFNHANLNFTKLGNANLNGTN
FT                   LSDANLIGTNLYSADLRNAILIRANLFSTNLSNVNLYSADLSSTDMSSANLSNADLIRA
FT                   NLSGADLHNTDLFYANLSNANLSNANLSNAILLSSNLRETKNLTQAQLEGAEHPLICNS
FT                   PLPQNIRIDRNRDCDKVAAVLHERYPQLFRDIEEAEKHVEEQRQSKWN"
FT   gene            complement(141473..141661)
FT                   /locus_tag="AM1_G0163"
FT   CDS             complement(141473..141661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33343"
FT                   /db_xref="GOA:A8ZQQ7"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQQ7"
FT                   /protein_id="ABW33343.1"
FT                   /translation="MCLYTGFRIGEACILLTSDVVNVSGPKPSVLFRWHQTKGKRDTRE
FT                   VTMHPQLHEYLVAYALT"
FT   gene            complement(141780..145484)
FT                   /locus_tag="AM1_G0164"
FT   CDS             complement(141780..145484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0164"
FT                   /product="WD-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33344"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQQ8"
FT                   /protein_id="ABW33344.1"
FT                   /translation="MPSGCQVDANFKPITTQCKLNYVFNSGTKNLSLGLFQMSRVNFST
FT                   EISPQLKQKIITAFYEKYRKSEYSRLQISKFLHDWEQTISEKVPSDQTIHNFLNSKYSS
FT                   YKYWLVDGLCRLLLGQPYDQLNLLEPLSETQTRIKHARCGEFRCNWGDAPDVSIFFGRT
FT                   RELSMLQRWIVDDHCRLVAIVGIRGSGKTHLSVKLGHGGVGKTDLSLKLANGIQEDFDF
FT                   VFWGKLLNAPPLRDYLTEVVKFLSHQQETELPGSEDKQISRLLYYLQSRRCLLILDNFE
FT                   SILQGGEQAGNYRQGFEGYGQLVQKIRDVNHQSCLLLTSREKPRDIRPVTGGGNHIQCL
FT                   ELQGLSVEEAHQLLTQLGEFTATDKDWEHLLSFYDGNPLALELAANHINEVFNGSISAF
FT                   LREGRPIFDDLKQLLDWHFERLSWKEQEVVYWLALHREPVSISTLRTDLLRVGDKWDLP
FT                   STLQNLKRRLPLEKSSVGFTLQPVLIEYLTDRIIRQVIQELETNALDIFNRFALCKPVA
FT                   KDYLRKTQARLILEPIAQLFAADQRPLLQFFQYFREHPQFSQGYAASNCLHLLRWLQAD
FT                   LSGCNLSQLTFRQADFQGMTLHQIDLTGSDFRNCTFTQSFGAFFSVAFSSDGQSMVTGG
FT                   NDGQITIWDMHSYQPLKILQGTGDWVWCVTFTPDAQYLVSGSDDSKVRVWSVESGECLR
FT                   VLSGHRDRVWSLDISPDGQTLATVSDDNTLKLWSLDSGACLRTINDVHGASPKSICFSP
FT                   HEETLATGSEDGTVKLWDIRSGQCLWTGTGHSNMVNSVTFSPDGNLLASAAWDNAVMVW
FT                   SIRTRSCLAKLQGHQSIIWDAAFSPDGKWLASSDHQGVIRIWKIASYQCFRTIQAHASV
FT                   IWGIAFSPDSQLLVSSGGESMVKLWRVDTGVCQQTLQGYINRTWSVSFHPNGQTLANGH
FT                   EDGTLQVWDIHTGHNRQVFRGHQNWLWGVAFSHQGQILASACQDGVVKVWSYPDGHCLH
FT                   SIEHGNRVFPLAFSPDGKWLATGCDDSFVRLLSVASGECLKQLIGHTNRIWGLAFSPSG
FT                   HIMASGSDDLTVRLWYLESEESLVIDVGTRVRSVAFSPDGQILASGSDYESIQLWSVEM
FT                   RKCIRELPGHKQFIWSVAFSPDGECLASASQDQTARLWSLETGECLQIFQGHTARVISV
FT                   EFSPDGQTIATASDDGSVKLWDLHSAQCIRTFRPSRPYEKTNISRTTGLTDAQKSSLIT
FT                   LGAVDDLFG"
FT   gene            145467..145592
FT                   /locus_tag="AM1_G0165"
FT   CDS             145467..145592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33345"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQQ9"
FT                   /protein_id="ABW33345.1"
FT                   /translation="MASTWHPLGINSISEYKKLLIKFKSRFSHLQLRYDYDYKSK"
FT   gene            complement(145923..146051)
FT                   /locus_tag="AM1_G0166"
FT   CDS             complement(145923..146051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33346"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQR0"
FT                   /protein_id="ABW33346.1"
FT                   /translation="MSLILRKSELKLLGLRFSNERPILISWKIVEFGMIYSNNLEC"
FT   gene            146282..146455
FT                   /locus_tag="AM1_G0167"
FT   CDS             146282..146455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33347"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQR1"
FT                   /protein_id="ABW33347.1"
FT                   /translation="MICSNVDMIRKFSHSIFIALKTIEEKNLSIGIPFMTVHSMNRNTY
FT                   SYLKLSRNKVEI"
FT   gene            146522..147112
FT                   /locus_tag="AM1_G0168"
FT   CDS             146522..147112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33348"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQR2"
FT                   /protein_id="ABW33348.1"
FT                   /translation="MLNIKNKGISLNGACKLSWIIFFFLLTSCSYSDKNNIQITDEVLD
FT                   VHINYAKSYITVQRYRYPGIPWPEKTDNTDIYITMLNGFIQKYVSAFNASNSTLNFSVD
FT                   QNFTLVIGQVIYAGNWSNKNGKISFNGKLDKLGNNSIPKTSGCNDSQTIEGEKIKEDLV
FT                   IISFKENHECDSTSKEGSSLYKSSVSYKIRLKS"
FT   gene            147220..148152
FT                   /locus_tag="AM1_G0169"
FT   CDS             147220..148152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33349"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQR3"
FT                   /protein_id="ABW33349.1"
FT                   /translation="MNLSRSTASLFGSFIVILIDASITLGNVPSNRQTVHFIKSSPIAD
FT                   SRFLLDGCKISVLRDTRDDCKKTNSTESQTTNPSTDSKKGQKPSNEIKKSLIISDHSFF
FT                   SWNLPFFTWPIASKLATHPHIDLIKTSSLESTEPIRDWSMYDEIVVMVHEIIGQPNKIS
FT                   SGDTPQSLAAKLRKRRINKYASIELVICNGGTAQLGSDKQSFASLLAAYLDRPIIAYTH
FT                   PVRVEASYCFKGCNTSRIVRSNRLEHNKEGTKYEYLISDKPIDRRLYYPNKSSSSISGI
FT                   PNIILINNLKKANQPSAQPLKIQLPPRND"
FT   gene            148599..148715
FT                   /locus_tag="AM1_G0170"
FT   CDS             148599..148715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33350"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQR4"
FT                   /protein_id="ABW33350.1"
FT                   /translation="MILVYVNGSFYKLGLGSSDDSMFFLSGFKNHCSEALRD"
FT   gene            complement(148771..149148)
FT                   /locus_tag="AM1_G0171"
FT   CDS             complement(148771..149148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0171"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33351"
FT                   /db_xref="GOA:A8ZQR5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQR5"
FT                   /protein_id="ABW33351.1"
FT                   /translation="MAKKAAAKKQGKQPLVGKELLNKLKDLSHLSKREKAKECGYVVGK
FT                   KVNLSGFMNAILEAKGISLDGDANSDGRGREASYRIKVHQNGQMVIGSAYTEKMGLQTG
FT                   DEFEIKVGRKHIHLTQLTEDE"
FT   gene            complement(149351..149464)
FT                   /locus_tag="AM1_G0172"
FT   CDS             complement(149351..149464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33352"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQR6"
FT                   /protein_id="ABW33352.1"
FT                   /translation="MGQLSCQVKPETVMWYDDNWKDLQEEVMGCFQGCWGR"
FT   gene            149859..154559
FT                   /locus_tag="AM1_G0173"
FT   CDS             149859..154559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_G0173"
FT                   /product="FG-GAP repeat protein"
FT                   /note="similar to Na-Ca exchanger/integrin-beta4
FT                   [Trichodesmium erythraeum IMS101] and Integrins alpha chain
FT                   [Anabaena variabilis ATCC 29413]"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_G0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33353"
FT                   /db_xref="GOA:A8ZQR7"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQR7"
FT                   /protein_id="ABW33353.1"
FT                   /translation="MKFQFPPLLSVENSQRLVIIDPTIDAPQHLINGVLPGTSVVVLDP
FT                   QQKSVPQITKALQAHAPIVELHLVSHGAPGQVQWGNGPLTLANLGEYAAELQQWRSLLG
FT                   EAAAVFFYGCQVAAGELGQQFVQRLSQLLGTGIAANKSVTGSAAMGGNWDLSYEQSPAW
FT                   SSHRLSTLLPFTATTLYTYPAHLAVDFSIQSTFAAGTNPASVSLGDFNGDSQPDLVTAN
FT                   ILINNVSVLLGDGSGGFSSQTTFAAGTFPNSVSVGDFNGDSLADLAVANQISNNVSVLL
FT                   GDGSGGFSSQTTFAAGSRPFSVSIGDFNGDSLADLAVATPASNNVSVLLGDGSGGFSSQ
FT                   TTFAVGITPFSVSVGDFNGDSQPDLVTANFDSNNVSVLLGDGSSGFSSQTTFAAGTNPS
FT                   SVSVGDFNGDSQADLVTANNGSNNVSVLLGDGSGGFSSQTTFAVGTDPFSVSVGDFNGD
FT                   SQADLVTMNFASNNVSVLLGNGSGGFSSQTTFAAGTNPASISVGDFNGDSQADLAVANS
FT                   SSNNVSVLLNTTPIDHAISVDTPQIIEGDSGSQTLTFTVTRSRFIGSVSSVDFTIAGTA
FT                   INGSDFTNIGGTSGATTTSGTINFAAGETSKTITLDVLGDTNFEPQETIAITLSNATAA
FT                   VNTTISTATATSTILNDELFADFSVQSTFAAGIRPSSVSVGDFNGDSLADLAVANDGSN
FT                   NVSVFLGDGSGGFSSQTTFAAGSRPFSVSVGDFNGDSQADLVTANLISSNVSVLLGNGS
FT                   GGFSSQTTFAVGTNPRSVSVGDFNGDSQADLAVANIGSTNVSVLLGDGSGGFSSQTTFA
FT                   TENSPISVSVDDFNGDSQADLAVANNSSNNISVLLGDGSGGFSSQTTFAVGTNPRSVSV
FT                   GDFNGDSQADLAVVNGSNNISVLLGDGSGGFSSQTTFAVGTNPRSVSVDDFNGDSQADL
FT                   AVVNFVSNNISVLLGDGSGGFSSQTTFATGIDPISVSVGDFNGDGQAEIAVANYSSNNV
FT                   SILSSNTTLVALDSSRNLVITDRSNAKDDNLTLTTDGTNFTLTDPNNLLTHVISGATGN
FT                   ATNNITVPTTLVTGPQLFINTGGGNDIVSGSSQSETINGGLGADLLNGGAGDDVLTDGA
FT                   SNGTVNPNAAAVDPSRVATTAFTSTSGWSNDTLFPRQIADVNGDNRADIIGFGNSSVAV
FT                   ALGQADGTFGTAFTATTAFARTTGWTNEDQFARRLADVNNDGFADIIGFGNSSVAVALG
FT                   QADGTFGTAFTATTAFTRTTGWTNEDQFARRLADVNNDGFADIIGFGNSSVAVALGQAD
FT                   GTFGTAFTATTAFTRTSGWTSEDLFSRHVADVNGDGRADIIGFGNSSVAVALGQADGTF
FT                   GTAFTATTAFARTSGWTSEDLYPRQVADINGDGQADIIGFGRSAVAVALGQADGTFWTA
FT                   TVVNQGSTANPDFTVAGGFNSANANPRFVADVAGNGQADIIGFGNNQVRVANVVAVNDS
FT                   LLGGAGNDRLVGGAGNDLLTGGADADRFVFDANAAVSGINRITDFNAVEGDRLEITQAA
FT                   FGITNLSEITFNATTGELFVAGTYNNTLAIFTGQSGFDVNTHITLV"
XX
SQ   Sequence 155110 BP; 42355 A; 36202 C; 34514 G; 42039 T; 0 other;
     acccgttttg gttatcccac caaggatgct gcgcaaagtg ttgatgtgcc actggacaag        60
     agtcattgaa gacatcagcg aacaaactca ccatcaagaa agcgctcatc actatctccc       120
     accacttttc aatttgttcg tagtgcgtca tgcgaaaatc agcccaaccc aaggtatctt       180
     tagactgttt gagaccatac tcaatccaag ttctgaagcc atagcaatcc ccaatttcat       240
     ccagcttgat ctcgggtgcc gctgccatga cataagaggt tgagttctct ggtagcgttt       300
     gggggtccgt ggttaatagc caatagcgct tctggtggtg tcgctggcca taaatgatct       360
     cttgcctgta acgagtttca gtggtgccat tgctgaaggt tcgttcaaat gactgccacg       420
     gttcggcaaa gactgcttgt tctgcgggta accacaccgc atgattgcta cgaatcgcta       480
     ggatataggg cagctttaac tcctctaaga cattcacaaa gtttgtttga gcttccccat       540
     acaagctgtc agccaggacg agctcaaagc aaaagcccat cccttgcaac tgtcggatca       600
     ttccagcagc aatttggggt ttgctgagat actcatcctc ctctttaaga cgttctcggg       660
     gtttgtacac ttcaaaggac aaaggcaaaa tcatcccttg aaacagcccg taggcagtga       720
     ctgcgacgat gccattctct ttcttgccca cattgccgat atactgccgt ttcacatagt       780
     cggtactctt gccttttttg caatcgcccg tctcatcgat caatagaatt aacctgcgcc       840
     catccagtat tttcaagatg atgtccaatc tcttgtcaga caaatgtgac gctacccaag       900
     gtgattcact cagaaaatga tgcaggcttt gatggttctc caagcccact gctcttgcaa       960
     tggcgggcaa tgatttacgt ttgatatcac taatcatccc cagatggaga tgcttgaagg      1020
     cttcataact gcggacttgg ggaaataact ctgcaaatag ttggcagtac tcatcaacaa      1080
     agccaatggt tggttctgga cttcttgaag ctgacatcac tcattagaaa aatagaaact      1140
     gagaatagtc tattttttat ctgtctaaag tgataaaaga gggataagaa cgaccatgcc      1200
     gaccaggaaa caggtaggtg cgagtcaggt caggtgcata agccactaaa tagtcatgca      1260
     actgggatgc atcggcactt atcgcgtatc acgcttgccc ttcgtctgat gccagcgaaa      1320
     caacaccgat ggcttgggtc cactgacgtt gtgtaatgga atttgattaa tagtgactcg      1380
     gctaataaaa actggcttct tcaactcatt attaaagtgc aataatagct ttttaaaatt      1440
     ttataattac tttacccatt tcctttttat agataattac aatgttgtaa gagaaaagta      1500
     ttgataacaa actgacaact attctaaaac ttttaaatgc ttacattcta gaaagaaaga      1560
     aatcaaaaat attccccgta agctacatta gaaatatgta atttactaaa attattcata      1620
     ttttttgagc cattgatcta tcatttcttt atctctatct gactgtgcaa cctcacgtgc      1680
     aaaaatcaaa gattctttta ctgcttcgaa ctctccaata tcttctaaaa caaatgcacg      1740
     ataatacctt aacttaaaat cattaggatc aatttccaat ccacgatcta tacatgtcaa      1800
     cgcattggaa tattgttcta attcactcat agataaactc agcaccctat aaagggttac      1860
     tttatcttta tccacataat ttttctcaag tagtgaccaa caatctttaa tagctttttt      1920
     atacttctta ttatgatatt ttataataac tttcaatatc tcaattcttt tatccttgtt      1980
     ccatgtatga caaacttttc tagcatgtcg ttttgcagct cgatgctcat catagctgaa      2040
     gtaaaaatat atcaagttta aatgattttc aatatctcct gaatcttcaa gctttctaat      2100
     gattttttct aatccagttt taatatgtga ttctcgggat aacctccaat ttacaaccca      2160
     cctacttgag tcaaagcacc aaaagcatat taagagaatt atttgagcta ttacaattaa      2220
     acttgcatga ggttgaattt caaaattata aattattaac cagtcaccaa attgaagaag      2280
     aatagaactt attgggtaaa ctatcaatac aaaaattaat tgtatatata tgtaaaagta      2340
     aattatttca gcaataatac gtttccgaat gcgttgaaag aaaggaatac agataattgc      2400
     agtaaaaaat gacaacaaat ttccaaataa cgaaacccac cattggtctg tttgataaaa      2460
     aattcctatt ttcttgatgt atccccaaaa gaatcgccat tggaaatcag ttacgatccc      2520
     accaaaatgc caaacagcta aacaatgccc aaattcatga ataggtacac ttaatggaag      2580
     caagaaaaat attacaactt gcttagctaa tttcaagtca ttataggtta ttttgtcatc      2640
     acaaaattct tttctttgtt caattaattc ctttaatact tttgcacaat aaatcaagag      2700
     tagaatatta gatatatcta caatatattt catcaatact aattcaccat atagattttt      2760
     attgttagat tatttataga ataaggtcaa ataaatctga ttaaacttga ataatattta      2820
     attaattttt ttcactttct caaaaatcag atttgatttt tgagaaagtg aaaaaaattt      2880
     gctgagatgt agcagaatat tgatgccaaa agagagaata attttggaat tatagctggt      2940
     ttctatacct ccacatcttt tatctaggag attccttcac tcaatatgga attaattacc      3000
     cctctgcttg cagcggggta attaattatc tgtatggatg aagggcagct gagtcactga      3060
     caaaacaaca tgcactaaaa gaatttggat taatcaggga cagtcagccc ctaacgcttg      3120
     ttgactttct tctggaggag gggtttgacc ttgaacatca ggaatatcaa tatctacctc      3180
     caaattcact gtaggaactg ctccgcaggc aacatcagat gtctttgaca actcctgtag      3240
     atcagtccaa aatcctaaga attccgttgc agggatatca ggggtggttg gcgcaatggg      3300
     tgagtttgtc agggtaaaat tacctgccgt aacgccaaca ccagtagcag taaccgtaaa      3360
     ggtacccgcc gtatcattag ctgtggcgct cacactggct accccattat tgtcggtggt      3420
     gacggtggtc gcgctgaggg tgctggaggc tccagtgctc ggtgcactgt agttcagggt      3480
     cgtgttgggg accagattgc caaactggtc agtgacggta acatctaacg tattcgcaaa      3540
     ggcggtgttg acggtggttg attggttgtt ccccccactg atggttaaca aagccggaac      3600
     atcgggagta ttggtgaggt tgaagctgac tggggcaagg gtaccagagc tgctggagat      3660
     cacatagctg ccagccacgg tattgccagt ggcactcaca ctagccactc cattactatc      3720
     ggtggtggcg gtagtggcac tgagggtgct ggaggctcca gtgttcggtg cgctgtagtt      3780
     cagagtcgtg ttggggacta gattgccaaa ctggtcagtg acggtaacat ctaacgtatc      3840
     cgcaaaggcg gtgttgacgg tggttgattg gtcattcccc ccactgatgg ttaacaatgc      3900
     tggaacatcg ggggtattgg tgaggttgaa gctggccggg gtaagggtgc cagagctgct      3960
     agagattaca tagctgccag ccacggtatt ggcagtcaaa gtgggagctg tggccacccc      4020
     tgtggcattg gtgactaccg tggtggtggg gttgccattg aaactccccg ttgcccccgt      4080
     gggtgaaggg gtagccgtaa aggtaacatt gagccccgat actggaaggg gtgaattagc      4140
     aaagttttct gtgacttgag cttctagagc tgtggtgaag gccgtattca cagtcgttgt      4200
     ttgattattg cccgcagtca ccgccaagct atacccttgg gactcaacag ccccaatatc      4260
     tactgtgccg ttgaaacgat tggctcctcg ttggtccgtg gtcagcgtgg ctgccatggc      4320
     aagggcatca ctccctgcat tgagagcagg gctatccagg aaaaaggcgt gagtttgggt      4380
     ggggccgcca tagtcgccga gggggagcag catcggatcg agaggggtag ccacactgcc      4440
     gaccagggta ctggtggtga aaatcccctg gttatcaacg ccaatcaggt tattaccccc      4500
     gtcgataatc ggggaattgg tggcacttgc tcgtcttaca tctggaaata ccgtagctgt      4560
     attcagggca atgatactgt tagccacggt tacccgcgca gtattagcac cgcccaaaaa      4620
     attaagattg agaatgccac ctgagctgct ccctggattg gtcacttcat tctggacaat      4680
     ggtgctattg gtgatggtga tggtcgcgcc caagagggaa gtttgtcccc ggttgtagat      4740
     gccaccgccc ccgaagacca ctgtattccc agaaatggtg ctgttgttga cgatcaccac      4800
     tgcactgttg ttagcatttt gtcccaattg ggcaatgcca ccgcccacat tggcattatt      4860
     gccagtaatc gtgctgttgt tgacggtcat caccgtacta ttagggccgg cccccgtaaa      4920
     ggaagtgttg gacagggcac cgccattacc catggccgta ttcccagaaa gggtgctgtt      4980
     gttgatggtc accgtcacag cattggcagt agtattaaag ctggaaatag cacccccatc      5040
     atctgcggct gtattgccag taatgatgct gttgttgacc gttagcgttc ctctgttgtg      5100
     gatggcccca ccatcgtctc cttgaccacc agaattggct atcccacccg tcagggtgat      5160
     atcgttgacc tctaactcgg cacctagggc tacatgtatc aaccgaaagt caggggcagt      5220
     agtatcccgc gcaagggtat tgcccatgcc attaatcgtc aacttttcgg gtgccgtaat      5280
     ggagggcaaa ccattcgctc cgttagtcgc gttatctacc gctgccaggg tgatattatt      5340
     cgccagatta atcgtatccg tctctgtatt gccattcgca gtattaatcg cggcaatcaa      5400
     gctcgcggca tccgttgcgg taaagacctg taataatccc gtatagtctg ctagggtggt      5460
     ggcctcaaaa gcgctacccg tttcaatgct gccaatcgac tgctccagta tccagttacc      5520
     gcctcgggct gtatctccgg ttagatctgt actacctgcc acatccgcat gggtcaattc      5580
     ggcaatttta ttcagcagcg ccagcccctc gggtccacgg gctgtcaaac aggcatagat      5640
     taaaatatct gcttcagtac tgagtaagcc tccccattgc tgaaaatggg ctttgtattt      5700
     gtctaaggtt tcattgctca cataggcatt gcccagccaa aactcgccct catctccctc      5760
     tgaaacgata tggacggcat caacagctcc cacctgttgt aagacgctgg tgactcgttc      5820
     gatgccattt tcgctcacgg ggatggcgac cgttgtcgtc ccggcttcag ttccaaacaa      5880
     cagcctttga tagtccggta ctgtagtgtc gagaaagact aactcgttgg cgttagtgcc      5940
     atctgcatta aatcgcgtca cgattggggc actatgttgg ccattgtgag tggtaatcag      6000
     cttttcactg tcccccatca cattgatgcg attcgctgcc gccaactgca cctgattgcc      6060
     agtgacgtcc ccggcaatgg cgacgtcgcc attcactact ggggtattca gtagccaagt      6120
     acgaccttct gcatcaacct ccacaccggt tgccactggg atatcccccc ctgttaatag      6180
     ttctgaaagg gatactgctc tggcgttctc tgttgtatca ggatccagtt ggtttacttc      6240
     caaactgagc aacatatctg gatgattgat acgtacccga cgttgaccgg gtactgcagc      6300
     cagggtaact tgccccccct cagcggagag ggagcctgta ttcacgaccg tgccgccaat      6360
     caggcttaag ttctgccctt ttgccactgc taggtgaccg gcattgacga tgctaccggg      6420
     ctggtccgta ttaaacaaca aactttgagg ggttccctct aaagcagcat agtcattgtc      6480
     gccaacggcg ttaaaccaac ccttttcaaa gccaattcca tcggcagtgg ttgcgcgaaa      6540
     atctgcaggg acattgattg tggcattggg accaaacaca atccctgccg ggttcatgag      6600
     gtacaggttg gcattgcttc cctggacttg aatcatgcca ttaataatcg aggcatctcc      6660
     tccgttcacg cgcccaagaa tattctgaat gccgggattg ctgagaaagg ttgcaatttc      6720
     cccttggcta aggccaaatt tcttaaagct atgaaataga ttggccccat cgcctgaaag      6780
     actgccacca ctgatgttaa accgcttacc atcagcggtg acaatggtct gagtgccgtt      6840
     gggttcagtg acaatcgatt gggcgtgggc tggctgcatc cataagtaca ctcccaaaaa      6900
     cggtagcaat agaagtctgg gtataggcca aagtttcata acaacccttg gataaagatg      6960
     atttagaccg aagctgcgct tgagtatgcc cattatgaaa gcatatttga atactcacat      7020
     atcatcatcc agcaccatta aaatatttaa aaagagaaaa ttatttgatg tagttgaatg      7080
     gctaaatcct cgaaatcata ggcagtcaaa tgtaatgagt ttttatagca agtttttgag      7140
     cataaaaacc ccgtaactta ggcagtaagc ctagattttt atcactttgg cccaattgaa      7200
     gagttgctga taccaactgc aacgaaagct agaagctata caaagcagag acttcaggcc      7260
     ttagtatttc tcaattttct ttagccttta gtaataattt ggattcttct cgaacgtatt      7320
     tgcgtcgttt caagccccta aaagtgtttg attgcagctg gtgtcagcga cccttcaatt      7380
     gggccttgta gtttcttgaa tttttggata attcttacag atgggagttt acctttcatc      7440
     aggcctatat taggtgcaaa ttattttagc taatttaggg ttatctaata attcaaagaa      7500
     ttcgctaatt catctcaaaa ctctaatcta atgacatttg gccactctgt taattagcta      7560
     tttcaggtaa taaatatcaa caagataata cttaataatt tgtcttaatc aagaccttat      7620
     taacgctaac tactaaacta aaaagtagct atttcaggta ggttacacac aaaatccgaa      7680
     atcatttatc agattataat ttcccctcag catcgttcca tttcctttcc tgaaaattaa      7740
     ggagctaagt tatggcatta ttttgcgatc gcatagccat cacagcgatt acccttactg      7800
     ttttttatag cctgcctacg atcgctgagc ctcaaccttc aactcaagcc tctgacctac      7860
     gcttctcgcc tcgcttcggt attggcgcga atagccccag cagcggtaca aacaccacca      7920
     ctcgcctcga aacctttgtt cctgtttggc agaagccggg tcgagcattg accttcttcg      7980
     aaggccgtct cctgctagat gaccagggca acccaggtgg aaatattctg ttcggcttcc      8040
     gtcagtatag tgatgatcta aaacgtatat ttggtggtca tctaggtttt gatattcgta      8100
     acaccgataa taataccttc cagcaattga gcttgggtat agaaagcctc ggaaaggata      8160
     ttgaccttca cctgaatggg tattggcccg ttggcagtac tcgccgccaa accaggcaac      8220
     gtatttttga ggtattgcaa cttaatggtg accctcgatt tactgggaat attctacttt      8280
     tagacttgct gcggcgacgt ctgattacgc gtcaatttga agaagccttg gccggagtgg      8340
     actttgaagt tggaaaacaa ctccttagtt ttaagaatgg aggtgattta cgagcatacc      8400
     taggccctta ctttctccat agcagtattc gaggtaatac gattggaggt cggttgcgct      8460
     tacaggtacg acctactcct aatatcagtg gtggaattgg aattcagcat gatgattttt      8520
     tcggcaccca tgtgttggga aatatcacct ttacactctc agtaaatcag cctcaaagcc      8580
     cagtttcacc agcgaacaat gttgtggcac gaatgggtga ttcagtcatt cgcaacaaca      8640
     gcataattgt agataccccc aacactacag aacttcttga aactgagact caaacggttg      8700
     cagcaatgaa cccaaccacg ggagagccat ggttttttca ccatgtcaac ttaggtttgg      8760
     gcaatagcga tggcaccttt gaatcaccat ttcctagctt ggaagatgca ctaggagtga      8820
     taagggggga tgggaatgac atcgtttatg tagcaaatgg gataaattca ggtattgaag      8880
     gatttacgat tcctgacaag gtacaagttc gttcaagagg agctgtacag cagattgatg      8940
     ttaaccccat ttcattccca ttgcggccag agagtgttct taggctaggc caggttcaac      9000
     ttcccttctc tggcgatagt agcttccctc gcatcactag taccgtcagt ttggggaata      9060
     acacgctgct ctcagggttt gatgtacagg taacgggtgc cccagcatta gtagctaaca      9120
     acattactac tgcgactgtt atagataata gtcttgctag tacaaattca actaccaatg      9180
     gcatctcaat caatggcatt agtggctcac tcaatcttga caataacgcg attaatattg      9240
     ataaccctgc gatggcagga gtggatatta gcaatgttag tgcgtctaca ggctcagttc      9300
     gaattgtagg tacctcaggg agccgcatcc aacgcacggg aagagatgga gtggtgctgg      9360
     gaaataatac taccatcgca aatttaaaca tagccccttt acccaacaac gtagattttt      9420
     caggcaatcg aggcatcttt ggccgtaacg ttcgtaatgt tagggtgcag aacaatcaga      9480
     ttattgttat cgggagagac ttttctccag gcatcaaatt agagaacata acaggttctg      9540
     ctgaaattat taataaccag attaccagga accctatatt tgttgatcct gctgctccag      9600
     gtatatctca cggtatttct ctcagcttat ccaacatcaa tttggaccgt gtagtcatct      9660
     ctgaaaacac aattaaaaca acagggatca gtactgacgg cattgtgatt cagtctttga      9720
     atgatagtgc tattcaatcc gttactatct ctggaaatac gattgaaaca aatggagtac      9780
     aatctgacgg catcgtggtt caatcttcca ataatagtac tattcaatcc gctaacatct      9840
     ctggaaatac ggtggaaaca gcaggattga actctcaggg tatttccgtt cggcctatct      9900
     acaacagtgt catcactact gctactatct ctggaaacac cgtctcaacg gatagaatct      9960
     tttcttatgg cattttggtt gagccgttca acaaaagtac tattactacc gcaaccatct     10020
     ctgaaaatac tgtctcgact actggaattg ctgatgggat cttgctccga cccggctata     10080
     acagtgctat taccaccaca accatctctg gaaataaaat ttcaacagct ggtttaattt     10140
     ctgatgatat ggttttaaga cctttcttta ctattcctag tacaactgcc agtattaata     10200
     tcaggcctac tactaatagc gttatatcca ctgcgatcat ctctggaaat accgtctcga     10260
     caactggact tgcctatggc attaacgttc aaccttccca aaacggtaca atcaccgttg     10320
     cgactatttc aggtaacact gtctcaacgg atagattcaa tgctgctggt attagggtcc     10380
     agccatacat agacagcact atcaataaag cgactatctc tggaaacacg gtttcgacgt     10440
     cagggaaaaa tgctgacggt atcttagtaa ggcctgttgg caatggagcc atccaatccg     10500
     ctactatttc taataataaa atccttcaag cagggcggga cagtgtacgg attcaagcaa     10560
     gacaggatag tttacggata ggaaattatg atgttaatcc catctgtgct gctatttctg     10620
     gcaatcgtag tgataatccc aacgttgcaa tggcaggagg gttagatttt aatctaatct     10680
     ctgcgaggag tcctttccag gtggaaagtt taacaactgt cagtcttgac aataataatg     10740
     caatcttcag cttcgatggc acgttggttc ctcctggaac tccttctagt ccctttacga     10800
     atgtagttag ttgtccctag caactcattt cagtttttat tttagaggtt gattgaactg     10860
     aaatccattc cctgtatgtc attcaagcga tacaaactaa aatagttata aagggcttcg     10920
     ggtttttatt ctgttgacct aaactattgc cttttaatgt tcaaaacccg agttacagaa     10980
     catccttcct tcctccataa tctcaaaacc acgtttcaaa aaccttctta tagcagcaag     11040
     ggtattttag tagttatttc tactccaaat aatccctctt atctgtatta cacgaaaact     11100
     tacactaaaa aatgaccgtt tcactctaga ctctggagtt cttgccagga ttgacttttg     11160
     gatttctgat gtttgctgag gtcaactaga gcaatgactc taagttattc cggatagcca     11220
     tagttgtaga atgctcaaga cccaaggtga ctactgcgat actcagagct tgctgaaagc     11280
     aagaaatagc ctcttcatag cgcccttggt tgttgtagag tcctgccagg ttattgaggc     11340
     taatcacgac agaggggtgt tcgctgccca agagcttctg tttcatctcc aacgcttgca     11400
     catagagcgg ttctgcttcg ctgtagcgct cttggttgtt gtagagtaat gccaggttat     11460
     tgagactttg agcgacatca gggtgttcgc tgcccaagag cttctgtctc atctccaacg     11520
     cttgcacatt gagcggttct gcttcactgc agcgcccttg gttgtagtag agtcctgcca     11580
     ggttattgag gctttgagcg acatcagggt gttcgctgcc caagagcttc tgtctcatct     11640
     ccaacgcttg cacattgagc ggttctgctt cgctgtaacg tccttgattt ttgtagagtc     11700
     ctgccaggtt attgaggcta agagcgacat cagggtgttc gcttcccaag agcttcttgc     11760
     tcatctccaa cccttgcaca tagagcggtt ctgcctcgct gtagcgccct tggttgaagt     11820
     agagtaatgc caggttattg aggctttgag cgacatcggg gtgttcgctg cccaagagct     11880
     tctgactcat ctccaacgct tgtaccaaga ggggttctgc ttctatgtac cgcccttggt     11940
     tgacgtagag gaatgccagg ttattgaggc tcgttgcaac atcggagtgt tcgctgccca     12000
     atctctgtcg agtttgttct aagcattttt gtctccaggg cagagataag ccatagtttc     12060
     cctgccctgc atagaatcga ctgatgccaa catagggcca tatcaattca tcgtcattta     12120
     gtgagtcaac ccattgattg atcagttcct ctaagtgagg aatttttgca ctcatctgag     12180
     caatcacatc aatcgttgga ctttcatcaa tctccttagc cgcgactacc attcctatac     12240
     aaaaggctgc cttaaggggt ttcccctgat caggacgctg atttagttta attcggaagt     12300
     actcctgcac aatttgatga agcttgtaag taccctggac tactcgtttg agtaagtttc     12360
     tagcgattaa accgtcatct ctggtgtctt ctaatgcatc tggatcctgt tcagacaggc     12420
     agctttcaac caaggtccaa ggaataggtg caaccgcaaa catccccaag aagcaagcaa     12480
     gttcttgttc tgcctcactc aactctaccc agcttaattc caacgcagca gcgataccaa     12540
     actgtgcggt cattcctgat tctctttctg tcagcgcttt agcatcaagc cgcttggatt     12600
     caagtcgctt aatcaattta tggagggacc agtcgggctt attggctaga taccgcccca     12660
     ctaactctag tcctaagggc aggttcccca cccatctaca taaggcttgg gcatcgtcga     12720
     gctgaggatc aatgcgctcg gctccaacta gagttctcag tagggataag gcactcgtat     12780
     cgctcagttc tgtgattggg agggaatgaa cggatagacc taaatcctga cgggttgtga     12840
     ttagaacttt atactgtgga tctgatggcg gtaagtacgg ttcgatggtc tcaaggtcca     12900
     tcacatcatc aaaaataatc agcacctttc cggtgggcca gtgcccccag atataactca     12960
     cttgtttttc ttcatcgagt ccatccggga aggtcaggac taacttggtc cgggcaaatt     13020
     cgataatttg ggcggctagc tcttgacctt tcactcgcaa ccagcagagt ccacccggat     13080
     aatgaccctg attgagctgg gagatggcat attgcagagc aagttcggtc ttcccgatcc     13140
     cacccatacc tgctaatgca gtgagggcta ccggattgtt ctcttggagg agctggtgca     13200
