Dbfetch

ID   CP000843; SV 1; circular; genomic DNA; STD; PRO; 172728 BP.
XX
AC   CP000843;
XX
PR   Project:PRJNA12997;
XX
DT   29-OCT-2007 (Rel. 93, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Acaryochloris marina MBIC11017 plasmid pREB6, complete sequence.
XX
KW   .
XX
OS   Acaryochloris marina MBIC11017
OC   Bacteria; Cyanobacteria; Synechococcales; Acaryochloridaceae;
OC   Acaryochloris.
OG   Plasmid pREB6
XX
RN   [1]
RP   1-172728
RX   DOI; 10.1073/pnas.0709772105.
RX   PUBMED; 18252824.
RA   Swingley W.D., Chen M., Cheung P.C., Conrad A.L., Dejesa L.C., Hao J.,
RA   Honchak B.M., Karbach L.E., Kurdoglu A., Lahiri S., Mastrian S.D.,
RA   Miyashita H., Page L., Ramakrishna P., Satoh S., Sattley W.M., Shimada Y.,
RA   Taylor H.L., Tomo T., Tsuchiya T., Wang Z.T., Raymond J., Mimuro M.,
RA   Blankenship R.E., Touchman J.W.;
RT   "Niche adaptation and genome expansion in the chlorophyll d-producing
RT   cyanobacterium Acaryochloris marina";
RL   Proc. Natl. Acad. Sci. U.S.A. 105(6):2005-2010(2008).
XX
RN   [2]
RP   1-172728
RA   Touchman J.;
RT   ;
RL   Submitted (25-SEP-2007) to the INSDC.
RL   Translational Genomics Research Institute, 13208 E Shea Blvd, Scottsdale,
RL   AZ 85004, USA
XX
DR   MD5; e5651ce44dfb57b3337e1c156da12f61.
DR   BioSample; SAMN02604308.
DR   EnsemblGenomes-Gn; EBG00001236574.
DR   EnsemblGenomes-Tr; EBT00001581813.
DR   EuropePMC; PMC2538872; 18252824.
DR   RFAM; RF00174; Cobalamin.
DR   StrainInfo; 373281; 0.
DR   PubMed; 18252824.
XX
CC   Source bacteria from Marine Biotechnology Institute Culture
CC   Collection, Marine Biotechnology Institute, 3-75-1 Heita, Kamaishi,
CC   Iwate 026-0001, Japan.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..172728
FT                   /organism="Acaryochloris marina MBIC11017"
FT                   /plasmid="pREB6"
FT                   /strain="MBIC11017"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Acaryochloris marina"
FT                   /db_xref="taxon:329726"
FT   gene            3..311
FT                   /locus_tag="AM1_F0001"
FT   CDS             3..311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33180"
FT                   /db_xref="GOA:A8ZPY4"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPY4"
FT                   /protein_id="ABW33180.1"
FT                   /translation="MNVVENWNSANDFIFYGKNGDFASNQTAMQELSMLCLHLLQISLV
FT                   YINTLMIQKVLSEPTWMNRMQEEDLRALTPLFYLHINPYGRFRLNMNERLVIENLAA"
FT   gene            629..2290
FT                   /locus_tag="AM1_F0002"
FT   CDS             629..2290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0002"
FT                   /product="transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32993"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZMN7"
FT                   /protein_id="ABW32993.1"
FT                   /translation="MSMRPTDLLDIPSETIEVARAAFPDGNLYMQLRDELGIIYHDHDF
FT                   ADLFPKKGQPALSPWQLVLVCIMQFLENLSDRQAADAVRARIDWKYALSLPLRDSGFNY
FT                   SVLSEFRKRLIAGDKEQQLFDSFLEHLQAKGFLKEHHQQRTDATHILASIRTLNRLELF
FT                   GETFRAALNSLVVADPQWLSEHMHDDWFDRYGRRIENYRLPKPDSERKALGSTIGQDGL
FT                   TLLDAIYAPSSPPWLKHLPAVETLRQVWLQRFYPPNADGTVEWRKVKDMPPSDSSIHSP
FT                   YDVEARYSNKRSMDWVGYKVHLTEVCDPESPRLITHVHTTSATVPDDQVVEPIHLALAK
FT                   KQLLPKEHLLDGGYLSAEHLVNSKAEYDMDVIGPVRQNHSWQAKAGNGFDSSFFLISWD
FT                   QQKVVCPQGHFSTKWLPGKDIHGKDVIQARFQGTTCRSCPVRSQCTKSKTQPRELTFRP
FT                   RELHQALNERRQVQRTTEFKEKYSLRAGVESTHSQGIRRFGMRQSRYIGLAKSHLQNVF
FT                   CAIALNFVRLDAWFNDVPLAKTRVSLFKRILQPLPA"
FT   gene            complement(2785..3534)
FT                   /locus_tag="AM1_F0003"
FT   CDS             complement(2785..3534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0003"
FT                   /product="transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33179"
FT                   /db_xref="GOA:A8ZPY6"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPY6"
FT                   /protein_id="ABW33179.1"
FT                   /translation="MVKGVLRHCTQMSVNKSYVDTHGQSEVGFAFCYLLNFQLMPRFKG
FT                   INKQKLYLPMSGQKKKYFHLKAILKRPIRWDLVREQYEPMIQFTTAMKQGTAEPEAILS
FT                   RFTRNNIKHPTYLALAELGRAIKTIFLCQYLHDEALRQEINEGLNVVENWNSANDFIFY
FT                   GKNGDFASNQTAMQELSMLCLHLLQISLXYINTLMIQKVLSEPTWMNRMQEEDLRALTP
FT                   LFYLHINPYGRFRLNMNERLVIENLAA"
FT   gene            complement(3698..5428)
FT                   /locus_tag="AM1_F0004"
FT   CDS             complement(3698..5428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0004"
FT                   /product="RNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33178"
FT                   /db_xref="GOA:A8ZKQ7"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKQ7"
FT                   /protein_id="ABW33178.1"
FT                   /translation="MSKARVKPMMEWSAIPWPKLERKVFKLQKRIFRARQRGDVKVVHR
FT                   LQKTLMRSWSAKCLSVRRVTQDNQGKKTAGVDGVKSLSPEARLPLVGQLKLGSKAPPTR
FT                   RVWIPKPGKDEQRPLGIPTLYERARMTLVKLALEPEWEAVFEPNSYGSRPGRSCHDAIE
FT                   QIFAAIKQKAKYVLDADIAQCFDRINHEALLKKLKTFPTLRRQIKTWLKAGVIDGHQFL
FT                   QTSEGAPQGGTISPLLANVALHGLEYRIKQAFPIRKIADGNKRKRIATPDVIRYCDDFV
FT                   ILHEDLSVVQRCQSLVHEWLKDMGLELKPSKTHISHTLKRYEAENPGFDFLGFSVRQFP
FT                   VGQHQSGRLCGTLLGFKTIITPSRKKQKVHYNRLVSIINAHKAAPQAALIRHLNPVIRG
FT                   WTRYYSTMASKETFSRLDHLLYQKLQTWANHRHPGKSRKWVVNKYWQTVGGDKWVFATR
FT                   VTKSRTEKLLKHRQTPIIRHVKVKGDASPYNGNLVYWSSRTGKHPEAPKRVSMLLKKQK
FT                   GKCAQCGMFFREEDLLEVDHILPTSMGGLDVYKNLQLLHRHCHYVKTAKEKSSQAKWYV
FT                   "
FT   gene            complement(6040..8187)
FT                   /locus_tag="AM1_F0005"
FT   CDS             complement(6040..8187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0005"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33177"
FT                   /db_xref="GOA:A8ZPY8"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPY8"
FT                   /protein_id="ABW33177.1"
FT                   /translation="MKRKWHPEELLEHWSIQPDEEHLLAKRQGANCLGFVLLLKFFRYE
FT                   GRFPEQKYEIPHMALTFVADQLALLPELFKSYDWHGRNSYYHRAQIRKFTGFRQATVAD
FT                   QNQLRTWLVDTVLSQEQDYHHLKLKVYAQLRTLQIEPPTPARIERLIRSAQRLFENQLF
FT                   SSTLQQLSKQTQTELDELIQEPKVTPGKEIPDPPLSALKKDPGPVGLNSLLSEIIKLQR
FT                   LRQVALPDTLFSHLTPRVLECYRLRVETETLSELRHHPKVIRLTLLASFCWQRCQEIID