     atttgtgcag cgtttggtta cgaccgacaa atttaacgac accgctacga gggagattat     13260
     gagggggact cacctgggaa gaaggcgagg cttctgatcc ctgactctga taactctccg     13320
     ttggtgggct gagtcctgac ggagagttgt ctactttttt gttagggact ctaccgccct     13380
     ccgtatccca ttgacaacat ccaagaaagc ttcatcgcga tccgcccatt tcgtcacggg     13440
     cttggcatct ttaggtaata tctgaagctt actgaagggt gacccttgcc agtcactggg     13500
     acgcagaata atagggatga ctcgggccgt gccttcgtta tgtcggtcca tcgctctttg     13560
     catctcaatg tcgtagcaat agtcagaggc cataaagggt gggctgacca gtagcagaat     13620
     gatttgagca gattctagat ggctgtcgat ttttgttttc cattcttccc cggcttcgat     13680
     gtctctatca tgccaatctg caattttccc ctggcgtttc aggttggaaa gatgggtgac     13740
     tagctctttg cgcaaatcat cgtcttcatg ggaataggaa ataaagacct ctaaggggtt     13800
     gttggcgtct ggattcatgg gagaaggtgt gggtgttgga ggagtttgag cattgctttt     13860
     atcctgattc ttagtttcct ctgtaacggg ctttttgatc agaaccgggg tgagatgttc     13920
     ttcaatacct tccatgcgga tagaggcaca gcccaggttg aaggcaaact ccacatctcg     13980
     accagaaccc agggcatcat agaatcccac ggcaaaggag atcgccgctt tatcctggat     14040
     cgcccgtttc atgccgatga cgtagggaat atgttctgag atggcttttg cttgcacctc     14100
     ggtgtagcag ccattgagga ccacacagcg cagttgatcg gcaaacagac taaacaggtc     14160
     tgcaatcgct tcaccactga ccaattgggt gttgccactg acatcttcaa agaccaagcc     14220
     ctcatcccct tccccatgac ctgagaaatg aacgatctgg ggattcagat ccagcatggc     14280
     ccgctgaata tcacggggac ggactgccag gcgctgttca agctggaact catctcgatg     14340
     ttgtgcccgc tgtaaaccct catcaatatc ccttaactcc tgatccaatc ggagaggctg     14400
     tgtatctttg ggattcgctg caaggacaag aatggtttgg gcagtcataa tggcagggca     14460
     gataaattcg ggcagagata gtggaacgct caatgattga aatgcgacgt ggatgtcctt     14520
     cggttctgag agaacacccc aaacgttgag gcaggcattg aagggagatt agaacggttt     14580
     aaatcaagag atgacctccc catcgcctgt gaagttgggg ccttctagcc gcagaaagta     14640
     aagctgtccc ccataatctc cagcaacaac tgtgcaacca tctagggcaa tctcacaaca     14700
     tcgaaatgca ccttctccgg tgaagctcat cacttccatg cctgtctcca ggtcccacac     14760
     cttgagggta ctgtccccag acgcggagac cacggtttgg ccatcggggc tgatgctcac     14820
     gccagtgaca agtgaagtat gtcctatgag ggtgcgctgc tcctggcccg tcgccaggtc     14880
     ccacaccttc agggtattgt cccaagaccc tgagaccacg gtttggccat cggggctgat     14940
     gctcacacca gtgacaagcg aagtatgtcc tgtgagggta cgctgctcct cgcccgtctc     15000
     caggccccac accttcaggg tattgtcccc agaagcggag accacggttt caccatcggg     15060
     gctgatgctc acaccagtga caagtgaagt atgtcctgtg agggtgcgct gctcttggcg     15120
     cgtcgccagg tcccatacct tcagggtatt gtccccagaa gcggagacca cggtttggct     15180
     atcggggctg atgctctcgc cagtgacaga gccagtatgt cctataagag tgcatagttt     15240
     ctttccagtc tttaggttcc acaccttgag ggtattgtcc ctagacgcgg agaccacggt     15300
     ttggccatcg gggctgatgc tcacgccagt gacatattct gtatgtccta taagggtgca     15360
     tagtttcttt ccagtcttta ggttccacac cttgagggta ttgtccctag acgcggagac     15420
     cacggtttgg ccatcggggc tgatgctcac accagtgaca gatgaagtat gtcccttgag     15480
     ggtgtgatgc tcatttccag tctttaggga ccacaccttg agggtattat cactagacga     15540
     ggagacgatg gtttggccat tggggcaaat gctgacgtcc cttacaaagt cagtatgtcc     15600
     tgtgagggtg ccatgctcat ttccagtctt tagggaccac accctgatgg tattgtccaa     15660
     agacgcagag acaacagttt gaccatcgag gctgatgctc atgctataga caaaatcagt     15720
     atgtcctgtg agggtgcgct gctcatttcc cgtctccaag acccacacct tcagggtctt     15780
     gtccctagac gcggagacga tggtttggct atcggggctg atgctcacat caaagacaga     15840
     tgaagtatgt cccttgaggg tgcgctgctc atttcctgtc tccaagtccc acaccttaag     15900
     ggtcttgtcc aaagacgcag agacaacagt ttggccatca gggctgatac tgacgccagt     15960
     gacagatgaa gtatgtccta tgagagtgcg ctgttcctcg cccgtctcca gctcccacac     16020
     cttcagggta ttatcactag acgcggagac gacggtttgg ccatcggggc tgatactgac     16080
     accagtgaca gatgaagtat gccctgtgag agtgcgtagc tcccttcccg tctccaagtc     16140
     ccacaccttc agggtcttgt ccctagacgc agagacgacg gtttggccac acgggctaat     16200
     gctcacacgc ctgacaaagt tagtatgtcc tgtgagggta cgtagctcct cgcccgtcgc     16260
     caagtcccac accttgaggg tatggtccct agacgcagag acgacggttt ggccatcggg     16320
     gctgatgctc acgccagtga cagagtcagt atgtcctgtg agggtgcgca ctaatgctcc     16380
     ccccgcttgg ttgaggtggg ggaatagaca ccgtatccag cactctccct gtccctgagc     16440
     caaagattga gtcaaagcgg tcatatccgg tgaattttga ctcaacaaac gcccatagag     16500
     ctgactgcga agctgctcag gatgctgatt taagacatgg ctggataacc gcaatccact     16560
     ttggactatg tttaggtctt tgtccctggg taacgtctca tagtccaata gcagcgcatt     16620
     gatatcggtg actcccaatt tgcgttgcat ccaacgatag tcccagagta attggcgtaa     16680
     ctcatcggtg cgttctgcct gcttgaggtg atgggccaaa tgctcataga aatacccatc     16740
     ctttggtcca cgatgccacc cctcagtgca gctctgctga taagcctcca gaagttcctg     16800
     atgcaatgct ttttcgtcgg cctgctgggc ctgtaaataa tcctgctgta agtcatggag     16860
     gctgacttgc cgctgaggat agtccccctc tagccgcagc atacctttac tcgataaggt     16920
     cgttaggatt ttgcccgcat ctcgctcctt taatgctccg gtatattgcc ataggcgaac     16980
     aatgactgct tcaggaatca attcatcggc tggaaacact gccagttctt gataccgttc     17040
     ggcagcgatg gggttggttt ctgctaagac tgttgcactg acatgcaggg ctttgaagac     17100
     atcggggtag gaataatgac taaactgttt ttggataaat tcaagatctg aatcttgtaa     17160
     ggcactgagg acatggggcc atggggttaa atcccgcacc atggcaccgc attgggccag     17220
     ggctaagggc aagtttccac attctcttgc taccgcctgg gcttgggaag gcagttctga     17280
     tatagagacg cccacccaag cagctaataa ctccagcgcc tgatcgtcat tgagtactga     17340
     cagggaaaag tcagtggctc ctaatcccgt gattaattct gagtcacggg ttgttaccac     17400
     caaggtactt tgatgtccta ggacattgaa gacttcagca tcatcgatgc gccagacatc     17460
     atctaggatc aatagacttt ggcgtccctg ccatagggtt tgaagtcggg ttttcccttc     17520
     attgatatct tcaaatacct ggcgttcacc acaaagggct tctgctagat cggtttgctg     17580
     ggccagcagg ttgggttcta tccccacggt tagccaataa atcccatcag ggaaggctgc     17640
     ttgaacttga gggtcatagg ctagggctgc ggccaacacc gatttgccaa taccgcccat     17700
     gccctggaca ccaatgcgtt gctgatgccc cgtcatcact acgggctgag ctagattgtt     17760
     gaggactttc tctctcaggg cttttagggt ctgaggacga ggtaaaaagt gggggggtaa     17820
     ctctggcact ctccacagct tttcaggggg cggttgttct gataagggtt ggaggggttc     17880
     ggtttgaata ctggattttt ggactaagac tggggtgtgg gattcgggga agccctcgat     17940
     ttgaatggca ctgcgtccta gttcaaaggc aaattcaata tctcggcctg cacccaaggc     18000
     atcgtagaaa cccacggcaa aggcctgggc tgcttcgttg ctgatttcct gctgcatacc     18060
     caccacatag tcaatatgtt gggcgatggc ttgggcttgc tcctgggtat aacatccatt     18120
     cagaatgacg cagtggatat cctcagcaaa cagagtaaac aaacctgcga gagctgcacc     18180
     tgtgacgagt ttgggattgc ctaattcatc ttcaaagaag agtcctgctt caccttctcc     18240
     ccgaccagcg aagtgaatta tctgaggagt ttcatccaat aatgcccgtt gaatatcttt     18300
     agtgcgtaca tccaggcagg ggcttagagt gaactgatct cgatgctcag atctgcgtaa     18360
     cccgttttta atgtcgcgta attctcgtcc gacttggcgc aatccatcgg ggttgctggc     18420
     aaggaataga atggtttgct ggtctggtgg gtgcggactc gtcattcagc gttaatctat     18480
     gggatatttt gttgtctttt ttcaatgggg ttgagcgttt agaaatgact gcctgcaata     18540
     gatagcgaat gatgacggag ggctattttg aaatttaatt taatcgcatc taaaattatc     18600
     gtcacttttg atatgcttta cgcaattatt aaggatattt ctgtaatcta ggacgttggt     18660
     gggaatggaa ataattgctt ttttaagggc tttttaatgg ctcacaaatt tgattgagtc     18720
     ctgtcagcct cctgattttt atggtctatc acgggtattg atccaacaga acgaaccatg     18780
     ccacttcccc ctaacccaat ctgtctccaa tgcatcgact attcccgaag ggaagcaaag     18840
     cgagttcatg ggccgcaagg ggatggctgc tggacggata atcggtgcga tcgcaaacga     18900
     catcactacc gtcaccgcaa ggaaagcaat gctaagcgcc gaggagaata cgctaaccag     18960
     aaagcaataa caaccccagc aaaaaccact gaaaccttct caattcctgt tcaagcacct     19020
     cccgtggctt tgctctatct ctacaaagaa aagcccaagg atgcccatct ccatgctctg     19080
     gccgttagtg tctggcaagg gagcgagaag ttagcagaaa ttgagactgt ccactgcatg     19140
     ggcatgacca atactcaggt gaatcgatac ttgaaagagg tattgcaggt actaagagaa     19200
     aggtacggca tcacggagtt tgaacccccg attcgcatgg agccttctga gtgtgagatc     19260
     tcggattgtc cactgaagga taagctccat gttcaaacag cttgagctag attttgctag     19320
     tacgttggct tctgctttgg atgaaccgga gcaggctgat atttctctga tgtgtgcatc     19380
     gttggatcag catttgcagg gtcgatctac ccatgaacag cttcgattag ctggtaagaa     19440
     attgtcaagg gtgcaaactc caagaatgga ttagacctct tgcaatattc gtttcatggt     19500
     gtgttacgaa ctcagtaaat gccgtgatct gacttagatt ttttgtcttc tactatatcg     19560
     gtaactgaat catgcaagag gtctattgac tacctcaagg ttcaaaaatc ctttatcgcc     19620
     aattacaatg agcgtcgtca gtaaccacaa tatatggaga gttctcatac agaggaagcg     19680
     tgtgatttgt ttgttgccaa acgacagaag aacaaaggga tacattgttc agaagcctct     19740
     gctgatgctc ttgctgcgat gaagactgtt aagttaaatc agacatggga gcatctactg     19800
     ggttgaccag taaattctgc ctctcgtttc agccccttaa cctagacctt ttggccatta     19860
     actgggctat ttatacgttg ttatcggaaa gccactactc tagttttaga aaaactatca     19920
     tgccagccat agagatcatc acctaaaaaa gagaacgctt cgaaaggtat aagtcgacat     19980
     aatgttcgaa caaaaatact actaaaacct ggttttttcc cagaaatagt aacaacctta     20040
     gttttagtaa taaacttggc tatagttttc ccaaagaggc actcaaggct cacataatat     20100
     gttgtataga gtattagacc taatagaacg tcattcatgt ttagtattac ttcttctaga     20160
     cccatgatgc caaacaggag tcctactata aatgcgaata aaaagaaaaa tatataatca     20220
     agaattagat tagtgagtct tttccctttt ggtgcaaggt caagctttga atatacactt     20280
     gccatcgaaa acctcttata taacttattt agtcatatta taaataagtt ggttgccatt     20340
     tttgttctta agataaacaa cttagatcta attttttgcc aaatatttaa tgactattta     20400
     aatctttatt ctcagtatta atatgggcaa taatagcgga ttttcaatta aaaaacaata     20460
     ctatcgctgt caaaatcaaa acttttcccg tgttaccttt ttcctcaaat tactcctatc     20520
     aaatgatatt agcattcata aattttgagt tgaatataaa tttaatttct gtccagtctg     20580
     aagtattggt actacaggag tgcggacaaa aacacttctg agtgaatcag gtacagggat     20640
     atcttacttt ctcaaagtct aaatataact gcgaatactg cagaactgct aagcactggc     20700
     caacgatcgc aagcagcctt agatcttctg cttcaatttc atcatgctaa tatgctgatt     20760
     agcatgatga aattgaagag aacctggaaa tcatacataa atggcgggga ttcctcaatt     20820
     ttagacaacc agccttgaca gattcggtga agtggctggg tttgccttta gtagctatgt     20880
     tgatcggagt attgctgggt ggttatcggg tggagcaaca agaatgtttt tgcgggggag     20940
     aggttggagc atgtcaactt tttgagggaa tattcagact gcacacaagc ctattgtatt     21000
     ggtagtggtt gaaacttgta aaattaaaga atttaatttt cttcccaaga ggtgacacgt     21060
     tcctggtgag gtttttataa agtaggagaa ataatttttt tcgattcatc atattgattg     21120
     cgtaatagtt ctaatgattg ttgataaatt attgctaccc tgttctttga aatcgtgaga     21180
     gacaaacatt aggtaactcc aaaggcaata agattaaact tcaatttatg aataaaaaag     21240
     cgatcgcaca atttcacctt gttaatggta cagaagtact gtttgaggtt ccaaaaccct     21300
     catcagatgt gaagtacaaa gaagtagcta acggtgactt caaacaaaag gtaatagaaa     21360
     tagctgatgg tgcagaaggt actttagagg cggcccttag caaagttgca cccgttgcag     21420
     ataccgtttt aagtcgtttg aaagaagggt taaccacccc ggcgaatgaa gtggaagtca     21480
     aatttggggt gaatttaact gccgagggtg gtgtaatctt ttccacagtg ggagggcaag     21540
     tgagcctaga agtcaccctg aagtggaccc agaattaacc ctaagcctgc aatgaccgag     21600
     ccagcagttc acccagacta tcgacaggga attgtccgta tcgttagagt cagtgatgat     21660
     gatgataagg ttatcgagaa agtcattgga acgggctttt acctgagtgg acgatacatc     21720
     attacttgtg cccatgtggt taaagagaca ctccacatcg acaccgcgac agagtttaca     21780
     tccgtggagg ttgccgaggg tcgggatatc tatgttcaat tcaactgcat tgaacgaaac     21840
     gctgacccct tagccacacg ggtggttcct tatagttggc ggctccatga tgaagatctc     21900
     gtcttactaa aactccaagt gtctccacca cccggcgttt cacccagtcc aataacgcca     21960
     actatcacct catactatga ccatcctttt aaggttttcg gctatcccaa cgaagatggc     22020
     cattgggcac agggtaagtt atctggggaa aatgatcgcc agtggattga aatgtatggt     22080
     gaagatgagc aatgcattag aatacagccc ggttacagtg gttctcccgt ttgggatgtt     22140
     acgttaagta cgattgttgg catgaccgtg gcgaccctcg tcgaagaaga ttcagaactc     22200
     tacgataatc ctgagtcgaa aattggatat atgattcctt accgacgact tttacccctc     22260
     atacaggaga ttgaggttca gttacttctc gacttgctta aaccccatca gaaagcggtt     22320
     gaggatcacc tacaggaggc ttatgggatc taccacccca tatctgaaga tcctccaagt     22380
     gctctcgctg acaagctcag ggcagccatg aaggctaaga aactccccca cttaatggct     22440
     tgtctccttc tcccagaggc tcaagccccg gagacattaa atcaatctct acggcaatgg     22500
     ttttcagatc gtgggtatga cattgaacaa tataagttcc aagcggatca agattacaaa     22560
     gctcactctc cagaggatca tgaagataag cagcctcatt tacttttctg ggtccaagat     22620
     caaggagcac tctacaatgt tcaagctctg ttaatcaaag atgcggagtc ctacaatcca     22680
     cgcaaatccc ttggttgtga ccgtttacta gccccaggtc aatttgatga ggctctcccc     22740
     tatgaaaaat tagaggagct tcttattgcc tgtcttcaag aatgttctgt tcgaggggtg     22800
     ccagcgaacc aaaagctgat tgtagaactg ttgctcccga ttaaactgct caataaggcc     22860
     gtggagcatt ggcaggctga gtcagcagga gaagatgatt tcctttgttt gccagaatcg     22920
     atcggttttc ggacccaagt ggtgatccgg gccgcagatc gccttcgggc atctcaggat     22980
     cgcaaacgca gagactattg gtatgctgaa tggaaaaatt atcaaaaatt aaaagagaaa     23040
     cgggctgaaa actgtctgtc ctctggggat gacttgcccc ctcaacaact gatggctagg     23100
     ttgaacacta ttcaacaggt cggtttatat ctcacggagc ctcccaccga aatggctcca     23160
     aagacctctt ggactggagt gctttttagc tcagttgctc ccattgctgc tttatggcct     23220
     cggcaaaaac ctaaaaacat tgactgttcc caagaatgtt gcgagctatt aagtcacccg     23280
     ctatgcgaat tgccatttca aatccattgt tgccgtagtc aggctcacgg gactgacact     23340
     gaggaccatc tgggccacca tttgtctttg atgtgggaga atccccatat gatccctccc     23400
     aaagttgccc agcgagatcc tgaacctgac ccagcgttaa ctccaacaat tgaccatcct     23460
     tctgaggttt aagcgatgag tgactggaaa atcttcaaag gtgatcgtca aaagaagcca     23520
     atggccatca atagcctacc tgcccctccc ccttggcgga gttttacggg taaagagtcc     23580
     gtttccagta cccaaaaaga gcggcgggga aagaatttct atcctcgtga agatgaaatc     23640
     gagatggtca atgctgcgct ttaccttcgt cgtccactac tggtgacggg taaaccagga     23700
     acgggaaaaa cttccctggc ttatgccatt acctatgaac tagatctggg tgaagtcctc     23760
     acctggtcca ttacgacccg gagtaccctt agccaaggac tctacagtta cgacgctgtg     23820
     gggcgattgc aggatgccaa acttcaaggt caagatagcc ataaacggtt gggtaaatac     23880
     cttagattag ggccattggg gacggcctta ctccccacag ataagcctcg cgtattgttg     23940
     attgatgaaa ttgataaaag cgatatcgat tttcccaatg atctgctgca tgtctttgaa     24000
     gatggcgaat atgtgatcga agaactggct cggattgcgg atgaagcccc caccattgat     24060
     gtacaaactg ccttgcggga tgaacaggaa gagagttatc aagaaaccgt ctccattcac     24120
     aaagggctgg tgcgatgtac gacgttcccg ttggtgatta tgaccagtaa tggagagcga     24180
     gattttccac ctgctttttt gcgtcgctgc ttgagattgg atatgggtga gccgacccca     24240
     gagcgattaa gggatattat tgaagcccaa ttgggtaaat cactggctga cgaagccgga     24300
     aaaatgattg atgactttga tcaaaaacgc aggagtggcg atggggattt ggcaacggat     24360
     caactcctca atgcggtcta tctgattggt aaagaggggg cacccgaaaa gctgaaagaa     24420
     cagttgctgc aatatctcaa tcgctaagat tatccatgag ttcagcccag ccatctcccg     24480
     atcctataag agggtttgcg actctcttaa agggggctgg tgttgagttg gatgttactg     24540
     accttgcgga caccttgtgg ttagcgagca aaattggccc atcagcaaga caaggattgg     24600
     ttgagagtcc cattcctgaa gaccctcagc tacctcttat tcctgaagag gttggatcta     24660
     gtgttccacc tactgagaat ttgcctgaag ctgccctccc tacccccccc gatatccctt     24720
     tagtcagtcc ctctcaaacc gttgaaactg aaatgaaacc cgaagggttt cctctgcaag     24780
     tccctgctgc cccatctctg aggggaagac tgaatctctc cagagcgtta cgtcccctga     24840
     aacgcaagat cccgtctcct acgcaacggg tatttgacga agcagcaacg gttcatcagt     24900
     atgcagaaca ggaaattttg tctcccgtaa tgactccagc caaagagcgg tggctagatt     24960
     tgaccctgtt aattgaagat catccctcca cgttcctttg ggaagacacc ctgctagaac     25020
     taaagcaaat cttggagcgc cagggagcct ttcgccagat ccatacatgg caaatacaac     25080
     tacaggtagg gagggttcgt ttatccccac ggcggtatgg ccagacgatt tcagaacgcc     25140
     actattccaa tcctcgtatt cttcaagatc cgacacagcg acaagtgatt tggattgtga     25200
     gcgactgtac gtctaatctt tgggaaacag ctcaatttca ggaatggctg ggactttggg     25260
     gtcgtagttc tcccttggca ctgtttcaac tattgcctga gcgactctgg gacagcaccc     25320
     atttaggaca ggggcgaccc atccaattaa gcgctacttc tgcgggtgtt gcaaattccc     25380
     ggctgaagtg ggagcgactg ctggctgatt gggacaaaga agatgagttt ggggatttag     25440
     atcttgagcc aacacctgag acagaatcct ctcaggccac agaagaacct agctcagatc     25500
     tagatgtgta tttggaaaca ggaaccgcct cggatgatga cccattagag cagggaaatg     25560
     ggcaaagcaa gattgcctta aacaacattt ataagaatca ggttctatgt ttgccagtca     25620
     taaccctaga accggagcca ttaaatcaat tgtctcgggt cattgctggt caagtcggat     25680
     ttcaagtggc aggcgtcgaa ctccattggc aagacatagc tgaatacaaa tcagtcttag     25740
     aacggatttc caatcataag atgtcccctg aggaacgggt gcgtaagttc catacgaatg     25800
     catcccccac ggccagtaag ttggcgggga tgatggcggc agttcccgtt agtctgccag     25860
     tcgttcaact gattcgccag acattgctgc cccagtctcg gcaggtgcat attgctgaaa     25920
     tctatatgag tggcttgcta gagcttcaac agaaagctcc aggacctggc aatcctcatt     25980
     cgcctgagca gcctgaatat gattttttac ccggaatccg ttcgctccta ttggagacag     26040
     tctttaggga tacgactgaa gcagttcttg acgcggtgtc agcctatatt tccaaacgtt     26100
     tagggctttc aacccgaagt tttgaagcct taattgccaa ggctcctgat ttagccccgg     26160
     atcaacaagc ggttgcgatt ccctttgcca gagttgccac ccagacttta aggcaattag     26220
     gagggtatta ccgcgatata gctgagcagc ttgatccgaa ccctgagcca gttcagcctg     26280
     aaaacactaa tcctgaacct gaggaagcct ttccaccctt acaaatcctt cattttgaga     26340
     cagcacagct catagatgaa attgagacaa attttccagc tcaattgcag tccgaggaat     26400
     ttgtagtcaa aactctggct atacgaaccg gtccaacgat tcaatccttt gaatatcaaa     26460
     cagcccaact cacctattcc tctgggcagc ttttcccgcc tcaactcgct ggatggaaaa     26520
     tccaatccca gcagaggcga ggccagtttt actgtgaaac gcttagtgac gatctggtat     26580
     tgagaatggt gtccatttct ggaggtcaat ttatgatggg ttcaccagac gacgaatcac     26640
     aacgaagaga ctgggaagtc ccccggcacc caattaaaat cccagccttt tttatgggcc     26700
     gataccccgt tactcaagct caatggaaaa tcgtcgccag ctacccagaa atcaatcttg     26760
     gactgaaccc caatccatcc aacttcaagg gcgacaatcg tccagtagag caagtgaatt     26820
     ggcatgaagc cgtagagttt tgtgctcgac tctctgcaac gacgaaacgc ccctatcgtc     26880
     ttccgagtga agcagagtgg gaatatgcct gtcgagcggg aactacaacc ccattttatt     26940
     tcggcgaaac tctgacaaca gacattgcta attacaacgg aggctatacc tataataacg     27000
     ggccaaaagg gaagtatcgg aaagcgacaa cccctgtaga tcactttcag tatgccaatg     27060
     cttacggatt aaatgatatg cacggcaatg tatgggaatg gtgccaagac acctggcata     27120
     ggagttataa cggtgctcca gaagatggga gtgcatggat aggtgagaat gataacaatt     27180
     ctagtaaagt caggcgcggc ggttcttgga tctacaatcc gaggtactgt cgctccgcgt     27240
     ctcgcagcga cgcttatccc ggtgaccgca actactttat cggttttcgg gtagtgtgtt     27300
     ccgcgccgag tccttttccg taaccctttc tccctcttat cctcttaccc tctaccgcac     27360
     cccatgtcac aagccaccgc aaaagaatgg attatccagg aagcaactca tcgaaactct     27420
     ttttatcttg aaaacttggg gaatgatcag gctctgaaga tgatggatat tcccaaaggg     27480
     gagtttcaaa tgggttcacc tgacggggag gttgatcgga aagatgatga agggccacag     27540
     catttggtta agatttctcg attctttatg tccaagactc ccatttctca agctcaatgg     27600
     caagtggtcg ctaagatgcc aacgatcaat attgagctgg aggaaagtcc ttcaaacttc     27660
     aaaggggtga agctgcccgt tgagcatgtg agttggcatg aggccgttga attttgcgat     27720
     cgaatgacac aacaaacgaa aagtcaatat cgcctgccca cagaagcaga gtgggaatat     27780
     gcctgtcgtg ctgggacctc aactcccttc cactttggcg aaaccatcac aactgatctt     27840
     gctaattacc gtggtacaga ttgggaagaa tacaaatggt cgggttctta tggtggggga     27900
     cctaaagggg agtatcgcca acaaacaact cccgtcgatc aatttcaagc acctaatagg     27960
     tacggccttt gtgatatgta tggcaacgtg agggaatggt gccaagacat ctggcatagc     28020
     aactataaca atgccccaga gaatggaagt gcatggatat ataagaatga taatgagtcg     28080
     tcaaaagttc ttcgcggtgg ctcttggctc gatctgccgg gatattgtcg ctctgcatct     28140
     cgctactatg ttcagcccca ctaccgcgac aacagcatcg gttttcgtgt cgtgtgttca     28200
     tcaccgagga ttcttcacac caaaaagatg ggcaaaaact agcagcatgg aatctgttgg     28260
     gcgttccagg gaagagtcca gaactattcc agtgatgctc tacatccgaa aatcaaacca     28320
     gggtgtttat cttggttagc ctagactgaa gagttgactg ccccatcaga tatttgaatg     28380
     atccgatatg ccagagctga tcctccgacc tgaacccaaa atggtccaat actttattga     28440
     agacctgacg aatgagaagg gtttatctat ggtgttgata cctgtgggaa agttcctaat     28500
     gggttcaccg gaggatgaac cggaacgaag ggaaagagaa ggccctcagc acccagtaga     28560
     tgtctcaact ttttttatgg gtcgctaccc cgttactcag gctcaatggg aaatcgttgc     28620
     cagttaccca gaaatcaatc ttgaactgaa ccccgatcca tctaacttca agggtgacaa     28680
     tcgtcccgta gagcaagtga actggcatga ggcagtagag ttttgtgctc gtctgtctgc     28740
     aaagacgaat cgcacctatc gtctcccgag tgaagcagag tgggaatatg cttgtcgagc     28800
     gggaaccaca actccctttt acttcggcaa gaccctgaca acagacatcg ctaatttcga     28860
     tggaaactat atctacaacg atggacctaa agggaaatat cgggaagaga ccacccctgt     28920
     agatcacttc aaatatgcca atgcctacgg gctacatgat atgcacagta atgtggctga     28980
     atggtgccaa gacacttggc acgacaacta tacaggtgcc ccagaagatg ggagtgcatg     29040
     gatagatgaa aatgatacta atcctaataa agtcctacgg ggcggttctt ggtaccttga     29100
     tccgagacac tgtcgctctg cgtctcgcgg caccgatgag tccgatatcc gcagttacgt     29160
     tttcggtttt cgaatcgtat gttcagcgcc gagctctctt ccataatcct cgccctcttt     29220
     tatcctttta cccttgtctt taacgcgtca gggcaatcgg ttgtcttgtc taaatctgaa     29280
     aataaaatat tcgacccata tcttatgttc gctaaatctt agacaaaaaa gtaccgctac     29340
     ctcactcaag gattgagatc acgaatccac aaatcatctt cgatacaact ctctttagcc     29400
     cattccaata gatgattctg aatctgatgt tgcacctcca aagactgact ggctatgttg     29460
     gctcgtacac taaaataggc agtgcctccc tgaggaccat cggaattatg ggtaatgcct     29520
     actaaataga caaaattccc tgcactgaac ggaatgttgg tattgcgagg ggtactgaca     29580
     atattcgata ttctggcaat aagaccctct tggtctggcg tgtttaaggc aagatgcatc     29640
     atgtaagcct gcggccaata gagacaggtg ttttgggagc tagagactgg ctgcagaaat     29700
     tgattagctt ggatgcgacc ctgaatgcag gtcaaatcct ctaaggctcc tttggcaaga     29760
     atttccattt caaattggtt ttgttctggc aaaatcagat taaactgaat ggcttcaaca     29820
     tataggtgct gaagttccaa taacccagta actttggcca ctactccagc acgatcttgc     29880
     cctcccatgc ggaataataa ggaacgattt tggctatcta aatttttgac tgtgacccaa     29940
     tctgtgaaga ccttgtccat ttttctaacc attaagcagc ttaagaatct tgtcttaccc     30000
     caccttcaca ttgataccaa aggtctctta ctgatcaacc ccaagataag gccactcgct     30060
     cgcgatcgag aaagtctccg accatctccg cgatccgctc catcgcttct gttggtcgct     30120
     gctcgatcac ttgctgaata tcaaacgtag cctcaagttc caaacaacat tcccagcaat     30180
     atttagaagt atcaaaaact gctcttacaa aaggttttcg tgaacctctc tcgatgatcc     30240
     aaaattgccc agcccctatc tttgatactc tcaagcactc aagcttggct cgtttcctgg     30300
     tcttttgagc aattcgcttt tggtaagatc aagtctttgg aatcttcttt ctagactggc     30360
     tgatggtttc agagatctct gctggttggt tcggggttga atcgtgggca ggggcaccga     30420
     tttgtaatgc tttgatggga tctggatgat cgggcttgaa gttttttgga ggactagctt     30480
     gggtttgaga agcgttgttg aagaattcaa ggctgatatc ctccgctcat ttcacggcca     30540
     gtttaacggg acaaccgccg aagctaaagg taacgtttca aaacttacag acggctgttt     30600
     atcttcgaca gcaattccct cgctgccttt gtctttgctt cctgcttaga tgatccttca     30660
     ccattttctt gaaggcccat cgcttggaca ttacaactga acccgtttgg tctctccgaa     30720
     aacccatatc tgggcaaagt aatctgctgc ttttgacaca gctcctgcaa ttgcccgatt     30780
     ggattctcca cccaatcatc cccctggcta atgggttttt ctgggatttc tccttggttt     30840
     tcttcggatt cttggcccag atgtaagact ctaatctgtt tctctgcttg tcgaatagct     30900
     tgtttcctgg ctctctcaag aagcttgacc agggcatctt ctgggtcgtc gtttgggaaa     30960
     aggtaggcga ggaatccaat ctgctcttcg gttatatgga tgttgaggtt gtgagaatgt     31020
     tgcgatcgca aagtcgtctc caaaaaattt aagacctgga cttaatcaaa aataatctga     31080
     atcgtaagcc cctaaaggga ttcaatctaa gattttaatc caaatatata agatagtagt     31140
     ttgcacacat aggcatttaa atatttaagt atttacttat gtacatgtat acgtaaatgc     31200
     ataaacaaag aaatacgtaa tattagtcat actgaagtct atcagcattt acttataaac     31260
     acgcataagc ctgtactcat gtatttgcgt atgcatttgc ataaatatgc tcatacgtat     31320
     aagcttgctt atgcaaacat ttaagagact acgtatgtgg gtaagatcat tagcttagtc     31380
     aatgaaaagg gtggaagtac aaaaagtaca acctgtgtac atctggcgac ttggcttaag     31440
     aatgctgatt acaacgtgtg cgtcattgat gccgatcctc agaaaagctc atctgtatgg     31500
     attgagtcct tagaattgga tatcccatgc acattgatgt tttctgcgga cgacctaatt     31560
     gataagactg gagacctcgc cgatgagttt gactatgtag tcattgatag tcctggaaaa     31620
     actgatgaaa ttactcgcgc aattttgtta gtgagtgatt tcgcactact accagtcccc     31680
     ccagcgggct tggatctaca tccaagccaa aaaactgttc gcctcgtcaa gcaagcgcag     31740
     aaagttaggg gtggattgcc aaaaggagcg ctattcataa acagagcagg taaaaatact     31800
     cgcttaaagg atgaaacgaa gcaagctctg aaagacatca aggaagtaga cactcttgaa     31860
     acgatagtcc atttcaagca agtgatcatc gattcatttg gtcaaggtca gaccgtcttc     31920
     tcaatgaaag gtagagctgc caaagatgcg gcgagggaat tcaacaagtt atttactgag     31980
     ttattggaga ttatgtaatg gcaagaaaac cgctgaacca agcagcaaaa gcatttctat     32040
     caggagaagc aacagatgta gaggcttccg ttgagacggt gaccccaaca accactacgc     32100
     ctacagaggt taaagacgat gctccaaatg gtttgattga ttcactgtct ctgacgcctc     32160
     aagaaaagcc tgcgccaatg acaattacca tccttcccag tcggaaaaac aaacttcagc     32220
     aattatccca atcaaccgga cgtaatatgt cagagcttat tggaattgcc ttagacagaa     32280
     tgtttaatga tgcaaatatt tgatccactc ccacggctga agctcgtggg attcgggaat     32340
     caaatgctct gtaagtattt acacatgtat tatcttacgc acttaaatac gtatgtacat     32400
     acgtaagttt ataaatactc tcaacttcaa accctactca cccgctcccg gtccagccac     32460
     accccgatca tctcctcgat ccgctcgata gtttcccctg gccgcagact taaaacctgc     32520
     aatacatcga acgtgttctc caattcaagg gcgcatatat aacaataatc gggactttgt     32580
     tagcccagat tatccatatt gcttcttaac tttggcgtgt tcattggagt catctaaggt     32640
     cggcaacgct tgacctagat cttcaacttc atgccccaca tgctggccac tccctttgcc     32700
     atcttctgca acgttcaagt catacactgt atctccctct tgtggagtaa tataggcggt     32760
     tactttcgct tctgtttgat tgtcattatt gaaatagacc tcatcccccg ttttgcctgt     32820
     aacccaaggg ttatcccaca aggcgtcaaa ggcttttccc ttaatacttt gttcggtctc     32880
     tcctcgtata taaacaaagc ttcttggacc ctcatgatag acctggttta agatattccg     32940
     atgtatgttg atcggagcat accgctggta accaccagat ccaaccttgt attctgaatt     33000
     agggatctga tcattaccat tatcagtcct gaattttgcc ggagcatttg tccataatgc     33060
     tcgttgaatt agctcatccg atagactctt ttgggtaaat cccccagttc ctgatttttg     33120
     agaatttttg ctgttgatgg gattgccagt gccaacctgc tgcactacat gggttaactc     33180
     atgggcaatt agctcttgcc ctccacgatc tcctggctga taggctccct ctcggaaaaa     33240
     tacatcctga cctgttgtaa atgcccgcgc ctgaattgat tgattcaatt ggtctgactg     33300
     ggtatccgta tgcaccttca cctcactaaa atcagcaccc atcacctgac ccattgaccg     33360
     ttgcaacctt gcatccaaag actttccact gcctctcgca ctattgattg cagactctaa     33420
     atctgctgat gcttcttcat ctgtcattgc ttgacgacgc tggatagcag cacgaagact     33480