FT                   NIMDLLIQIVHRIDTRSKNKVTSEVIAKVKKTDSHTQLFYQVATAALATPDGLVRDVIY
FT                   PVASEQTLEAFVDSYNDGGQTYRQLLHSRIRSSYGHHYRQMLPAVLEVIDFRCNNKQYQ
FT                   PILQAVDLLKAYVDTPRKPYASADDVPIEGVVSADWQETVLGQDEDQPDKVDRIAYEMC
FT                   VLRALREKLRCKEIWVAGANRYRNPDLDLPQDFDERREEYYQDLQQPLEVETFITQIQT
FT                   DMENALTLLNQGMPHNSKVEILSKRGGRIKVSPLEAQPEPMNIQKLKEEINHRWSLTHL
FT                   LDVLKEADFRIDFTQHFKSAASREILSPQSLRKRLLLCIYGLGTNLGIKRIAHSEADAG
FT                   YFELHYVRRKFLSKIALSCAITDVANAIFRIRLSHIWGEATTACASDSRHFESWDQNLM
FT                   TEWHVRYGGRGVMIYWVRFVG"
FT   gene            8505..10166
FT                   /locus_tag="AM1_F0006"
FT   CDS             8505..10166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0006"
FT                   /product="transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33176"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZMN7"
FT                   /protein_id="ABW33176.1"
FT                   /translation="MSMRPTDLLDIPSETIEVARAAFPDGNLYMQLRDELGIIYHDHDF
FT                   ADLFPKKGQPALSPWQLVLVCIMQFLENLSDRQAADAVRARIDWKYALSLPLRDSGFNY
FT                   SVLSEFRKRLIAGDKEQQLFDSFLEHLQAKGFLKEHHQQRTDATHILASIRTLNRLELF
FT                   GETFRAALNSLVVADPQWLSEHMHDDWFDRYGRRIENYRLPKPDSERKALGSTIGQDGL
FT                   TLLDAIYAPSSPPWLKHLPAVETLRQVWLQRFYPPNADGTVEWRKVKDMPPSDSSIHSP
FT                   YDVEARYSNKRSMDWVGYKVHLTEVCDPESPRLITHVHTTSATVPDDQVVEPIHLALAK
FT                   KQLLPKEHLLDGGYLSAEHLVNSKAEYDMDVIGPVRQNHSWQAKAGNGFDSSFFLISWD
FT                   QQKVVCPQGHFSTKWLPGKDIHGKDVIQARFQGTTCRSCPVRSQCTKSKTQPRELTFRP
FT                   RELHQALNERRQVQRTTEFKEKYSLRAGVESTHSQGIRRFGMRQSRYIGLAKSHLQNVF
FT                   CAIALNFVRLDAWFNDVPLAKTRVSLFKRILQPLPA"
FT   gene            10123..10650
FT                   /locus_tag="AM1_F0007"
FT   CDS             10123..10650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33175"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPZ0"
FT                   /protein_id="ABW33175.1"
FT                   /translation="MYLFSRGYFSHYQRDFLEFANSVNPSITPFKKYHVGPQVGESDAA
FT                   VELFSDETREADDRALLLKVRDMVRGAADIAKFTQIVEQMRDATERKIEGNPVTAVEVL
FT                   GDKLNVNQEERSGILTHLIQGGDLTAYGMMNAVTRTSQDVESYDRATELEAMGSQVLSL
FT                   PKATWREIAVAR"
FT   gene            complement(10713..10979)
FT                   /locus_tag="AM1_F0008"
FT   CDS             complement(10713..10979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0008"
FT                   /product="plasmid stability protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33174"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035095"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPZ1"
FT                   /protein_id="ABW33174.1"
FT                   /translation="MSYSVFLAPAAERQLKKLPNKVKAQIVPILKTLTDDPHPSGSAKL
FT                   KGAEDLWKIRKGAYRVIYQIQDKKLTILVVNIAHRRDVYKDKS"
FT   gene            complement(10987..11370)
FT                   /locus_tag="AM1_F0009"
FT   CDS             complement(10987..11370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33173"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPZ2"
FT                   /protein_id="ABW33173.1"
FT                   /translation="MLLIWNTLSSKIVGTKRKINPKSLQNLRPGKSPGRTTLHESTKSR
FT                   HGVSLTDEGWSGVQEAAKKYGYSVSEFLEQIGRGNLAILELEAIEAFQDALDLAEAQTA
FT                   IAEARLVGVRPLEDVLSEIGLED"
FT   gene            11631..11813
FT                   /locus_tag="AM1_F0010"
FT   CDS             11631..11813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33172"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPZ3"
FT                   /protein_id="ABW33172.1"
FT                   /translation="MSDILTQAWQPRTDAEMSQPWTTPKKWLSVPTQDGYQHQPYDSGD
FT                   SRHFVPDTHPEDTWN"
FT   gene            11880..12224
FT                   /locus_tag="AM1_F0011"
FT   CDS             11880..12224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33171"
FT                   /db_xref="InterPro:IPR022243"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPZ4"
FT                   /protein_id="ABW33171.1"
FT                   /translation="MTITEATQATTIAQLNDRFRQGDHTLGQVYTTQLVQGLSSEEQQE
FT                   LFRLVRTFDDFNLSNDPRGEHNFGRIKFKGEVFNFKIDYYSPDLIHGSEDPEDLTITIR
FT                   VLTLMHSSEY"
FT   gene            complement(12473..13576)
FT                   /locus_tag="AM1_F0012"
FT   CDS             complement(12473..13576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0012"
FT                   /product="SCP-like Type I secretion target protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33170"
FT                   /db_xref="GOA:A8ZPZ5"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPZ5"
FT                   /protein_id="ABW33170.1"
FT                   /translation="MTILEQDRFDQQLLDLVNQERESRGLRPLQLSQNLDQAADQHSAR
FT                   MATGDFFAHRDPQTGTSAGDRIEAAGYTGWSTWGENIAAGQATPEAVLNAWMGSSGHRA
FT                   NILNPNFTHMGIGYDLLENDTGNQRYSHYWTQVFGAGGVTGTYVAQTDGNTTAGNPSNP
FT                   NTPPAPVNPPLTPPVEAPLVGTPGNDQLIGTDSNDNIFGRGGNDILRGQFGNDMLYGEA
FT                   GQDRLYGDAGADQLYGGLDNDTLWGGAGNDSLIGVDTNSPNSASQVDVLVGGQNADMFV
FT                   LGDASAVFYNDGIDNTYGTANYAYIYDFQSVQGDQIQLSGSSGDYRLQSYSSGHLLFLN
FT                   TPGADEVIAFIANTKSLSLTNSVFMFV"
FT   gene            13792..13941
FT                   /locus_tag="AM1_F0013"
FT   CDS             13792..13941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33169"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPZ6"
FT                   /protein_id="ABW33169.1"
FT                   /translation="MKIQAAKIEVWNGCSFQWIDFQMAQTQNSLGAVQAILDRTKLRFA
FT                   DSKA"
FT   gene            14310..14465
FT                   /locus_tag="AM1_F0014"
FT   CDS             14310..14465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33168"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPZ7"
FT                   /protein_id="ABW33168.1"
FT                   /translation="MKMYIANILVWNGREFMMLPFQQAQTQENLGVVIREYVAAMGLRL
FT                   VYWSKV"
FT   gene            14508..14849
FT                   /locus_tag="AM1_F0015"
FT   CDS             14508..14849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33167"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPZ8"
FT                   /protein_id="ABW33167.1"
FT                   /translation="MDVLILEILSIHLKVGDVLELALIDKKFATEQMIEIPIACKLVKK
FT                   DAIVVHFHHHELDLDFNTVDIHSKNDHRYLTIHSLEIVDPEKGYLVINEEDGAVRYQVA
FT                   WKKISTTYE"
FT   gene            14917..15132
FT                   /locus_tag="AM1_F0016"
FT   CDS             14917..15132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33166"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPZ9"
FT                   /protein_id="ABW33166.1"
FT                   /translation="MQPPGIPHQGAFFMMPRGNPIKMYVAKIEVWNGRSFQLIDFQQAQ
FT                   TQESLRLVIRECVAAMGLKLIYWYES"
FT   gene            15154..15678
FT                   /locus_tag="AM1_F0017"
FT   CDS             15154..15678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0017"
FT                   /product="hydrolase, HAD-superfamily, subfamily IIIA,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33165"
FT                   /db_xref="GOA:A8ZQ00"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ00"
FT                   /protein_id="ABW33165.1"
FT                   /translation="MDILSKTMKLIILDKDGTLTTPKSGKNFVQKPEDQILLPGVLDAV
FT                   RWHTLQGHMLIIASNQGGVSAGYKTIAEVILEMKYCLHLLRGIQSAYFCPDFEGNQCWH
FT                   VERQSSSQVEVLRFRGRMRKPGDGMIQQALLDHPCVSEILFIGDRPEDEQAAQAAGVDF
FT                   QDAESWRQPRE"
FT   gene            15848..16381
FT                   /locus_tag="AM1_F0018"
FT   CDS             15848..16381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33164"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ01"
FT                   /protein_id="ABW33164.1"
FT                   /translation="MTVSVPPPTLTSNSQIPSHQTYVRPLGFGESPSGLAIFCNRANTN
FT                   TWYTLSQDSQPVELPYPALTGYLTSIEFIKGEYKRKPTCKLRFRMIAHRPCTLEAGSES
FT                   TFTKGFLSAIASLSPEQLRSPITIEAIPADEETVLFCSVWSGGQKVRTQWDDQTNWREV
FT                   ARRAKDNVAQLQSS"
FT   gene            16356..16589
FT                   /locus_tag="AM1_F0019"
FT   CDS             16356..16589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33163"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ02"
FT                   /protein_id="ABW33163.1"
FT                   /translation="MWLNFRVADESNLDWQALKTLTEYCREDIKGFFEDEGFQIYPGRL
FT                   HPYQALFLSNFFVQLVGTRGVLCLLLAGPVSL"
FT   gene            17129..17338
FT                   /locus_tag="AM1_F0020"
FT   CDS             17129..17338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33162"
FT                   /db_xref="InterPro:IPR025475"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ03"
FT                   /protein_id="ABW33162.1"
FT                   /translation="MAITVINLRYNRNVKGYRCDRASVLGNPFHMFQESERLAVVAAFR
FT                   EYLHEVANLGANPVDVVLLLAEKY"
FT   gene            17307..17513
FT                   /locus_tag="AM1_F0021"
FT   CDS             17307..17513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33161"
FT                   /db_xref="InterPro:IPR025475"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ04"
FT                   /protein_id="ABW33161.1"
FT                   /translation="MWSFFWLKSTNVTVSGMWKHPSRTQVMAELVKLEAMPDMKLLCWC
FT                   VPLACHGDVVKSYLEWKHEEACR"
FT   gene            17890..18051
FT                   /locus_tag="AM1_F0022"
FT   CDS             17890..18051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33160"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ05"
FT                   /protein_id="ABW33160.1"
FT                   /translation="MIHKSSGRPCCRWLCKDCGKSRGIYPTPKFLMNLREMDEGGETEV
FT                   GLKVLAQV"
FT   gene            18048..18533
FT                   /locus_tag="AM1_F0023"
FT   CDS             18048..18533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33159"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ06"
FT                   /protein_id="ABW33159.1"
FT                   /translation="MIGEKVMAIYSASYFEPHNHHGALVSISRSHPRSFQVDDRLPFLA
FT                   PSRQLLDDWKHRQLTEAGYTDRYRQELQQSWSQVNSWLASVTPEGDCTLLCWEKAGEFC
FT                   HRNLAMKVIRKHRPDCYGGRDISADPGLRCSKCQTVIIPGLDQSFCPCCGEWLATPI"
FT   gene            18973..19092
FT                   /locus_tag="AM1_F0025"
FT   CDS             18973..19092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33157"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ07"
FT                   /protein_id="ABW33157.1"
FT                   /translation="MRSLCKLNISQAKLPLKAGANELTELQILFLRQMALNDF"
FT   gene            complement(19057..19413)
FT                   /locus_tag="AM1_F0024"
FT   CDS             complement(19057..19413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0024"
FT                   /product="two-component response regulator (CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33158"
FT                   /db_xref="GOA:A8ZQ08"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ08"
FT                   /protein_id="ABW33158.1"
FT                   /translation="MKRILLVEDEKRVASFIEKGLLKHGYCPTLVTDGEQALNQIYHES
FT                   YDLVLLDLGLPIISGRAVLQTLRQQGFTLPIIVLTAYSEKKNLALGLGADGFIDKPFRF
FT                   SELLEVIQSHLPQE"
FT   gene            19557..19718
FT                   /locus_tag="AM1_F0026"
FT   CDS             19557..19718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33156"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ09"
FT                   /protein_id="ABW33156.1"
FT                   /translation="MAYEYHRNPDEFLICEGFWVAAPGFIQNKVHRPNYFEQTWQEATG
FT                   KVKQLSLV"
FT   gene            20110..20337
FT                   /locus_tag="AM1_F0027"
FT   CDS             20110..20337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33155"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ10"
FT                   /protein_id="ABW33155.1"
FT                   /translation="MELFNSRAKWMEDYTDHLQTIIVVRSCVKFRTNINGSDSVTCAWF
FT                   VWQKNWSWKKLGVDCPFQIFTKLEELNDGK"
FT   gene            20327..21097
FT                   /locus_tag="AM1_F0028"
FT   CDS             20327..21097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0028"
FT                   /product="phage protein Gp37/Gp68, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33154"
FT                   /db_xref="InterPro:IPR011101"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ11"
FT                   /protein_id="ABW33154.1"
FT                   /translation="MENSEIEWTNHTFNPWIGFSHYSPGYVNCYAETQMDKRYDRVKWG
FT                   VVGTRTRTSESYWKLPYKWNRKAAERGGTETVFCGSLADVFEDRDDLIDWRLDLFDTVI