     tttcgcttgc atcccacctt ccagttcttt ctcttgctgt acagattgcc cttgattgaa     33540
     ttgggataaa gaaggggcat taatttgctg tactacctgg gaagcaaccc gatccgcttc     33600
     ctgttcatac ttatctcccg gttgtccaag ggttagcttc cgctgaatcc agggttgtac     33660
     caattctccg gatggattgg gaaccttatc tttccaaggc gttccaaacc tttcccactt     33720
     ctcctgttga gctttccatt cagccaaacc ctcttcattt gttttggctt gaagaggggg     33780
     aggaactggt gttgctgatt gagcttgatc tgatgatatt ggttgaggta tcggttgtga     33840
     cttagatttt tctggcttat aagcatgagt acgcttcatc aacagtctcc cattagaaac     33900
     cgaatcacat acatttaatc ctaaacccaa agacaaaatt ctcaggatag aaatattaat     33960
     ggagaagcct taactgacat aaagaatcca tcactctacc ttgtgaattc cttgtcaccc     34020
     ccaaagacat tctggattat ggagggagtg cctctagcat tgacatagca tcttcatagc     34080
     ctttttgatt ctttagttgc ttgtataact gtgctgcttc tgtcatgtca gcaatcgcac     34140
     ctttgcgatc accaagactg cgccgaacaa tggctcgatt atagtaggca cccgcatgat     34200
     ctggattcag ctgaatcgcc ttgtcatagt cagtaatcgc accgttggga tcactaagtc     34260
     tgaaacgggt attgcctcga ttatagtaag cacctggata atctggattc agctgtatcg     34320
     ccttgtcata gtcagcaatc gccccgttta gatcacctag ctcagacaaa gcattgcccc     34380
     ggttattata ggcaagagca ttatctggat tcagttgaat tgtcttttca aaatcagcaa     34440
     tcgcgcctct attatcgcca agtctgtacc gatcaatgcc tcgattgtag taagcacctg     34500
     cattaactgg attcagttga atcgccttgc tgtagtcagc aatcgcacct tcgcgatcac     34560
     caagctcaga caaagcatta cctcgattat tgtacgcaaa agaatcatcc ggattcaatt     34620
     gaatcgcctt ttcaaaatca gcaattgcgc ctttattatc gttgaagttc tgccgaagta     34680
     agcctcgatt attgtatgca ttagcatagt cagcattcag tcgaattgca cgggtgtaga     34740
     gttcaattgc agctttatta tcattttgtt gccgtgcttt ttccgcccgc aaaaaccaat     34800
     catctgcggt tagttcagca ctttcagaaa tggatggaga ggggctactt ggaacagttt     34860
     ttccttgatc ggtaaagctc aagtaagtgc tgataggaat accaagattg aagcctgttt     34920
     ttagataaac cgctcccgtc agttgctgtt gttgttcagc atccgctcta ccatgaatcc     34980
     caatcagtga cccttgctca tctaagacgg ccccaccact catcccaggc aaggtgctat     35040
     tgctatatac caatgcatac ccatcagcca atgggcgttt tgcattggca gtgatactcc     35100
     cttgggtaaa gttaaacacc cgatccgtta tggcagtggt gggggctgga aatcccgaga     35160
     caaaaatggg ggtgccggat agggcttggg ttgagtcacc tatctcagct atggtgtaac     35220
     ttgtttgact ttcaaattct actagggcta agtccacacc tgggaatttc ttgactcgct     35280
     gataatccag agaatagctc tgaccatcat gggtgatgat ttcatactca tcttccgttt     35340
     ccactacatg ggcggctgtt aaaacggtgt aagtttctcc ctgcttctta accaacaccc     35400
     ctgatccagg attttgacct tcgatacgga cggttacccc ttgagcaatt ttccccacct     35460
     ccctcgcact caacgcttgg gccgactgaa agggagtggc aaccaatgcc gctataccaa     35520
     gtgtaaaaac ttgcaaccga tagtcaaatc tcatctcagg tatattgctg ttgcaacgat     35580
     actctccaat catatgggat tagaggagct atccaaggcg attaatcgct taggatagct     35640
     cctctgacta tctacagaac ggggttatcg tcccgcttat ttcagaagca aaatccagat     35700
     gataatcccc cagatccaac cgatggagcc tgtgtgcaac aagagcgttt agaatcgttg     35760
     taagctatcc ctctatggga atggaagcga tcaagtctga taagacttcg gcattgccaa     35820
     aggttactgg cccccaagca ctctgcttaa cttcgaattc accattaagt gtgtttacgt     35880
     agtgaattcc ttgaatggtt gttgcatgaa gccctgtttg atctggtgac atttcagcca     35940
     gacgatcttg ccagtcagca ttctctccca acaccaccag aaataggccc acctcagcaa     36000
     acatccacat agaagacaac ttcttagaaa ccaaacgacg ccgttcctct aggaattcat     36060
     ggccactatt gcttccatcc catagggtta tagctaaagc atatcgtgaa gttattccgg     36120
     tttttctggt aaagagcata cagagttcat ctggcaactc ttgtatctct cgtggataca     36180
     ccgcagggaa aagaagagat ttcagatttg atacgtagtt tataaattcc atttttctca     36240
     ctcaaaaatc tattgcaatc taaaccagta tcgctataca aaccaagcag tactccattc     36300
     aaaattaaaa actatttgta accaataacg taatcaaaac gtaagctaaa ataccaaata     36360
     agaatgcagc ccaacaccaa tttcttgaaa caattgatgc tttcatcgca cctctataat     36420
     cacctgtcct atactttgaa attgccctag ctgcatacgt aattgctatg ctccctagag     36480
     gggcacaaca aaaaattgtt actaagatag cctgaggaag atagttaggg attttatgct     36540
     gtcgtgctag gtatggattt aaagaacttt tctgtaattg atctaagcta gaatttatag     36600
     gtgagtcagt gatgacattt ttgattaact ggcaaatttc attagaatag tattgcaaat     36660
     accactgaac catcacatag aaaaatccaa cacaaaaaag tgttaagtta tatcctacta     36720
     acccgaattt tggaacaaga aaagctatca gagaagctat cattgaaacc catatcaaga     36780
     tatagagata tggatgattt agctggattt taaaatgcaa aattgtttga ttagagtgac     36840
     ttgttaattc tccctgagca cgaaaccaaa aagaatcact attaattttt ttcgggccaa     36900
     tcatggatag atgatttcca ttgagatctc ctcggtaata tcgaggagat tctctccaac     36960
     tccttccttc aagatagata tcctcactga accttaagtc aagtcgctgc tgcgcttgaa     37020
     gcataggtat aggaatcgtc aatttcctac gtcgagatgg aatcaatagc atcgcaatca     37080
     atactgtatt tataactaac tcgcataatc gtttctttat tcatcacaca gtatgaattc     37140
     aaagatttct tcacttcata aataactttt tacgttgact caaaatatca tcgataatta     37200
     tggcaattac cgttggtata cctccaaaca tcaaaatcat aataaaaact acagcaactg     37260
     taagaaaacc ttcatccatc tccgtatcaa agaaaaaacg ctgaccttct aaatattgaa     37320
     ccgattgatt attcgcccct atcttaaaaa ttgcttcata gtagggtatg tacccgtccg     37380
     agatttgaga accaatggca ctaataaatg cacgtttctc accaaaagac gttttcccaa     37440
     tcaaaataat ccctgagatt ttatggtggg agaagttctt gctaggagta acaacaatag     37500
     gagtctttac catcgcagta tataaatccg gaactccctt taaatctcta tcagagaacg     37560
     tgggtagaac tccctttgac tgcaaataac tttggagccg cttatacaag tctttatcgg     37620
     aggaatagtt cagaatatct gagagacgta agtcagggtc aactatgaat gaacattctt     37680
     taggttttct acagtccgat gtccgtacta gaacatatcg ttcaatcttc tcgattgtct     37740
     ttgcttcatc gaggatgcca ggacgcttat accaatatcc ccaaagctca tagttaaccc     37800
     caaaaccacc cacaatagat agagcaatca cactcatgaa gtaatacagg gcaagtctta     37860
     caggcttact taaagagctt aatagtggtt cttttgtgga gggcatactg agcttatcaa     37920
     tggcagaaga aatctgatag gctaattcca ccttttggtt atgattagct ataggtactg     37980
     atacaacgtt tggatgttgc tttgctgtga ttctgaatgg ctataaacgt gatctccatt     38040
     agccacctca gtgacatttg tcacctcgcc caaaaagtct cctcagattc tagagagaat     38100
     ccaacatcac tagccttaaa tacccctatt tcttactcag atccatggcc aaattcaact     38160
     atctcagatt gcttttcaga ttctgcaatt aaagtcttaa cggaggtcag tcttgtcatg     38220
     cctgaaaaac ggaataatga tgagcatttt caaagtgtgg tgatttaact acttaattaa     38280
     tcctgtcaga tatttatgat agttttaaca gctcatattt caggttaatc atataaatac     38340
     cctaaatcag ttgtatggtc tgacataaaa tcgtagaaaa tggctacctc atccgaactt     38400
     aggttcaaga gcctaatttt ggtatgcgct tgcgcccaat aatgaacggc attaatttag     38460
     ctagatttct ggcatcatca atgccacgat gatgcgtacc atctagggac aatccaaccg     38520
     tcattaaggc tttagccata ccgtagtgct ttttggttct taatgccaaa gagaattgct     38580
     tcttgaggtt gaagtgctcc tctcccatgg gatagggaat cttatgatac tttgattccc     38640
     gttcaagttg atttttatcg tagtcgcccc atgaacaaaa aacagaattt tcgtattgtt     38700
     caaaccaacg cttgaaggtc ccgactgctt gtggaaacgt aggtgcatcc tcaagatctg     38760
     tttgcttaat cgtcgttagc tctgtacaaa aatctgtcag cttcggatgt ctgatgggtt     38820
     taataaaaac cgtaaattca tcgattatct ctaaccctac tgattctaca attacggcgc     38880
     caatttcaat ggtttcagtt tctttatgcg gaatagaaaa cgtattgcaa caagtcgcct     38940
     ccaaatcaac tatcagatag tagtcgtacc taaaaaatcc aatattcata tttgatttag     39000
     ttcttgagca atctcaggta taacagcata ttcaatgctc aattgggtag atcctgaata     39060
     atttttctga gttcaagata ttcatgacgt tggtgagcat attcatcgcc tggataatgt     39120
     ttcaccatgc cgctagcagt cagactcaga taaaattcac aagtagaatg ggttagccga     39180
     ttgcctagag gctacacgat aacacctatc ttccggctgt gtctacgcaa cgattaggcc     39240
     cattagactc gctctacgtc actttaactg ggttgtgtcg caaaaatagg gtgttggccg     39300
     aaaggcagtg gtaaattgag agactttgtt ccttttcttt ccagtcaatg aaaactgctg     39360
     acctattcaa atggcgtcac tatcaatctg agatcatcct gcttaatgtc cgtttgtatt     39420
     gccgttatcc tcttagctat aggaatctag aagagatgat gatggagcga ggtttagaag     39480
     tagatcacag cactattaat cggtgggttc ttcagtactc ccctgagctg gacaagcgct     39540
     gtcgtcggca tctcaagcct accaatgatt cctggagagt tgacgaaact tacgtcaaaa     39600
     tccgcaaaaa gtggcgctac ctttatcgag cagttgactc tgacggctat accctggact     39660
     tcttactcac agcaaagcga gataccaagg ctgcaaaacg atttctgact aaagcattga     39720
     atgcagttca tacccatgaa cctcgggtga tcaatgtgga caaaaatcca gcgtatcccc     39780
     ctgctgtgga gcagttacag gaagaggaac gtatccctga aggcgaaaca gtacggcagg     39840
     tcaaatacct caacaatata gtggagcagg atcatcgagg gataaaacgt ctggtgaatc     39900
     ctggcatgag ttttggatcg ttcaattctg ccagaagaac tttgaaaggg tatgaagcga     39960
     tgaacatgat ccgtaaaggt cagatcaaca atgtgggtaa ggatgatgta atgggacaga     40020
     tctctttcat caatcaaatc ttcggactag cagcatagtc tttgataaaa ctgagcggat     40080
     tgttgtaccc ggaaccacta tttacgacac aaccccttat cctgctaacc aatgcttgat     40140
     ggtgggggac gatgtaacag ctgatgttga agccgctatc aatgcaaatt tacaaggttg     40200
     tttggtgaga actagaaaat atctgcccag agacgagcta aaggccccca atcaggcatt     40260
     tattctcaac agtattgcgg atttaatcca cctactatga tgcgatcttc ctttgaaatc     40320
     acagtctact aacgttgggc atagggtgta tagtccgatg ctttctgggc caaacccatg     40380
     gtgccgcacc attatgcaac gatgcgcaca aaagtgctgg catgagagga gtagagtgaa     40440
     caccagttca cgaaatcagt aataaaagag tgatgctgcg ggctttcctg gctagggaaa     40500
     gaatgtaatc catgcatagg gcctttcaac ggattcgcac gggggtaacc ttatttgcga     40560
     tcgcaattct cacctccgta atcggctatg tcgccctagg ctggcccgtc atggatgcga     40620
     tctacatggt cgtgatcacc atctttggcg tggggtatgg cgaagttcgg cctctggaaa     40680
     cacctgccga acgctacttc accattttcg taatcgttgc tggcacctca tccgttgtct     40740
     atatcgtcgg aggcttcgtg caaatgatca cagaagggga gttaaatcgc gcttttgata     40800
     ctcagcggaa atctcggatt attgccaaac tcaaagatca cgccattatt tgtggatatg     40860
     gacgcatcgg ccaggtgtta gcgaaacagc tagaccaggc ccaacaggct tttgtaatta     40920
     tagataacaa ttctgaacgg atacaaacgg ctgagaccaa aggatatctg gttcagactg     40980
     gcagtgccac cgatgaagtg accttagagg ctgcagggat taaccaggct aaagttttag     41040
     ccaccgtcct cccggacgac gccacgaatg tatttattgc tttaacggcc cgcggtctga     41100
     atccccagct cttgattttg gccagaggtg agtcagcgga aacggagaaa aagctgcggt     41160
     tggcaggggc cgatcatgtg gtgttgccct ccagcgtcag tggccatcgg atcgcgaact     41220
     tgattaccca acccaccgtt gttgatgttc tttcccagac gaccgaacga catgccttaa     41280
     atgagatgct cacccagctc aacctcaaaa tcgatgagct gatgattcaa gagaattgct     41340
     ttctactggg taaaacgatt ggtgaggtgg aagtccgagg gaaaggacga tttgtagtga     41400
     ttgccctccg acgccgagat ggcaccacca ttaatcatcc tgagtatggc cttgttttag     41460
     tgctagggga tgtgttgatt gtcctgggcc atcaaggaga tctgcccaaa tttgctagcc     41520
     gctatgagct gagatctgaa ctatccaatc caaaagttga gaccagatga ttgatctact     41580
     gtggatgttg ctctgcactg gcttggtatt tttgatgcaa gccggattta tgtgtgtgga     41640
     gtctggccta acgcgatcga aaaatagcat caatgtcgcc gtcaaaaata tggctgattt     41700
     tggtttatcg gtggctctat tttggtgttt tggctatgcc ctgatgtttg gtgcatctca     41760
     agggggctgg ttgggtgggt cgaggtattt cccatccagt gagtcaagcc ccaaactcat     41820
     tgttttcttt ttataccagg ccatgttttg tggcaccgcc accaccatta tttccggagc     41880
     tgtggcagag cggttacaat ttgtcgctta cctgatcatt gccagtttgg tatccagtct     41940
     aatttatccg ctctttggcc attgggcctg gaatagtctg gtggagaaca atactggcgg     42000
     gtggctggaa aatttaggtt ttattgattt tgctggatcc accgttgttc atagcgtggg     42060
     ggcttgggtg agcctggcca ccttgatcat tgtcgggtct cgtcaaggac gattttcgga     42120
     ccaaggggca acccagatcc aagggtctaa tttacccttt tcggtacttg gagccttgct     42180
     gttatggttt ggctggattg ggttcaatgg cggcagtacc ttggccctca atgaacaggt     42240
     gcctgggatt atcctgaaca ccatgattgc gggcattgct ggcatggtga cggcagccct     42300
     tttaagctgg ctccaacacc gtcttctagc agtggaatct ttgatcaatg gcacgttagc     42360
     gggcctagtc gctatcacag cctgctgcca tgttgtggca acaccgttgg cttttgtcgt     42420
     cggcagtact ggggcagccg tcgccctatg ggtctcctat gggctacacc gattgcgtat     42480
     tgatgatgca gtagatgctg tcgcagtcca tggcggagca ggagcctggg gcacgctatg     42540
     tgttgccctt tttggccagt taagtgagac agggatgaac cgtgccagcc aactgctggt     42600
     gcaactatta gggattgggg tttgttttgc ttgggccttt ggcctctcct ggttgctgtt     42660
     atctgcagtc aatcgatttg tacctttgag ggtcagcgct gaagatgagc ggctgggact     42720
     caatatctct gagcatcatg ctaagaccga tacctatgaa ctgtttcagg tgatggatca     42780
     gcaggccaaa acctctgact taagcttacg agttcccgtt gagcctttta cagaagtggg     42840
     gcatattgcg actcgttata accaagtcat cgattcactg gctcgtaatc accaggagag     42900
     cgctgagacc ctggcccaaa tttatatgat tacagccgcc tcagccgctg tagttgaaaa     42960
     tcagctattt gacccccatg cactggattt ggatgagatt tgcgatcgcg atgatgaatt     43020
     aggaactttg gctcaagtat tacaacaatt agtcacagca gtccatcaac gagaccaaga     43080
     actagcaact cttaaaactc aattttcacc tgagaatggg cagacatcag atttgagaat     43140
     tggttctaaa gaatccattg gcggggcaat tgtagaaata ttgatggttc gttttggtgc     43200
     tgtttctcct cagatcattg aggaggtggc tgccatttct gatgcaaatc agttgaagat     43260
     attgctgaaa tgggcaatgg ctacagattc catagtcgtt tttcaagctg gaattcgccg     43320
     acaactagac acagtttccg acaaggccac tctcaataaa agccaggaaa ttctagagta     43380
     aactactaat cgtggtaatt gaaaagtcgt aaatcaataa agtattgttt tgctaaacct     43440
     atggggagtt gagctttcct attccctcat gaactatgct atacccacaa gtcttgaaag     43500
     tcagactgcc aattgctttt agtacttgta gggtagggat tcaggtggtt ggggaagaca     43560
     aagcaaaggg agtagaatgc ttaacaaaca aggaaaccac cgatagtcac tgttcctcaa     43620
     aaccaccttc tagtgacatt cacaagagtt cagaacagca accctaaaca aacccccagc     43680
     aaggcaagcg ccgagcgggt tttacaaaca tcttttgtag actaactttt tatgctaact     43740
     ccatcagtat cagggaaaat cgtatcaaaa gatacttatt atctcttgct tcaatgatat     43800
     ttttgtataa agctaacatc taatttaagt aataagtaaa aatcaatatc ctagatttat     43860
     catttcttag ttattagctc caagacaaaa ctatttatat ttttgcatct agggttccaa     43920
     ctcagcctaa aagctgagtg ttcggtccaa gagatgcagc cagccaaagt ctaaacacga     43980
     cctactctgg ttcacggagg gataaaagcc cgggagaatt ctgttgacct ttactttggt     44040
     catcgtttct cttgggcttt tattcattgt tgagtttgaa gtttcaatat ttattctgga     44100
     gataaatcaa tggaacattc agttttttcc tggggaatta ttatatttct cctaggaacg     44160
     ttgggtatag gagtctgggc ttctcagcaa attaaaggcg atagtgtgaa ttttttggtg     44220
     gctggaagag ggctagcatt gcctttagct gccgctacac taatggcaca atctgtagac     44280
     tctaatgcca cattgggtaa taccgactta tctgcagaat ttggcttttg ggctggggcg     44340
     gccttgccta ttgggttatc tctgtgtctg ttcttgactg ggactttttt ggctaaaccc     44400
     atgaatcgta tggggttaat taccatcccc gatttttatc gagttaagta cggcagacga     44460
     gtagaactca ttgcttcttg cattatgtcc attagttttt cgttcctgct ggcgggaaac     44520
     ctagtcgctg gcggtttcat gttccagaca tttttaggga ctagctacgt tggtggtatt     44580
     actttgctag cgactctggt ttttgcctat accgtctctg ggggactctt cgctgtagcg     44640
     tatacggatg cgatgcaaat cttgattgcc ttggtgggtg ctttgggatt gcttgcattt     44700
     gtattggtta actttggctt agatattgct ccagggactg gcccactagc cctggaacaa     44760
     ttgacttcag ttggttcagg tgcagcagtt aattgggcta gtcttttggc attagggttt     44820
     ggcaatatgg tcgcgataga ttttatggcc cgcatttttg cagcagaaag cccagaaaca     44880
     gctagaagat cctgctatgt tgcctctgct ggtactttaa ttgtgggtat tcccttttca     44940
     gtcattgctt tgtcggctaa cagcattctt gaaggggcta atgtggtagc tgatggtccc     45000
     gtactatttg ctctgctgca aaatgtggtg ccgccagtgt tgggattgct ggttctagtg     45060
     gctattttgt cagcctctct ctccactgcg gatggtgcaa tcctgggtac ctcttcggtc     45120
     ttagctcaca acgtattcgg aattcgtcat gggggtactc atggacgtgg tggcggtgat     45180
     cgtctcctct tagtaacccg attattgtcg cttgtaatta ctctattggg tgtgttcttg     45240
     ggcctacgag tacctcagac cggagtgctg ctgctgctag gttttgatct ggggtttgcg     45300
     ggcttagtag tacctttgtt aggtgggtta ttttggtcct attctacccg tcaaggggca     45360
     ttagcctgta tctttgcagg ctcaacaacc cgattgattc tttttgcttt gatgccaaca     45420
     atgtttggta ttgagaatac actgctttac atccccaata gtctcttcac tagcaatttt     45480
     gatgggttcc caactctgat tagtcctgta gttggcttca tagcgtttgt agtcgtttct     45540
     aaactcacct acaaaccaat ccctgtagag ctagagcgag taaaactgcg tgagggagta     45600
     caagccttat aaattcagcg atagagcgca tctcaaagga ttggcataaa acacccagtt     45660
     cattcacccc caaactctac acacccgttc ccggtccaac cacaccccga tcatctcctc     45720
     gatcctctcg atagtttccc ctggtcgcag cttgattacc tgcaacacat cgaacgtatt     45780
     ctctaactcc aaagcgcact cgaagcaaaa ctcgggcgtt tcaaacgaaa ttttgatgaa     45840
     tggcttacca ctaccttcga tggtgatcca aaaattccct aagctgcttt gggaaaccgt     45900
     cagatactca agctgaccct tttgcttggt ctgctggatc agattctttt gtctgcgctc     45960
     aagggcattg aacttggact caaatgctct ggatactctg gggggttggg ttctgctagt     46020
     tgtatgccga gctgtatatc ctcgctgagt tctccgcgca aaatcgggtt ctcggtgaat     46080
     gtggataggg gctgattcac gcttgcgctc atcgtctcca gcatctggag atggcttgcg     46140
     ctttaatggc agatcatctt tccgtgcaat cgttgggaat gccgtcttgc ctgaatatgc     46200
     agagtttgat tcgatgtttg ttggggtttt cagcgtaggt tgggctggcg gttttggttt     46260
     cagcgagatg agttggggag ccatcaggaa tcctctacca agacaaaatt agtgtagctt     46320
     ctggggatat gcttagggga gttttagggg aaagcttaat ttggaggtgt ggaaattaaa     46380
     ggcagctata ggaagatttg ctatcgagtt cccaggatgc ttcaccaata attagatgat     46440
     tgagcttaca caaaattctt ggcactccct atgatgatga ctcccaatct aggtcagcaa     46500
     tcactacacg ctattactgg gaacgattta acattttttt cagccaacca gccacacata     46560
     ttacccatta cttgttaaat tcttcgaagc agtccattca ttgagagcac caaagcgata     46620
     acactaccta aaccagcaat cagcaaattg gtcatacatg actggctggc agaccccagg     46680
     gcagtattca agtctgggct actaagtcgc tcataattac ctactgctac tgacatctct     46740
     ggtaaagaag agattaagct accaataaag taatggattg tggggaacaa gctaaattct     46800
     acgaaatggt tctgaaatag ttcggtccaa actgcaaata agtcattcaa gatataacaa     46860
     gataaacaca acataattac gccaagaaaa aagcgagacc agcttgcctc aaagttggta     46920
     tcatcgatat cttcaaatag ctctggtcga cgttttttta gttttgactc aaatatcaaa     46980
     aaaacaataa caccacataa actaactatt atggcaatta ctaaactcat tatatctaat     47040
     tcggtattcg ctcctgaatg ttgaataaat tgaacatttc ctgttaagat taagtaggta     47100
     aaactagcaa aaaagaacat taatagtgac ataaatacat gccagagaat taattgcttt     47160
     tctagctttg ctaataacat caagttcttg atatgatttg gatttttaat caaaatccat     47220
     ttacaaatta aaactatagg tgaaacaata aagattaagt aaacgttaga taaatttgat     47280
     ccaagaggtg ttgcaatccc tcctagtcga cctagcccaa ataatgacac aagcatgatc     47340
     cctaactctg ggagattagt tgttgaatta ataacgaggg ttcgttgaga gttgccccat     47400
     attaaaccta ccaagccagc agccgagctt gttgccaaat cagttgacct cggaatagct     47460
     cgaaaactaa ctaaaccaac gagtatgaga gtgactccaa taaatggtag ttcaccgaaa     47520
     tagttataga attctagaag aatattctgt aaacctggca ttagagtaat tttatatttt     47580
     cactagattc atacattaac taattgacaa acagtactca aattatcctt aataatagaa     47640
     gcatcgacta attaagagaa agaaaactga aatttttgat atagcaataa tgctttagtc     47700
     gatgttgatg gtcaatttca atcgctcttg atatccttaa aacacctcac tcattttaag     47760
     aatggtatgg ttgagtttaa atcctaatca aaacgtcata ttcatgtata agcaatagtt     47820
     ttatacttaa tattatttcc aagtggatct actgctgggg tgtctacgat gattcgctct     47880
     ctccagacca ttgcattcat tacgatcctt tctacgatgt ctccaagcct tgcaatggct     47940
     gagatttcac cgaaagaaaa gttaaactct tcgatcagat ctaactctat cgctcaaaat     48000
     cctaataccc aagctggtga tactttaatc aatcaacagg cctatatctt gggacctgga     48060
     gatgaaatac agctcactat gtttggacaa cccaatctat tcaccactaa ttaccgggta     48120
     ttagtcgatg gtacggtgag ccttcctcta attggtcgtg tgttagtcaa aggtcgctca     48180
     atcggtatag ctgaacgaga gatagctaaa cgatatatcc gattctatag gcgtcctttt     48240
     attaccatag ttttggtgga tgcccgagtg gtcacgttag ctatttctgg agaagttcgg     48300
     caccctggta catatcccgt tgaatctcct acccaaattc ctaccgtcac ccaactgatc     48360
     cagcttgctg gtggtgcatc ccagtccgct gatatcagcc aaattaaggt tcgtcgtcca     48420
     caggagaatg ggaaagaaca attcatcagt gttaatttat tacaactgct tcaagaagga     48480
     gatttaagtc aaaatctgca actgcgtgat aaagatacgg taataattcc gaccactaca     48540
     accgttgatt tctccaacgc attactcata cgtaatgcca gtttttcttc agatcggtct     48600
     gaacccatca acatcgctat tattggagag gtttaccgac ctggtcctca taccatccgt     48660
     ccaggtagtg cagatgtcca agaagcaggc acattgggta atgctaaagc cgcttccact     48720
     gaacttccca ctgtcactca agccatacaa acagctggag ggattaaacc tgaagcggat     48780
     attcgccaag tgaaagttat ccggcgccct cacaatggca atcctcaaga gataatcgtt     48840
     aatttgtggg aactactcaa ggcaggagac ttatcacagg atatcgcctt gcaggctggg     48900
     gataccatcg ttgttcccaa agcggttggt ttatctgctg ccgaattgac tgagttatcc     48960
     acaataagct ttgcccccgc cactattgac gtcaatgtcg ttggtgaggt caaacggccc     49020
     ggaataatca agattcaacc caatacccct cttaatactg ccatgttagc tgcagggggg     49080
     tttgatgatc gcagagcgaa taaaagcaaa gtaaaactca ttcgcttaaa tccagatgga     49140
     accgtgactc aaagagaaat taagattgac ttagaacagc cactgaacga ggagaacaat     49200
     cctgcccttc ggaacaatga tgtggtggta gttggtcggt ctggcctgac aaaggttggt     49260
     gataatcttc gaaatattct tgcgccaata acaagtagtt ttggtatatt cagaatctta     49320
     ttctgatttt ataggaattt atctattttt ttgaatctaa actactaatg aatcttaatg     49380
     gaactcctag ttcaccaatt caatcaagta ctatccaagt acttgattga ggacacgttc     49440
     taaccctcga taatattgta aaaaattagt tctaaataag ggaatactcc ttatacaatc     49500
     cctactaact attcggctct ccaacagctg aaaggatttt taaatcttca gaataagctg     49560
     ctccaattcg ataatttttc aggatttcat caaggctttc ttcagcctcc tttttgtcta     49620
     taacaatttg aaaattacgt gcacctttaa aggcaacaaa aggagaattt gaagttgtaa     49680
     cgagttgaca aaattcgcta aaatctttaa atttttttcc attaacttcc ttaacaatcc     49740
     aacccgcaat accatggtag cctcgattca cctcagagcc aagaactcgg gttgcaacaa     49800
     cgatttctat tttctctcta gagggccaat ttgatagctc tatcaaaagc tctttgggtg     49860
     ctgtttttga ccagttaatt ccccatgatt taatgagatt tttagttaat ggagaaaaca     49920
     caattccacc aaatataaaa tatcttggta gctcattgta ttgctcaagt ggtactagtc     49980
     ggaaatcttt tttttgttta tttagagtga gcattactgt cttcagcttg gaatttcgaa     50040
     aaaattcaat actgactgtc tcacccactt gatgaatatc tatatagtag ttaaaatttg     50100
     ttcgatctcc ttgtcgaaat acgactgtgc catcatcagc aatagcatgt ccatcaattg     50160
     cgtgtatgac atctccggca cgaatgaatc cttcagcagg ggattctgaa agaatatgtc     50220
     taactagtat cccagttaag ttctcggata ttccatagct acgtttcatg ccagggtttt     50280
     ccatcttttg ataaacgagt cctaaccctg ggaaaccgtt gaaggtcttg tcctcaaggt     50340
     cttgaagaaa atgtcttatg acgggtacag gtaccatata tccaatattg tcagcacttt     50400
     tccttgcttg catcgctaca ccaacaattt ggccattgcc atccagaaca ggtcctccac     50460
     tattgcctga gttaattgca gcatcaattt gcgcggctag aaagtactcg ctgctatgag     50520
     tataaaactg atgttctata cgtgaaacaa tgcctcttgt agtactcaaa gcgtttccac     50580
     ctgtgggaaa accatagaca gcaacctctt gccgaatctc aggcagatca gcaaattcta     50640
     agggtgttac acctgaaaaa aaagcattat tcttaaccga taagattgct agatcaactt     50700
     catgagcaac actgacaact tgagccctat aacgcttggc ttgaccgtga cgtcgaactt     50760
     caacaaaggt ttgatcggca acaacatggg catttgtcag aattttgttg tctgcgatga     50820
     taaaaccaga accagtactg cgtttaatga ctgtttccca aggcttctgg tagtctggct     50880
     tattgcgaac tgaataaacc ttaacgatag ctcctctaat ccgctgctca ttatatggct     50940
     cagtgtttcc agccttaaaa ataaagcagg ataccatcaa attgatgatg agtagactga     51000
     gaacgacctt cttaaaatgc ctagatatcg gattgtgcat tcagaaacaa gagcatacgc     51060
     tgctattaat ttgaacttac cataggcaag gaagccggtg atagactcgg cgtttcacct     51120
     cccaagcaat cagtaacaca ccctttgaat taaagaaatt tcttaaagct aatatcaaac     51180
     ttagcttaaa agatttaacc tacttataaa gtgtttttat tgacttgagc aatttcaatt     51240
     tttcagaggt tgatatttcg taacgcagtt ccgatctctc actcatttag acaacagaga     51300
     cgactatttt ttccaatgaa taaaactacc aaaattacca atctaataat ttttagtttg     51360
     attataggaa taatacctgg aattattgac ttatacatac tgaagtgttt tactccgcaa     51420
     tctgctgtag caatccccaa tacagcaggt agtcttcgtc cgccaaagtt agtcgcatca     51480
     gatttacctc caggatttcg agaagtcccc accccaatca gttcacttat ccgtggtgcc     51540
     atatcttcaa ccattagtga ccactttggt agtaacgaaa tccagatcag agatttagtc     51600
     acttacatga atctgaatca atggaccctc atcattgggt ttgttacccc gctaaataat     51660
     gagaatgctg ttcagatgtt tgatctaggg ttagagcagc cgagtgcttt agaaaagttt     51720
     gtgacaggta ttaaaaagag taattattat ttgggttcag taaatattgt tgagcaaaga     51780
     gttgcccctt ccttatcgca aaagattggt caagtttcca ctggtatggc agtgattgca     51840
     aaagcgagaa atgtctcctt attttctgaa atggttgctt ttcgaagaaa taatttaggt     51900
     gcaatgctaa ttgttggacg cctaaatgac aacatccctt tgatgaccac atctaaactt     51960
     gcacagaaat ttgacagtca actattaaat tttcagtcat atccacaccc atcaaaccaa     52020
     cagtaatggg taaccttagc ccctagggct aaaactaccc atcatcagta gattgaaaac     52080
     gtctttagct cgactttatt catttacgct gtatagcaaa gtatatccat caagtgaagt     52140
     gagttgataa atcataatac tttttttcat gctattgatt acctattcta cttcagcatc     52200
     ttgaaaggag gatctctaga aatagttact tcagaaaatc ttaatcactc tgtaaataga     52260
     ttaaggaaat atataatgac tctttttgta acaatattga ggtaaaaaat gagggttttt     52320
     caccgactaa tccatgtagt tttattattt tctctctcac tatgtttggt gtttagtgat     52380
     tttgtttttg cagatggatg tgctttggca gaagaactaa aggtagtcac ttttaatgtg     52440
     gaatctggca atgatactga tcccaatatg gttgctaggg atatgcaagc tattcctgat     52500
     gtagatttat ggggcttatc tgaagtagaa aatcaatctg ctgcagatac atttttgcaa     52560
     gctgcaggag actcaaattt tgaaagtatt ctaggcactt cgggtggttc tgatagactt     52620
     caaatcattt acgataaatc aaaactaaat aagcttaact ctagtcctat ggagctaacg     52680
     ggtattggtg gagatagaaa gccattggtt gaagaatttg aggtgatttc agacaataca     52740
     aaatttttgt ttgcagttaa tcatttcaat cgtggaagtg cacggaagcg gcaagaacaa     52800
     gctcgaaaat ttagagattg ggcaggaaga caaactttac ctgtagtggc agttggcgat     52860
     tacaactttg atttcgatat aagtgccatg gatggtaatc ctgcctttga gatcttcttt     52920
     gaagaaccag tttttagttg ggctcgtcaa acttgcttat catctaacac ttgtccatca     52980
     acagggaccc aatgtaatga atgttttgat ggtttgctag attttatatt tttaagtggt     53040
     gatgcaaaaa aatggtcaaa tcagtctgag attcttttta agggaagttc attttgtgat     53100
     aatgacccaa caggagcttc agatcatttt cctgtgcaag ccataattga tttagatgga     53160
     gattttcaac cctttcaacc taatatcttg aaaggtcctc atatcgctag tttacttcca     53220
     aatccttctg gacgggatga tacgaatgag agcgttacac tggtaaatac tgggacagag     53280
     gctatcaacc tcgttaactg gatattgaga gataaagatg gcaacacatt gaagttagat     53340
     gaacttgata ctctttttcc aagagaacgg aaaaatattc tacgtgacgg tcgcgattta     53400
     tcacttaata attcatgtga cacagttgaa cttgtcgatc ctgctggtga aattgtagat     53460
     tcagtttcct acataagacc ggaagaaggt gaagagttag agttcatatt ttaattcact     53520
     actagtagag tgatttagac tgagtaaaac actgaataaa cctttgactg gataactcac     53580
     tctgaatgga gttttgttca aacaacagaa ctctaaatca ctttggaagc gtatatagat     53640
     ccccaacctg atatccttca gtcccaaaat cctgggaaat tgccataaaa taggtaattt     53700
     ctctgggtga actgtggatt tattacgctt ctaagctggt ctcagtgcta ctcgtcgggg     53760
     agacgagtct atcaagactt atttccactc aaaacccttt tggagtttat ttctcagggc     53820
     ggtgaaagac tgttcccgcc catgagtgag atttatttac ctgcaatttg atgatgtttg     53880
     cgatctactg agtctagtct ctctgggaac tccctagaga ctttgcttaa taacccaatt     53940
     ttaggaacgg aaatatattt cgaggtcaat cgcaccccaa tttcaactca gatcccccag     54000
     aaaatccatc atcactcccc tcccactgac cgatttcctg atcatttcca ccaccatact     54060
     catcaatttc agttcgcttt tccatttctg taattagatc agtctctttc ttacagattt     54120
     cacaacttgg tctatttttc tccaatcgtt gattccactt cgactgaaat gccttcaaca     54180
     tctggtcttt gtacgcttca ttacctgaat agcgaatcac atagagactc acagattcct     54240
     cactaccgac cttcaccaac tcatgggcca cccgcttgat cagcttatta acaatggcaa     54300
     cggcactctg accctcactg atgacattac ggaaatgtcg ataaatctga tagcgatatt     54360
     ccaacgcttt taccttgata tcttcaagtc gctgatcagc ctcattcatc accagaatct     54420
     ccatccgcat ccgggcctcg acctgctcat atcgggcctg ggtaaacgcc tgagactgct     54480
     gctcaattcg ctccaccaat cccagcttct ggtccttcag cccctgtttc tgctgctcta     54540
     actgctccag ctcccccttc agggttgcct tcctgggatg ggcctttctt cccaaagccg     54600
     tcaacttagc ttggatggcc ttctgctcct gaacaatttc cctaatctgc ccagatagac     54660
     ccttgacctc taacctcaaa gactgtcgct gccgttgcac ctggcgcccc ttctccaacg     54720
     ctttatcgta ggcttcataa tcagcgctag tgacattgta ggtatccact aaatcaaata     54780
     cccccaggtc acgaagtaac tgtacctgaa ttcgattatt ggttaaccga tgagtcaaca     54840
     cgaactggct attgagctgt ttcataaagt ttctccggtc taattcctca gcaacttcag     54900
     ggtgataaga catccaatgc aacttagtgg cactcttgag ccgtcctcga tgctccacac     54960
     agacttgatg aataaactca tccgtcaatt caacaccggg caactcatcc tgtaataaga     55020
     ccttcttggc atccaacgta tctttatagg tggcagaaga actccccatc actcggatgg     55080
     cctgctccac cgtgaaccgc tccccgtcag ccgtccccag catcaccgcc gtttccacct     55140
     ccatctgctt ccgcacttta ctgaaggact cgacgatatc ggcattgcga tctctcagtt     55200
     cctccatctc aatgggatgt ccatgatctc tcagcaacaa catcaaggac tctctgagag     55260
     ctaacaggga tgcaatcgag cgggtctgat atcgagcaaa gctgacgtta tgacagttgt     55320
     tgggattctg ctgatatgcc ttcagtgctg ctaactgctg agccgtttcc ggggattggt     55380
     catgaatgag ctgctgttct agatcaatgg aagcagcaac gtcttgccca tacttcgact     55440
     gcaacataat gacctgttcc acggacttaa tcgaaggaat atccgggata tgggccttcc     55500
     tcgtcacata gatttcacga gtgacttttg ctctgtatct ccagagctgc tgatagacac     55560
     tccgagcatg attggaggag gcataacaga acactctgct gaaataggga atcaatcggg     55620
     gttcatcaat actgacccca ctttctgcgg tgggactcaa gaacaatgcc gtgggctgat     55680
     agtctttgac aaactcagtg ggattagcct gaaagaattt gttttctggc cgctccgatg     55740
     tcttcctgtc atggcgcaaa atacccttgg caaactccgg attcacatca gagatcatcc     55800
     gctccaactt ctcaaggaat tcctgagagg tggcgacgac aataaaccgc tcatcgttag     55860
     ccacagcatt taggattctc tctagaaact gagaggtctg ccctgagaaa accttcgtgg     55920
     gaaagttatc atcgggctta aactcattga cgacaatctt ggtgttgtac ttcccacctg     55980
     taatcccctt gatatagtca atggggattt gagacaggga atcttccaag agaatgatat     56040
     tgcctcgggt ttctaagact cggtttgcga tcgcatgaaa atgctccaag atttgatttt     56100
     gccgatcccc caaggtctga ccactgagaa catggaataa agcagcatcg gcttcatcga     56160
     ggatgatgca gctatcgggt tcaatatcat caagttcaat cttgagtagg ctatcgaaac     56220
     atagcaatat agaccgctca gagcgaaagc ccatgctgat attgccttgg tattccttat     56280
     tgagtcggaa taagtgaatc aggttataga gggtattgcc gttggcatcc ttggaagtaa     56340
     agcggtcctc ggtattgaat agcaggttgt tccgataccc cggcataatc acctggcctt     56400
     tgacctggcc caccagtgac ttcagcatct ccgttttgcc cgtgccacac atagaggcga     56460
     tggcgacgac ggaccccgga tcaatggtgc ctagatccga gagttcgatg tagcgtttgt     56520
     tgatcaccgc tgtggcttga tccgataagc cattgagctt gagaaagagt tgacccagtt     56580
     catattccag acctaagcta ttaaagaacc aagtgggctt gaacccaatc tgagccaatt     56640
     ccacgggggt gagttcatcg atatcacagg cattttcctt gtaggtttgc ccccaccagg     56700
     ctacttccac ggcatagccc cactcttcta gtaagcgaat gactcgctga tactgacgaa     56760
     agacgttgag gtttcgcacg gcacccgcat caggataaag ggtgataatc ggggtctgtt     56820
     cagcaccttt tgataagacg gtcagggttt cccgcagtgt ttcaggggat gaggcccaga     56880
     gtccccccgc tgccccaatc gtggggagct gcaatcgttg agagaggaga tagggtttga     56940
     cccccgtgcc ttccacgagg gcaattcgag agtaggggcc aaatgacttg tagacggcta     57000
     aaggaatttc gccgttaaca tgaggaccat tgccgttggg attgcggcgg gtagaactgg     57060
     acaaccagat gtagcggttg tcttcatgaa cattgcgctt ccgcaattgc aaggccacga     57120
     tttgatcgtg gacattatag agaggccaga gatagccccc ctgtgaattg aggatgccac     57180
     cgggaaggac accgggcaga tccggggaga ggtctttaac tcgctgaaat tgaccaacag     57240
     aaacagcccc aaagccgctg atttcgtttg aggacatgcc tcgtcggtcc atgtctcctc     57300
     gatccattga gcagagggat agatcacaga ggagttgtcg atacaggtga tcgcgttggc     57360
     ctacgggcaa ctccttggca atccgttgac gccgttcttc cttagcttgt tgatcacgga     57420
     tggccttgcg ggcctgccaa ttaatagagt tgtagttgtc atcacctgtg tgaggtgccc     57480
     agatccccca gttactatct ttcgaaagct ttctgaactt atagccgttg atgataccga     57540
     catcataggt ttcggtgagg caaaggatga tatcgccacc tttgctgcat cttccatcat     57600
     tagagccgca gatggggcaa tgattttgtc ttttgaaagg aatcagcttt gaagtaaatc     57660
     gggtaggtgt accaaagcct agatgaggtg agttcagagt gagtgatggt gtggaggtca     57720
     ttgatggcct ccttgatgat gcatgggtat atgagtcgat tcccgaacca ttagcggctc     57780
     ggtgaataaa aatatagaaa gcatggaaaa tccctctatc gtttatcagt agcgagatag     57840
     agaggtgtgg taggtaaagt tcaattacaa aattcttgca gcaaaaagtc ggctgctcta     57900
     gaattagaac acaccccgtg ggtcactaac gcctgtcttc caaaactgtt gttagatccc     57960
     gcaatctcga aaaaatattt ggttttttcc tggagccctg gctatttcag tagccgggat     58020
     tccttttttt taggccatcg tcacctcctg gggaaaaata caaagattct tagtgaacca     58080
     tactacgctt cagccctcaa tacgcaaagg ctttaaaaca aaagatcatc aagggtttca     58140
     gaatcttgag cagcatgatt ttatgaggga aacatgggtc agttcctcga atgagaatga     58200
     agaaatttgt tgcttgatca gagaaaatct aaattggtat ctgggaatta atttggtggc     58260
     cgagggtgtt ctttcctata tccaccctca atgactttag atacacctga agtaatggac     58320
     gacattattg acctcctttc gctcggtcta tcattgtcct gtaatcctct aatagactga     58380
     gatacaagtg ctaatggcag caagattata ttgagaatta ctgggctgaa tcccagatgt     58440
     cctcgccaat cgtcttgagt tctctccagt tgatggcatc gctgattctc tgaggtaagt     58500
     cgatgccccg cgacattagc agccccgcga ctgctacgcc gacgacaaac cagaatgtgt     58560
     ttctgagcat tggtcagttc tccaggttca tgaatatgac tctccttatt ggtttgtttg     58620
     aaaatctttt gaatagctct gccgattttc ccgcccagcc gtgaggcgtc aacccttttt     58680
     acagtaggct tctcgattcc ttcgggatga attagctggg tcttgtcagg ttgtgggaat     58740
     cgaactaggc aagatccata agtgataagg tgcttgagat attcaagagc cttttgataa     58800
     agctgcctaa ttctttcgcc agaaagcttg agcattgtcc caatctcgcg atagctatga     58860
     ccgtctctcc ttgcacggac aataaaactt tcgcgatcag ggagctgagc aatgtagtct     58920
     ttcatgttga tactctcggc aaaatcccaa gaatctagct gttcaaaatc ttcaacaaaa     58980
     tcaagacatt caatcccttg ctctgtccca gtcaagacat tgaggctaga ggtatcaact     59040
     actcgtgctt tattccaggc gttagtaatt actcgatgtg aatatcctgt acgttcagcc     59100
     agttcatcta gagtgggttt tcgttctaac tccagctcta agtcttgttc agcttcatca     59160
     atttttttta ggtgtttcgt aatttctcta ctgagtcctc tttgttcaca aatcaactgc     59220
     ctgatttcag ttctgatagg cttaacagcg taggtactga attgaaagcc cctcgataga     59280
     tcaaattttt gaatagcaat ggatagtcct agggttccag cattcactaa atcgtcccag     59340
     tcaactaatc cgcgatatcg tttagcttcc ttgaagacta gccgctgatt ctttcgtata     59400
     aaacggtctt cagcccttct gtcaccagcc tgagcgcgtt caatctgtgg gtactggact     59460
     ttgcggctaa acggtccggt ctccagggat tgcgaattga aaacattggt gtataccatt     59520
     gtttaaacct tcagatccgt aatctgtgtc taaggttttc ggaccctctg gttgtttgat     59580
     cgcggttaga gggtctttgg ttttttcatc aaaggctaac ggtgcagtta gcctcaatcg     59640
     gtgtttaagg tttcggaccc tctggttgtt tgatcgcggt tagagggcaa tagcaatctt     59700
     gtgtcgtcgg caatctaggt agcgaagatc gaaataccct attacctaaa acggttttgt     59760
     agtggagaaa tcgttgatac ttcatgtcac cccccgataa ccatttgttt taagtgcctg     59820
     ttctgtttgt ttacagccca gagacgagat tgagaattgt gtagctagat agaaatcatt     59880
     ctcattaaat atagtacata tgtaccaaaa ttatcaatca ttcacctcct agtaaataga     59940
     gtttttgatg aaattgataa gttcgagcta gctagaggta aggcatccag taagaggtga     60000
     atttcattaa atttactgaa gcaattattg atcgcggtta gggaattcaa agtctgttca     60060
     atgcctgctt gtgctcacat gtttgtggtg tgatgagtat ctctgtgatg taggcagggt     60120
     ggcaggattt gtaagtttaa tgcggtgctg cctaccataa atatgtgacc tctttctagg     60180
     tttaaggctc tctaatcttg tttcaaggtg gactaggggg ctgatttgtt gtgtgagtag     60240
     agctttagag tttcctttcg ttatacgcga atggtatctg atttaatacc aagtttaact     60300
     tgtttatata gattttagat caattctata taatttaaag caattaaaaa cactcttttc     60360
     aatctaacat catttaattt gattagattg cagtaaaagt tgtgtagttt atgattcgat     60420
     gggtacatcg tggttaagca attgataacc tggaaactca aagaacacat ggctgcaaac     60480
     aagatttccg tacctcagtt ggcagccaga ttaggaatta gtgaaaacgc tgtaatcaat     60540
     atgagaagga gcgagatgcc tcgtattaat ggggaacgat taaatcaaat tattgtggcc     60600
     ttgaatgcaa tgcgtaagaa aggtaagaaa cgtatacagg ttcaagactt gatagttttg     60660
     actttctcga tggatgaagc tgatgaagca aggatccacg agtgatttgt ttcctatagc     60720
     ccactctccc tacccttcct gtgtacctca tcggtcacac agaaaatgct caaaaccaca     60780
     ttattgtcac ttgggctgtt agcgatcaca tccgtgtcag ccctcgccaa tcccgccacc     60840
     attcccatag atcaagcctt caaacaaact caaaagctag aagtctcaga tgtggatcat     60900
     ctattagact tcacggatac ccgctaccga gtcatcaaag cctttcccag taaccctcaa     60960
     cagttgcggg ccttaagcct gtctcgtaac gatcatcagc aactccttct caagtggacc     61020
     ccaaacggca cagccaagaa agctagtgtt ttccttcggg tcatggggcc agggggagaa     61080
     caaaccatta cgctcctagt gaagcggtct ggcaacgaac cggacaacat cagaacagcc     61140
     ttcgtcccca gccaaaccgt ttccaaagat gcagtgatcg gggaagtatc gcaagtttcc     61200
     atcaaaccaa ctgttgcacc tatcccaacc caactcatcc gccccaacag gaccacccaa     61260
     aatccaccca aaacagcaca gcctgttaaa ccgcccttaa ccctcactca cccgaaatcc     61320
     ccacccgtca tcaaactcag atcttctccc aagcccatcc tccaaatagc caaagtctca     61380
     accacaggtc ggcccctcat cgaccgctcc acattggaca acaaagcctt agccaactac     61440
     ctgatcagag gactacacac cccgaagggt cggaaacaag ccaaccgcca tcacgaccac     61500
     tactggtttg ctcagtcgat ggctcgatat ctcaaacgtg gcgtatccat tgataaagcc     61560
     ttgcgctggt ctcgactacc agagaaaacc tttaatgacc tcctcggcca cggtggcgtt     61620
     agtcgctgaa aagcccaccg ttaaagcaaa cttgcacctt taaagccatc ttacctatgt     61680
     ttcaaccatc cccctttcgg agattgaatc ctcatgctat ccccatgcct tcaaaccgca     61740
     cggcactatg cccataaaca tggaccaccc tggtcagctc ccctactctg catccttctc     61800
     accctctgcc cctttatcct ccccctcccc ccaggcactc agatcgcagg gctagagatt     61860
     atggcaatgg tttggtccac cgccctcttc ctccacctct accaaacgct caacatccaa     61920
     accaagctgg gcctctatct cttcttctcc gggatgatcg ccctaacccc atccatggtg     61980
     aaagcccaaa acgtcggcaa tgccccctcc agtgcttgta actccggttt cttcctgatc     62040
     ggccccatgc tcggagccgt ggatacctcc ttgggctggt ttctgggtgg cgtcctcgct     62100
     tactcccttt gcgcctttat gattgccctg ataattgtct tcttcctcgt tgtcattgtc     62160
     ggtttagtga tggctggggc agaatcccac aacagcaaac gcaccctgtt tgaagtcctc     62220
     tcccaatacc tgaacgtgat catcaccatg atggtgatcg cctccttggt gaccgtcttt     62280
     aacctgcaat tgagtaataa cggcaacgcc gctcccatcc ccgtcggtgg acagaatcag     62340
     ccccaaggcg caacctccgt actgaactag gaggttgagt catgaaccag accgaacaga     62400
     ttgaaaaaga actgcgctac ggcaaaatca acccctacat cggccccacc caattccaac     62460
     tcctgagtgg acagcagatc atcaccctcg ccgccagtgg ctgtatctgc tttatcctcg     62520
     gattctccat tggctggttt atggccgcat ttctatggct gggcatcttt gtcctcaccg     62580
     tattggccct gggaaaagac tactcccgca tcttcgcccg tatgagcaaa cagcgacggt     62640
     actacagtga ccgtcccaac tatcaagtca aagcaggaat ccccctgatg gtgattgaac     62700
     tacctgaacc cttcaaactc agtcagcttt tccgtagaca aactaagcag aaaaccttaa     62760
     agaaaataga acccgaattt gacctgagag cctatggaga aatgctcctc ggtgaagaca     62820
     ttggttttta cctcgtccat caagataaac aggaccgagc catggtgatc ttcggattca     62880
     ccctccaagg catcgacccc accctgtcag aacaagaagc catggactgg cttcaagcca     62940
     tcgtcatggc cctccagaaa atccctggca tcgaactcaa attcttctgg gacgtggaag     63000
     gctctgcaga tcaagtcctt ttacatcaac atgatctcgt cacccaccat gacctcgacc     63060
     ccctgagtga aaagctgatt aaaagtgagg cccaagtcgc cgttgattta gccgcagacg     63120
     gtaaactcgt ccattccgtc atccgggtct atgccaaata cagactcagc ctcgctgatg     63180
     actatgccgt caaagaagac cgcttagata agctcctggc ccatacccag cccctagtcg     63240
     gcaccttcca agagtatctc aacccccaac ccgaaggctt tagctccaaa caagcctggg     63300
     agaaagtctt agaccgagcc tatcaagccg gatatattcc caccgccaaa gcgttaactc     63360
     aaatgggtgt caaaccccag cccatgacca aagaagacct gtgggccatc gactgggaag     63420
     acacccatgc agaacccgct gacccctgcc cccaatccat tacctacagt gaagcgggcc     63480
     tctctccctt cagcgagaat cagcctctgc cctatcacat cctcggagaa ctgttcagcc     63540
     ccgaacgagg gttacccgcc gtacccaccc cctacctcta cactctctat caccccatca     63600
     agaatcaatg ggctgccctc gtcaaaatca atcagctcag cacctacaac aagatcgata     63660
     acttcctctc tattggctat atgaaatttc tcctccaagc cctagaggga tttcatggct     63720
     atcgcctcat ctcagaaatc acccagattg aacccgactc ccgcctgaag ctcgtcaact     63780
     ccgccatcaa agaacgcaac cgcaaagcca tcgatgctca actgctccac agcacccgca     63840
     acgtccaagc agaagccgat gtgaatgaat tagtggatgc ctcccgtgaa ctcagctccg     63900
     gtcgctggcc cttaaaagtc agcctcggta tctgggtcta tcgcaaagat aaagccagcc     63960
     ttaccgctgc tgtccaagac ctaattcgcc gcttgcccac cagcaagacc gagcaagtca     64020
     gcaatcacct catgacccac tggatctcca gtcatccctt ccactggcaa agcctgttct     64080
     ccaagcccca actgcggcga gaagaatatc aatgcaatca gggggttccc ctgatgcccc     64140
     tcgtccatcc ccagaccatt gatcagcagg gcatcccctt tgtctccaga ggcgttgcca     64200
     ttcccgtcca tctcaacaca gccctgaaga agaacctgat tgccatcttt ggacctatgg     64260
     gggtaggtaa gtccgtattg atgaaccgga tgatcctaga gaacatcatc catcgcatct     64320
     ttaccgtcgt cattgatgtg ccccccggca acggcaagag tacctatcag ccgtttatga     64380
     tccagctcca acgaattggt gtctccgcag cctacttcga cgttaaatcc cacatcatca     64440
     atggactcga tgaaatcgat acaagctggg caggtgacct cctcagtgtc caactcctca     64500
     agaaaatcaa gcaaaaccat ctcagtctcc tgcgggcctt agtcctcggt gacgacctcg     64560
     accatcctct ctacaaaacc atcaaatctg tcctggccct cagctatcaa gactggcggg     64620
     ccttagcgga cattgaccag cgctatcgca ttgccaaagc tgctgctttc ggctcagaag     64680
     actccaaacg aatgcctatc ctccaagact tcgtagatta ctttccccag tgggtaaagc     64740
     aatacaaaca ggataaagac tgtgaggatt tagaactgca ggccatcgcc atgatccgca     64800
     cggaactgga agccgtcctc accacggacc tcggagcctc catcaatggc attaacacct     64860
     ttaacttcga cctccaaacc cttgtcattg gcctgacgga cttgcaagac ccccaagaga     64920
     gcgtcatcta ttccatggca gcgattaact tgatggaact ccagtccttt cgttatcccc     64980
     gctccgccat ctttggcgat gaaatctcca ccacctttaa gtaccgctcc atctccatcc     65040
     gcttcgctga gacctgcacc cgaggccgca aagaagccaa gaacgttgtc atcgcgggca     65100
     cagaggaaaa cacccttgtc cagtctgagg gaggccgaga tatcctcagc aacctggatg     65160
     ccgtcttcta tggacactgc aatcccaccg ccgtagagaa cgccgctaag catctgcgcc     65220
     tcaagcccga aatcctctcc aaatatgtcc gagccgaata tgcccccaac ctggcggaac     65280
     tctgcacctc ctggtatctg cgtaaaggga atcaacacta tgagctgctg ttctacacct     65340
     cagccctgat gattgctctt gtctgcaccc aacccgaaga aaccgcagcc agagaccgga     65400
     tcctggctct ctatcccgat aatcccctcc agggctatat caaatttggg catctgctga     65460
     aacgggctta caaactcaac ctgccccttt cccttatcgg agcctgagcc atgaaccgta     65520
     aacaagccgt actgttttct ctaatcattg tcttctctag ccctcagctt acccaagccc     65580
     aggttttctc tgatgacata accctaccga cgaatgcccc caccttccca tcgggtgttc     65640
     ccaataccac cggggatgtc agtgtcaccc aggataatcc ctttgacgat agccccaaac     65700
     ccaacttcct caaagacatc ttcttgggta cgagcaacta tagaccgatt cattccagta     65760
     ccttgaagtt gttcgatatc ctcggtaaag cccagaaagg cttacagacc tataagaacg     65820
     tcaaaaaagt ctatgacggc atccgaggta agaatgccaa cagcattacc gatggggtgt     65880
     tcaacgtcct cgaacagtac ggcatcattg acccccaaaa agccaccact gcctcgaatc     65940
     gctccacccc tatcctcatc ggtcaaggga atcaaggtcc cgcctatgcc acagctggct     66000
     caatcggagc cttagagcta gaacccaaag aaccctatga atggcgggtc aaagccttaa     66060
     acgaaaacat cgtctataaa aacgccattc aaaagaccgg ggactttatc tactcccctg     66120
     aagcccaaga aatcctcaaa gtccaagatc aagtcgccgc tgatgccaga gacgctgccg     66180
     ctgccgctgc tcaaggagag ctagaatccg tcctcgcctc gacccaagtc aaagaccaga     66240
     gcatctatgc cagcaccgtt gttggtgaat acggcacctc agctcaaagc gctaaatcca     66300
     cccaagccgt caacaaactt gagacgaagc aaaacaccga gattgccaac attctggcgg     66360
     gcaatgcctt tcaactgaat gccatcaacg aatcaatggt ccgcaacact tcagccttgg     66420
     gcaatatcgt cactacccaa tccatcctcg tagacaaaca gaccgtctcc caatacctag     66480
     atgccgctca actccgccag tcaggtcaaa tcttcaccac cctcaacaac caatattcct     66540
     atgaaaagcg caaggacatg tatcgccacc tggccgcagc cgacaccagt aacctgcttc     66600
     atttcccagg tttggtggaa cctcaaccga atctttcagg acaaacgcaa ccgtagactg     66660
     atcattgcct taatctatgg catccttatc gtcctgcata tggcaagcca tgcccatgcc     66720
     gactttgccg aagacctgat tagcgatcta gaaccgtccg ttgcccatga cgcattttgg     66780
     gatgacctct ggaacgccac ctttgaccgc tccacggtta tcagtggtga tacccgaaga     66840
     attgcctttg gatccgtgag cactgtcgtt cgttgggtga ccctgattgc cctattcgtc     66900
     gtcctcctcc attacgggtc aggaatgatg ttcagcggca ccagcttgcg aaaaggcaat     66960
     gaattcacca tcaaaagtgt ctttcccgtc gtcatcatcc tcgcccttct cgccaatcag     67020
     tttgccgggg tccatgccgt ggggctgttc gtcaatcagg cccgcttagg ggttatggga     67080
     gaagcctatg ctcaaacaga attcgccacc accttccgca gtgccattaa agacgcctat     67140
     ctgtcagaga agtatcgaga gagcctcgcc tttcgggcca agcaatgcaa cctgattgaa     67200
     acccccatta ccaccattcc ttccctagaa gaacccacca accccgagac gcccctgacg     67260
     gatgaacagc gtcagtacta caaaaagctt cagtgcatcc agtccatggt cacctatatc     67320
     caaagtctgc aagcgcaagt ggcagcagaa tgtgaaaaag gctgtgtggg caccaacgtt     67380
     gccatcgtca aagatctcaa aaagtatgga gtcgatgggg ttcctggagt cgtagccgag     67440
     aacttggata tcttcgtcat ccccattcaa aaattaggag aactggccgc tgatggagcc     67500
     agacatggag cccaagaaac ctatcgtctg atcttccgag ccattcaatg ggcctggacc     67560
     tcgtttctaa atatgggatt ctatctcacg gcagtgggag cacccattac ctacgccata     67620
     tccctaatgc ccaccaagcg acattttcta tttgatttga acctgttcgc cctgctgatg     67680
     ttctccctag cagagtttgc caatatcttc tgcattggga tagtggccct gatgctgcaa     67740
     cgacccaccc tagtggactt aggtgggtat atcttccctt tgacctatgg attacttgca     67800
     ccgattgtgt ccggttcaat cttcctgggt gggtttaagg ccgcagccag ctttagaggg     67860
     ggtgccttgg gtgttgccag tgcagcagga ggcatcgctg gagggattgc cacctcagtg     67920
     atgatctcag cccggaaccg ccgagagcaa tattactaaa ccgatttgct gctcaaaaga     67980
     catcttgcct atgtttattg caaccgtgac taaagggaga aaatcatgcc cttgtaccca     68040
     accatcgccg ttgtatttat cgtctttgcc gtgttgctga tcatcattcg tggggtcttt     68100
     gcagatctga ctcccttggg tgggttgatg gcctgcaccg ttctcaccct atttgcgggt     68160
     taccaccgca tctttgctgg ggcagatcag cttgcagggg tggactcctt tttcaccttg     68220
     ggctttggat tgatcatttg ccagctcttt gtcccagact tccgattctg gtggtcagac     68280
     ttccggttta tctacgggat gacggtgctg ttctactttg ccttctgctg gacctttgac     68340
     catgtgtaca tcctttggtt ttggttcacg ggattcgttc tgcttctcct ggcagtccaa     68400
     ctgctgttta gcgcagtgtc atctgggggg cgtccacccc tgcatcctga tttagataag     68460
     gatttcatgc tgtatgaaga cgaatggctc tttgacgatg actaagaaaa tatctcgctt     68520
     cctcccccta ttagttgttt cagccttact gctgaatatc cttgtctgtt tttcctggtt     68580
     tacccaagga gccagagcgc aagccccctc tcaggtgtat atccagactg actccgggtt     68640
     agtggtcaaa ggtcagcccg tggaccccct ctatcgcagt gatgaagtcg tgatgcggtt     68700
     tgcccaggag tttgtctccg tggcctacac ctggccgatg aatggcgagg gtcaccgtga     68760
     aggcaagctg atctaccccc tgcctatgta cacccaagct ttcaagatcc atcctgatat     68820
     tcgttcccag tggttagggc gtcagcatgt cgcctatgcc aaagccaaag atccctttgc     68880
     caactatgta ggccagtccc accatacccc tcttttatca ctttagacag agagaaaatc     68940
     aggatgcttg agcaatttcc tcaccagtgg acagcaaaat gcctccatct ttgatgtgag     69000
     ttgctcaaac ccctttttca aagcacggct gggaaagact tctaaccagc gctttagaag     69060
     attccaactg attaacggtt gaatgatcaa gcgcacatta ttgagcagat tcttccaccc     69120
     gttttggtta tcccaccaag gatgctgcgc aaagtgttga tgtgccactg gacaagagtc     69180
     attgaagaca tcagcgaaca aactcaccat caagaaagcg ctcatcacta tctcccacca     69240
     cttttcaatt tgttcgtagt gcgtcatgcg aaaatcagcc caacccaagg tatctttaga     69300
     ctgtttgaga ccatactcaa tccaagttct gaagccatag caatccccaa tttcatccag     69360
     cttgatctcg ggtgccgctg ccatgacata agaggttgag ttctctggta gcgtttgggg     69420
     gtccgtggtt aatagccaat agcgcttctg gtggtgtcgc tggccataaa tgatctcttg     69480
     cctgtaacga gtttcagtgg tgccattgct gaaggttcgt tcaaatgact gccacggttc     69540
     ggcaaagact gcttgttctg cgggtaacca caccgcatga ttgctacgaa tcgctaggat     69600
     atagggcagc tttaactcct ctaagacatt cacaaagttt gtttgagctt ccccatacaa     69660
     gctgtcagcc aggacgagct caaagcaaaa gcccatccct tgcaactgtc ggatcattcc     69720
     agcagcaatt tggggtttgc tgagatactc atcctcctct ttaagacgtt ctcggggttt     69780
     gtacacttca aaggacaaag gcaaaatcat cccttgaaac agcccgtagg cagtgactgc     69840
     gacgatgcca ttctctttct tgcccacatt gccgatatac tgccgtttca catagtcggt     69900
     actcttgcct tttttgcaat cgcccgtctc atcgatcaat agaattaacc tgcgcccatc     69960
     cagtattttc aagatgatgt ccaatctctt gtcagacaaa tgtgacgcta cccaaggtga     70020
     ttcactcaga aaatgatgca ggctttgatg gttctccaag cccactgctc ttgcaatggc     70080
     gggcaatgat ttacgtttga tatcactaat catccccaga tggagatgct tgaaggcttc     70140
     ataactgcgg acttggggaa ataactctgc aaatagttgg cagtactcat caacaaagcc     70200
     aatggttggt tctggacttc ttgaagctga catcactcat tagaaaaata gaaactgaga     70260
     atagtctatt ttttatctgt ctaaagtgat aaaagaggga tacaaagacc accattacgg     70320
     gtgccaagat tgagcgatta gatgcagaag cccatgaatg ggatgtcagg ctgtatgcca     70380
     cccaataccg ttttgatggt caaaacaacc tgatttataa ccccgtcaag gtcaataaaa     70440
     tcttgacctt acgagctgtg caagggttta ggcccaactg gcaaattgcc gatacggacc     70500
     tgggccgcat gattgatgat gccctgcatt cagagctatt gattaccaac attgtggatc     70560
     tgcccaccta gaacaaccca gagagcaaag acaaggagcg agacatgccg acagataaac     70620
     gccaggtcga ggaagccaaa gccatattgt tggatgaccc ggaactcaat gaactcttag     70680
     aagagaacaa gatttctgaa ggtcggccca tcaacgatct ggagaaaatg gtcgatccag     70740
     gggataaagt caaacacccc tactatctcc agccctggtt caggattggg agtatcgcca     70800
     tccccctgat catcatgggg tttgtgggct acaagatttg gggacccaaa ccccagaagg     70860
     tgatggcctt gggggacaag gataagcaga ttatcgagct gacggaaaag cttcagcagt     70920
     ctgaattaga gaaagcccag ctcacccaag acaatatggg attgactcag gccgcagagt     70980
     tagagccatt taaacagcaa cagaagcagc tcaagcaaca acagctcaag cagcaggctc     71040
     agaaacaaca agccaaacag aagaaacccg tgcccgtgcg tgggaaaccc attcagcgcc     71100
     agaataccgt tagtattcct cgtcggctct atcgcaaccc cactcccaaa cgtagctata     71160
     ctccagctaa gcccagtcct tccctactgg cgaattctaa gcctagcggc ccctccttga     71220
     gtgaatgtgt gggttatgta gagcggaata tcaacgttcc aggctgtaac cgctatcaga     71280
     tcagtcaaaa accccagtca tcatctcaga ccgcttccat tggcaaaaac ccgacaatcc     71340
     ctcgtcccgc ctatacccca agaccccaga ctaagcccgt taagttggcc tttgccagtc     71400
     aaagcaaggc caaacctcga actaaagtaa agcctgacta tcaggtgaac tttatggcag     71460
     gggagattca aacggtggat cagtttgagg ctgagttcta tggtgcaggc cagagcgctg     71520
     ctgcaccgac gcgcacctca atgaaggcca aagtgattga ccatgtggaa tggatatcgc     71580
     cccaagaagc tcaacagatg gtcattcctc tgaaaattac cagtggaccc cacaagggcc     71640
     agacggctga ggccaagatt cagcagatga atggtttgca gttcacggct tatgtcaccc     71700
     gcatcaatgg tcaagagatt gaaccaggga cgatggaagt gaggcgcaag aataccaagt     71760
     atctgagatc gcaactgaag cgtcaaggag gagagtcttt cggggataga gtgatgggga     71820
     cagtggctgc aattggtggg gagattgcca cagaccagtt agcggatgtg cggggaggga     71880
     atcacatttc ccgactggta tctaatcctc agcgtaggac cagagaggtg acgcagtatt     71940
     ggcggtttga tggggaggtg gagttggttc cagtggggtg atttgcaaat actgaagtag     72000
     tttgactatt ctgggttaca tattccaaaa tatatatttt cttccccctc ttgagattaa     72060
     ggttagggaa gggtttcatt cttcattcca cttctggtta atttaattta cacctggctg     72120
     cttaatctaa gactgtctgc gttaaagaag cattatggct agaaaatcta aggattttag     72180
     tgaattaatc catcagaagc agcgtcaaga acaaaaaaac gcagactcat ttgagcggct     72240
     gcagaacaaa gtcaaggaaa ttgcgggaga agacgtttcc cgaaacatgg tgttcaaccc     72300
     cccggatgtg aacaagatgt cagaagtttt gcaagaatta gttgcaccat acgtacagac     72360
     aacccccagt atttcagagc ttgataattt tttgaaaatt gctgttttgg cttggaatat     72420
     tgccttgaca tccccggaag agcgccaagt tgcactaaaa cagatctttt cagaaatggc     72480
     ttctagcact gatcaggaca tcatagaggg cttgaaaagc ttagtcgagg aactgattga     72540
     acgcaaagac cactatttct ggtcttgcca acgcagtatt actagctttg atttacaaga     72600
     tcaaggggat agctattttc tttcagtcgc ctctactctt gaagaataga ttcctgctat     72660
     atcaatagat ttcccttcca agggccattc tgtctatcct ttaactctgt ccaatttttc     72720
     tgggcctaca agcgtacctt ctgttctaac ccttagcgta ggaccaggga agtgacgcag     72780
     tactggcggt tcgatggaga ggttgagttg gttccagtgg gttgaatagc ctaaaagaag     72840
     acagcttttc tacccttcga tttattctgg aagtatgcat tcttctccct ccctgaccat     72900
     gcgttgggag ggatttcgtt gcagagcctc attccgttca aaaaaccgtc caacttaagg     72960
     gtaattggac agcaagttct gttggatgtt tccaagatat atgtatcaca ggttagaaat     73020
     tttcaatacc ttttgattag gactaactaa acaaaaacat agcaagagag atacttgctg     73080
     aatatagtga agtttgatgc tcacgcgtta tatgttcggt tggttcgtct taaattttca     73140
     aggaacccca cgctcaccat gtcaagcaag gtggggtatt agcaggtatc agatttatcg     73200
     gacctttgaa ttgttacatc cattgaattc ataaaacctt aaattttctc gataaattaa     73260
     ataaaaatat tccttcattt ttaggaatat atagacacta attcagcttc tcgatctcaa     73320
     acgcgaaatc taaaaataca actcctcttg aagggaagta ttgatcaatg acgggatgtc     73380
     ttgaacttcc gcaatgctct aaagggtcta gtaaaaaggt atttcagaag atctccgaaa     73440
     ggtaattcgt atttggaatg agagttgcta gcggatccgt agaatctgcg tccgcatgat     73500
     ttacagcgat aaggctgaat ccgaaaaaaa cagaagtaca ttttcatgga atcctctgag     73560
     tcgagattcg gtaagataac gacttctaca tctaggacag cgcttaacca cagctctcac     73620
     tttcgtactt ggtttaggta gcttcgttaa tattgtggca gttgagtata gaaagagtcg     73680
     taattttcat gacattcctg tgtattttat ttggaatgaa aggagtttga agcaccagtt     73740
     ttatatctcg gagtatactt cgaataaggg aaatatattt taaggcactc catcgctgga     73800
     ctgagcgctt tctgtgtagt ggataagtaa gagtagttct acccgatgaa aatatcatca     73860
     gattgataga gttggtggag tgattgaaag aagcacaatt tgtctcaatg agctatggca     73920
     tataacattc agacgctata tgaaacagat gtagtcaagt ggtctttgaa gcaggcaaaa     73980
     ctactgaaag ctcgtaagtt tgatttggta gatcttgaaa acctaattga ggaaatagaa     74040