FT                   DKTPNLTWLLLTKRIDMAVLFLTWVRVPPNVWLGHSICTQRESDVVIPKLAKLQHKVGG
FT                   IFLSCEPLLEPLDLGALPVNWVIIGGGSGPSARPCDVAWVRSIRDQCKSVDVPVLIKQL
FT                   GSNPVGVPKLRSAKGGDILEWPKDLRVWEFPEFG"
FT   gene            21052..21168
FT                   /locus_tag="AM1_F0029"
FT   CDS             21052..21168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33153"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ12"
FT                   /protein_id="ABW33153.1"
FT                   /translation="MAQGSSSVGIPGVWLMEVSVDEERVHSGLASWHHGSSW"
FT   gene            21209..21517
FT                   /locus_tag="AM1_F0030"
FT   CDS             21209..21517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33152"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ13"
FT                   /protein_id="ABW33152.1"
FT                   /translation="MIRKFKTSNFYQENYIGYMEDGSFDEVLICTYICPGGTSLYQEDV
FT                   WQQNSDINFEIFYLSEPAHAYLYIGCAHWFIPVAFAERLFSVFQTGKANACPGWTAD"
FT   gene            complement(22141..22287)
FT                   /locus_tag="AM1_F0031"
FT   CDS             complement(22141..22287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33151"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ14"
FT                   /protein_id="ABW33151.1"
FT                   /translation="MTPSAVSRGCADLASGLYPHCERRPEFWLSDKVEQSDLLTMGMGL
FT                   WIG"
FT   gene            22291..22761
FT                   /locus_tag="AM1_F0033"
FT   CDS             22291..22761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33149"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ15"
FT                   /protein_id="ABW33149.1"
FT                   /translation="MPTYDFEQQFEIGTHHEQTLDEYFQQYFWIESTSRQEQRQGIDRW
FT                   FQAPDGSWMSVEYKADKTAGRTGNAFIETISVDVRAVQGWAYSSEADVLAYYVPPRHTV
FT                   WLICFVELRQYLAEWHQRYPIRQIPNHGYCTEGLLVPLVLLSNIAFEVCHVT"
FT   gene            complement(22720..22866)
FT                   /locus_tag="AM1_F0032"
FT   CDS             complement(22720..22866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33150"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ16"
FT                   /protein_id="ABW33150.1"
FT                   /translation="MGVGQRLSCDEYLDAATALLGWKPAYDQPDPQKLVSRHMTNFKRN
FT                   IAQ"
FT   gene            23026..23667
FT                   /locus_tag="AM1_F0034"
FT   CDS             23026..23667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0034"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33148"
FT                   /db_xref="GOA:A8ZQ17"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ17"
FT                   /protein_id="ABW33148.1"
FT                   /translation="MAVLPGITTSSSVNGSQVLEKVYQGRQTYEFREGFNIPLHPHDVW
FT                   IVCRGVVQLNTFHGDGNEAILGLVYPDMPFGVPLTQVDPYEAIGLTNVVLMRVSQQEIE
FT                   RSLHLSQWMLVQLQKRLQQTEAFLALNSQRRVGDRLQQLLLLLTKDVGEVIPEGMRLKV
FT                   RFTHQQLAELVGTTRISVTRILGSFRKEGWLSIDGTRHFVIHESSVVDLQ"
FT   gene            23986..24666
FT                   /locus_tag="AM1_F0035"
FT   CDS             23986..24666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33147"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ18"
FT                   /protein_id="ABW33147.1"
FT                   /translation="MKLITSIKLQQADHTEVIDSAATQVGLAANKAFLFVVRKEIQGWK
FT                   NFTALCSWCLSKVSQKHGPIFEEVKERAVAVYRKGCQQETAFVQALIKSQITDRLDAHW
FT                   KLHDQAIDWFKDQTQAFLADSPVEDTSEVEVEDLSPDSSEDLEEIAPVDEGEEPSMTIL
FT                   DEAPVPVLGPPVDPDPLDDELTVPQDPTPVVASGGGKRRTRNKSKRTPLGAMMLSQAKT
FT                   GKPS"
FT   gene            24841..25569
FT                   /locus_tag="AM1_F0036"
FT   CDS             24841..25569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0036"
FT                   /product="Conserved CobQ/CobB/MinD/ParA domain"
FT                   /note="CobQ/CobB/MinD/ParA nucleotide binding domain
FT                   (PF01656)"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33146"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ19"
FT                   /protein_id="ABW33146.1"
FT                   /translation="MTVSRIAVAGRKGGVGKTTIACGIASILASMQQRVLVIDMDPQSN
FT                   AAYVLGVDPTKPGTASLLVGDHLEPLKVGDYLWVLPGGPELMNHNIQSCDQEELADAVF
FT                   GMDYDVVVFDCPPGNEHLERLAIKAADTVLIVSDAHPLALVGASRVIKELKLNSQKGRK
FT                   GASRWAIIQSKIDARRAMDRTFDSDLAESFPNLQRFVVRQDTQLSLAAADQIPLMTYDA
FT                   KCRGAQDLIVVAQWGLNGSA"
FT   gene            25556..26356
FT                   /locus_tag="AM1_F0037"
FT   CDS             25556..26356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0037"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33145"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ20"
FT                   /protein_id="ABW33145.1"
FT                   /translation="MAQRKTNTKRFQQALNVADDMSVIDQAISNDTNSNRYLKTAILLD
FT                   QIKLRSEDTRELNQDHVFALSESIEVLGLIEPLVVDTRNRLLAGGHRLSAIHFLRDNKQ
FT                   ERYDEQFPGSKIPVRVMPFDADQDPEKALQCEVAENEHRRDYTATEVRNLAERLKKAGY
FT                   SHGKGRPRKGKKALLPALEVIIGKHTRTIQRYLSDHQKENTTNVALTAETKKLKRIEKD
FT                   LLAWKNENMHCTANSKKALLLKRIPSMAKLINQVLTEIQTQDGN"
FT   gene            complement(26461..30681)
FT                   /locus_tag="AM1_F0038"
FT   CDS             complement(26461..30681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0038"
FT                   /product="helicase, SNF2 family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33144"
FT                   /db_xref="GOA:A8ZQ21"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ21"
FT                   /protein_id="ABW33144.1"
FT                   /translation="MSLSTNSPEKQEDLSAVRASLVNKYEQLSDLEREIIQAVSVIYTS
FT                   TSRTALLSCLATIGTLSPKQKKLTSSTIRPYIENLLNLEVLLMENTKLRVHPLIIEIAT
FT                   RDAVAKGKFKAMVEAVESIIPFKPGWNGKGLSFDDYQEFIRAFRMGFYQKDFEAIAEYC
FT                   QDYYAYGYRSDKIALDEVLDLVCNNPFDRYWFWTIPMELADLFLVNGLLTDSLMLFSAD
FT                   DKLEVLIEICEDVGGNYLSIVLAEQLILRGRIEEAKACLVDIPADYEHDALAIQGWLAC
FT                   LEGNFDAAIAAYVEALKALRKLTSKRKVYFESISGIFYLLTLLHEGSRASLSSAICYID
FT                   LILESEDHWLSQIYSLLKKVLLIQQGDLSYQNSVINTSVLPYQYGQSLQTLISALCVHW
FT                   VDPSSAKTALVEVLVPYCCQAYNSGYGWLASEAKALIQQLASEQPATKPKLPDLPTPQF
FT                   PLAKLVTAQEDWQLSLKALEQLNSEFLLNDGTGAISRLAWFVSIGSENVTLEPKEQKRN
FT                   AKGGWSKGRKIALSRLFNQPKSLGYLTTQDLKTCAEIEDQVSYYFGYHKTEYQFKEQAI
FT                   AQLVGHPAVFWAGLPSTRIDIIKGEPELLVKEKDQGKLTLELHPPIPRAKDILVTQETP
FT                   TRLKVIEINESHRRIAKILGKYNCLNVPKTAKEQVLSAISSISGLVTVQSDIGGGTENA
FT                   ELVAPHPIPHVHLFPAGDGLKAMIRVRPFRNCGSYFPPGSGGSTVITEIEGRRLQTNRD
FT                   LAEEEQLAQKTIHSCPTLSQYGDDNGEWQITEPEDCLELLYALQSLSDQVIVEWPEGEK
FT                   FRISHRADLDHFKLKISQQQDWFAIQGEVNVDNTLVLDLQKLLALLDETSGRFIKLEEG
FT                   QFLALTQSFRKRLAELQALSEPNGKGLRFHPLASVALEDLVEDIGNLQADKHWRDQKQR
FT                   LNQIKNFEPEIPSTLQVQLRDYQIEGFRWLAKLSHWGVGACLADDMGLGKTLQALAVIL
FT                   TRAPHGPTLIVAPTSVGMNWHKEAKRYAPTLTPLQFDNSNRQQLLEHLKPFDMLICSYG
FT                   LLQQAEVAEMLAQVRWQTIVLDEAQAIKNFSTKRSQAAMKLQGELKIITTGTPIENHLG
FT                   ELWNLFRFINPGLLGSLDSFNQRFAIPIERHQDKAARSCLKKLIQPFILRRTKSQVLEE
FT                   LPSRTEIVLQVDLSPEELAFYEALRQDALAKLNESDAASGPKHIQVLAELMRLRRACCN
FT                   PRLVLPETDLPSAKLQLFAEVLNELLDNKHKALVFSQFVDHLEIIRRYLDEQQIQYQYL
FT                   DGSTPAKNRHKRVDAFQAGEGEIFLISLKAGGTGLNLTAADYVIHMDPWWNPAVEDQAS
FT                   DRAHRIGQQRPVTIYRLVAKGTIEEKIVELHNQKRDLADSLLEGADMSGKVSTDELLRL
FT                   MQQN"
FT   gene            31038..31532
FT                   /locus_tag="AM1_F0039"
FT   CDS             31038..31532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33143"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ22"
FT                   /protein_id="ABW33143.1"
FT                   /translation="MARKSKGFSELLHQQQDDEQTTAQSFNRLQKKVKKTTGKDLIKDI
FT                   ATSPKGITKMSDVLEEFIDPYKETTSSFEDVESLLSIAVLAWNIALLPDEDRQEAIEII
FT                   LSEAASGMNQKSRAELQTLIHQMIERKDCYFSSFQRYIANFDLQPQGDSYFLSVASSLK
FT                   E"
FT   gene            31973..32095
FT                   /locus_tag="AM1_F0041"
FT   CDS             31973..32095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33141"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ23"
FT                   /protein_id="ABW33141.1"
FT                   /translation="MGLAIDKAIAEAHRGRVELISEPGVGSTFTISIPFRDSMS"
FT   gene            complement(32051..32176)
FT                   /locus_tag="AM1_F0040"
FT   CDS             complement(32051..32176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33142"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ24"
FT                   /protein_id="ABW33142.1"
FT                   /translation="MIRLLSMGCISFGGEASFQLSFLAIVESTHTVSEGDADSEG"
FT   gene            complement(32652..35006)
FT                   /gene="metE"
FT                   /locus_tag="AM1_F0042"
FT   CDS             complement(32652..35006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="AM1_F0042"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33140"
FT                   /db_xref="GOA:A8ZQ25"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ25"
FT                   /protein_id="ABW33140.1"
FT                   /translation="MSQCNKSPIKTHSLGYPRIGAKRELKKATEAYWKGDLPLSELLVT
FT                   GKTLRETNWKKQQAAGLDLIPVNDFSFYDQVLDMSCLLGNVPPRFQWQGGQTDINTAFT
FT                   IARGTEGGTSWVEDEKDCQTSKVSTFASEMTKWFDTNYHYIVPEFRGDTTFSLSSTKVF
FT                   DELAEAKELGINAKPVLVGPVTYLSLGKVQGSNNPDFDPLTLLDNLVSVYVEILDKLAA
FT                   EGAEWIQLDEPIISTDLSNLQREALKVAYDRLSKVQGSAKLLVTTYFGGVRDNLDDYLA
FT                   LPVDALHFDFVRGSEDIDSVLDTFPTNKILSVGIVEGRNVWKNDYDASLEFLKKAKVVV
FT                   GADRLWVAPSCSLLHSPVTLQNEQKLDDELKSWLAFADEKLTEVTELRQLLDEVGSEEM
FT                   LETNRAAVASRKSSKRIHNDAVKKRLAGVKPSDFDRASAFVERQTKQRAKLRLPEFPTT
FT                   TIGSFPQTKEVRLARAQWKKGKLSDADYDQFMKEEIAKCVAFQDEIGIDMPVHGEFERN
FT                   DMVEYFGENLEGFTFTSTGWVQSFGTRYVKPPIIFGDVSRSKPMTVYWSEYAQSLTDRP
FT                   MKGMLTGPVTILQWSFVRDDQPRSVTTHQIALAIRDEVVDLEAAGIAAIQIDEPAFREG
FT                   LPLRRSEWDNYLNWAVKAFHLSACGVEDETQIHTHMCYSEFNDIIDSIAAMDADVITIE
FT                   TSRSNMELLDAFVDFKYPNEIGPGVYDIHSPRVPPTDEMSNLMSKAEAVLPREHLWVNP
FT                   DCGLKTRQWSEVKPSLINMVETASKLRATNC"
FT   gene            complement(34990..35214)
FT                   /locus_tag="AM1_F0043"
FT   CDS             complement(34990..35214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33139"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ26"
FT                   /protein_id="ABW33139.1"
FT                   /translation="MQVNRTDDLKVATFEQCYRPSMNFTHYFMNNNHLYSSINADSIIA
FT                   MPMGNKGITSKKIAGIIPAHRSQVYESMQ"
FT   gene            35167..36060
FT                   /locus_tag="AM1_F0044"
FT   CDS             35167..36060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0044"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33138"
FT                   /db_xref="GOA:A8ZQ27"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ27"
FT                   /protein_id="ABW33138.1"
FT                   /translation="MLERSHLEIIRAVDLHGTMTAAANALHLTQSALSHSMRKLEDQIG
FT                   VKLWYREGRSLRLTQAGTHLLAVANRLIPQFVHTEERLEQFARGERGTLRIGMECHPCY
FT                   QWLQKITGPYLRAWESVDFDIKQKFQFGGIGALFAHEIDLLVTPDPLLKKRLHFVPVFD
FT                   YEQVLVVGSEHQLRGEDWVIPQQLGEEVLFTYPVSQDRLDIYTRFLTPVGMTVRRQKVV
FT                   ETTEIMLQMVACGRGVAALPRWLVEEFSEKYTVHAVRLGPEGVQKQIFLGVRQADLEVD
FT                   YINAFIDLARNYHEHP"
FT   gene            36462..36866
FT                   /locus_tag="AM1_F0046"
FT   CDS             36462..36866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33136"
FT                   /db_xref="GOA:A8ZQ28"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ28"
FT                   /protein_id="ABW33136.1"
FT                   /translation="MWRYNLLAIGSASNFIYPHVPLVSLASLAGVTLNRRQAIVSAGLI
FT                   WLVNQFFGFTVLQYPLSAISLLWGLSMGLGTIAVALVASIRPPFSRRSWWAQSLWLGIS
FT                   LLLGFCLYQSGTLLVNQWVQMHGLTADVFL"
FT   gene            complement(36844..37191)
FT                   /locus_tag="AM1_F0045"
FT   CDS             complement(36844..37191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33137"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ29"
FT                   /protein_id="ABW33137.1"
FT                   /translation="MTGFSDPIFWIFYVADYEDGVMDPNFGNFQRLQLSQPEYSGTKLL
FT                   RCVAKLPSKRLNFINVTGLKMKLAFNQIERLSAESVAGYVDGSELKRCRTQTARLPTAP
FT                   LVLASIETHQP"
FT   gene            37288..40170
FT                   /gene="nrdA"
FT                   /locus_tag="AM1_F0047"