     gatgtggcga gaaggtacaa ggacgtaatc gaaggacaga ttgaaaatct gctggtgctc     74100
     atccttactg ttaaatacaa gcctcagaag caaacaaaaa gttgggataa agacgtcctg     74160
     accagtcaag ctgaaatcca taagtggatt gagaaagagc cctccctgca tcgtcatgct     74220
     ctatctagtt tcaacttttg ctacaagtat gctcgaataa aagtatctat tctccatcag     74280
     atttcccttg catcgattcc tgaggaatgc ccagaagatg tcaggataac agcttgggaa     74340
     ttgattaata gagatgatgg gatggactag caacctgctg atctacgaga attcaagtta     74400
     tagaccttga tatgcaatct ggcagcccta aattagattt acacctcatg ggctattgag     74460
     tagtccttct catgtacgca ttcataggat gcctatttta gccatgtcta atgatggata     74520
     ttttggtgag gcagttgctg aaacttacga caacgatgta gattccttta accctgacgt     74580
     aattgaacct gtcgttgatt gcctgaaaga gcttgctggg aatggtaggg ttcttgaatt     74640
     tggcattgga ataggccgaa tcgcattacc cctagcaaag cgaggtgttg aagttcatgg     74700
     aatcgatctt tctggggcta tgctctctaa acttgctgaa aaaacgggtg gagatcgtat     74760
     tcccgtcatt caaggagatt ttgctaccac gaaatgcgaa ggctcattct ccctggttta     74820
     tctgatattc aataccatca tgaatctgac gactcaagat gcacaagttc aatgcttcca     74880
     gaacgcagcc gctcatctcg aacctggagg acatttcatt atcgaggtta tagtccctag     74940
     ccttcagcga atacccttcg gtgaaaccaa gcatgtattt gaattcgggg atgatcattg     75000
     gggaatagat gactatgatt tcgtctctca aaccttagag tcgcatcaca tgatggtgag     75060
     agattcaaaa atagaactgt cctgtattcc atgtcgctat gtctggccat cagaactaga     75120
     tctgatggcg aggattgcca atttagaact gaaaggaagg tggggaggct ggaagaacga     75180
     accctttaca aataccagtc gttctcacgt ctcagtttgg gaaaaatcta gtgatggcga     75240
     ttagacgcca ttagaaattg ctggcctcaa cccctgacat atcaacccat ttgcacctca     75300
     aaggtcatcc tgcctatgtt tcctctgtag ctcatctaca gggaatttct gttagtgacc     75360
     ctcactgttt tcaagcgatg ccctactccc atcgtttctc tgattaacat ggttttccag     75420
     actctttatt catcgatatc acacgtcaaa ggttttccct ttgccactgt tgaataaaat     75480
     cagggaagcc tgagaactgc tgtttggctg cagagacaat tgagtcaccc gttggcgggc     75540
     aatcgatact tagattagta gccagccagt tacgcaatgg ctgagtagcg ttccaacctg     75600
     aggctttctg ggtaaggtcg tcccactcca attcgtcata tccacaaccc aataagcggc     75660
     agaattctag cgaatttgta gcaagaacca gcagttctcc ctcagatcca agaacgataa     75720
     ctggagcaag ctcggtatcg aggttatctc gaagccaaag agcatatacg gaacccgtag     75780
     agccacggcc aaacacagca aactgttgct gcattgccac gtcattagga aaccaagccg     75840
     ccatatcatc atcacctatg gtactaatct cgaagcaacc actgatcgga taaccatgat     75900
     tgtccaaaaa gtcgcatagg cagcggattg gccgtggcat tatgacacca ggtgggaatt     75960
     ttgattcgac tttatctgcg agcataatgg gctgaaaaag aaagcaggat tggtggtttg     76020
     atggcgaggt tgagattgtg ccgttctttt gatttgctac taccaaagta atttgtcagt     76080
     tcttggattt attctaagaa tatgcgttct ccccctccct aaccatgctt tgggagggat     76140
     ttcattgctc attgccagtt cttgttaatc tagtgtgcat ctggctgctt aatttcaaga     76200
     agactcatca gaagaaccat tatggctaga aaatctaaag gttttagtga attactccat     76260
     caacaacaag atgatgaaca aacaaccgtt caatccttca agcggttgca aaaaaaagta     76320
     cagaaaacaa ctggaaaaga ccttattaag gacatagcca ctagcccaaa gggcgttgcc     76380
     aaaatgtctg acgttttgga ggaatttatt gatccctaca aagaaacaac atctagtttt     76440
     gaagatgtga aatccttgct gagtattgct gtttttgcct ggaatatcgc cttattaccc     76500
     gatgaggacc gccaagaagc tatagaaatt attttgtcag aagctgcctc tgggatgaac     76560
     caaaagaatc gaatggagtt gcaaacctta atccatcaga tgattgagcg taaagactgt     76620
     tatttttcaa gctttcagcg ctatattgct aattttgact tgcagcctca aggagatagt     76680
     tatttccttt ccgttgcttc ttctctcaaa gaatagactt tatattatct tctcaatcag     76740
     tgtgaattag atgagcctaa tgctatgggc gctgtgatgg ggaagtttaa ccgttctcag     76800
     ttagaaaaag aggaaacttc tttttccgca atcacggcaa cggtacggtc tgattctgat     76860
     aaccaataga agcttttcag cgcagttttt atgtctagac cgttttaggg cagtgctatt     76920
     acagtgacta catctcttag ccatgagtct acccagactt tttatctcaa gtctaaagga     76980
     agagctagat agagtcagtt aagagtaata cacatacctt taagctgact aaaatctatg     77040
     gggtaatttg cctatctttc gtcatatatt tttctagatt ttttcaccca ctcgttgatt     77100
     tcagcgagtg ggttttatgc ggatatctag gtcaccaaga ttcaatttgc acctcaaagg     77160
     ccatcttacc tatgtttcct ctgtagccca actacagggg atttctgttt gtgaccctca     77220
     ctgctctcaa gcgatgccct accctcatcg cctccatcct catcgccgct tcccagaccc     77280
     ttcctgtctg gagtcagact caacaagtcg ggtactatcc agcccccgaa cttgccaatg     77340
     ttcctgggct aatctatgac ccacccccgg aagcccaaga ggtttctttc tctagtctcc     77400
     ccggtgccag ctctcctggt tgggttgtcg tggatgaccc caacctcacc tatgacccca     77460
     accgtgcttg gcccgctgga gccacaccag atcggatcat caaatttgga gacttaaagc     77520
     aaaaccctca atttgcaggc ttcactaaac acagtcttag agactttaac aatgccattg     77580
     gcaccgacat cggcggagtg cccatcggcc aggttgaact agtcaatggc ctcaacctcg     77640
     aacaggtcaa agacatttac aacaacggcg atatcaaact caaagactcc gctcccctat     77700
     tccaagccgt cgtcggagtc gtcctcgacc ccacaggtgc ccagaagcag cttcaacgca     77760
     atgccctgag tacaggtaag aaagctctga tcaacgaact gaataaaaac ccagccctca     77820
     aagatatccc ctttgaagac ctcctagatg gcaattggaa aggggccatc aaagaaggtg     77880
     aacaagtctt acttcgagaa attggcaatg acattcccgc agagctgcgc cgcttacccg     77940
     tcggttcact caccattgaa gtcatagaag gcaactggga aaccgcccga caacgcgccc     78000
     agaattatgc cattaatgag atccaaaact ttaccctcaa tgaaatcatc aaagaattcc     78060
     ccgaactcaa gcgagtaccg attgggggca tcgtccatat cgccaatcag cccctagacc     78120
     aagcccttcc tcaactggca gatatggccc tagaacagtt ccctggcata gaagacaaga     78180
     tcctaggatc agtccctggc ctcggtgata cggcccttgg gtccatcgtc gctcccgtca     78240
     tcattaccct gtttaacaga gatatcttag gtaaattcga tgcggcccat agtggtcagg     78300
     atgggccaga agaacattat ggtaggccga tcagtggtgg cacccctgac gccaaattca     78360
     agccagaaca tgggattaag agtgccacga gcaggagcaa gcgaccagag cgagggttcc     78420
     ctcggtttga gatggcccct cttgaaccag gaactacgat acttggtgat ccacttctag     78480
     gaaaagagtg gatgagtcga gatcaggaag tcccaggatg taaagggttt ctctgtctgt     78540
     ttggaaacaa agaacgcgca ggcatcaaac cctttggcaa tggctctctc accaaattca     78600
     gtctgggaga catcacggaa tacgatgaca aacccgcaga agcaaggcta tggatcgact     78660
     ttcagatctg cgtcaccatc ctatttgaga agcactgcac ggctcatatc tttagtttca     78720
     aaaccccgtg gaaagtcaaa gtggggggca tcttcccgat cctcgctcgt cgtagagtcc     78780
     aagattactt tccagggatt aacgagaaga ctagaaccat tgacttctgc caagtccctg     78840
     acttcttagg gggaacgaca acagcgggga atagtccccc accgaataac aatgccctct     78900
     atggtcactt cgtctatgcg gaaaccacag gtcaattggt caacgtgacc tccgtcgatg     78960
     gggtacagga aaccttagcc ccagatgcag cccaagcctt tgagcaaatg gtggcagatg     79020
     cagccgctca gggattggat atcaaagcga tttcaggctt tagggacaat cagacccaac     79080
     agcagctatt cgacctccag actcaaaggc aaggctctcc tgaagcagcg gctaaagtgt     79140
     cagcccccgc aggtcacagt gaacatcaca cggggttagc cgtggatgtg ggtacgaatg     79200
     ccaaccccac gcttgagact cgttttgcga atacacctga gtatgcctgg atgcaacaga     79260
     atgctgggaa gtatgggttt gagttgagct ttccagagaa caatcgtcag ggaatcaact     79320
     ttgagccgtg gcactggcga ttcgtgggta cgagtcaagc ccaacagacc tttgcgaatg     79380
     ctgctggaag tcatacagac cataatcaag gcaatacttc aacgccttca gatcctcaac     79440
     atcgtttgag acagtatctc gcccgtatag ccttgggtga atcatctggg ggaacggata     79500
     ttgacgccca tcccaatact ggggcttatg gggaatatca gtttatccct gagactcgca     79560
     aaataatatt ggatcggtat ggtttagatg cttggtccac gaataaagcc gaacgcgatc     79620
     aggcgaccgt cgcattgatc caagcctttg gtgacgagat tgggacagac attcttgggt     79680
     tgattgaggc gggtgagttt gagcaagcag atcaattgct tggtcagcat gtctacagtc     79740
     gagcggggaa tgtgattcgg tatggtcagt tcacctcttt accgggtgga gctgaacagc     79800
     atgacatctg gaaagaccca gcaattctgg ctcaatatgg tccgaatggg aatgcagggc     79860
     agaatccatt gttggctgca atcaatacga attcacagcg gtgtaatcct acgttgttgg     79920
     tgagtaatag tccctttgtt cagggttccg gtgtggcctc tggggagtta caagatccat     79980
     tatcgggtca gcaatataag gtcaccagcg attatggata tcgaaccgat ccagtttatg     80040
     gaggaacggg cttccattca ggcatagact tagcttggga tgctgggaca cctataaagg     80100
     cggcagatgg gggcgtagtt gttcgctcag agtggtttgg aggttatggc aactatatcc     80160
     tgatagacca cggaaatggg ttggctactt ggtatgggca caatcaaaac aattatgtgt     80220
     ctgtaggcga taaagtggac ccagggcaag ttattggaac tgtgggtagc acagggaaat     80280
     caactgggcc tcacattgac tttggagtta aagaaggttt cgtgactggg gacccaaatt     80340
     cgggcaccat cgtaaaccca aggaaatacg ttaacctccc ccctttaggc ggttacagcc     80400
     aaccattctg agcaaaaagt catgagaaaa acacttatat tcacaacgtt tttaatagca     80460
     ggtctggcta acctatcccc tgccaaagcc aaccccgctg ccgagcaatg cctaaatcag     80520
     attaggctaa gccaagagga aggttctccg tctgactcag caaagttact tgcttcaatt     80580
     gagcacaatg gaagccaata ccacttgatt cgagagggct acaaccttcc aggtgtacct     80640
     aatgcgagaa cttacctcag aaccaatgcc caaggagact gtcaggaagt gttgtcatat     80700
     cttgaaggtt cctacccttc tcagaaagta tatgaggatc ggctgggcac agcagtcttt     80760
     aataaactaa ggcaagcagc tcggtcgcaa tcagggaaat gattttggct gcccggtaaa     80820
     tcttgtctgt ggtttcgtta gtctatttct agcgtgttcc catgcaaatt accgttcaat     80880
     ctctcatgct acctaaagaa caggttggac tctgccaaac catctgttgt tctgattcag     80940
     aaagggggca tgccgagata cgtgtaaaaa catgcaagat ggtgccagaa gctatataca     81000
     tcagtgcttt tgaagattta gcttttagac ttttagatcg cctcatagga tgtcaaacag     81060
     ctccgaaaag ctttgcctag actagatttc gtcaaactta atcggtagtt gaatggcttg     81120
     ttcaaaaggt acaggtacgg tctccagatc caagacaaaa tctccaaacc gcttcaactg     81180
     ctcagtcaga taaggactca tcgttgccag tgcctcacga tcaatcggat atccctccgc     81240
     actgagctgt tgcaatgcca gagacatatc aacggcattc tggaaaatca cagcgctgat     81300
     taaattacca cacagcggct ttctttcaat ccctccaata cttctacttc ctactccgct     81360
     aggtagtggt ttgtgatggt tttcgactgg ccaatgccct tcggagagac aagaactgcc     81420
     aagtaaaggt tgacaagtga ctggtggttg cttattatgt gaccagtggt tacttattta     81480
     tctatgagtt gggcaagagc acggagtcaa agccaaaaag ctgctaggcg agaggaaatt     81540
     cttgaagcag ctcagtctct tttctctgag ctggcatatg aagaaattag cctcaacggg     81600
     attgcccgtg aagcaggaat tagcaaagcc aatatttatc gctacttctc gacccgagag     81660
     gagattttct tagtcattta cgaagcagaa caaattgtat ttgtgcgcgc attaataaac     81720
     cgacttcagc aaatggcatc ggtggataac gtatcggaaa tgactcaggt ttgggtcgaa     81780
     acactgctgc aacatgaaac attactcaat ctgattcccc aactttcaat ctccatggag     81840
     cgtaattcct ccgttgagca actgattaaa ttcaaaaaac aaggttatac cacctaccaa     81900
     gaactattag agagtttggt atcggtgttc ccccgcctca atcagcagca gtggatcatg     81960
     gtgattcaat gcacctactc aatgattgct ggcctttggc ccctctctaa tcccagtgaa     82020
     aatttgctgg aagcgctgcg gcatccagaa gtcaatcagc ccccctggga atttgaatcg     82080
     acgatgacgt atggactatc cgcgttaatt catggggcga tcgcaatcaa taacgaataa     82140
     tttacccgat agcaaagccg ttcaatatca accctcaatc accacaatca ggagtcaaac     82200
     tcatgaatca gaaaacggtc ctaatcacag gggcaagttc aggatttggt aaactggccg     82260
     ccctgaagtt tcagcaatct ggctggaatg tggtggctac aatgcgttct ccggagcgcg     82320
     aaacggacct cacacaactt gaaaatgtag ttgtaacccg actcgatgta actgaaccag     82380
     ccagtattga agtcgcggtt aaattgacaa tcaccacctt tggcaccatt gatgtgctgg     82440
     ttaataacgc aggctacggt ggccactccc tgtttgagca agcaacagac gaaaacattc     82500
     gggcaatgtt tgaaaccaac gtctttggcg tcatgaatgt gtcccgtgcc gttttgccgt     82560
     ttatgcgtca acaaaaatca ggctgcatca ttaacgtaac gtccatggca ggtatgctcg     82620
     ccgcacccac catctcaatt tacgcctcaa ccaagcatgc tgttcagggc ctcacggaag     82680
     gtatggcctt tgattacaag ccatttaaca ttcgagtaaa aagtgttcta cctggggcct     82740
     atccgacgac ccggtttaat gccaatacca gcgacatcct taaagctgga gatgccgaac     82800
     tagtggctca tgctgagaag ttgcatactc acttgcaaga cgtcgctcag aagatggcca     82860
     accagggtgg ccaagttgct gatcctcaag aagtagccga caaaattttt gaatgtgcga     82920
     cccaagacac ccccatcaac aacccggtcg gttctgatgc agaaatgcta gcagggatga     82980
     tcgctaaagc tgactctcgc caggccttta tcgaccaagt taccccatta ctaatgccgc     83040
     cagtgtaata agtcacccgc caacacagtc atcacacgat tcaacgtcat cacgctcatc     83100
     aagaggtcag atatgtttgg caatatggtt tccaatatga tggtcaagcc atcccagtca     83160
     ccgttgtttg acagtcctac agactatgga ctcaactacg aaaatgtgga gttcaaagcg     83220
     cgtgacggtg taaccctgcg gggctggttg atcaaaggag gcacagaccg cgtgattgtg     83280
     cagagccatt ttggtgtgca atgcaaccgt ggtggctggt ctcccaaagg cagagggccg     83340
     atcgcaccct ggaaagaaga catcaagttt ttacgccagg ccaaatacct tgctgagcag     83400
     ggctattccg tattgatgta tgacctgcgg gggcatggag aaagcgacct aggtacgatt     83460
     ccgtgggtga gctgggggcc tgaagaagct aaggatgtcg tggcagcagt agactttgtt     83520
     tcggctcgac ctgagtttgc caatgccagt gtggggctgc ttagtatctg catgggggct     83580
     gcttccacca cctatgccta cggcttagca gatgggttag ccagtcgtga caaggtaaag     83640
     gcgctggtta acgtgcagcc cctgctttac agctacttcg tcaaagcact gggcatgcct     83700
     ggatttatgg agcgcgctgg ggccaaggtc tcccgcgatc gccttggctt caatatggct     83760
     gagcccaact ttatcaacga tgcccctaaa atttcagtcc ccacattggt ccttcagaac     83820
     cagaacgatc cctggaccaa tctagacatg gtgcggtcct actacgatgc cctgaccgtg     83880
     gaaaaagatc tgcggatgct ggacttagaa gccagccggt ttgcgggcta cgactatctg     83940
     ggacggtctc cagaagcgtt tgtgggctgg tttgatcagc acatctaata cgaccagcaa     84000
     cctcaagcgc caaaccccgg tgaatccttg gctgaatatg tcaggtgatt gcgtcttggt     84060
     caaggtctca atcagaaaga gttaacggct aaagcaaatg tgcatctgca gagtattggc     84120
     aagattgaac gggggaagac cactaaactt aatcacaaaa ccaagaatgg tcttgcttat     84180
     gccctaggcg tgccagcaga gtactttgag gctgtatgtc gagggattgc tgtggaggcg     84240
     gcttctcgat tgaagttctg ccaacttgct gagtgctggg aacgatcccg gatccattac     84300
     ggatgcctct aagagcaaaa tactgttttg cttgtgctgc tgagctaaga agttggtgta     84360
     gtcaatgcaa tgaaccgatg ctttccctca aacatcggtt ctgttccttc tgtggtcaag     84420
     cttataaatc cactccagtc aacacataaa tcgtggtcgc tagattatga catttcacgt     84480
     acaatgtcgg gagttttccc cgtccagaga tgaaaggctc ggaagaatga actgggttca     84540
     ctatagccaa gcagcaagga tatttctgca cttgaatagg gtgtattaac aagatagtga     84600
     ttagccaatt ccgcccttaa gctgctcagt tcttgcttaa agcttgtatt ttcatcttgc     84660
     agccgtcgct gtaaagtgcg tgtgctgact gccagccttt tcgcgacatc agccatcgtg     84720
     cattgaccgc tggcaagaat ttccattaga caagcccgaa cgcgatcccg aaaatgcgca     84780
     tctacttcta gatgctgcat acgcttgtgc aattcaggct cgaaaatcga ccacatccca     84840
     gcattagcgg ttagaaatgg cttttgcgca tctgccgctg aaaagacaac accatcaagc     84900
     tcaccgttgt ccagaggtac accgaagaaa gcctcatatt cttttgaacc gggaatcgtg     84960
     aaagtacttt gcaccttaag tggaataatg aaagcgcggg tcgccaatcg agtcaaatgc     85020
     acgagtagcg ctagctccat agcaatgaga gattggggga tcggtgggtg tcccggaagc     85080
     tctcccaggg cgatctgagt gtcatggata gtttgtgtaa catcaaggcg aaaagggcca     85140
     atcaatcgtt tatataaggc taatcgctgg ataccctgat tgagattttc gctgcaaata     85200
     caggcaaaaa taggtgggct gaaagactct acggtgatag attgagcaat ccgtaacgga     85260
     aaagttggat cctttaataa aagagtttct aacccttccc aaaaacgaaa atactccgtg     85320
     gaagttaggg caggagtagg ctggcagaat aggtctaggg gtaaattcgc ttgacgtaat     85380
     atcgcctggg gagacacacc caaatctttc agcaagactt gccagcccga atccaatacg     85440
     aatttatggt ttgttgggtt cattgaaacg atatccctgc acagtagtcg agccaccagt     85500
     tagccaaatg ctcggttaat tatgaactcg aaggttccgt cacctaacca ttttctgata     85560
     aacatcagtg gcttggccat ggagcctttg acatatctgc gcttggggtt cttggaatta     85620
     acagcttcga caaaaaccct agctaaaaca atcggttctg tggcattatc catagcctta     85680
     ggatctgcca tcatcctgag gtaaggatcc atctgttttt gatatgcact gctgtcgtaa     85740
     tacttttgca attgcttacc tacgacatcg ccaaattcag ttttgatacc accaggctcc     85800
     actaagacaa cctgaatatt aaatggcttt gtctcaatcc ttagacaatc ggaccagcct     85860
     tccaaggcat gtttcgtagc gtggtaccag gctcctagcg gtgtataaat tttcccaccc     85920
     atagaagagg tgttgataat cctgcctgac ttctgttggc gcatataggg cagcacgatt     85980
     tgagtcaaat gagccaatcc aaacaggttt acgtcaaatt ggtattgtgc atcgtctaag     86040
     ggtacatctt ctactggtcc gtataagcca aatccagcat tattgatcaa gacatcaatt     86100
     cgtcctgcat cggcaataat ttggtcaaca atcttctgat tattttcgcg attggtaaca     86160
     tccatctgta ccgggataat ccctagagat ctaagcgatt ccatgcgctc aatccttctt     86220
     gccccggcat atactttgtg gccctcttgg gcaagtaact tagcggtctc cagccccata     86280
     cctgaagatg caccagtgat caagatgact ttgctcatta ttatcctcct caatgattag     86340
     actaaaattc acgtagggat tgacccactt gttgttgcag aacaggactg agattcgttc     86400
     tgacgtcgta tcgaacatcc ccttcgtaac ggggagcata tgttgcataa gcagcggcca     86460
     aagctttttg tttttgatgt aacatcacca cgttgtaagc atggctgaca acatagaatt     86520
     cattggcttt taactgaggt attgttatac tcacaaactg atcagtcggc ataccatact     86580
     gcatgttctc gggtggcccc aattcagata caacaaagcc tggacaaatt aaactaacgt     86640
     caataaagtc tggtagctct tctctcagtg aatgagtaaa ggccagcact ccatgcttag     86700
     tagcaacata ggcaccatta aaaggcgtcc catggaaaag agagttttcc gagccaatgt     86760
     tatagatagc tgctggagtg ccttgatcaa caaagcgctt accaaatact ttggaaccaa     86820
     tgacgacacc aaacagattg acgttgaaga tggcatgaat atcttctagg ggcatgtcta     86880
     gaactggcgc gtgatgcacc atcatgccag cgttattgat gagtacatcc actttgccaa     86940
     aactatccca agcaaagtcg gccagttttt cagtgtcttc caagctactg gcatctgcga     87000
     ggatagcttt ggcttcaatg ccattattat tgagcgctgt tatcgcttct tgtagtcgat     87060
     tttctcgccg accactaatc acaacctttg cgccttcttt gccaaatgcc ttggcataac     87120
     caaagccgat tccggttgtt ccaccagtaa tgacgatgac tttattacta aagttatcca     87180
     tgtactttta ccttacggtt gagattattg ttgtgagatg gaaagctgca agtgctttcg     87240
     tttagtgatg ttgctcccag tcacttttgg attgagagct aattctgatt tcttgagaac     87300
     agcatacggg ctgaaagttt tttggggagt gacataatgc gtcaattttg tagcattaca     87360
     cgccaacttt ttatactctc taaccaacag aggaaagcaa caaggaatat cgttctgttc     87420
     aatacttttg agcaatcctt gctacttggc ttagaacatc aatgacatca cgggcattga     87480
     gcagagtggt ttcaagttga aagtgattcc ttggtttcac aactctttgc cacaccccta     87540
     tctcacagag cagttgaagc gatttggaga ttttgtcttg gacttagaga ctgtacctgt     87600
     accttttgaa caagccattc aactaccgat taagtttgac gaaatctagt ctaggcaaag     87660
     cttttcggag ctgtttgaca tcctataagg tgatcaagaa gtgaaaaaac tagatctcta     87720
     aaagtctttc tatatatagt ttctgggacc atcttgaatg tttttacacg tatctcggcc     87780
     agacctcaga aatattcaaa atcggggaag taactaagaa aaaatgtagg tatcgagtta     87840
     aaaagattgt tgttgactag tcaacagcct gcaatcaata aatttgcacc ccaccataca     87900
     atctgcctat gttcccgtta gccctaccta gcaggaattt tcatatgccc caacaaacca     87960
     cccaaccctc accagaatac agagggttcc acaacattcc catcaactat ggctggctca     88020
     ctgtgggctt tctcagcatc gtctttatca tctggctcag taccctcaat cgatgcagaa     88080
     ctcaaattcc agagggaatg ccaaatgcca gagaagccac ccccaaagaa atcaaagaag     88140
     ggtccaacaa agccaaactg atccgagctg aaggcgacat cgaaaagtcc gcgatccagc     88200
     tcaacccaga aacaggtatc acccttggtc ccattaatcc cggtggaatt gtctcaggta     88260
     aaagcggtgg cggaaaaact gaaagctttg cccttcgcct catcgaatcc ctcgcggaag     88320
     atggagcctc cctgatgatc agtgacatca aaggcgaact catggagaaa accgctgcct     88380
     atcttcatga cttgggttat gaccttcact ttcttgcccc tggcatcaaa gaaacctcaa     88440
     agtactccgc agataaactc cccttctccg gtggcctcaa cctcctcgac ctgattgcca     88500
     atgatgaaga cctcgcaggc acccttgaac taacccgagg catcaacatc aatgctgccg     88560
     agaactatga acgcagacat caatacttcg gtccccagtc tgacctccta caacagtcca     88620
     tgatgctcgg agccaaaagc agtgaatatg ctgacatgct gatggtctgg gaactgatgg     88680
     gcctcaacaa catcgccgaa cgcttagccg cagccaaaga caacgacaag atggggaaag     88740
     gactccccta ctttatgact cacctaagcc gaggactgag gaccgtcgcc aacagctcca     88800
     gcagtgcaaa ccctggcccc accattcaat ccaccgccag ccagaactgg gtacaatttc     88860
     tcgaccccga gattgccaaa tgcatgacca agaccaccat ccccttggac ctcacaggca     88920
     aacaagccat cttcttccgc atcaatgaag accagctaga agccaccaag acctacctcg     88980
     ccgccgccca acatatgctg atcaagcgca acatcagcta tacccgcaga cgccagaaca     89040
     acctaggcgt gatcatcgaa gaagccagtt tcaccctcta tcccaacgcc aagaaatggt     89100
     cagccctcgg acggcagaat ggtctattga tgtggatggt ttatcaacaa gaagaacaga     89160
     tgcaggaact ttatggcgag aagcgctggg aaagcatcgc cgccaacctg ccgacccgga     89220
     tctatatgaa ccaaggatct tataagagta atcaagtcat cgccaaccgc ttaggcaaga     89280
     aaaccatcat cagcaccacg gaaaacgagt cctttggttc caaccattca cggagtcgca     89340
     acgacagctt tcagcaagtg gatttgatga cggcagaccg tttagatgcc atgaagaaac     89400
     cggggcaatg catcatcgtc gatgcctcca ccaacggtca cccgatcatc tatgagaaga     89460
     aacagcttcc ctataacgag aacagccgtc aagccaggat aaggaagcag tgtaaagtcg     89520
     catggcgaga ggacatccta cccagcctcc aagaagaaca tcagaagcac tttggagaga     89580
     tcaatatcca agtagcaatg gagaacagag ccgcagccgc agaggatcta ctcccacccc     89640
     cagagtatta cgccattgaa gaagaagccg cagaaattga tgcagaagaa ggcactgaag     89700
     acgcaactga tgtaaacgaa atggaggaga tggacgatgc agcctagtca agaccagacc     89760
     ttagaacggg atgctgagaa aggaatgcac ctggccgaag aaggcgtaga gaaagccgcc     89820
     agattgacgg ctgagactct acgaatactc aaggcacaac tcgctaaata caacaatcgc     89880
     gtgtccatca aatttgagtc acgagccgac gatatcgcca acgtcaaagc tgggatgcag     89940
     ggaggactca agggagtaca gctcaggcag attgtcaggg cgggtgactc gatcaaggaa     90000
     gtagctcagc gaacccagtc agcggagaaa gtgaagctgt atgaggaccg ggtattgtcc     90060
     agggcacaac atgaactgaa tcgagagaag gtagaacatc gtcgatctca gcaaacggat     90120
     cagtcccaga agcagagtca aaggcagtct cagtcacagg atttggggtt gtaaaatacc     90180
     tcttaatttc caaatttaca tgcttgtgga ttataaatag gatggcatcc gatggcatgt     90240
     aattcggcat tatgactttg ctcaatattg agcttgtcac cgaaagactt ttctgtgatg     90300
     tttattgaat tatttataga catgaagccc atagatagac tcaacgcact ggcaagccca     90360
     actaagcagt atttcatgag gtgttaatcc tttgttattt aagtaacggc aaattcaaag     90420
     aaggaaatat cttgattcac agcaattatg ggtaaggatc acaagggaaa aaagtacaga     90480
     taaatgcaac ctgattaatg tcttgcggat aatcaaattt aaatgttctt tcgtcagatt     90540
     ctctagctat ttcactggtg aaatttattg ctgttaaacc tagagaaagt ccaatagtgc     90600
     ttgcaaggcc aattaagcaa tatttcatga gattaaaact ctaaaacgat ttagaaaaac     90660
     ggtatcactg catctagaaa aatcatcaat attttacgtt tattgatact agcaacttat     90720
     atgaatttcg attgcctatt tttctctctg ccccagaaaa ttctttgatt taggtctacg     90780
     atctctcacc atcagcacga tagataacag tcttcaaacc caatcctcac ataacgattt     90840
     gtccctcaca ggtcatcttg cctatgtttc ataggtaaac ctcgcgaggg tttgaaatgt     90900
     ctaccttcaa agacctatac aacacagcga aggaggccga ggatgtcgcc tttgccgtgt     90960
     ccccgatccc ccttggattc atcaagagtg ggattcaaaa tgtgggggtg ccattagtcg     91020
     tagcggctgc ggccacccat accccctttg ttgctcccct agcaggcaca gcaatcaagt     91080
     gggggagtga tgccttccag tctggcaccc attctctggc ccaacaagcc atgagcaact     91140
     ttggggaatc cgtgatgtct ggcctgccag cctttggcgg gattcaaacc agctttaatt     91200
     ggatttcatc agaatcttct caggtgatat tggcaggcca ggatatggtc acccatgccg     91260
     tgggatctgt gggtacttct ctgatgttgg gccgcacagt ggcgaattct gccgtcgttg     91320
     cctttcagaa gattcgaccc atgaccatca atgaaatact cgccaatggt caacaggcat     91380
     tagagcgctc tcaagaattt ctcaccagtg tcgccagtca tatccgtcaa atcggcatcc     91440
     atgctgaatt atttgtagaa caggagtttg caaaattgtc taacagcgaa gaacagacta     91500
     cccaggttca gcccactgaa tctccagagc aagcaaccgt cttggctatg gataaaactc     91560
     aagtcgaagc agaaccccaa ctcaaagctg cggctcaagt cgagtcaaac ggcacccagc     91620
     ctgagatcaa cgttcagccc tcagagaatg gcaatggtca atcagagcga gggacacagg     91680
     ccaatatctt tgaggcggca gtggagacgg ctgctaatat ggtcaatccg attcgttctg     91740
     aatcttctca agaagcagaa gattatgtat tgggtttagt ggacaagtta gccgctggca     91800
     atatgaacgt ggatcggctg tatatcaaga tggatggcat tgatatcttc aaaatgaaga     91860
     acggtgcccc agatccatcc acctcgatca cggactctca acgagatgcc ttgcagcaag     91920
     ccttggaaga ccccgcagcc tttgggggga atctggtgat taagcagggg aataaagtct     91980
     tactgaatat caaaaagggt cggatactgc ataacccgat gggtttagcc aagcaatctt     92040
     tgagcgctga aatggaaacg aaggaacacc ttcaacagca gcagccagag gccaaacaag     92100
     ccacagttcc gaataatcca gccgagggtc tgtggtccaa gtatggagcc aatgtttcac     92160
     ctggcttgaa aggagtcaaa ctagccgctg ataacgcctt aaaagatgga attaagccca     92220
     aagaagtgcg ggcgatgttg ggtcaatccg ctcacttcaa aggtctcacg gcagacaaag     92280
     gagcctcggt tgcagaaaaa gtgattgccc gcacggtgaa gacagctcag gctagggttg     92340
     cccagcaaca gcgacccaag cagaaagtac agcagaagga ggagcaaaaa caggcagcag     92400
     tgatggcacc gggcctctaa ttaagtgccg ttggcaagcc tttgaatctc ttgatcgaac     92460
     agcgattgag aggtttcttt ttgcaataaa aagtattact tgaaggagtt gtaggtgctt     92520
     tgccgtaaag atgtttgtac ttcgaccaca aagctaaaac cagatcttaa aatcaagatt     92580
     gctgcacatc ttaaaaaaac ataaaaataa gatgtatagc aatcaatgta taagcaccaa     92640
     tagtattaag cgattttact gcgatgtcac ctcctcttct ccgtcaactc tggcaaatga     92700
     ttgaagaaat accccagcac tccctggaga agcttgatga ctcaggtttg gtgggatggg     92760
     tgttgtctca cctagaacaa cacaaaagtc tgcaaacaga cgaacgaaaa gctgctgagg     92820
     actatctata tgaccacata ctgctgattc gcgatattgc tgaatcgcac caactccatc     92880
     actgccctct cgcaggctga tgtactagaa atggatgggg tgaaggagca aggtacataa     92940
     cactccatct acgcaaaacc gccagcgaat aaaaccgtag agactcataa acagccctga     93000
     aaggataaca aacaagatag caaagaacca agtcagtcta gatatttgat ggatcagatc     93060
     agttgttttg gtcaccattc acacgatata gattattgcc tggagaatgc tagcaacaga     93120
     aaagagcaaa actagccatc tctttcaacg gcacagccta ctcaagcgat tcgttaaagg     93180
     agaattaggt aacgagtcgt aaattaagta ctagcattta tcttgaattc ttctgcttat     93240
     tcctagccta aaaaaggcat aagaaagtgc tggaaaacta aagcgtcaat tattgaaagt     93300
     aggccactac aagtttaaat tgacattagt aaaacagcta ggtgcataaa aatctaatta     93360
     tgaaaatagt gtacagctag ttcttaacaa actataacta agttaacttt gttttcataa     93420
     tatgttgaat gcaaagcgag aagtgcagca agctcatgat ttatttcaat gcagctaaca     93480
     ctttttcatt ggtaattccc ttttcagtgg ctaggaattg gaaaaacttc ttgagtgcta     93540
     ctcgtaaatc actttcggtt gaagaatccc agaccttacg tttgtaccac ttcctgaaat     93600
     ggctattgac catgccttta gtgatttcgt ctatggcttc gacatcggta tagccacaaa     93660
     tgaagtgaat gaacagctcg acaatgttgg tgtgttttct aacggttttc ttagagtact     93720
     tttgagagag gaagccagca aagtctcgat tgagctgttc aagggacttt ctaaaaggtg     93780
     ctctggcttc ttctgcggct tgcatggctt ccagatattc attcatttga ttcgctggga     93840
     tgaccacttt gccagtgtag acttttgcca ttttcctgtc ctcctgcgag tgatcgtggc     93900
     tcatttatgt gttgataaca gcaacttaag agtattgata gttcattccc caatttagac     93960
     tctagtagta caatagaact actgcttaca attgcctgtc cagaaaagag gcaggcattt     94020
     ttcctgggca tacacctacg agattgctca cctcaaattt taatacgact gcccaatatc     94080
     aaaattgatt tgctcactct gtaatggcgt gggcttttct ttgacaatct gcaacttgac     94140
     ccgattctgc accatctcag gcatccgctg attgaagtta atcggcttat ctgagtccat     94200
     tagctcctca tagatgggtg agactttgtg aatcgccaat aaatacagcc gtttctgttc     94260
     tggggtggcc gcccgcatat gatctgactc tgagatgaac cgataagcat cattgagttc     94320