FT   CDS             37288..40170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="AM1_F0047"
FT                   /product="ribonucleotide-diphosphate reductase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33135"
FT                   /db_xref="GOA:A8ZQ30"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ30"
FT                   /protein_id="ABW33135.1"
FT                   /translation="MPDTKELESAPLSILPPIQGGSVEGLDAEYKVIRRNGSVVGFEAD
FT                   KIAIAMTKAFLAVKGVQSGVSARVRELVATLTTNVVTALKRRQPTGGTFHIEDIQDQVE
FT                   LALMRSGEHDVARAYVLYREKRSQKRTQQHGIEAAPIYLMDGGDRVLLDLERFNDLVDS
FT                   ACINLGDTVSGKAIADEALKNIYDGASVVELHKSAILAARSHIEKDPDYSKVTARLLLH
FT                   RIRQEVLGAEVTQAEMQARYAEYFPHFIQQGIATGLLDEKLAQFNLQKLGSVLVAERDL
FT                   QFGYLGLQTLYDRYFLHTEDRRIELPQAFFMRVAMGLALNEIDREERAAEFYDILSKFD
FT                   FMSSTPTLFNSGTVRSQLSSCYLTTVPDALDGIYSAIKDNALLSKYAGGLGNDWTPVRA
FT                   LGAHIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKN
FT                   TGDDRRRTHDINTANWIPDLFMKRVMEDGDWTLFSPDIVPDLHDKVGKEFETAYLAYEQ
FT                   QAAKGELKPFKTVPANTLWRKMLSMLFETGHPWITFKDPCNVRSPQQHIGMVHSSNLCT
FT                   EVTLNTNENEIAVCNLGSVNLVNHMVEKNGQMQLDQAKLQHTITIAMRMLDNVIDLNYY
FT                   AVSTARNSNLKHRPVGLGIMGFQDCLHQLRLPYASQDAVDFADRAMEAVCYYAYWASTE
FT                   LAQERGRYSTYKGSLWDRGILPQDTLALLKEVRGGFVEVDESSTMDWDLLRDRIAQHGM
FT                   RNSNCVAIAPTATIANIIGVSACIEPTYQNLYVKSNLSGEFTVVNEYLVRDLKVRELWD
FT                   EVMIADLKYFDGSLAKIDRIPPELRQLYATAFEVEPNWIVEAAARRSKWIDQAQSLNIY
FT                   MAGASGKKLDQIYKLAWQRGLKTTYYLRSLGATHVEKSTAPASSLNAVSNNGSSNGIGN
FT                   ILTTSKSENLGQVCSLSPGDANFDDCEACQ"
FT   gene            40212..41366
FT                   /gene="nrdB"
FT                   /locus_tag="AM1_F0048"
FT   CDS             40212..41366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /locus_tag="AM1_F0048"
FT                   /product="ribonucleoside-diphosphate reductase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33134"
FT                   /db_xref="GOA:A8ZQ31"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ31"
FT                   /protein_id="ABW33134.1"
FT                   /translation="MMLVWEEETTATAQTKTVQTEPVQAVPSPQEAGPQTIMAQPETQP
FT                   PRRINVADKRIINGQTDVNQLVPFKYQWAWDKYLAGCANHWMPQEINMSRDIALWKTTD
FT                   GLTEDERRIVKRNLGFFVTADSLAANNIVLGTYRHITAPECRQYLLRQAFEEAIHTHAY
FT                   QYIVESLGLDEGEIFNAYREVDCIREKDEFLIPFVETLTDPTFETGTPENDQKLLKSLI
FT                   AFSCLMEGLFFYVGFVQILALGRQNKMTGAAEQYQYILRDESMHCNFGIDLVNAIKQEN
FT                   PHLWTPEFCEEIRDLFKRAVELEYRYAEDTMPRGVLGLNASMFKSYLRYIANRRSQQIG
FT                   LDPIFASEENPFPWMSEMVDLKKERNFFETRVLEYQTGGALSWD"
FT   gene            41492..41962
FT                   /locus_tag="AM1_F0049"
FT   CDS             41492..41962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33133"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ32"
FT                   /protein_id="ABW33133.1"
FT                   /translation="MTDHPQPDWQQAFITTNLLVLGYNAWCGFLTGARGAVVCSLNSPQ
FT                   LGMTGESFPAHYISRARLAPFLNAWLAIPDTVILTHHHITSHILDVVDGYNPETDIILL
FT                   LESGDLASFFYLRNLPISPPQSYEVVCKGWDEFKPIEPDYPKTQLFQNNLKS"
FT   gene            41978..42370
FT                   /locus_tag="AM1_F0051"
FT   CDS             41978..42370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33131"
FT                   /db_xref="InterPro:IPR012863"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ33"
FT                   /protein_id="ABW33131.1"
FT                   /translation="MTQTTLFVCSLCRFSKDEASRDGISGGQHLINQLHQFLTDSGLQD
FT                   VVRLEPLRCMAGCSHPCNVSLAAPGKLTFVLSQISPTEGAKAVSAFCQQYATSPDGKVP
FT                   YSERPNSVREATAFVLPPLPTDAPTR"
FT   gene            complement(42335..42457)
FT                   /locus_tag="AM1_F0050"
FT   CDS             complement(42335..42457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33132"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ34"
FT                   /protein_id="ABW33132.1"
FT                   /translation="MTTVTGILCIKGTPLKKRQTLLNSIEAESLAGGGISREWR"
FT   gene            complement(42454..42585)
FT                   /locus_tag="AM1_F0052"
FT   CDS             complement(42454..42585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33130"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ35"
FT                   /protein_id="ABW33130.1"
FT                   /translation="MTSAVRRQCPLRQTHLLTLQFDDPGYFAVDAAPEWFCLNRESQ"
FT   gene            42591..43475
FT                   /gene="cobW"
FT                   /locus_tag="AM1_F0053"
FT   CDS             42591..43475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobW"
FT                   /locus_tag="AM1_F0053"
FT                   /product="cobalamin biosynthesis protein CobW"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33129"
FT                   /db_xref="GOA:A8ZQ36"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR012824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ36"
FT                   /protein_id="ABW33129.1"
FT                   /translation="MCNDEETPNGSGPNIVELANGCLCCTVQEEFFPTMQELLKRRDEI
FT                   DCIVIETSGLALPKPLVQAFHWPEIRTGATVDGVVTVVDGDALAQGCIVNNLDALHTQR
FT                   QADDSLEHETPIEELFEDQLACADMVLLAKTDVIQEEDTCSRIQQWLQQQTSTGVKVVP
FT                   CHHGQISPDILLGFNAAVEDNLDSRPSHHDQEEEHDHDDNINSICIELEQTFDPNTLIE
FT                   RLQVLVQQQEIYRIKGFVAVPNKAMRLVLHGVGQRFDQFYDRLWQTSEPRLTQLVFIGQ
FT                   GLDSHHITEAISA"
FT   gene            44010..45890
FT                   /locus_tag="AM1_F0054"
FT   CDS             44010..45890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0054"
FT                   /product="nonribosomal peptide synthase"
FT                   /note="Homologous to AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33128"
FT                   /db_xref="GOA:A8ZQ37"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ37"
FT                   /protein_id="ABW33128.1"
FT                   /translation="MEYNVAKTTNWDTKIEESDPPKVESLVDLLRYRAAYQPDRRGITF
FT                   LVDGEEEALHFTYAELDIKARAIAAALQLACHPGDRALLVYQPGLEYVAAFFGCLYAGV
FT                   TAVPIYPPRPNRSLMRLQSVIADSQAIFALTTSQILSKLERRLIDAPELRALKWLATDS
FT                   LSVTEPRQAWQETHPQGQDLAFLQYTSGSTATPKGVMITHHNLLKNLSLIHQCFEHSSQ
FT                   SLAVIWLPPYHDMGLIGGILQPLYGGFPMVLMSPFMFFQSPIRWLQAISRYQGTTSGGP
FT                   NFAYDLCLRKIKPEQLQGLDLSSWRVAFNGAEPISAQTLEDFATKFAPYGFRSEAFFPC
FT                   YGLAEATLIVAGGQPDAQPALKTVQGTALEQHHVVSAQANDVDARTIVGCGTSLQDQEI
FT                   VIANPETLQQCSSEEVGEIWVSGESIAQGYWGQSDVSEETFQAHLADTGAGPFLRTGDY
FT                   GFLVGSELYVTGRLKDVIIVNGRNHYPQDIEWTVVQSYPGIRPNCAAAFSITEAGEERL
FT                   IVVAELERNYINRYRKNGKKPSSQPPQLNDFVSPTSLTADSEPTTVEKDILTQIRRAVA
FT                   KEHDLHIHALWLLKPGSIPKTSSGKIQRFTCRSKFLEGDLDSVARSMPRA"
FT   gene            complement(46083..46454)
FT                   /gene="smtB"
FT                   /locus_tag="AM1_F0055"
FT   CDS             complement(46083..46454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smtB"
FT                   /locus_tag="AM1_F0055"
FT                   /product="transcriptional repressor SmtB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33127"
FT                   /db_xref="GOA:A8ZQ38"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ38"
FT                   /protein_id="ABW33127.1"
FT                   /translation="MSHSHLDISTHSLLEKPRSEKPVVDQILSFEKAQRMAEFLGVLSD
FT                   PNCWRILSALAIEEMRVGELAAAVEMSESAVSHQLRVLRNTRMVRRRKCGRTVIYGLKD
FT                   HHIFNLYRDVSEHLDEADY"
FT   gene            46672..46785
FT                   /locus_tag="AM1_F0056"
FT   CDS             46672..46785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33126"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL50"
FT                   /protein_id="ABW33126.1"
FT                   /translation="MRFKKAVSIFVAKPVQMDIPQARVVDIRVVDAVHNLN"
FT   gene            complement(46818..49310)
FT                   /gene="priA"
FT                   /locus_tag="AM1_F0057"
FT   CDS             complement(46818..49310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="AM1_F0057"
FT                   /product="primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33125"
FT                   /db_xref="GOA:A8ZQ40"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ40"
FT                   /protein_id="ABW33125.1"
FT                   /translation="MSTPKAPPTVIPTSKGASFVEVLVDCPGTDKLFTYRIPSDLNICP
FT                   GDILNVPFGARQVGAIAMRCLSDLPPELTTTRILSVVDVVCRNLFPPGYWQILEKVAAY
FT                   YHTSLMAVIRVALPPGLLQRSQRRIRLHTSINSVDVHGLGTAAQDILTLLQQSPTQDYT
FT                   WQYLRRQVKKAQVGLRELQQRGLVKSYLQTQAPTQPKQQQVVTFTTLNVPDLTKRQQEI
FT                   LTLLNQEGGELWAQDLLRLAHTSSNTLKKLASKGCITLQQQERLRLETSPIQPDQPRML
FT                   TPDQAKVLSQLNRLQGYAEVLLHGVTGSGKTEVYLQAITPVLARQQSVIVLVPEIGLTP
FT                   QLTDRFRSRFGDRIRVYHSALSDGERYDTWRQFLTSTPQVVIGTRSAIFAPVANMGLIV
FT                   LDEEHDTGYKQDQPAPCYHARTVARWRAQQEDCPLILGSATPCLESWSQTRRCEPHLSQ
FT                   SKVHYLQLPQRVNARPMPPIEIVDMRLELANRNHSIFSRLLKKRLQELQQKHQQGLLFM
FT                   PRRGHSTFVSCRSCGYVAECPHCSISMTYHHSPDSRQTLLRCHYCNYTQPQPQACPVCK
FT                   SSYFRFFGSGTQRVMQELDKTFPELRVIRFDSDTTRRKGAHRQLLNQFARGQADLMVGT
FT                   QMLTKGIDLPQVQLIGVLAADSLLNIPDFRASERTFQTLLQVAGRAGRGEHPGQVILQT
FT                   YAPEHPVIQAVQQYSMNTFLINELKQRREANYPPFQQLILLRISGLNETMVENTALDIA
FT                   NYLKAYIQLHRYEGSILGPAPASILRVARRYYWHVLVKRPQAKLGQSEHWPFPRQECQQ
FT                   RCPQNLRLQIDVDPLKLL"
FT   gene            complement(49539..50849)
FT                   /locus_tag="AM1_F0058"
FT   CDS             complement(49539..50849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33124"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ41"
FT                   /protein_id="ABW33124.1"
FT                   /translation="MLSVVFEALSSTSSEFDCFVNFYVRSPWGGPTPYCRGGDGRAVLR
FT                   SSVREFLAQEYMQALGVPTSRSLTLYASKSETVKRPWYSQNSYSTDPDVLMDDPVAIST
FT                   RVAPSFLRVGQLELFARRARNKAHPRALEELSMIVSHLMEREYKSDINQNLGFADQLVE
FT                   LATLFRQRLTSLVTNWLRVGYCQGNFNSDNCAAGGFTLDYGPFGFCEVFDPWFQPWTGG
FT                   AEQFSFFYQPIAAEANYYMFWKAVRPLLSEDADALEQFDQVGRSFAEVMEKQVQKMWTA
FT                   KLGLTEFNPELFKELMQLMTNSAVDYTIFFRELSHIPEDVSALKKSFYGKTSQQLDEQW
FT                   QSWLKSWRDLVIKDGNLAEISKHMKQTNPKYTWREWLIVPAYQQAMQGDYTLVKELQEV
FT                   LSYPYDEQSQDVEDKYYRLRPKAFFNAGGVSHYSCSS"
FT   gene            50853..51533
FT                   /locus_tag="AM1_F0059"
FT   CDS             50853..51533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0059"
FT                   /product="transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33123"
FT                   /db_xref="GOA:A8ZQ42"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ42"
FT                   /protein_id="ABW33123.1"
FT                   /translation="MTSSPFASIIEHFSDLDDPRAAHRIEYSLEDIIIITLCAVLCGAD
FT                   NWVEVANYGRSKAQWLKQWIALPNGVPSHDTFEWVFARLKPQQLQQCFLNWTQAIYQLS
FT                   AGELIAIDGKTLRGAIAPGEQCSLIHMVSAWASHNRLVLGQRTVDEKSNEITAIPELLK
FT                   VLELEGALVSIDAMGCQTAIAETIIEGQGDYVLALKGVIEGSLTPAAIKIDHPPKQGKF
FT                   TSNQ"
FT   gene            complement(51635..52384)
FT                   /locus_tag="AM1_F0060"
FT                   /note="fragment; similar to C-terminus of transposase"
FT   gene            complement(52548..54278)
FT                   /locus_tag="AM1_F0061"
FT   CDS             complement(52548..54278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0061"
FT                   /product="RNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33122"
FT                   /db_xref="GOA:A8ZKQ7"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKQ7"
FT                   /protein_id="ABW33122.1"
FT                   /translation="MSKARVKPMMEWSAIPWPKLERKVFKLQKRIFRARQRGDVKVVHR
FT                   LQKTLMRSWSAKCLSVRRVTQDNQGKKTAGVDGVKSLSPEARLPLVGQLKLGSKAPPTR
FT                   RVWIPKPGKDEQRPLGIPTLYERARMTLVKLALEPEWEAVFEPNSYGSRPGRSCHDAIE
FT                   QIFAAIKQKAKYVLDADIAQCFDRINHEALLKKLKTFPTLRRQIKTWLKAGVIDGHQFL
FT                   QTSEGAPQGGTISPLLANVALHGLEYRIKQAFPIRKIADGNKRKRIATPDVIRYCDDFV
FT                   ILHEDLSVVQRCQSLVHEWLKDMGLELKPSKTHISHTLKRYEAENPGFDFLGFSVRQFP
FT                   VGQHQSGRLCGTLLGFKTIITPSRKKQKVHYNRLVSIINAHKAAPQAALIRHLNPVIRG
FT                   WTRYYSTMASKETFSRLDHLLYQKLQTWANHRHPGKSRKWVVNKYWQTVGGDKWVFATR
FT                   VTKSRTEKLLKHRQTPIIRHVKVKGDASPYNGNLVYWSSRTGKHPEAPKRVSMLLKKQK
FT                   GKCAQCGMFFREEDLLEVDHILPTSMGGLDVYKNLQLLHRHCHYVKTAKEKSSQAKWYV
FT                   "
FT   gene            complement(54890..57037)
FT                   /locus_tag="AM1_F0062"