     cgtatgttcc ttacagtagg cgtaaacctc caggtcaacc cgctccttgg gcatctcacc     94380
     taagcgtttc tggacccgct tggcaataga gttgtactgg cctttgtaat gacgcttgac     94440
     ttcagcatct ggggaaattg cattagcaat ggcggcattg taatagcgtg gtcccacctt     94500
     agcgatcaca tcatccaacc ccttgcctaa cttcggattc cacggtgcca gtttgcagac     94560
     gaccccctca gcttgtagca gttcaatggt gcggaccaaa tcacgacgca cattgaagat     94620
     ggccgatagc ttagtgtcct ggtcaaacgc aaaggtgatt tttcgtcccg gcttagctaa     94680
     tgctttgcca tattccgata actctcgctg gggtaggcga tggtcgaaat catctttggc     94740
     tcgatacaaa gcggtgaccc ccggtaatcc taccgttaga tgtccctgac tgagggatgc     94800
     ccaggttttt ttgagtcctt ccgtcaacac aatgggtagg ttgtactgat cggccacata     94860
     ccaaaccccc ttggcccgct cctctggagt cggactgatg gcattacgct gatagatcag     94920
     ctctgtaatt tcatccggga tatggggcaa gaatacctgc tggtcaacgc ctttgggtgt     94980
     ctcgtatttc acttcctcac catcaaagat tcggggcgtc ttcggcttta cctggcaata     95040
     ggaagacggt tgtgggttcc cctcgatgac ggagagtaaa tcagtccccc catagccaat     95100
     ccatccccct ccctcagcaa tacgggtata ggcgcgttca ggatcatcga cccatttgcc     95160
     attaaccttg tgagtgccat tgagctttcg cttcatctcg tgggtgactt cttggcctgc     95220
     cccatatttc ggtttggtaa actcagctcc gagtaacgcc tctagcaaaa cgttgtctcg     95280
     gattgatggt tcagaactcc ctgcctcact tctcagatgc tctggggtta acaagctggg     95340
     atgaatgcca ctgctcttca tctcggccca ggtgtccatg tcaagctgcc aaggtttctc     95400
     cactcccgta tagtcagggg tccaaccttc atgggggtcg aatagggtct caatcgcatt     95460
     ctcttgggcg ttggaggtgg cgacccactc tttcaagtct tctagagatt ctgtaaatac     95520
     agagatatgt ttggtccgat ggcgcgaaat accgacatag aaagactccc tagcagaagt     95580
     gggattgaga ctggcaatgt agatcgtctc ggaattggtc ccgccttgtg cccggtaggt     95640
     cgtcgtggcc caatcatggt caatttgctg gggcttactg agatcgagct gatgcacttg     95700
     gcctttgttg ccttgaaccg tagcaatccc ctcttgaata cggatgcact ctaaataggc     95760
     atgggtatag atcccttcct ttttattcgt tgaagtgaat ctgagcttat ctcctacggc     95820
     aatatgattt tgctttgcag tgaagacttc agttctttca tgttgagcgg gattaatctt     95880
     gaattgcctg ccccctggtg acgtaactcg tagatgttga ccttcaactg ccaagacttt     95940
     gtaagggaca tgggtttgca gttgggtata ggtgcggtgc ttacgatgga ggacgagtaa     96000
     atcgcctttg cggtagttct ccgctcgttt cttctggacc ttcgtgagat tgcgattctt     96060
     gagctgtgtg aattcagtgt tgttggtcag cttcccttct tcgatcagtc gaactctgag     96120
     ttgatccgtg aaggcttctc tctcggcatt ggtcccgatc accactaagg ttttatctcg     96180
     tcggctttgg ggtaatgaaa tgtactgctt gactgccgct gagattttag tgtcagcatc     96240
     ttcgacctca tggatatgcc cctgtttttc gaggacattg agcgcttcaa tgccatgtcc     96300
     ttcagcgatg agctttactg ccgttttctg ttccttgttt tgttgtctga tgatttcact     96360
     gagcttatgg acagtggccc cgctatgcat gagcattcgg acgggtgcgc ctgcggcgat     96420
     ggctccattc tgtccagtat ctccaacagc ccagacccga gcgcccactt tggttgcttt     96480
     attcatgacc atctcaaagt catcagagcc aaccatgcct gattcatcga gtatccagag     96540
     ttggttggat tccgtcgtgg gttcactgac ggccagttga gcgatagttg cgccttccag     96600
     gtcaaaggat tcagcaatct cgttcttggc attgtgggtg gccgcaaaga ctttgatgac     96660
     ggtttcaggg gggagctgct gtcgtgcaat tcctaatgct gtggtcttgc ccgtacctgc     96720
     gagtccttta aggatttggt actgatctgg tgagctgagc aatcgcttca tcgcttcaga     96780
     ctgaccacta ttgaggatgg tatggctgaa gtcagcgata ggattgaggg gagtaacgct     96840
     attattgccc ttgagccagt ggttgatgat gcggatatct cgatccactg cggtctgggt     96900
     ggtgtatcga ccatcccagg cagtaagtag atctgggtgg tgatcaatct cctggtttag     96960
     gggcttttca tcaaagctgc ggaggtgaga aaagacgaag cgctgaatgt cttcaaggct     97020
     aaagctggac tggcgttctg ctagatggcc gatagcagcg tcaagtaatt ctctgggtgt     97080
     ttcagtgctt tttggggtga tcgggtggtt ggcgggagtg agacccgtga agccaactgc     97140
     ttccatctca tggccccatc gctcctgctt ctgttctaga ctttccgtga tgttcttagc     97200
     gattcgggtt tcaaagacgg ctttctgtct gttcgctgga gtattgctcc agcccttctc     97260
     tttgagatag tcttcgattt ccgtagagcg cttactaaat acttcaatct gctcatccgt     97320
     tacacctgct aaatcaaacc ccgtggccgt ctcccggatt tcatagccca atgcttggac     97380
     tttaagggct agtttctggt ggtagaggtc accgaggacg ccactattgc ggaggggttc     97440
     gtaccataag gcccgatact ctccgtctgg acagagagtg ccattaaaca gcacaacatg     97500
     ggtatggaca tgggggtcac ctgccctgga ttcatggtga ttaaccagag tggcagcgat     97560
     gttacccgtt ttgatggctt ggcgctttcc attggcctgg actcgtgccc cggcatatcg     97620
     gttctcaaca atcaccatca cttctttgac ggcttccaca tgagcctccc aaaggcgctt     97680
     gtctccgttg ggtccatgga ttgccatact caaagacttt ccaggaacgg tgaatgtgag     97740
     gtcataggct aagcgttctt tgcctttacc attgacttcg cccctcatgc gttggccgtt     97800
     ggggagatca ccgtagaaca tctttgtgaa gcgttcagcg gaataaggtt cattgggtgc     97860
     catgctgccg aaccattctg attccgtcat ttcttgaact tcttcatcct ggctgtagta     97920
     gctttcctct ttggtgtagt agcgggcacc gtctttgatg ttggagttga tggtggtgat     97980
     gtctagcatt accctattcc cagaaatgga ggttccgagt agaggatagg cagattgtta     98040
     tgtgagggcc aaatgcttgg aagacataca atcaacgact agccagattg agtagttcgt     98100
     ctttttgacg agagctatca gcccatccaa gaagatattg gcttagggtt atgctggtcg     98160
     ataatggaaa tttctttggc tgaaaatcga tggtttgttg tctcaaccca gattgtgaga     98220
     agcccctgaa tcaagactcg tccaagtttt gtcagtcttg tggcacggag ctaataccat     98280
     tacttcgcca tcgattcaaa atcatcaagc cgctgggtcg tggaggattt gggaaaacct     98340
     acttagcaga agatgcagat aagttaaacg aaaaatgtgt ggtcaaacag cttgtatatc     98400
     aagcgcaagg ctcccatgcc aataagttag tggttgagct gtttatgcgg gaagcagaac     98460
     agttacagca gttgtgggaa aaccctcaaa tcccctcctt atttgcttat tttgaggaag     98520
     gaggttattt ataccttgtc cagcagtatg taaaaggtca agaccttctc aaggaattaa     98580
     aagagcaagg atgtttcgac gatcaaaaga tccttgcctt attgaaggat ctactacctg     98640
     tgttttcggc gattcacagt cgcaaagtga ttcaccgaga tatcaagcct gagaacatca     98700
     tgcgccgaga gaatgatggc aggctgattc tgattgattt tggggtatcc aaacaactct     98760
     ccaagtctat tgtgtcgatg gccgggacaa tggtgggttc tttgggctat gctgccccag     98820
     aacagatgga atctggcatt gcccaaccta atagtgactt atacagcttg ggggcaagct     98880
     gctttcattt gatgacgggg attaaccctt ggagtttatg gcggaagcag ggttatggtt     98940
     ggttagcgga atggcgaaaa catttgcaac agcccatctg ctctgaatta ggaaccgttc     99000
     tagataagct tcttcaatta gaagtcgaag accgctacca aagtgctgac gaagttctag     99060
     cagatttaga cggggctaag gcccaagcag aggctgagca actgcagcgg tatgaggcag     99120
     agtttagtaa tgctgtgcaa tctgcctatc ctttggaggc ccatgtgcga gacggtctca     99180
     aacaatttca gcaatccttg gggttagctg atgctgaagt ggatcagata gaacagccca     99240
     ttctcaagca agccgaagca aaacgacaag aaagaatcaa acagcaagca gaagttcaac     99300
     gtcaagccca acaaaaacaa cacgagaaaa aacttaagca agaagcagac cagcgagaag     99360
     aaaaagctgc catactctcg acaaaaaact tagtctcaca aacgcctcgt tctacccgta     99420
     aaactttgat tagtgtgggc ttatttggat tgattgtggt gccattgagc ttatatggat     99480
     tgtccaccat ctctcgtgat ccagatccga tcccaactgt ctcatctgac ttatcaacta     99540
     cctcaatcaa cttaaaaggc tctatagcta tcgatggttc tagcagtgtt tttcccattt     99600
     ccgaagtaat agctgaagaa tttcagtctg ttaataagga tgtcaagatt acagtgggta     99660
     tttctggaac tggtgggggt ttcaagaaat tctgctctgg tgaaactgaa attagtgatg     99720
     catctcgccc aattaagcaa agagaaattg ctctatgcgc taagaacaac attgagtaca     99780
     ttgaactccc ggttgcctat gatgtgttgt ctgtcgttgt tcataaagac aatgattggg     99840
     ctgactgtat gactacaaat gagttgaaaa ctgcctggtc aaagagtgct caaggcaata     99900
     tcagtaagtg gaatcaggtc aatcctaatt atccagatgt tcctctaacc ctgtacggtc     99960
     caggtactga ctcaggtacg tttgattatt tcaacgaagc gatcacaggt gaggaaggca    100020
     gccgaggcga tttcgccacc agtgaagaca acaacaccat tgttcggggt gtttctggtg    100080
     ataagaatgc gatgggctat ttgggctatg tctactatga ggaaaataaa gattctctca    100140
     aagcggtaca aatcgacgac ggtgacggat gtatcgctcc tagcgatgaa actatttcga    100200
     aagggaccta ttccccacta gcacgaccga tgtttattta tgtcagcaag gttgctatag    100260
     atcgccctga agtgaagtct tttatcgagt tctatctgaa tcctaaaaac aggcaactcg    100320
     tagctaatgt aggttacatc ccattatctg atgagattta tgccaaagca ctagcccgct    100380
     ttcaggaagg aaaaacgggg actgtttttc caaatgggaa aacaaataac gttgagctaa    100440
     ctgacgttct ctagctacta aacgcaaaac ttaaggcttt gaattattac ttggctctgg    100500
     ctccacctcc attctggctg actgttgagc tagactgctg gattacgaag gaagcgatcc    100560
     cctttggata ttcagcaaga tttttctaga gtgtttggga tagattccac caaagtcaac    100620
     agaaaaatct tgtagtacaa aagtttcaga tgcactacaa ctctgtagtg taaaagtttc    100680
     aaacgtgtga cagttttgta gtcaaaatac tgcaaacgtg ctacaaaaaa ctgaagtaaa    100740
     aaatcccact gcaaaattat gcagccccaa gtagtggcga ataggtgtat ccaggtggga    100800
     ctccccctca gacgtccttc agcaacctct tgaacccgtg cgcagcgtgg gatttggccg    100860
     ttggcgagca gctcgactgt aatcaactgt attcgactgt aactgactgt agaaaaccgt    100920
     aaaaaaaccg ggtttttggt ttgcacctca gaggtcattc tgcctacgtt tcttgggtag    100980
     gtctcagagg acaaaaaaat ggtttacacc ttgaccgttg ccgctgacat gggctcaagt    101040
     ttgggcaagg gttgctacac gattgataaa gggccaccga acgatgccga gggattcgtg    101100
     ggcggattcc agcgggacac tcctcgcaaa ggctggatta ctcaagccaa tgccgttgac    101160
     gaggaaaagc accgggactt aaccccagat agttgcacca ttgaagtcag aggtaaagcg    101220
     tggaccgtgg gtgaatcagc ccgatacgcc ctccatgaaa ctcgtgtcag agcagccaaa    101280
     tctaacaccg catccatccg ggtcttagga atgctcggca agattattga acaagaagac    101340
     ttcactgagg gcagtttgga tctgcgggtg ttgctgcccg tgggcgaaag gaaaacattt    101400
     aagcaactcg aagccaacct gacgaaagcc ctctatgaag tcagactcaa tggcgttaaa    101460
     cccagcttgc ggattaatcg agtgcgggtt tatccagaag gggcgggggt tgctcaacgg    101520
     gtcaccgtcc ctgatgccct ggtgctgatg tttggtcata aagacatctc catcgtgccc    101580
     gtgaggaatc aagtgattca agctcatgcc tgtcagacca ttacgggtat gggcatgatt    101640
     gccctgatta atgagtttcc ctgctacatc aatgatgaat tgcttttagc tgagttctta    101700
     cacttagaag ccgtgggcaa ggggggactc aagcggctcg tgggtgaaga cagcctagag    101760
     aaagctcgca tgaactttga gcaggccaag aaacggactt ggcgacgcat cctgcaacaa    101820
     ctcatgctag aacccaaggt caacaccgtg tccaaaatct atgtgacggg tggctcgatg    101880
     cgagtctggt tgccagagct aaaagcaatc tttgggggtc gtctagcctt ttttgctgac    101940
     tctttgaagt cgatgattgc cgcctatccc gatatgcaag aacccaagaa caaggaaatc    102000
     aaaccccggt tcaccgattc attcttgctg atggagggtg caacccatgg gtagacggac    102060
     aatgaagatt cagctccagt acccagacca atccctcaat ggtcggaggt tagaagcctt    102120
     gcgaggctac tttggcgaca acttggagcg ggtgatgatt caagcgatgt ggtccgttgt    102180
     ggggccactt ggatcaacct tggctgactt gccagagaaa gaggttcaag gtcatatcaa    102240
     tagcggcaaa ctcaccatta aaggctttca ccaagaagcc ttggacatga tcgggggtgg    102300
     gggagttact cctgaagtga ccccagaggt aactgaaaaa gtgcccccag cagttacctc    102360
     tgaagtgacc caggaacaac caccgtctgc tgcccaggaa tccgtttatt cagcatctcc    102420
     cccagaacaa agcggcgatc cactgaacaa tttattctga tttgctgctg acgatgcaat    102480
     ctgcctatgt tcccattaac gctatttaaa gaaggacaac gacatgcata acattggtga    102540
     catcctcgaa atcctgaaga cctccaagga acatctagag ccgatgttgg aggcttgcgg    102600
     ctggacagac cagaccgaat tcacagatga gcaggccgaa accctattgg caatgaaagt    102660
     tagccatgag gagaaaggcc gagactatat tgagggctat acgcggaata tcgctcataa    102720
     cgttggcata acaggcaccc aatttgacga gattcaccag tgcattattg atgccggggg    102780
     gagtttgatt gactaccggg agcggtttga ggagatttgc caactggtga atgattgtgt    102840
     ctctcccgct gaggccatca ttccccctca gcccgtggtc gaggatacgc acccagtcgt    102900
     tgaggccgag gctgatcctg aatcagtcca gatggataga ttcattgatg agcaggcgaa    102960
     cgctgccatt gcgaccacga tctctcaaat caaagggttt gcagatctgg cctatgagga    103020
     acaggaacgg ctgaagactc tatttatgac caagtatcgg cagggcttag ctaaggaact    103080
     cctctccgag gaattcaaag ctgaatttat ggcgcggatg accgctagct tggagggcaa    103140
     aggagctgaa aaaaagcagg gagaactcac tggagtacag aaccctacgc cattgttgtc    103200
     cagcagcaac taacggcccg gatggatggc ctgcttgcgg aaaacgagaa ggctatcaaa    103260
     cagcgcattg ttgatttaaa gctcaaagac aaggaaatca gtcagcttga aaagctccag    103320
     cgcattaagc ggacagagag ggaaattaaa cgagaaggga catggttcaa aatcgcgttt    103380
     attggcatcg gcattctcat tggtcttccc gttggggtct tcctcaatca cttagctggg    103440
     cagaatgcgg ctgtgtcttc gcccattgag caggtttcgg ggaagtgatt tcgggggtga    103500
     tgttggggat tgtggttgtt gcgatggtcg aagaccgccc ttcgggcatc gcaaactcca    103560
     ataccaatcc ctgacatcac acctactaat tcactcagtc tttcaacttt tcaaaatctc    103620
     tatggatttt gtgttaccta tctgattccc cacctatcta ctcaatacca atgctctaac    103680
     ttttcatttt ctttgtggat tttgtattac ctatctgatt ccccacctat ctactcaata    103740
     ccaatgctct aacttttcat tttctttgtg gattttgtat tacctaacta tagggactca    103800
     gctatgaaag taactctaga ccaaccagaa caagaacttg aaaccatcgc ccgaatgctg    103860
     acggaaaact acattatgga ggttatctaa tgaaaggccg tctgattgtt cttctgatcc    103920
     tgattacccc cttactgatc ctcgcaggct ccattggttg ggtcttaggg attagtgcct    103980
     ggattttgat actgaagtga ggtactccca ttccctcagc gaccaagcca cttgatcagg    104040
     gttgaaggca ccctagcatt tcattttcca ggcagattct gtattgccta gatgtgatga    104100
     catacggttg gtcgcagacc atcgcaactc caatacccat ctccaatacc aacctccaga    104160
     cttcacacct aaccaaataa aacgacccct tagctcttcc agtccaagag gtcgttacca    104220
     atcctttccc taaattataa cgaggtcacc agcatgacga ctaaccccta ttttggccac    104280
     ttcgagcaag cctggataga ccaccagacc gactacggcc agcacccaga tccatgcaag    104340
     gaattcccac cagaccagat cctagaccgg gttgcgtcct ggttgagtga gttcaatccg    104400
     ctgataccac ctgagtctca gctatctaag gctatccggg tgggcattgt ccaccgattt    104460
     tatgggtggc agctatgaca aatactcaaa accatgatga atctccgggt tgggagtggg    104520
     agagtttagc gattgcatgt tttattgtca tcgccatctc aaccctggta ggactcatcg    104580
     ctttacctaa aaaagaaaga gaaaaccttt cttggtcctt ttgggcactt acgattccat    104640
     ttacgatatc tttttctgtg gttgggtgct ggttgttgaa acctcgcgaa ggttgtcccc    104700
     tggaagataa aaagcccaac agtgtaactg gcaattctga agccagacga ggggccagag    104760
     ctgacgatcc gcaggtgcat actcatgcca ttctggatac ctcgtttgat gaaaagcttg    104820
     ctatcgtcac caaagatgta gctgaaatcg ctcaacgagt gggagcgctg gacatggctc    104880
     tagtaaagcg ggtcaggcca ttacagacta aagctacaac agtaagggaa aaagaacagc    104940
     aagctagaac tgccctaatt gcaaggctga gtgatttggg tacggagact agccccatag    105000
     atgctttgca gggggctatc cagatttgct ccgatgctcg gctgtgggag catccagcaa    105060
     ggattgcaac agttcacatt gacacacagc ggttttacaa cgaggggaag atctggccca    105120
     ctattcgaga caatcatatc gtttggagtc ttgaccctga tcatgatcca ccagacgaaa    105180
     cagatgaaat tgagcaaacg cttttccgtc cctttcgttg ctgctcccgg tgcaaatata    105240
     ttggcaagta ttacgattgc tgcgcggttg tgcccttcga ttgtggcacg ggtaacccat    105300
     ctgagcaatg ccgggaattt gagtgtgagg acggtggtac tccaattcct gagctaacga    105360
     ttgatgacgt gccgttttga gtattggggt tcgtactgtg gcaatgaaat cgcaaactcc    105420
     aataccaact cccgacattg cacctattaa tgcatccaat ctctaacttt ctgtttttcg    105480
     acgaataaag taaatcttgc aaacttacag gtcaaatcaa tgccattact aaacatacat    105540
     tatcgaacaa cgctcgaccc tctcactgac cccgaccatg cagaaaaagc ccttaacgaa    105600
     attaagaagt tctgggtcct aaacgtacaa tctgatttag acagtatcga gactgcattt    105660
     aaagaagaat ttcccactta caaaattttt ctgcctgatg tagaccattt gaagcttgct    105720
     cacccgatcc ccgagaaaaa aacgttagag taccaaaact ctttcgagta catctctaag    105780
     aattatctgg agacttacac cgatacatac gacaaaagcg agtatcctga tttaatccct    105840
     tgggatgagc agtttgcttg ggacggtagt tataacagga agccagtaac ccatcccctt    105900
     cataaatacc cccagtggga taagctagcc cttttagtcg atgacgagga aggcaaggct    105960
     aacgatatat ttttgagagg tctttttgag caggtgctcc cctgtttaga tgatgagggt    106020
     aatccgcaat ttaagggtga tgactaccat attctagggt aaggcccaag agtgagaggg    106080
     ttgtctctca ccaggatttt gaacccttgg caaatgtggt ctttgtaata tcaaagctat    106140
     atctctggtg atgtgccgtt ttgagtgtga gttattggta ttggggtttg cgatcgcact    106200
     ccaaaaccaa ttcccgatat cgtacctatt aattcactca agtttttaga ttccctgtgg    106260
     attttgtatt acctatatct ggagactgaa ccaggtcagc aaaaactata aacctggatc    106320
     gactcttcgg ctctctcaat ctcgccaaca ccatccttaa cggtgatttc tctgggtttg    106380
     agctaggcat cttttgcaca tgcaattgca ggcaggtatt actgttagca ggtttccaaa    106440
     tagatgaggt agaaaatgtt cgtggaatac ttaagccttt gagttgtcaa tcctccagca    106500
     tgaatagctc aaacaaggta cacaacaagg tagtctcttt ggcagggtgt tgtgctggcc    106560
     aaggttgaag attgatggaa gtcgtccacc atttgcaagg caacttggaa atcatcgtat    106620
     cttttttaga agtggtactg gaaacagtag cggctttttg cattgtgttg ggcctgctcg    106680
     tgagcatcaa gctctcagtt gctctgcgcc gccgtcgcaa tagtattcaa ttccccctgg    106740
     ggcgattgag gttaaccttt ggccgatggt tggcgttagc ccttgagttt caattggggg    106800
     cagatgtctt agccacaacc gtagccccaa cgtttgaggc gttagggaaa ctgggtgcta    106860
     tcgccatcat tcgtaccttt ctcaactact ttctgaacaa agagctgatc gaggtctttg    106920
     agatgcaaaa acacttagat gaagacgaga ctaattgatc caactccgat taataagacc    106980
     tggatgctag atggataatt caaaattcgt aaggatagtt cagaatcgtt gttttaggag    107040
     ggccacgata ccccaaacag cgataatccc atgcttgaaa tgctgcttag gaagctctgc    107100
     aatccttctg atgaaatacc gttgaatgat tttgaagctc taaaatctca gattctgcag    107160
     gggatttatg ttgcctaata catcgtcaag actgaatttt agggtgagaa tctctggtaa    107220
     gtcttattat gaaagccttc tgaagattgt ctaccctaat tttttagctt gacgctgcac    107280
     tgagtaaaat tttcgaggtt cgggattagg gctggtattc ggaaatgaga tcgcaactca    107340
     cgattaagcc ttatctttca ttttctcgat agaattcata ttgcctagct actctgacta    107400
     ggtcactgaa cctcttgaag ataagtttta agttatttca agcccaatgc gaaatatccc    107460
     ggaatatgat ccattcgttt gatattgggt aagcttgaat gttagttgat cgcccccacc    107520
     tctaaaaatg ccatcttgtt catttcgagt ggtgcgtcat catctggtgt tattgggtga    107580
     ctgggtcaag acttgattgg taagagtgtc ttcaaaataa agctgtgatg cttattcaga    107640
     atcagtatcg aatcatcaag caacttggtg agcaaaacgg tggaatcact tatttagcgg    107700
     aggatttgca tcacccctct aaacagctct gtgtggtcaa acaaacgaaa ccgtttgtct    107760
     tgaatcctac ggttaatcag aggactccta aacaaatcaa attagttcaa gagagattga    107820
     accaagaagc ggtaagcctt gtggaggtta gtagcgaaaa tgaccaaatc tctaagttat    107880
     atacctgctt cgaaaaagaa ggacaattct attgggttcg tgaatggatt gaaggccaat    107940
     cattagctaa atgggaatat cctgtagaac caggcataat catagaaatt ttatgtcaga    108000
     ccttgcttgc attggactcc ctccacagtc aacgcatcct gcatttgaat ctgaagccaa    108060
     gcaatatcat ctggcgaaaa ggagacagta aggttgtact gactgatttt ggagttttta    108120
     aagaaatcac cagcctcttg aaccttcatg atgaacctgg cccccgtatt gtcccgttta    108180
     gctacaggtc tcccgagcaa tccaagggca gtagaacggg gccttttagc gactactata    108240
     gtcttggttt aaccatgatc atcctaatga tagggaattc ttttaaccag ttcgaacagg    108300
     aatttcactt ttatggggaa gtgagttggc gtcaatatgt accagagatc aaccctgtgc    108360
     tagctgatat cctcgaacga gcgattcact atgatccagg gcagcggttc gtcacagccc    108420
     gtgaaatgct ggtggctctg caggaggttc ccgttgaacc ttccaccatg taagaatctt    108480
     cgttgctaga atgccccata atgccgggtt gtctgttccc ggttctggcc ttggtcgtgg    108540
     tcttctggga aaatgacctc agtgataggt aatcctagcc gtaaaacttg gtggcgaagt    108600
     tggaggatgt agtctgcggt cctcccggtg agggtgatca tggtggggtg gggtagttag    108660
     ctgcatagta tcaattgagt atttaggagt ttgactagta ctaagcagaa cttggttggt    108720
     actttttgaa atcttctaac agaacagttg taagccaaga gaagattctg acctgtcatt    108780
     caagtcagcc aaattgagcg gaaaatcccc cctgatttga accatacata tccccacagt    108840
     ttcctcaaag ttaatggata acttgataga gagtcagttc atgactctat cgtatgaatg    108900
     atcaaattcc tgttaaacag atccactccc ctagagtcgc tgatgagctt taggggagtg    108960
     ttcactgaga tattctgagg tttacatacc atctcaattg gtgatggaag actcctaagt    109020
     taacacatag gtgcctgaga taattcttgt gtgttttgct ttatctttgt cctaagagct    109080
     ggcttcatat catacctata gactctattt gcccaaggtt aaaaagtatt ctcgtggtga    109140
     tgtagaggat tgataaaatt attttaaatg gataaattaa ggctctaata ggaggattag    109200
     cctcaaacac ttgtcagatt gagaatctac agattgctat atgtaaaaga atattgagtg    109260
     attactctta taatttttta cttttactaa tcactaaaat ataacaacta taattctggt    109320
     aatattcata gaaagtttat agactccatt tttactcact ctaaaagaaa aagactaaag    109380
     tacaaccgtg attaaagctc agtaaatgaa tcatggtcta cattgataga cctgattagc    109440
     ctgtgctcat ttctatcctt aaaatcgcta aatcatttga ttgaagattc tactagcatc    109500
     tagcttaaac atctatagct agattatgta ggagtctaag aaaatgattt cttcaagcgt    109560
     ttaggtctgt gtgagcaata gattaatgat agtatttgct gtctatcagt gttattgaag    109620
     attcctctct ataacagtga gataatagtt atcattagac ttctcttaag caaccgccta    109680
     gagatgctgt aattgtattc agcattctct tagacaatag aatattttcg taattatcct    109740
     tgttgagaag gatatttcac cataggctat tcgctttcag taaaaacctt tttttgccac    109800
     agccttatga attttaactg gactatttct gtagaaggat agttttaatt tttatattcc    109860
     ttggtgtctg ttctttttag ttattcagtt tcgttcgctc tcttgtttat atctgattaa    109920
     taggaaggaa tttattcata tgcgactatt catccgccgc tttgctttat taaccttagt    109980
     agtagcaagt tgtttaagtt tgatgggttg gttacaacct gttagtgctc tggatatcca    110040
     agggcaatcc aactcaccag gtctcctggc tgctgcttac cgtaatcccg tagatgccaa    110100
     actcgaaacg gactatggcc aaaaaatcga cttgaataat acgaatgtca ttgcctttag    110160
     ccaatataag ggactttatc ccactattgc gggtaaagtg gttcagaatg caccctatag    110220
     cagtgtagaa gaagtattaa atattgatgg tttaactgaa cctcaaaaga aattgttgca    110280
     gcagcacatg ggtgacttta cggtaactga cccagatcca gctttagtcg gaggtcaaga    110340
     ccgctataac acaggggctt attaccctgt ccgtcgttcc taagttctct atagggatgg    110400
     aatatgctgc gattccatcc ctatagcggc aaggccatga acattaagaa gtagtttata    110460
     agtcagtcaa tcccaggctt gaaataactg atttaaccct ttgtgtccaa caattgggtc    110520
     catccaccat gaaaaatttt ttgggccaac tttggaattc aatcttccat cgattcacct    110580
     tattggttgt cggtattatt ttttcctggg gtgtcatgtc gatgggctgg ctaaacaatg    110640
     atgtaggaat tggctgggct gctctgcctc aaggggatgc gttcactaat cccatgagta    110700
     tattgaggct tgctttgcct gttgatagcc aagctattca tactattcat caatatctag    110760
     aagagatgcc acctcaacta gatgatccca cagcgcggat gcaacccaaa caatggtctg    110820
     aggtgggaaa tcagatatca aaagcaatta aaacgtttaa tcgagaagct tcagaccttc    110880
     tttctgatat tcccactccc tatcggcctc aagctttagt ccgcatgaat caaatcaacg    110940
     cagcactagc cgatctcaaa atattgtctg acgagcaaag taaagaccta ttcgtagcta    111000
     aacgaacaca ggcttggaac tctatcgatt tgttagcggc ttctatggtg ccagaatatt    111060
     ctgtcaacat acccgaggac tatcaaacgc taccgcagct caatggtcga gcagttgttg    111120
     ccctcgacac tagcaaggga cccatcacta tcatggtgga tggctataac gctccaatca    111180
     ccgctggtaa tttcctagat cttgttcagc gagagttcta cgatgacctc acgtttactc    111240
     gtgaagatga ggcttatgtg gtacagacgg ggaatccaga aggtccccaa gcgggattta    111300
     ttgatcctga tacagggcaa tatcgctcta ttcctttgga ggtaatggtc aaaggggact    111360
     ctgaagctgt ttatggggct actttagaag agctaggttt atcgttgtct gaaccagtcc    111420
     ttcctttttc tgcctatggg actgtcgcca tgggacatcc acagggcgac cctaacggtg    111480
     gctcgtctca atttttcttt cacttgtttg agcctgattt gactcctgct ggattaaacc    111540
     ttctagatgg ccgctacgct gtttttggat acgtgattgc gggccaagag gtcttagctc    111600
     aattacagca aggtgacctt ctacgttcag ctaaggtggt tgatatctct ccaccaaacg    111660
     ccttcacttt ccggtatcta gattggatcc ttgttcaaag acttagtagc agtttaaagg    111720
     gcatggcttg aactgctgca aatcgaatga ctgattcaaa ttggccccta ctataaatgc    111780
     aaaccccact cacagactac ttggctgaac ccctcgaagc caatctctcg gatccatacc    111840
     ttagagaatt gccccaagct ttttcctgga gtcatcaggc tttcaaagcc ctcactgagt    111900
     tggacaatga atccctgcct ccatcggtcc caatcggttt gcttgggata gtcaatctcg    111960
     tcacagtact cggtccagct ttcttgttga aactcggaag cacataaaga agttcctttc    112020
     tcttgcacct gtgtgagtaa atccaggatg gtctgtgagt tatccataaa tttctcctgg    112080
     tatagcgact agaaacattg gatagatccg ctcagcgttc tctgccctct ctcgctgagg    112140
     aacagccccg ttagcgagtt ggaagaggtt tagacttcct gatatatccc gagtgcatcg    112200
     tctggagggt gggtattgat tgcccccacc gatgggctat ggacctgatt agtgcagagg    112260
     attgagggtt gtagagaagt ccctctcatc catgtcaata atatatctaa ttttcctatg    112320
     cagtgcgagg gaaattcaat cactataatt tatttgtctg aggggaggta taagcagatc    112380
     ctagtgtgat agcattggct caaatcccat gcatttcagg gtatggatag agacaatgag    112440
     tggacataaa acgaaacccc tatccccttt atttaaggct cagcgcttta aaccagaggg    112500
     ggacgaaccc cgaacggctc aggtgacgtt cagactggat cagcggctca aggatgccat    112560
     tgtggagcac gtggataatc agtctgagtg gatgcggatg gtccttgccc aagcggcgaa    112620
     agaacaaggg tggttacggg attgggatta gggtgttttt ggggtggagt tggctgcgat    112680
     cggatctgtg atacttgttc ataggaatta ggtgaatctt gttggtaagg gcagccctag    112740
     actgaatttt cagatttatt ttctatggat ttcttgtaga tagataatcc tgcggaagag    112800
     agctgaatga ggaacagact acccggaaac cgatagtgct taagtgatgc tcagatttga    112860
     tgcttattcg tgaagcagag cggcaattcc tcagattatt agacgacaat cgagctgacg    112920
     gattaatgac gatgtcacgt cggctatagc tatgaagaaa ccaggcatcc cctgagaagg    112980
     ataaaactag atctcaattc cctagaaatg atgtgtgaga tcgcgtttct agaattcaat    113040
     ctcaagaaaa aagacacttt ttacatccct aatcaataga gggctgtaca agtgcctaac    113100
     aaaagaattg attcctatca tactcgtgtt tatatgaacg gaagagacct cggcttgaaa    113160
     caagctgatg cagcttacat tgccgaaata tctacaagaa ccggacaacg aattgaggcc    113220
     ggcacccatc aacctaatcg cggccgcctt caggaccaac gcaccgttcc cgacccctta    113280
     gctgatgtgt gggaagacga gctagaacca atgctgcgtc gagacccacg cctcaaaccc    113340
     atgaccctgt atgagtacct gcaggataag tatccaggcc agtatcccca agtcctgcgg    113400
     accctacaac gtcgggtgag aacgtggaaa gccttacatg gaccaagccc tgaagtgatg    113460
     tttgaattgc gtcatgaacc cggggtacaa gggttttccg actttacaga actcaagggc    113520
     atcacgatta ccattgccgg caaacccttt gagcacctga tttaccatta ccgtctggga    113580
     tacagcggct ggcgatatgc ccagatcatc gaaggaggcg aaagctttgt cgccctctca    113640
     gaaggattgc aaaatgcctt tgcagcctgt ggaggtgttc ctacacagca tcgtactgat    113700
     agtttgagtg cagcctatcg caacatgggc ggccgccggt ccaaaaacct cactcgtctg    113760
     tacgacgaac tgtgtgacca ctatcggcta gaacccactc gtaacaacaa aggtgtagcc    113820
     catgagaatg gctccattga atctccccat ggtcatctga agaaccgaat taagcaggcg    113880
     atctatctgc gcggcagtgc agattttacg agcgttgctg agtatcaagc cttaattgat    113940
     gcacaggttg ccaagttgaa tcagcagtgc caaaccaagt atgagcaaga gaaagaccat    114000
     ctacaaccac tgcccaaata tcgaacccct gactatgaag tgctcacggc taaagtcagc    114060
     aaacgcagca ccatcgatgt tcgctgcatt ctatacaccg tcccttctcg actgattggt    114120
     cgtcaattgg aactgcatct ataccatgac cggattgtcg gctatctgga gcgacacccg    114180
     gtggtggaat tgccgaggaa gcgcgtcagt ggcaaaggca aacgtcgcga ccgttgcatc    114240
     aactatcgcc atgttattgg ttcaatgcga ttgaagcctc gtgcttttat ctattgcacc    114300
     tggcaatcag acctacttcc caatcctgaa taccgccaaa tctgggaaca gctcaaagcc    114360
     caatttgacc tggagcaggc tgccaagatc atcgtggaag ccctgtatat tgctgcggtt    114420
     caagataaag aacaggccgt agcagtgtac ttacagcagc agcttcgctc atccagcctt    114480
     accctcaatc gcctgaaaaa acagtttgag ccgcctcaga tgaagcaggt tcctgaactc    114540
     agcattgaac aacattcact tgaactttat gacaaactcc tcccctcctg ctcagtcccc    114600
     gctgagcccc taccagcacc tgagcctcta tttaaaaaag ctcaggctct cccacatgtt    114660
     gacccattgg gaatctatcg aatcccaagc catgcaggaa aactggtctt atgcggaatt    114720
     cttactagcc ttgtgcgaaa cggaggccca acgaagagaa caagctcgtc taaaacgtgc    114780
     cctcaccgaa gccaggctcc caaacgcaaa aagttttacc aactttgact ttagccattg    114840
     tccccagctc aatccagctc ccttgatgca attagccgca gatccgggtt ggttggagcg    114900
     cgccgagaat tgccttattc tggggccctc gggtgttgga aaaacacatc tggccactgg    114960
     ggtgtccaaa aagatgctgg aattcggtaa gcgggtgaag ttctttgcag ccaacgcatt    115020
     ggtccagcaa ctgcaacagg cgaagctcca actgcagctg catccaatgc tcaaaaaact    115080
     ggaccgctat gatctgttga tcttggatga cttgggctat tgcaaaaagt cggaagcgga    115140
     aacgtccgtt ctgtttgaat taattgcgca tcgctatgaa cgaaaaagtt tgttgattac    115200
     agcgaatcaa cccttcagcc aatgggatga cattttcact gattcgatga tggcggtggc    115260
     tgccattgat cgcttaattc atcatggctt gattatcgaa attcaagccg atagttatcg    115320
     gcgcaaatca gcgactcaga gaacggctca aactcagtct caacctcaaa aatcccagtc    115380
     caaataatcg agcgatcact ggttgtcatt tcgatcacgg gttgtcgttt tgttctgaag    115440
     gtatcgtatg aggtctgaaa aagagctaac gcaaagggag tgtacgccaa ataatacggt    115500
     tcaaatttgg gggttgatcc gccttgtggt tgtcgcgaca tcgcctatgg ggttgacatc    115560
     caatatcaga tagttgaacc aggagtcacc gcgcagaata cgataatcat ctgagataat    115620
     ctacccttgc ttattgacgg cgatgacttc atctgagcgc atagtcaaga gcttgcaaga    115680
     atttaaaaac atcaccaaca taagcactgt catcctcgtg aattcggaga gcaattcctt    115740
     aggatatttc agtcgttcta agcattgaga gaatgtgatt actcaagcag ggctgatacc    115800
     acgataaggt cattatttac taatatcaag gaatttagga atttttaggt caatatctgt    115860
     tgtgagattg agggttcgct tctgggttga gatcgaaaaa ccattcttta acaggtgcaa    115920
     tgaaatcttg gatacaacct ccacaatgca gctatgtttt gtaaaataga ttccaacctt    115980
     attggtgcag aaaagtcgtg aacaccatgc tagggaagga ttactaagcc attagaggga    116040
     tggagtgaga cctacaatgt gaggcttaat tacctcactt tccttcaagc acatgtcaac    116100
     tcctctgctg taccgtcaac tgcaaactca actgagccaa tggatcagtc ccaaggatca    116160
     tcgtcacctg acggtctttt ctgaaaatat tgccgcgatt ctacaagccc agagtggctg    116220
     catgagccat tggctgtcgt acttgagtca tcggtcctgc caagctcgta gtcagatgga    116280
     acgcctgagc tattttcttc ataatcccag aatcctctca gagactttct atgcaccatt    116340
     actcaagcaa tttcttcatg cttgggaagg aatgtcaatg acattaaccc tagatacgag    116400
     catgctttgg gacacctatt gcttgataga ggtctgttta gcgtggggtg gacgttcgtt    116460
     cccgttagct caaaaagtca tggaacatgg tagtgccacg gttgcttttg tagactattg    116520
     cagtgtttta tcgatgactc aaggggtgtt acctcctcgt tgccacatca cgttattggc    116580
     agaccgaggc tttgagcacg gtgagttgat tcgctggctc cgctcatctg agtggtcttg    116640
     ggccattcga gccaaatctg atttgcagat taccttagct aatggtcgca gtaaaccagt    116700
     atccaagcta ctccctgaag ttgagcaagc gtcactcttt cgggatgtca tgatccttga    116760
     ggatattcac tgtcacttgg ccacagcttc agtctccaca acacaggagg cttgggcggt    116820
     gattacggat acgccgccgt cattgcaaac ctttgccgtt tatgggcaac gctttggcgg    116880
     gattgaaccc catttcaagg attataagtc ggcagcgttt gaggtacctc gctctcacat    116940
     cagagatact gcagccttag aacgcttact gatgttactc gctgctgcaa ctctcatcgc    117000
     gatctctgta gcctttcagg tgatcgctca agatgcgctc aaaaccattg attggcatac    117060
     tcacagggga ttaagctttc tgcaaatcgg tttgcggcag atcaatcagc tttgctacct    117120
     aagattaccc ctacccccgt tagcaatgtt gccccgacaa aatccgcctc ctgcttatgc    117180
     ctccctaaag aaacgagctg ctatgaagac ttgcattgaa ttcgctaagg taactgttat    117240
     ttaagctttt cagcctactc aaagttttct gcaccactaa ggattccaac tattatcaga    117300
     cctaagtgag cttgagttta catcaaggct tcaatccagt taaggtttat caaaatacat    117360
     tttagactct gctacaggca taacctaatc gctccatcat tggttcaata taaggagtaa    117420
     tccgacggat tttatttgga tatttttttc tccatttatc tttttgggga ggtgaaatag    117480
     tagtacggct atgcggattg gaattgagat agttgataca gtcagcggag atagtaagtc    117540
     ccgtattttt agagatagct tctaggacgg ttctaggatt ttcaataaag ttttcatacc    117600
     gtattctcat gtagtttgaa gacttttctc tctcaaattc ctccaaaacc acgcgattat    117660
     gctccaccca gctccacgca caaatctcct ctatagagtg tttaacctga gattgccaat    117720
     ttggaggcat cggatatgac caatgttgga tcttattgct atcactgcta ggcaagtcag    117780
     cattaacatt cacaattttt tcccaccctt caatcatgga agatacattt gctctaccat    117840
     ccctgactaa atggatatag aaagcatcag gaaacatgcg tttcaaggct tccaaatgga    117900
     aacaatttgc aattgtcttt tctagataag aatagatttg tcttctaaga ataaagtgat    117960
     taatgaggat attaggtcta aaagtgtggc ggtcatacac taacttcaaa gcaaagaatg    118020
     ttcttagctt cattaaattt ccagaagtac attccttggc ggatatatat tccgactgag    118080
     ataccaattt ttttggcgga aatactctta gccatagtgg tgtattttca cgatccagcg    118140
     aaataggttc ttgcatgcgt cttatcgtct caaatagatt agttgagccg gatcgaggcg    118200
     ctgctaaaat aaagataggt ctaacaaatt gagggcaaat gaacttaagc attttaaaaa    118260
     gcaaggatgt gaattcagct atataaattt cagcagcaaa agctgctgaa actccctttt    118320
     taccccaagg gaatcagctt ttgtctaaat attgtaatcg attatacctt ttttgaagga    118380
     aaaaacaagt tagtagatgt ctttagttat tttttcttta cttgagtgcc tctccggtga    118440
     gtaagttcag gatggtagag tttatcaatt ccataattag ccagtatcaa agaggctatt    118500
     tgagaatttt tagtattctt cacctaccta tctggatcag gtaatagaat ggctaacact    118560
     gtaacaatcg aagactgcag aaatttgggt cgtgcatcaa caaagtgtgg gtttgctaaa    118620
     ccattagaga gttgagttat cctatgcctt gatgcaatgt cctctatgtg gtcatccaaa    118680
     gacccacaaa cacggtaaaa ccagtaaagg cagccaacgt taccgttgcc cccactgcca    118740
     gcaaaccttc agtgagacct ttgataccct ctattatcgc cgtcagattt ctcctcaaac    118800
     catccagacc atccttcaat ctcatgttga aggcattagt ctgaggggcc tatctcgcat    118860
     cacaggtgtg gcgtataaca cctgtgtgag cgtggttcgt tcagcaagcc ataaagccca    118920
     aatgattcac aatcaagacg ttcaggctgt ttcgactgac gtcatcaatg cagatgagtt    118980
     gtggtctttt gtcaaaaaaa gcaaaagcac tgtgaaccgg aagaattgag tgtaggcgat    119040
     tgctggatag cgttgagtct tgccaaagat agtggcttgg tgctcagtgg tcgcattggc    119100
     aaacataccg acgaactcgc tcaagaatta attgagaata ctgaaggcaa aaccgcctgt    119160
     caccattggc aaactgatgg ctgggaaggg tattcacgac aattccccga tgaggtgatt    119220
     catcaagtga gtaaagcctt gacccaaagg ttagagcgga ccaatggcat actacgtcaa    119280
     cagaccgggc gctggcatcg acgacagaat aaatttggca aagtctggca acagagtgca    119340
     gtgacgttaa gactggtgct ggcttatttc aactggatct ggcgccactc tcgattcaaa    119400
     aatacggctg cccaacgtgc tggattgacg gagcatcctt gggaatggca aaatttagcc    119460
     acctatccca cactttgttg atgcacaatc aattttgtct agactgctcg gcttctacta    119520
     tttcctgaaa aatgttgtcc agactacggg tgattcccca atcagggaaa tgagacttta    119580
     gcttgctcaa gtccgaaata tagcaaaggt gatcacctat cctattggtc tcaacatatt    119640
     cccactgaac tttttggcca gtgatagctt caacccgatc aaatgcttcc aggacagaaa    119700
     cactattgtc acgtccacct cccaagttat agacttcacc gggcctagga tttttgcgat    119760
     atgcctcgaa ggcttgaatt acatcgtagc tgtgaatatt atctcgaacc tgcttgccct    119820
     gataaccaaa caccttatag gttcgtccgc tgacagcaac cttcaccaga taggataaga    119880
     aaccatgtaa ctctacccct gaatgagacg ggccagtcag gcagccaccc ctgaaaatcc    119940
     ccactttcat gccgaagtac cgaccatatt cttgggcaac aatatccgcc gcagccttag    120000
     atgcaccaaa cagagaatgt aaacagcgat cgacccgaca agtttctgga ataccattat    120060
     gatcttctgg atttgcatag tcataccgct tctccagttc aatgcgtggc acctcattgg    120120
     gggcatcccc ataaacttta tttgtactca tatgaatgaa cacagcctct ggggagaact    120180
     gacgggtagc ctctaaaagg ttaacagtcc ctaatgcatt cacctcaaag tcaagcaaag    120240
     gaatttgaca ggctttatca tgagatggct gagctgcaca gtgaatgatt aaatcgaatt    120300
     tttctgcttc aaataattca aaaatacttt ggcgatcacg aatatcgata ctgtgatgag    120360
     aaaagttctg agtaccctct ttaagacgac ttagattcca aagcgtatcg ccttgcgcac    120420
     caaaaaattc ggcgcgcata ttgttgtcaa ctccgaacac ttgacagcct tcgtggtcat    120480
     aatactcaac tgcctctgaa ccaataagtc cactagaacc cgtaactaat accttcacac    120540
     aaacctccta tcactcatca aaaaaaacat tcagaaaact ttaaacaaca gctggcaaca    120600
     catttgcttc attcaaaatt tctgaaaaaa ccgtgcgaat ttgttcaatt gaatgcaacc    120660
     gataatagcc ttcaaagtca ggatttagct cactcaaagc ctgatcagag caatcgcaaa    120720
     gatagcgcaa cgcgtcaata cacctcgcca catctccttc gggcatggtt acacctaacc    120780
     taaatttttc aatccgagcc gccatacaat aaccttcact gacaatgatc ggctttttga    120840
     agagggctgc ttttgttaat aagttactgc tgtaggggaa attttcatag gctgcgaata    120900
     aaacatcgca ggtatcaatc atgctattaa aagcataacc atctggaaca aattcaaagt    120960
     gaaaatagca gttagagggc ggttcatctc gcattttttt gatctgctga aattcatctc    121020
     caaaccgctg atcaaagtct tgatgaaaca tcgtttcatc aagtgcgccc gcaaacacaa    121080
     aaaaccagtt ttcctgaacc gactgtcgcg ccacttccag tagagttagg atccccttgc    121140
     gcttgcttaa tgcaccaatg agtccgacaa tcttacgatc tcctgccttt tggcgaattt    121200
     ccttgatcag ctcatagtca gtctgaggtt gcgtttcatc cgtaatgtcg gggaaagcaa    121260
     ccacagtttt tcctaaatcc tcctgtatat catccaccag ctcttcattg agcattgcca    121320
     gagcgtaaca ccggggagat cgggcgatcg catagtgggc taagggtttg ctaagtccct    121380
     ttagggagcg ttgcccaaat ctcaaaatgc ctggacgaaa ataaagtcca gcccaattgt    121440
     aaggaaatac cgcatcaata atgtggtgta ctaagtagta gctgaggtag ttgtcaagcc    121500
     agttaaaaaa aacgtagtca ggagagtgac cgatctcttc tgaagcatta cggatagact    121560
     ttgctaagtg ctgccacctt tcaatcaccg caatgggtcc gggaacagtg cctaacactg    121620
     gaactcgccg ccgcttatgc ttatgcatct cgaaggtcca tagacgatca cgataggctg    121680
     ggcagtgctc ttcaatccaa tcggtaagat ctacaggtct aggataaaaa gccatcacct    121740
     gatactgctg ctcaagtaaa gttttactga ataacctcaa ataagtaagg tgatgaccgt    121800
     ttccagaatt agtttcaatt aacgcaattg ttttcataat taataaatag gctctaaggt    121860
     gtcgccatcg gagaggagtt gccagagaca acaaccttca atggtcaatt gacggccaat    121920
     cagtgcgatt gcatttaagt aaaattcaat gaaatataat acagacagcg ttgatattac    121980
     attaaaggct catgttgagg ttagtaaccc tcccatgatc cgttgtacag tgcaagatga    122040
     tggtgtgggt atcgactctt aaaaaatcaa ttctctcttt ggagtttaac tcttggccaa    122100
     tctgattctc tcatcactga gtatggtctt ggtctctata tttgtcgaaa aattattgaa    122160
     gctcacgggg gtaccattgg cgttgaaacc tctgctgatg gcggagctac attttggttt    122220
     ctgctggaat tgtccacttg actaagtcag tccagaagga agacacctgt agatttttcc    122280
     aggttttctg ccctgcattg gggttgcatt cactatagaa tcgccaagtg aggatattcc    122340
     catagaatct gtcatgcatg atgaatgtca atttcccttt tctaactgat tactcagtaa    122400
     ctcctggatt tcctctacca taaatagttt tgtcacatat ctttgtccat aatccactcc    122460
     catagtgcgt gtctatatga cgaatagcga ttctcaaaga tggaccgatg atcggcttga    122520
     cgcccttgca gcctctactc agagtttgct agatgcaact caggctaata ctgccacaat    122580
     tggtcaagtc cttgagcagc aaaaagttac agataagaaa atcgaattat tgattgaagg    122640
     tcagctagca atgcagacct tacatggtca attggcagag cagacatcgc agctcaagcg    122700
     tgccgttgac tatttattga gtaaggatgg cggacaattc tgatcaatgg aatctgacga    122760
     aatcatcatc cgctactatc accaaccgaa acctgtaatg gttgatcctg ggaagagcca    122820
     cccctgttac gagcctgatt tattgctcgg ttggatttgc aagggtgact ccaaaaaacc    122880
     tgtactcaag aaattccctg atgctgagat agtggctaag gttaaacccg atactaagcc    122940
     caaaactcgg accaagctca gaagaatcca ataatgtagc atccccaagt aaagacacgg    123000
     agcagagtag aagaatgtga tcatggtcgg tggagttgcg atctcaattc cagtattgcc    123060
     attgccatcc aattgagcat ctcaagcact cgtttttcct ggctggcttc acatctcaag    123120
     ctgatcactt ttcaacgttg gttagccttg accggagggc attagatctg aaatggtgta    123180
     acttcatagg agaggtttga taacgcctag attttagatg tttttgggtg gattgatgat    123240
     agcgagtggt taactcaaga gggaaccgtt cgcggcaacg atcacaatac caatacaact    123300
     ggtttttatg aatgtgcaac aaaagatcgc ctgagcaaag aatgcagtca gacattgtga    123360
     agacctgagt ggggaaatgt gagtcagagt ctaacctaac aaaccctaat tttgtctcct    123420
     taaaaaataa atcctaggtg agtgtagttt acaaggcgaa atctccagca agttctctca    123480
     ggtctgccgt ttgttgagat tgctgtggga gaattcatgg ttttaattgc tatcaaacgt    123540
     attccccaaa acaaaaaaat tgataaaaat caccataata aaaggaatga atcactcttt    123600
     tataaactcc catgaaatct acctccgaac gctataacag ccttgccagt tcctatataa    123660
     aactctctga cgaatttcat cagctcgacg tggcccacat ggaccttaag caaaaactgc    123720
     tacccgccat taaagctatc aaaaactatc aatccttaac ccatcagctt cagcaagaca    123780
     acaccaaact cgaacaaacc attcaaaccc tcacagatca acagcaacgc ctagaggaag    123840
     accagcgcac cctaaaagca aaggaggtag aacagtcgat aataatcaat gcgctaaccg    123900
     atgagaaaac taacctccaa gctgccctag aagagtttca agccaagtat gatgccttgg    123960
     ccgattttga atccttgcta cagtctggac ctcaagctgt tctggcagag gctgaacagc    124020
     agatgctact ggtagaagaa accttacaag agatagccct caacagcgat cctgacctga    124080
     gtgaaaatga gcagcagctc atagaggctt atcaggatga ggatgaaagc ttattcatct    124140
     caacggaaat ctcaaaggat agcagcagtc taaaaattcc aaacatctta tccttcgttg    124200
     cttagacaac tattaaactg gggctttcat gagaatctga caactcccct gaagttgaat    124260
     cttccagggg agtttttatg tcttaggttt aataactcaa gcaactttgc tcaaatgaat    124320
     atgctttcgc cctaaggaga tttcgaactc atctcctggt tgcaggttca ttttcttggt    124380
     gtaggcactt cccaacaata gtttgccgtc agtttgtacg ctaatgcgat agctaggatt    124440
     gtggcctctt agttgctcgt tactctcacc tttcgcatcc aggtccatcc cttttgctgc    124500
     caatactgca tttagaaagg ccatgacatt aatgcgctca attccattaa gagtaacttt    124560
     gtaatactca caggcttttg ctttctcttc acaggtggcc tgcttaagtt gtttgactgt    124620
     agcaataagt gcatcccaaa ttaacggttt agggttgatt gcttatttct gaacattgaa    124680
     ttgaatgtgg gttggtatat atcaagatat ataaaataac aaagacaatc tcttatcact    124740
     tttatttgag atgtcaacgg aaatcacaaa aattgaaatc tcgtaattct gcactttatt    124800
     aaaataaaat taaagtagtt atttagaagt gaattatgtt ttatagggga tcgaagcatg    124860
     ctgtacgaaa aaaccatttc ctttgaagat tataaacaag ataaacccaa tattttgggg    124920
     agacaactag gaattagctt aaaattccac cacagtaata tattacaaaa actctctcaa    124980
     gaggctgcat tgcaagctat ggtagaagcc tggcagtctt gccattctaa gcagacctat    125040
     gagtgttcta gtaaagattt cactattact gtgcccagtc aagaaatggc taatatattg    125100
     gaatgcagga atttactgtg aagttgagtc aatttttcgg tgataggcta ctctttatat    125160
     tttgcaccac aggtatctaa attgacaccc tttgatatgt ctagcctaaa caaaaaagca    125220
     gccagataat acaatatgaa tgctgaaatt agatacaagt tcacctcata gattgctagg    125280
     ttgcaccgct tgcaggcgaa tctcccggat ccaaacctta gtaaattgtc ctaattcttt    125340
     ccctggcgtc atcagttgtt caattccctc tccaagttga gcgataaatc tcttccgcca    125400
     tcggtcccaa tccgcctggg tggggtaatc cagatcctca caaaattctg cccagcttga    125460
     ttgctgaaat gctgaagcca gcatagacgt ttctacctct ctaacctgaa ttagatggag    125520
     atcaatcagc tcttgaataa atggaggatg accgttccta agctcactgc tatcaaccac    125580
     tggaaactca taggaaagct gcagttcctc tacagaatgt tttttggcta ttcttaggag    125640
     ttctaactgt tgttgagtca ggtttgggat atgaaccata acggatctgc atcgatcagt    125700
     ctaaagtggt tgatttgagt ttcactgaag aaatgactct aggccatcca taccatctag    125760
     tcatcactgt tgattaactc ccatgcttta actctgatac tctcagggca ttgcatagga    125820
     aaagtggaaa tatctagcct tgtttcattg gcagcatctc gacgtgcccg cttatagcag    125880
     agatcaaagg actcttcaag gtggcggcgc agggaggggc gatcttcaaa ttcatctttt    125940
     atctggttcg cagcatcaac gatggtgata tcccagctat cagtgtgctt agagggctga    126000
     tattttatct tcagtaagtg ccaaagcatt cgtttgagct ggctttttac cttgtctcga    126060
     tggcggttac ccacatcctc aacttcctca atcaagtttt ctaggtcgag taagtcaaac    126120
     cgaccatctc gtaacaattg agcctgtcga tcagcccact ccacgacatc acggtcatac    126180
     agagtgcgtg tgttagtggt catggtttgt cctctttctc acgaatcaag agatctccag    126240
     ggctgcaatc taaaaattcg catattttat ctaaggtttc atgagtcaaa cggggcataa    126300
     cctctgactt tctgagtcga tagacagaat tttcatgaat ccccatgaat tgcgctagat    126360
     cacgacttgt ttttctttga atagataaaa gctcatgaag cttccactta atcactgctt    126420
     ggtgcatagt tttcatcatt aagatcctag cactcacatt ttagcaccaa taattctacg    126480
     ttaaagtgtt gattatcata gtctagatgt gtataatagg tacataagca aagggcacca    126540
     cctccgacca aagaaacgat gccctcgctg aaaaaaccct agataggttt aatcttatgt    126600
     attctacagt tcttaagcct ttaaccactc agcaacaaac ccagccagat atgtggctgg    126660
     ttcagactga agccgatgga atagccttca ttaacgaaca cactgaagat cctctttgcc    126720
     ctccctatac tctggcttgc gtcctactca aggactgcgg ccccttcgat tcggatatcg    126780
     atattgattt cgatgagcat tgggtgttga tggtgacccg caagccgacc cctgaggagc    126840
     gcacgactca aacccggatc gaaaactggg ttctttatca ccatgagctt aagggtgctc    126900
     tcagtgactg gtacaccgtt caggccgatc agacggttcg agctgagaac gattacgacg    126960
     acgaattcta agaatttcta ggggcacctt tgcccctccc acttcactta cacccactcg    127020
     ctacataggg gactaaatat catgatcacc gctgaagacc ttcagatcga actcgcgcat    127080
     tgtcattgca gtgaatctca ctatcagcat tggctgggta tccgttacac agaaggcgtc    127140
     aaaacactcg cagagaaagg ggaatgtttc tggctcctcg acgtgatcgc aagttatcaa    127200
     cgggtgcgac tcatcaagtg caatcccaac ctccaagaat tccagctttg gttgctgacc    127260
     gtaaacgacg accatagcgc tgtcttagcc tgctacgaag acagcgctag tacttgcagc    127320
     cctgtcatta cccaagatat tcccttcact gatttcgtcc tgccagaaat caagctgtat    127380
     gtggaatacg gcgttgtgct gctgccgtct gagcattaat ctccctggcc tgggtggtgc    127440
     ctaaccaccc gccgctacat tccaacctca gcgagatttc aacaatgaac cctcaagact    127500
     atgatcggac gatcatcatg ttctctggtg gcaaagattc tttggcctgc atcctctggg    127560
     ccatcgagaa caactgcccc aaaattgagc tttggcatca ccttgtagac gggttgcccg    127620
     tgcaaggcca gaccgcttcc accctgatgg attggccgat cacatcaacc tactgcaagg    127680
     ctgtggccca attgctttcc atccccatct atttttcttg gctggacggt ggctttgagc    127740
     gtgagatgaa ccgctccaat caagccaaag caaaaacttg gtttgaagcg cctgatggac    127800
     tgcgctctgc tggtggcaat ggtggtaagc aatctacgcg ccagaaattt ccccaaatct    127860
     ccgctgattt aagcatccgg tggtgttcgg cgtatctcaa ggtggatgtt tctgcgatcg    127920
     caattcggaa tcaaccccga tttaacgact ccaaaacatt agtgattact ggggaacggg    127980
     ccgaggagtc tccttcacgg gccaagtatg cagagtttga gccagatcgg actgacaacc    128040
     gtaacggcaa atccaagcgc catgtggatc gatttcgccc gattcatggc tggaaggagt    128100
     cggaggtctg ggccatcatt caacgacatg gcatcatccc ccatcctgcc tatcatctcg    128160
     gctggggtcg tttgtcctgc atgtcctgta tctttggcag tgctaaccag tgggccacta    128220
     tccgtaagat tgcgccagct cattttgagc ggatcgctaa ctatgaacag caattcgata    128280
     ccacaattca gcgtcaacgg tcagtccgtg agatggccaa cctaggaaca ccctacgccg    128340
     aagccaataa tagtcaactc gtggaaatag ctctttccag tgagtggggg gattatccta    128400
     tctggaccca tctccaagcc tgggccttgc ctgccggggc ttatggcgag agcaatggac    128460
     cgacttaggg ggcagttatg aatgcttaca caattctcta ttgcctaatc tggcaatcca    128520
     tctatttttc actctttctc tatttcttca tccccttcgc ttcagaggat aaacaatgaa    128580
     acccacaaca agatacaaac tcattccaca agttcagttc accacaacga ttgaactcca    128640
     tgaccagcag acggcaatcc ttaaccgcct ggtgctgggt agcaaagatt tgaccgacga    128700
     cgaggctttg gatctttggt tgtcacttaa cccctatgtc cacaccttcc aacattccac    128760
     tcccagagat atcttttctt cgttgagata tgcagcccta gctgctctac cagataatcc    128820
     caagccagct tacccctgga gctgctaaat tccgtgcact cagatattga agccgatggt    128880
     caggacttca tttgctgctg aggatcattc tgcctacgtt tcttataacc actcaaacct    128940
     cattcgcttt ttggagaaaa tcatgactgc cactctagac aacaacgcca ctcgcaacgc    129000
     tctaaccaaa gcgatcaaag agcatatcga tcctgctaag cctgagaagg tcaacatcaa    129060
     aaaaatacat cgtcaaacag tacaaacctg atgaccccac aggacaagac aagctggcta    129120
     agtttgcctg ggaattacac catggcaatc gtaatctgcg gaaccgggat catgtcctcg    129180
     aactcttcgg attgctaacc ctggaagcga cgggactaga acagcgcaaa accaataagg    129240
     ccaaatgctc tcccctaaaa gaggctgtat tcaaagtgct taagcaggta gcaggccagg    129300
     acattttgat ggtggttgcg ctaaatgagc tgatggatca actcacggtc actcgcatca    129360
     atagctggga gacctttttt aagcagcttg ccattaagcg aactgaactc gaatctctgg    129420
     ctgataccgt gtatgaactc tcgggggttt ctcctggggc ggttgaagat ctcgacgctg    129480
     tgattgtgcc cctctacaac gaagcaaaag gccaagacat caaagccatt aactgggaac    129540
     gtcgctcttg gtgggactgg gcacacaacc atttgcttga gcaggttagc aaagcggcct    129600
     aaccctctcc ccctgtctgt acctgggtca gccctgtggc gatatccccc caaccatcgg    129660
     ggctggcctt tccttattcc tattcccttg gagaaatccc atgcaagccc atcaccttaa    129720
     tttggcagaa tttctgctca acccgcctac ggttaacctg gcctattctc cggtggctgt    129780
     tatgacggta gcgacggcta agaatttaat gcaatcccag gaattattac tcagtggtgc    129840
     ccagaaactg tttaatccag cggtctggcc ccagctagaa ccagagattg agcggattcc    129900
     cttcgaccga cagaaggccc aatgcttccg tgattgtgtt gcctatctaa tggccgaggc    129960
     gacgacgctg aggtcggaac ggcgacatgt cgatgccctc aagcatatgg aggcggcgtt    130020
     gatgctggag gcactggtcc atggcggtta tgacgagggg ccattcgttt cagaacagta    130080
     aaaggcatcg ccaagttcgg gacaagtcaa acgatgcctt tcattgaacg aaccattcaa    130140
     cgaggttatt caacatgaat catacaactc ttccccaacg agttatcgac agtattgatc    130200
     tgccttccta cgaactccat accagaccga ctggtgagaa cgaccgcaag ctcaatgtct    130260
     ttttcggcag tcggttgatc gggtatgtct acatcaactt tatccagggc caatccaatt    130320
     acgtcggcac cacgctcaga tatcagtcct tcggccctta ctcccggagg acggaagcgg    130380
     ctgaggctgt cttagaagca ttcaatgcag gactcacgga tgagcaacgg ctgagggtcg    130440
     ctcttgctca tgagatggcc gagaacatga ccgtcattgc ttgctaatcc ccaacagcta    130500
     gagatttgga gtattcatca tgcccactat ccacattgcc aatctgagaa agtcccggca    130560
     gcttcaaccc ggtgttcgat gtgatcgggg gactccttta ggcaatcctt tccatatgtt    130620
     cgctgaatca gagcgagatc gctgcattgc ggctttccgg gtcttcttgt atgaggttgc    130680
     cattctggga aatgaaccta gccaagactt gattcgcaga attgctgagc agcacaaggt    130740
     tatgcccagc ggtagttata aaccattcgg tcgaggtgca atgatggcag cgctggaggc    130800
     gctgggccag aagtctgaag taacgttgct gtgctggtgt catcccaaac cctgtcactg    130860
     tgatgtgatc aaggctttcc ttgaatggaa gtgcccagcc ccccagcagc aaacattgga    130920
     ggttttgtga tgccgatgat ccgggcaaga taccccgata actgggacga gattgcaaca    130980
     cgggttaagg atgctgctaa ctggcgttgc actcagtgcg gtaaaccctg tcgaaagccg    131040
     ggggtcgagt ggccgcattt cgctttctgg ctgatgatta cgcaccctga atggttccca    131100
     aacacttcag agggggagga atagaagcct cagcgattca ctctcacagt ggcccacctg    131160
     gatcaggatc cgcagaataa tcacccagat aatctcaaag cgctctgtgc gccctgccac    131220
     ttgaaatttg atgcgccatt ccgaaaagcc aatgcgtaca caaagcagga atggtttgga    131280
     cagatgaagt tggaggattt gtcatgaata aacaaatgtg gaacttcatt caaagaggcc    131340
     gaggtgtctt gcaactaaag ccactgggat gcctgagtaa tcacagcccg tccttttgct    131400
     ctggatgtga acctgggcag tactacgagt gccaagcctg tggctatctt cagccctggt    131460
     gtaaaggagc tgatgatgac taccctgaaa tttgtgatga ctgctgggct atcgctgaac    131520
     aactgcacaa aaccattaaa accccaatgg aatccgagaa atgaacgcag ccacaaacaa    131580
     attaacccca tcaacacagc ccaaagctgt attgcaaccc ttatcacagc aatatcaatt    131640
     ccaatcccac gatcctagcc atgaaagggc actgggattt ggtgatagtc catcggcttt    131700
     ggctttattc tgtgatcgtt ccaaaacaag cacttggtat atcctcgata aagactctga    131760
     acctgttgag ctactgaagc ctgctttaac gggttacctg atcagcatcg agttcgttcc    131820
     caaggaattc agaggaaagc cttcgggtcg gttcaaatca gggtaacgct ttcacttaat    131880
     gggaaaaagg ctgcatctgc ttctgtacaa gagctttagg gtttttggtt atataaaagt    131940
     gttaccctga catcctagaa cttgaaccat gccgttcttt gtttggatca gcactttcag    132000
     aatcaatctg agcagatggt ttgaccgctg ctgtcggcac tggatcatat ccgccagggt    132060
     gaaaggggtg gcaacgacta attcgtttca acgccaacca gcttcccttg aggactcccc    132120
     aagttgatat tgcttcaatg gcgtaagctg aacaagtcgg ctgaaaacgg caagacggga    132180
     gaaataaagg cgaaatgaat cgccgataaa actgaattaa tccaattaat agcgttttca    132240
     tacaactaac tcaaacaggg gtagaccata agcctatccc tatttaacaa tgaaaatatt    132300
     gaatatggag tgggtctatg atccctattc ttccaacctg taattaccac agggcttgaa    132360
     tgggctcaga cggaatggga tcaggtcctg caccaccaat ccgaacatcc tgatcatcga    132420
     tcatatctat cggttgatta gttttcatgg cgttctcctg tcccttagaa acaagtactt    132480
     atctaggttt caccctaact tgagacctga tgagttgacc tacccaaata tctacatcac    132540
     tgattaaggt atccacaccg gatagatgac ttatacagcc agtggaccta gcaactcagg    132600
     ccgtttctgc agtcgatgtg cattaatggg gtcttgcagt atcaccgctt ttcggggttg    132660
     ttccactgat acttcttcta ggttgggaaa gtcttgccaa caatagtggc aaaaccagca    132720
     gatttgccca tgactaatgt gagggaggag ttcatgggag caaatgggac agtcaaacat    132780
     tgagaaacct ctggcgtaga ttgtctcacc cagaatcata ggtgagtgcc ctgcgttacg    132840
     aaggatagtt gataaagttg agaatcctat gaagatgatt gaaaacaaac gactttcact    132900
     gggctaaagg ttgcagagaa aggcattgtt caaattctag gatgccaggg gaaaactttt    132960
     atacggccaa aaatccctga agtccttaag cagcagtagc ggcagcctct atctcccgag    133020
     tcatagatta gaatgagcca tcagcctatc aggctggcgg tgatccctca attttgacta    133080
     ctttctaaca aacgacaaac taaaaggctg gagtcatttt agtgcgtgtc ggtggaataa    133140
     tttgcagtga aagggtttaa ggcaatttga cccatggaat gaaacccaaa atatgttgat    133200
     cgctatagtc acgttgttat ccgctgagtg aaaacggtgg agctaaatgg tcaatgggaa    133260
     cagctttggt tccctcaaat cgttgcagag aaagaaaacc tagaaaaatt tacaggtgga    133320
     caacttcaat aaatcagctc tttgatgtcc gtctttgttt aataaaaaga actatgcata    133380
     ttagacaaaa tattactcca atcacaaagg tggtatatcc taaaattaca aggaaggtca    133440
     catccatcca taagtaatga gtattgatgc tgttgctact ttggatattt agttgaaacg    133500
     aaagatattc gctcagacct gcttcatttt ttactgataa tcgataaata ttattctttg    133560
     agaaagatat agtattagaa ctaagtatta aaatgtcatt gtatttttta caagaaaact    133620
     tttctgatat taacttattt ttagtgcttt tattctttcc ttttattgaa gatagtcttg    133680
     gcttaataag ctcaataata ttacaatcta tttctagtaa ctctgaatta ttaattttaa    133740
     agatgacatt atatcgattt tcagaaatat cataattcgt ttcaatatca aaatatatac    133800
     tatcattaga ttttaagagt atatttttag ttaaaggttt aatagtataa atcttttctt    133860
     cccacttata atagataaag atagataaga aaataaagaa tagccctatt attcctattt    133920
     ttttattttt catgaagaat atactaaaga cagcaaaaac taagagaaca tgcctactca    133980
     taaagagctg gtcgcacctg gtgctgcatt ggcagatctc gtggtgtcgg gtgagggaga    134040
     tgtagaggga actgtagaga agatattagc gagattcttg gatttagggt cggtttaacc    134100
     ccatatcaat cctcacataa gggcactcca tcactgggtt cattcgttgc agatcccacc    134160
     cgtaatcgat gcccatcagg atcttcaata ttcatttctc gcattcccca agagaaatta    134220
     gtaggtgctt gccgaatctt ggctcctttc gctttgtaat caatgaataa cgcatcaaca    134280
     tcagccacga atattgatat ccatgttcca ggctgccctt gtgccccctg acataaaaag    134340
     atgcaaacgt catctctgga aacagatgca aaagtcggtg gatcgcccca gtcccaatct    134400
     ttttgaaagc caagaacatt gacatagtaa tcaatactcg taggaatact actgacattg    134460
     agtatgggag aaaggcccga aaattggttc tgagccatac tttctttagg tgtgctagtc    134520
     atactaatcc tctgctcatc aaagatctat cggctttaag tcttgcctag aaaataatca    134580
     gtactgtaga gaaaatagtt catttgtgct aagtataaac agtacatatg aaccataata    134640
     atgcttattc gatcagttca tgctgttgag tgggccgatc ctgtctgcct gcctatattt    134700
     agcgctccag tttctgctgg tttccccagc ccagccgacg accatttgca gaaaaatctg    134760
     aatttacaag atgccttgat tcctcgaccc gccgcgacct ttctgatgcg agtcgagggg    134820
     gattcgatgg aaggctgtgg gatattctct ggggatttgt tggttgtgga tcgctccatt    134880
     gatccagtgg atggagctgt agtgatagcg gttctagaag gtgagtttac agtgaagcgg    134940
     ctccgtaaaa cccaaggaaa aattttgctg actgctgaga acccagacta tcctcccatc    135000
     actgtgcaaa ggggaatgga tttctctgtc tggggggtcg ttacatttgt ggttcacggg    135060
     ttagaagctt gaaacgatat ctgatcgggc tttgtgactg taactctttc tacgcaagtt    135120
     gtgagtcagc tctgaaccct cgcttgcagc ataagcccgt ggtcatcgct tctaacaatg    135180
     atggggttgt tgtgacagcc aatgcaaaag ctaaagcctt aggtctggtt atgggtgtgc    135240
     ccttgttcaa agtccaagag ctgatcaaga aacacgatgt tagagttttc agctccaact    135300
     atgcgttgta tggtgatttg tcctcacgag tgatgacgat tctggagacc tttacaccag    135360
     agcaagagat ctattccatt gatgaatgct ttatgcgaat gccggaattt gctgaggcta    135420
     cgacatactc tcataaggtg cgtaaaacgg tgttgcaatg gacggggatt cctgtgtcca    135480
     ttggcattgc aacttccaag actctctcaa agattgccaa tcatgtagca aaaaagcaaa    135540
     agcagtatgg tggggtgttt gatatttcca ctgcccgtaa tgctgagggg attttggcta    135600
     cctttccagt cgcagatatc tgggggattg gtcgccaata caataagtgg ttgttaagcc    135660
     aagggattga gacagcgaag gagctgcggg atgctaacga ggggctaatc cgcaaaaaaa    135720
     tgggcgtggt gggggtgagg atgatccatg agttgcgagg tatttcatgt ttgcccctgg    135780
     agctggttgc taaaccaaag aaggaaactt gcgtctctcg ctctttcggt cagccagtga    135840
     cggagttagc ggatttgcag gaagcgattg cggcctatgc atctagggca gcggagaagc    135900
     tacgccatca agaacaagta tcagaggcaa tggttgtctt cgtgcggaca agccctttta    135960
     agccaggata ttttcgccaa tctgctactg tgcaattccc catagcgacc aactatactc    136020
     caacaattgt ggaatctgct cgtaatgcga tgaagcgaat ctatgaaccg ggtcgagaat    136080
     ttcaaaaagc gggggtgctg atggtgggtt tgtgtcctga gacgactatc caagggcacc    136140
     tctgggagaa ggatgagggt tgggagaaac ggaagcgcct gatgtcgatc atggatgaag    136200
     tgaatgatcg gtttggccgt ggaacgctgg agattgctgc gtcggggcta aggcagacct    136260
     ggcgaatgca gtcgaagtgg cgatcaccga ggtatacgac gtgttgggct gagctgccag    136320
     tggtgagttg ttgaggggaa ttgcagatag gcaaattgta agactgatcc tggtgatttg    136380
     atgtagacca tcttctcgct atccgacatt ctgaaagaga atcgataaac gagtaatcaa    136440
     agctccaaga agaacatagc cgattaatac ttgagacatg actagaaatt gaccagtaat    136500
     actcaaaggg tgtgcatgga tttcaccaaa gcccagagtc gtcattgtaa caacggaaaa    136560
     atatagcgac ctaaaccaaa gctcaaacaa acaaataaac cccaaatttt tcttgcataa    136620
     actttggttc aaaatatcat cgctaaaatc aactaaaaat gggttagcga aaggtgtagg    136680
     ccaagaatct ccatcaggtg ctggagttcc tataagatat gcaattgaaa aaaatagaga    136740
     acagcctaca aaagtacaga taatctttgt tgtagaacta ccatagtcag atatccacca    136800
     gaaaattcta attacttgtg tataagcaga aacaaaaata ttaatcgcaa aaacaagaat    136860
     taaactaagc ccaggagttt ctagtattaa tgcgggaatc ttctgtaaaa tatttattcg    136920
     cttgttgttt cttttgagcc aatgcagata gtgttttttc catttgcgcc aattcgcata    136980
     ttgtttgttc cagaatatct ttcgaatatt tcgtttcagc tttgatttta tgtgttcttc    137040
     aattctggca ctgtctagtc ccacagcaga aaaattagtt ttgtcatcaa tcctacaatc    137100
     tgtgatccca gtcttgccat caacaagtga gaattttgca atcgttccac acaggtccac    137160
     attgtcgaaa atagtgcctc tcaaatcaac accagataaa ttagcttcac taagatcaac    137220
     acaccaaaaa tcaattccac ttaaattagc tagtcttaaa tcagctttct ttagtatggc    137280
     tccagctaaa tatgatccag tcaagtttgc tcctttcaag caagccttag taagaactgt    137340
     tccaccaagc aatgattgac taagattagc ttcgcttaat ttaactccac tcaagttttt    137400
     ttcacacaag tctatttgtg ataaatcagg ttttacacct gggtgacttt ccctccagcg    137460
     attccaagaa tcgactccgt tctttaactc cacaacatgc tcaggatttg ccatccttac    137520
     cccaagaaaa caaagataaa atcaagataa gctaaatctt ttcaatctat caaacccttc    137580
     caccctaaat gaatcaaaga cacatcctat gattcatcac caatagcaaa tcttcaccct    137640
     tcccgatcac caaaagaaca ctccaccgtg attttgagat tgcattcccc gctgcccttc    137700
     gtgatgtaag gcactccccc ctcacccgcg actttgaccc cgaattccaa agtcacctta    137760
     tctacattgg ccgttgccac ctctttgaaa gcattgaggg tataggccgt ataggtgcga    137820
     atcgtcccct gcatggcctg gaagtttttc aaggccacat cacccatgcc tttcgaggtg    137880
     cgggtggtcc cttcagactc aggctgtgga tgtgctgata catcatcctc cgcttcgata    137940
     tagatcacgg ttccatcatt gaggtggatc ggggctaatt gggtcatgga ttggctctcg    138000
     cggtaagata cggcaatagt gatactgcat ggtcgaaaac attctatggt gatatcaaat    138060
     ccgctgctta tctcaactta tgagccgaga tgccctcatt gttggaatta accgctatca    138120
     gtatctcccg gatctgaaag cccctgccct ggatgcagaa gccattgcac aacggttgga    138180
     ggacgatgga gagttcgata ctctttaccg attaccggag ataataatcc aaggggaaac    138240
     gaaaaagcct gagattggtg aaaagggatc tgtttttatc acgaaattaa agcaagcatt    138300
     aacgcaactc tttttaccta aaagccaaca aatacccaaa acagctctgt tttacttttc    138360
     tggacatggc ttgccagatc aagatttagt gggggttgat aaaggttatt tggctgcaag    138420
     tgataccaat aaaaacaacc ctagttcggg tctgtccctg ctttggctgc aatcattact    138480
     atccaaaagc cctatccagc aacaaattat ctggttagat tgctgtcata gtggttcgat    138540
     ccttgtcaat gtcggggcag ccaaccctgg acatggagaa agtaaagacc gctgttttat    138600
     tgcctcatca cgggactttg aagagtcttg ggaggacttg aatagtccct atagtgtgct    138660
     taccaaggcg ttactggatg ggttagatcc caagccttta ccaggacgtt ggatcgatac    138720
     tttttccctg gtggattatg tcaaccaagc actgaaagga gaactgcaaa cccccgtctg    138780
     taccaacttt ggggaagcca ttaatctcac ccggagctgg caagtccaag aagaatcaac    138840
     cagtgtaagt caagttgata gcggtatttg cccctacaaa ggattggagt tttttgactg    138900
     caatgatgaa gaccccaaat acttctatgg ccgggagcag ttggtgggtc agctcctcga    138960
     tcaggtgcga acctctaact ttctggcatt ggtaggggct tccgggaatg gtaaatcttc    139020
     agttctgcga gctgggttgc tgcaccaact gaagctgggg cgacgtattt cagggagtga    139080
     acagtggcga attcggattg ctcgaccgga tcgccaaccg atacagaatc tagccctggc    139140
     ctttgtcgaa gagggattgt ccgatggaga tagggcaatt gctttggata aggtggttgg    139200
     attattggat aaagggactg cgggattaca gcgattagtc caggcatctg ctgcacctcg    139260
     aacggttctg gtgattgacc aatttgaaga ggtctttacc cgctgcgaga acccagagga    139320
     acgagagcat ttctttgctt gtttgatggg agctttgtta gatgtagaca acaagctttg    139380
     cctgatcatc gccatgcggg cagactttat cgtcaaatgt atggagcagg aatatagtgg    139440
     cttggcccga ctgattgatc agcaaatggt cagtgtgttg ccaatgaaga ccaatgagtt    139500
     aagggctgcg atttgtagac cagcagaaca ggtggaccta caagttgaat ctgccctggt    139560
     cactgaaata ctaaacgata tcgaaggggc accgggtagt ctaccgttgt tgcaatacac    139620
     cctgaaagaa ctttggaatc agcgacagga caatcaacta accttcgcct cctatcaaat    139680
     tttaggcgga atccaaggca cgttggatca acgggcgacg gctatctata acagctttga    139740
     taaagcagaa cagcagacag ttcagcatat ttttcagcaa ttgactcagt tgggggaagg    139800
     cacggaagat actcggcggc gagtatttca ggatgacttg ataacggagc caaagcatcc    139860
     agctcagcga gtacagcagg tcattgaacg actatctagc cccgagaatc gcctgatcgt    139920
     caccagtgaa gtggtcagca aatccgacca atccacccgc atgtcgattg tggatgtggc    139980
     tcatgaagcc ctgatccgtc actggaagct acttcggcaa tggattgagc tgaatcgaga    140040
     cttactgagg aagcaacgca ggattgaggc tagtgcgatc tcatggcgaa atcaggggca    140100
     aaagtctggg tatctattgc agggactacc actgattgaa gccattcaat ttaacaagga    140160
     taagtctgtg acttttccct tgtcagacaa tagcaaagct tttatccaga aaagtgtcag    140220
     agaacgccga ttgaatcagc ttaaggctgg agcatggttg attgtcccag cattactgat    140280
     tctcatcgtt agcgagtata ttattcgaga aagtggtgtc agtagaaact acgttcaatt    140340
     ggacggggca agatccactg gagagaaaca agcagttgat agcttagtgg gaggatgcaa    140400
     tgctcaaaaa gaggtacagt ggctaccaag ttatttagca gaacgtttat ttgggaattg    140460
     tcgccctctg atacaagctc agttggagca tgccaaactc cgccatgctg acctccgcag    140520
     cgccattcta attcgtgcca accttttcgc ggctgacctc aactttaccg actttagcga    140580
     tgccgacctt cgctacgctg atctccgccg aaccgacctc aacttcactg attttaacca    140640
     cgccaatctc aatttcacca agttgggtaa tgccaacctc aacggtacga acctcagtga    140700
     tgccaacctc atcggcacca acctatacag cgctgatcta cgcaacgcca ttctcattcg    140760
     cgccaaccta ttcagtacca atcttagtaa cgtcaatctc tatagcgctg acctaagtag    140820
     taccgacatg agcagtgcca acttaagtaa cgccgatctt atccgagcta acctcagtgg    140880
     tgctgacctc cacaataccg atcttttcta cgccaacctt agtaacgcca accttagtaa    140940
     cgccaacctc agcaatgcta tattattgag ttcaaatctt cgagagacaa aaaatctcac    141000
     ccaagctcag ctagagggcg cggaacatcc attgatttgt aattcacctc ttccccagaa    141060
     catcaggatt gaccgcaaca gagactgtga caaggtagct gctgtcttac acgaaagata    141120
     tccacagttg ttcagagata tagaagaagc agaaaaacac gttgaagaac aacgacaaag    141180
     taagtggaac tagtcaatca aaacaccaac ttcgcaatcg ccccctcaac ctgctcatcg    141240
     gtgacctcaa gataccccga caatgcggcc agcgtccgat gtcccaatat tcgctgaatg    141300
     tgcttcgtcg gcactccagc gttgtgcatc cgtgtcaggg ccgtgcgtct gaaactatga    141360
     ttactaaagc cttccagtcc cacccgagca aaagcttgtc tcaagattcg gtctgctgaa    141420
     ctgacccgga tataagaacg gccatgacga ccagggaaaa gataagtgcg agtcaagtca    141480
     gggcataagc cactaaatac tcatgcaact ggggatgcat cgttacttct cgcgtatccc    141540
     gcttaccctt cgtctgatgc cagcgaaata acaccgatgg cttgggtcca ctgacattga    141600
     ccacatcact ggtgagtaat atacaggctt caccgatcct gaatccggta tagaggcaca    141660
     caccaaagag ggccagatcg cgggacttga tttcttataa aggtatagct agagaaaatt    141720
     tgatttctat ttattttaat tctgtcattg ttttagctat cccctgtcta ggatctaaat    141780
     tagccaaaga gatcatcaac tgcacctaga gtaatcaagg aacttttctg agcatctgtc    141840
     agcccagtgg ttcttgaaat attcgttttt tcatagggcc ttgaaggtct gaaggttcta    141900
     atgcattgcg ctgaatgcaa atcccatagc ttcaccgagc catcgtcact tgctgtggca    141960
     atagtttgcc cgtcagggct aaactcaacc gaaataacgc gagctgtatg gccttgaaaa    142020
     atctgtaggc actcacccgt ttccaaggac cataatcgtg ctgtttgatc ttggcttgca    142080
     cttgctagac actccccatc aggactgaag gccactgacc aaatgaactg tttatgaccc    142140
     ggtaactcac ggatgcattt tctcatttca actgaccaga gttgaatgga ttcgtaatca    142200
     ctcccactag caaggatttg accatcagga gaaaatgcca ccgaccgaac tctagtacca    142260
     acatcaataa ccaaagattc ttctgactcc aaataccata ggcgaacagt tagatcatca    142320
     ctgccactag ccatgatatg accactcgga ctaaacgcga gtccccaaat tcggtttgta    142380
     tgccctataa gctgtttcaa gcattcccca ctagctaccg acaagagtct gacaaaggaa    142440
     tcatcacatc ctgttgccag ccatttccca tcagggctaa acgccaaagg aaagactcga    142500
     ttaccatgct caatgctatg taaacaatga ccatcaggat atgaccaaac cttaaccacc    142560
     ccatcttggc aggctgatgc cagaatttga ccttggtgtg agaaagcaac accccacaac    142620
     caattttggt gccctcgaaa aacttggcgg ttatgaccag tatgaatatc ccacacctgc    142680
     aaggtcccat cttcatgtcc atttgctaga gtctgcccat ttggatgaaa ggacaccgac    142740
     caagttcgat tgatgtatcc ttgcagtgtt tgctgacaca caccagtgtc tactcgccat    142800
     agcttaacca tcgattcacc gccactactc actagaagct gactatccgg gctaaaggca    142860
     ataccccaga tcacactggc atgtgcttga attgtgcgaa agcactgata actggcaatc    142920
     ttccagatgc gaatcacacc ttggtgatcc gagctagcta accactttcc atcaggacta    142980
     aaagcagcat cccaaataat actttgatgc ccctgcaatt ttgccaaaca tgaccttgtc    143040
     ctaatcgacc aaaccatgac agcgttatcc caggctgcac tcgccagtaa atttccatct    143100
     ggactaaagg tcactgagtt gaccatattg ctatgcccag ttccagtcca cagacactga    143160
     ccggaccgaa tatcccagag cttaacagtg ccatcctcgc tccctgtggc gagggtctct    143220
     tcatgaggac taaagcaaat agacttcgga gaagcaccat gaacatcatt gatggttcta    143280
     agacatgcac cgctgtccag agaccacagt ttaagggtgt tgtcatcact aacggttgct    143340
     aaggtttgtc catctgggct aatgtcaagc gaccacacac gatcgcggtg tcctgacaac    143400
     actcgtagac attcgccgct ttcaacagac caaacccgca ctttggaatc atcactgcca    143460
     ctaaccagat attgagcgtc tggggtgaat gtcacacacc aaacccaatc cccagtccct    143520
     tgaaggattt tgaggggttg ataggaatgc atatcccaga tggtgatctg gccatcattc    143580
     ccccccgtga ccatactttg accatcagaa ctaaaagcaa cggaaaagaa ggccccaaaa    143640
     gattgagtaa aggtacagtt tcggaagtct gatccagtaa ggtcaatttg gtgaagagtc    143700
     atgccttgaa aatcagcttg tcgaaatgtg agctgagata agttacaccc acttaggtct    143760
     gcttgcagcc aacgaaggag gtgcaggcaa ttgcttgcag catagccctg ggaaaattga    143820
     ggatgttccc tgaaatattg aaagaactgt aaaaggggac gttgatcggc agcaaagagt    143880
     tgagcaatcg gctccagaat taatcgggct tgtgtctttc tcagatagtc tttggctacg    143940
     ggcttacaaa gtgcaaagcg gttaaagata tctaatgcat tagtttccaa ttcttggata    144000
     acttgtcgaa tgatgcggtc agttaaatac tcaatcagta ctggttgaag cgtaaagcca    144060
     actgaactct tctcaagggg aagtcttcgt tttaaattct gtagggttga gggcaagtcc    144120
     cacttatcac cgacacgaag cagatcggtc ctgagtgtag aaatagaaac aggctcccga    144180
     tgtaaggcta accaatagac aacctcttgt tctttccagg ataatcgctc aaagtgccaa    144240
     tctaagagct gttttagatc gtcaaatata ggtcggcctt ctcgaaggaa ggctgaaatg    144300
     ctgccattga aaacctcatt gatatgattt gcagccagtt caagagcaag ggggttgcca    144360
     tcgtaaaagg atagcaagtg ctcccaatct ttatcagtag cagtaaattc tcccagttgt    144420
     gttaaaagtt gatgcgcttc ttcaaccgaa agcccttgca actcaaggca ctgaatatgg    144480
     tttccacctc ctgtgacagg acgaatatcc cgtggctttt cacgactggt gagtaaaagg    144540
     cagctttggt ggtttacatc tctaatcttt tggacaagtt gtccgtagcc ttcaaagcct    144600
     tgacgatagt tccctgcctg ctcaccaccc tgaagaatag attcaaaatt atccagtatt    144660
     aaaagacagc gacgtgattg aaggtagtag agcaaccgtg atatttgctt atcttcagat    144720
     ccaggtagtt cagtttcctg ctgatgggac aagaatttaa ccacctcggt tagataatcc    144780
     ctcagtggtg gagcgttgag cagtttcccc caaaaaacaa agtcaaaatc ctcttgaatc    144840
     ccatttgcca atttgagaga aagatcggtt ttgccgacac ccccatgccc tagcttgaca    144900
     gataaatgtg tttttccaga acctcggatc cctactatag ctacgaggcg acagtgatca    144960
     tctactatcc atcgctgaag cattgagagt tcgcgagtac gaccgaaaaa aatagagaca    145020
     tcgggtgcat caccccagtt gcaacgaaac tctccgcatc tggcatgttt aatcctagtt    145080
     tgagtttcgg acaggggctc caacaggttc aattgatcat aaggttgacc cagcaataat    145140
     ctacagagtc catcgaccag ccaatacttg taactactgt atttgctatt caagaagtta    145200
     tgtatggtct gatctgaggg tactttttcg ctaatggttt gttcccaatc gtgcaggaac    145260
     ttcgatattt gtaggcggct atattcagac tttctatatt tttcgtaaaa agctgtaata    145320
     attttttgct ttagctgagg cgaaatttca gttgagaaat taactctgct catttggaat    145380
     aggccgaggg ataagttttt agtaccacta ttgaatacat aatttagttt acattgggtt    145440
     gttattggtt tgaaattggc atccacttgg catccacttg gcatccactt ggcatcaatt    145500
     ccatttcaga atacaaaaag ctattgataa aatttaaatc acgattttct cacttacaat    145560
     tgagatatga ttatgactac aagagtaagt aacttattaa attactcaaa gctaagaact    145620
     tattagtagc ttcttctaag gatgaatcca ttaatctcaa tattgcttga ttccattcct    145680
     gcttcaagag gtatctatgt tgtcgaagta cataatctct accaagcaat tactacttaa    145740
     agcaaataag tagttacgct tttctctata tattggataa gacaatttca cagtagatac    145800
     atgaatagtc atacttaaag gataaaattc cttattcccg ttaatattta ataattaaag    145860
     caccatcttc tgcattgata acaacccttt tgatactacc tcttacaatc atttcttaag    145920
     atttaacact ctaaattatt ggaataaatc atgccaaatt caactatttt ccaagagatc    145980
     agaatcggtc tttcattcga gaatctaagt ccaagtagtt tcaattcaga ttttcttaaa    146040
     attagtgaca tcaccgctag ccaagttata tgtggagcgc gaagtataga cattaaagct    146100
     atatatagaa accactttag cgaatttatt ttaatatcgt cgaatttgcc ttttttagtc    146160
     tcaataattc aataatgtag atttgctaat aataaaaatt ccttgaaata ctatctaggt    146220
     ttagtcttaa gtgagctaaa aaaacagagt ctctagtagg tatagctttg aggtatactg    146280
     cgtgatctgt tctaacgttg atatgattcg caaattttct cattcaatat ttatagcttt    146340
     gaaaactata gaagaaaaaa accttagcat tggaatacct tttatgacag tgcattcaat    146400
     gaataggaat acatacagct atttgaaact atcaagaaac aaagttgaaa tttaaatatc    146460
     atctcttacc aataaaatag tggttcgacg aatttatagc attactagac agtggaagaa    146520
     aatgctaaac ataaaaaata aaggtatttc ccttaatgga gcatgtaagc tttcctggat    146580
     aatattcttt ttcttactta catcttgctc atatagcgac aaaaataata ttcaaatcac    146640
     agatgaagtc ttagatgtac atataaatta tgcaaagtca tatatcactg tccaaagata    146700
     taggtatcca ggaataccct ggcctgaaaa aacggataat acagatatat atataacaat    146760
     gttaaatgga tttatacaga aatatgtatc tgcatttaat gcttctaatt ctaccttaaa    146820
     cttctcggtt gaccaaaact ttactctagt aattggacaa gtaatctatg caggaaattg    146880
     gtctaataaa aatgggaaaa taagttttaa tggaaaattg gataaattag gtaataatag    146940
     tatacctaaa accagtggtt gcaatgattc acaaacaata gaaggtgaaa aaattaaaga    147000
     agacttagta attatatctt ttaaagaaaa tcatgaatgt gatagtacta gtaaagaagg    147060
     aagtagccta tataaatctt ctgtatcata caaaatcaga cttaaaagtt aattcactta    147120
     aactattgat tcctttattt tatctcaaga aataaaggcg aaaattgatc aagtcttgat    147180
     ccaagttttt ttaacttatt tattcaacag aaagcgatga tgaatttatc tagaagtaca    147240
     gcatctttat ttggatcttt tattgtaatt ttaattgatg ctagtattac tttgggaaat    147300
     gttcctagca ataggcaaac agtacatttt ataaagtctt caccaattgc cgattccagg    147360
     tttttattgg atgggtgtaa aatctctgta ctacgagata caagagatga ctgcaaaaaa    147420
     accaattcaa ccgaatcaca gacaactaac cccagcactg atagtaaaaa aggtcaaaaa    147480
     ccaagcaatg aaataaaaaa atcattgata atctctgatc actcattttt ttcatggaac    147540
     ttaccttttt ttacatggcc catcgcttca aaattagcaa cacatcctca catagactta    147600
     ataaaaacta gctctttaga atcaacagag ccaattagag actggtcaat gtacgatgaa    147660
     atagttgtaa tggtacatga aattattggt caacccaata agatatcttc tggtgatacc    147720
     ccacagagcc tcgctgccaa attgagaaaa agaagaatta ataagtatgc ttcaatagaa    147780
     cttgtcattt gcaatggagg gacagcccaa ttaggttcag ataaacaatc ttttgccagt    147840
     ttacttgctg cttatcttga caggccgatt attgcttata cccacccggt gagagttgaa    147900
     gcttcttatt gtttcaaagg atgtaataca tccagaatag tgagaagcaa tcggctagag    147960
     cataataaag aaggtactaa atatgaatat ttaattagtg ataaaccaat agatcgtcgt    148020
     ttatattatc ctaataaatc tagtagttct atatcaggta tacccaatat tatacttata    148080
     aataatctga agaaagctaa tcaaccatca gcacagccgc ttaaaattca acttcctcct    148140
     aggaatgatt agtactagac ctcttgctta attgaactgt tgatgtgtag aggactaaaa    148200
     attcaaatca aatttcggca taaattgagt tggataccta acaaaaatga atattgaaaa    148260
     aaggtcaagt tcattaaaag tgttagtaaa aatccagaaa tattttaggt tattaataac    148320
     aaaagaatag taaaaggaga gcaataatca ctattttaag gaattaggct aaccatttct    148380
     gacagatccc aaagagtatt tgaattcacg ctgagggaaa taccccattc ttaccgaatc    148440
     gatcttgttt cacaatttag aatctattct aggaggtctt ttgacacaaa gacctcctag    148500
     aggggtcaaa gcattggaaa ttcgtgaaat ggaggtcaag gggagtagag agatcgagct    148560
     tattgagaat ttattgagtt attgagaatg aggcgaaagt gattttagtg tacgtcaatg    148620
     gttctttcta taaactgggt cttggcagct cagacgacag tatgtttttc ttatctggat    148680
     tcaagaatca ctgttctgaa gctctgagag attaatatga gaaaccagta gctcgattca    148740
     ttttgagtca tggtttttgg caaaattgtt ctattcatct tccgtcaatt gagttaaatg    148800
     aatgtgcttt ctgccgacct tgatttcaaa ttcatcgcca gtttgtaaac ccatcttttc    148860
     ggtataggca gacccgataa ccatctgccc attctgatga actttgatcc gatagcttgc    148920
     ttctcgacct ctaccgtcgc tattggcatc accatctagt gaaatgccct tggcttccaa    148980
     aatggcattc ataaaaccac tcaggttaac tttcttgcca actacatagc cacactcttt    149040
     cgctttttcc cgtttcgaga ggtgagataa gtccttgagc ttattgagta gttctttccc    149100
     gactaagggt tgtttacctt gtttcttcgc agctgccttt tttgccatta atgctgtaca    149160
     tccctgactg aactgaattg caaaggactt agcctactac aacttccaac tttcctgagt    149220
     tctgacctta ttgtcaccta acaccttatt gacggcataa aaacaacgga agctgtgaaa    149280
     tagagctatt tagtgcatct gtattatagt cttacttcta tgccgcttta atgtagaaac    149340
     tgttgccctc ttacctcccc cagcaaccct gaaaacaccc catcacctct tcttgaagat    149400
     ccttccagtt atcgtcgtac cacatcaccg tttctggttt cacttggcat gagagctgcc    149460
     ccacaaaccc cgtggcgagt tgttgagggg gagagtaacg gtaaatatag ttaactttta    149520
     catcaatatt ttaagttggc ccagtctgtg caatggttaa gcatatatac gggtagggtc    149580
     tctatagcta tcgcatcaag tgtattcccc agactgaatc tttaacgcaa aatcacccat    149640
     actaacggcg tcttgccaga aatgcggtcg gttccaagcg tgttccccct ccgttttctc    149700
     cggaaccttc tgctgaattg agtctcagtt ccggctcgga tatcgggccg cttatccgca    149760
     attgttcttg tcgcaggtcc atgaagatgg ctggcggatt ggcctgggtt gacctgtagt    149820
     ggtttcgctc tacttgctta tctcttcatc aatgacctat gaaatttcag tttccaccgc    149880
     ttctgtcagt tgagaatagt caacgtctcg tcatcattga tcccacgatc gatgcaccgc    149940
     agcatttgat caatggcgtt ttaccgggga caagtgtcgt cgtgctggac ccccagcaaa    150000
     agagtgtccc ccaaattacc aaggcgttgc aggctcatgc gccgattgta gaactgcatt    150060
     tggtgagtca tggggcaccg ggacaggtgc agtggggcaa tgggccgctg acactagcaa    150120
     acttggggga atatgcggct gagctacagc agtggcggtc tctgctaggg gaagcagcag    150180
     cggtcttttt ttatgggtgt caggtggctg ctggggagct gggccaacaa tttgtgcaac    150240
     ggctgagtca actgctgggg acggggattg cggccaataa gagtgttaca ggcagtgctg    150300
     cgatgggggg aaattgggat ttgtcctatg agcagtcccc tgcatggtca tcccatcgtt    150360
     tatccactct gttgccattt acagctacaa cgctctacac ctaccctgcc catctcgctg    150420
     tggactttag cattcaatcc acctttgcgg cgggtactaa ccctgcctcc gtcagcctgg    150480
     gagactttaa tggcgatagc caacccgact tggtaacggc gaacatcttg atcaacaacg    150540
     tctcggttct cttaggggat ggctcaggcg gattctctag ccaaaccacc tttgcagcag    150600
     gtactttccc taactccgtc agtgtgggcg actttaatgg cgatagccta gctgacctgg    150660
     cggtggcaaa ccaaattagc aacaacgtct ccgtactctt gggggatggc tcaggcggat    150720
     tctctagcca aaccaccttt gcggcaggaa gtcgcccttt ctccgtcagc ataggcgact    150780
     ttaatggcga tagcctagcc gacctggcgg tggcaacccc cgctagcaac aacgtctcgg    150840
     ttctcttagg ggatggctca ggcggattct ctagccaaac cacctttgcg gtgggtatta    150900
     cccctttctc cgtcagcgta ggcgacttta atggcgatag ccaacctgac ttagtaacgg    150960
     caaacttcga tagcaacaac gtctcggttc tcttagggga tggctccagc ggattctcta    151020
     gccaaaccac ctttgcagcg ggtactaacc cttcatctgt cagtgtgggt gactttaatg    151080
     gcgatagcca agccgacttg gtgacggcaa acaacggtag caacaacgtc tcggttctct    151140
     taggggatgg ctcaggcgga ttctctagcc aaaccacatt tgcggtgggc actgaccctt    151200
     tctccgtcag cgtaggcgac tttaatggcg atagccaagc tgacctagta acgatgaact    151260
     tcgctagcaa taacgtctcc gtgctcttag ggaatggttc gggtggattc tctagccaaa    151320
     ccacctttgc agcgggtact aaccctgcct ccatcagcgt gggcgacttt aatggtgaca    151380
     gccaggccga cctggcggtg gcgaacagca gtagcaacaa tgtctctgtt cttcttaata    151440
     ccacacccat cgaccatgca attagcgtgg ataccccaca gattatcgag ggggatagcg    151500
     gtagtcaaac cctcaccttt actgttactc gctctagatt tatcggcagt gtcagcagtg    151560
     ttgactttac cattgccgga accgccatca acgggagcga ctttactaac atcggcggga    151620
     cgagtggggc aaccacaact tcaggcacta ttaacttcgc cgctggagaa accagtaaaa    151680
     ccatcaccct tgatgtcttg ggtgatacca actttgagcc tcaagaaacg attgccatta    151740
     ccctgagcaa tgccacagcg gctgtcaaca ccacgattag cactgccacc gccaccagta    151800
     ctattctcaa cgatgaactc tttgcagact ttagtgttca atccactttt gcagcaggaa    151860
     ttcgccctag ctccgtcagc gtgggtgact ttaatggcga tagcctagct gacctggcgg    151920
     tggcgaacga cggtagcaac aacgtctccg ttttcttagg ggatggctcg ggtggattct    151980
     ctagccaaac cacatttgca gcaggaagtc gtcctttctc cgtcagcgtg ggcgatttta    152040
     atggcgatag ccaagctgac ctggtgacag cgaacttaat tagcagcaac gtctccgttc    152100
     ttttagggaa tggctcgggt ggattttcca gccaaaccac ttttgcagtg ggtactaacc    152160
     ctcgctccgt cagcgtgggc gattttaatg gcgatagcca agctgacctg gcggtggcga    152220
     acatcggtag caccaacgtc tcggttctct taggggatgg ctcgggtgga ttttctagcc    152280
     aaaccacctt tgcgactgaa aatagtccta tctccgtcag cgtggacgac tttaatggcg    152340
     atagccaagc tgacctggcg gtggcgaaca atagtagtaa caacatctcg gtccttttag    152400
     gggatggctc aggcggattt tctagccaaa ccacttttgc ggtgggtact aaccctcgct    152460
     ccgtcagcgt gggtgacttt aatggcgata gccaagccga cctggcggtg gtgaacggca    152520
     gtaacaacat ctcggttctc ttaggggatg gctcgggtgg attttctagc caaaccactt    152580
     ttgcggtggg tactaaccct cgctccgtca gcgtggacga ctttaatggc gatagccaag    152640
     ccgacctggc ggtggtgaac ttcgttagca acaacatctc ggttctctta ggggatggct    152700
     caggcggatt ttctagccaa accacctttg cgactgggat tgatcctatc tccgtcagcg    152760
     tgggcgattt taatggcgat ggccaagccg aaattgcagt ggcgaactac agtagcaaca    152820
     acgtctccat cctcagctca aatactaccc tggtggcctt ggatagctcc cgcaacctgg    152880
     tgatcactga tcgctccaac gccaaagacg acaatcttac cctcaccacg gatggcacca    152940
     atttcaccct tactgacccc aacaatcttc tcacccatgt catttctggg gccacgggta    153000
     acgccacaaa caacattaca gttcctacaa ctttagtcac aggtcctcaa cttttcatca    153060
     atacgggcgg aggcaacgat atcgtctccg gcagcagcca atcagaaacc atcaatgggg    153120
     ggttgggagc tgatctcctc aatggcggag ctggtgatga tgtcctcacc gatggagcca    153180
     gtaatggcac tgtcaatccc aatgccgccg ctgttgaccc ctcccgggta gcgaccaccg    153240
     cctttacctc aacgagtggc tggtccaatg acaccctatt tccccgtcaa atcgccgatg    153300
     tcaatggcga taatcgggcc gatatcattg gctttggcaa tagctccgtc gctgtggctt    153360
     tgggacaagc cgatggtact tttggcaccg cctttaccgc taccacggcc tttgctcgca    153420
     ccacaggctg gacgaatgaa gaccagtttg ctcgacgctt agcggatgtc aacaacgatg    153480
     gatttgcgga tatcattggc tttggcaata gctccgtcgc ggtggctttg ggacaagccg    153540
     atggcacctt tggcaccgcc tttaccgcta ccacagcctt tactcgcacc acaggctgga    153600
     cgaatgaaga ccagttcgct cgacgcttag cggatgtcaa caacgatgga tttgcggata    153660
     tcattggctt tggcaatagc tccgtcgcgg tggctttggg acaagccgat ggcacctttg    153720
     gcaccgcctt taccgctacc acagccttta ctcgcaccag tggttggacc agtgaagacc    153780
     tcttttctcg tcatgtggcc gatgtaaatg gcgatggtcg agccgatatt attggctttg    153840
     gcaatagctc cgtcgcggtg gctttgggac aagccgatgg tacctttggc accgccttta    153900
     ccgctaccac ggcctttgct cgcaccagtg gttggaccag tgaagacctc tatcctcgac    153960
     aagtagccga tataaacggc gatggtcaag ccgatattat tggttttggt cgtagtgctg    154020
     tggcggtggc cttgggacaa gccgatggca ccttttggac agccacggtg gtcaatcaag    154080
     gctcaacagc caatcccgat tttacggtgg cgggtggctt taacagtgca aatgccaatc    154140
     ctcgctttgt ggcggatgtg gcagggaatg gtcaggccga tattattggc tttggcaata    154200
     accaagtcag agttgccaat gtggtagcgg tcaatgacag tctgcttggg ggggcaggga    154260
     atgaccgtct ggtcggagga gcgggcaatg atttactgac aggaggtgcg gatgcggata    154320
     ggtttgtgtt tgatgccaat gcggcggtga gtgggattaa ccggattaca gactttaatg    154380
     cagtggaggg ggatcgactg gagattaccc aagcggcctt tgggattacg aatctgagtg    154440
     agattacctt caatgcaaca acgggggagc tattcgtggc agggacttac aacaatacct    154500
     tggcgatttt cacgggtcag tcagggtttg atgtgaatac ccacatcacg ctggtgtaag    154560
     cctggggttt ggctgcgaaa agctgggatt cattccctga cttggtttaa agactggagg    154620
     gtttttgaaa tcctgtatag tcaatccttt gcactcctgc ctaaaaatac cagcttcgct    154680
     atcgccccct caacctgttc atcgttcacc tctaattgtc gcctatcagt gctgcaagcg    154740
     ttctatgccc cgatattcgc tgaatatgct tcgttggcac accagcgtta tgcatccgcg    154800
     tcagtgctgt gcgtctaaaa ctgtgagtac taaacccttc cagtcccacc ccagcaaaag    154860
     cttgcctcaa gattcggtct gctgaactca cacgtatata accctctttt atcactttag    154920
     acagagagaa aatcaggatg cttgagcaat ttcctcacca gtggacagca aaatgcctcc    154980
     atctttgatg tgagttgctc aaaccccttt ttcaaagcac ggctgggaaa gacttctaac    155040
     cagcgcttta gaagattcca actgattaac ggttgaatga tcaagcgcac attattgagc    155100
     agattcttcc                                                           155110
//