FT                   /note="fragment; similar to N-terminus of transposase"
FT   gene            complement(57237..58898)
FT                   /locus_tag="AM1_F0063"
FT   CDS             complement(57237..58898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0063"
FT                   /product="transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33121"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZMN7"
FT                   /protein_id="ABW33121.1"
FT                   /translation="MSMRPTDLLDIPSETIEVARAAFPDGNLYMQLRDELGIIYHDHDF
FT                   ADLFPKKGQPALSPWQLVLVCIMQFLENLSDRQAADAVRARIDWKYALSLPLRDSGFNY
FT                   SVLSEFRKRLIAGDKEQQLFDSFLEHLQAKGFLKEHHQQRTDATHILASIRTLNRLELF
FT                   GETFRAALNSLVVADPQWLSEHMHDDWFDRYGRRIENYRLPKPDSERKALGSTIGQDGL
FT                   TLLDAIYAPSSPPWLKHLPAVETLRQVWLQRFYPPNADGTVEWRKVKDMPPSDSSIHSP
FT                   YDVEARYSNKRSMDWVGYKVHLTEVCDPESPRLITHVHTTSATVPDDQVVEPIHLALAK
FT                   KQLLPKEHLLDGGYLSAEHLVNSKAEYDMDVIGPVRQNHSWQAKAGNGFDSSFFLISWD
FT                   QQKVVCPQGHFSTKWLPGKDIHGKDVIQARFQGTTCRSCPVRSQCTKSKTQPRELTFRP
FT                   RELHQALNERRQVQRTTEFKEKYSLRAGVESTHSQGIRRFGMRQSRYIGLAKSHLQNVF
FT                   CAIALNFVRLDAWFNDVPLAKTRVSLFKRILQPLPA"
FT   gene            59037..59594
FT                   /locus_tag="AM1_F0065"
FT   CDS             59037..59594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33119"
FT                   /db_xref="GOA:A8ZQ45"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ45"
FT                   /protein_id="ABW33119.1"
FT                   /translation="MSTLQLPLKGNQGDLYNDVVQLFDHACQTQFQGIEHDSYQTVEKG
FT                   HGRIEHRTYWTMGQTDYLLGAERWAQLKSIGCVESCRRQPGHPGTLQRRYYLLSIESDA
FT                   QRFADAVRSHWGIENQLHWILDVGFREDKLRACQGCSAQNLSVIRHLAANLLQQESTAK
FT                   CGIKAKRLKAGWDDNYSTTDIC"
FT   gene            complement(59578..59985)
FT                   /locus_tag="AM1_F0064"
FT   CDS             complement(59578..59985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0064"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33120"
FT                   /db_xref="GOA:A8ZQ46"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ46"
FT                   /protein_id="ABW33120.1"
FT                   /translation="MGQRFYDLKSGKRTERVSFIAALKEGQLFSPMTFEGSCNRLLFEA
FT                   WLQQSLISQLQLGDVIVIDNASFHHGQRIEEIVAEAGCEIWYLPSYSPDLNKIERWWFV
FT                   LKNWMKQRWDEFDTFRDCVDAAFKERTNIYP"
FT   gene            complement(60078..60461)
FT                   /locus_tag="AM1_F0066"
FT   CDS             complement(60078..60461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0066"
FT                   /product="transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33118"
FT                   /db_xref="GOA:A8ZQ47"
FT                   /db_xref="InterPro:IPR002622"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ47"
FT                   /protein_id="ABW33118.1"
FT                   /translation="MPAPYSYDLRRKAVDAFKNGERKVDICRMLNISRNTLHLWIVREE
FT                   ATGDCQAITNYQQGARHKITDWERFREFAQEHGGKTQAQMAKLWGDNVTQQNISDALRK
FT                   LGLSRKKRPMAIENEMKHNVKHL"
FT   gene            complement(60572..60763)
FT                   /locus_tag="AM1_F0067"
FT   CDS             complement(60572..60763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0067"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33117"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ48"
FT                   /protein_id="ABW33117.1"
FT                   /translation="MRQIGWTTGYALSILGTEYNQQCPFGTGNGYGDGRAISVFEGIIN
FT                   GQRWEMQLKGGGPQGNRT"
FT   gene            complement(60835..61074)
FT                   /locus_tag="AM1_F0068"
FT   CDS             complement(60835..61074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0068"
FT                   /product="hypotheical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33116"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ49"
FT                   /protein_id="ABW33116.1"
FT                   /translation="MSYPAKPSAEPCVTTFDEFVQLADYSLMDTLDADPDATVDGDDHR
FT                   ARQVFSGHFVPVTPTPLAEPEYVAHSSTFLRNLG"
FT   gene            61722..62117
FT                   /locus_tag="AM1_F0069"
FT   CDS             61722..62117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0069"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33115"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ50"
FT                   /protein_id="ABW33115.1"
FT                   /translation="MVTLKDARRIIEAAEKKAEEIGQPMNIAVADSGGNLVSHVRMDGA
FT                   WIGSIDISIKKAYTSRAFDISTKDLAEYSQSEGQFFGIHASNGGKIMIFAGGIPLVQDG
FT                   RVVGAIGVSGGSGEQDHAVAEAGAEAF"
FT   gene            complement(62383..64410)
FT                   /locus_tag="AM1_F0070"
FT   CDS             complement(62383..64410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0070"
FT                   /product="general secretion pathway protein E, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33114"
FT                   /db_xref="GOA:A8ZQ51"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ51"
FT                   /protein_id="ABW33114.1"
FT                   /translation="MGNDSSKRDLLVRNNFSPSNEKLIKSGYVDQARLREAIYESRRKG
FT                   RSLLVILQKMTGKPLPPRLLRQIKRQQLFELKILYGLECLDPELTQVDFDEIDRLIRTV
FT                   IPLDYCRRYQLLPLSLNEEEDPPVVRIGMVNPDHLSAIDDIGYLLRSNGMTFQRVVLDL
FT                   DTYQMLIAKFLDAQAKRQATIQENLPVEYGLEDDLDRLGGIEDLATNDADINLDEALLD
FT                   ENAAPIISLVNKILAKALQNQISDIHIEPQEENLRVRFRKDGLLHNAFQPLPRRITPAL
FT                   VSRFKIIANLDIAERRLPQDGRILRLFQGRKVDFRVSTLPSRYGEKVVLRILDNSSMQL
FT                   GLDNLIDDPMSLELVRSMVDRPFGLILVTGPTGSGKTTTLYSALTERNTPEVNISTVED
FT                   PIEYTLPGITQVQVLREKGMDFASILRAFLRQDPDVLLVGETRDKETAKTAIEAALTGH
FT                   LVLTTLHTNDAASAIVRLAEMDVEPFMVSASLLGVVAQRLVRRLCPDCRIPYRPSQERL
FT                   AQFGLVTSGKTDITFYKANTSTSDDILATANTEDACPTCSGIGYLGRCGVYEVMQVSEK
FT                   LKALITEGAPTEHIKEVAVEEGMQTLLAYSLKLVENGETSLEEVERVTFSDSGLKTELK
FT                   AKRKTALNCHVCKAALLPEWLDCPYCLTPRFTEQHPVNQH"
FT   gene            complement(64581..65066)
FT                   /locus_tag="AM1_F0071"
FT   CDS             complement(64581..65066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0071"
FT                   /product="Fe2+/Zn2+ uptake regulation protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33113"
FT                   /db_xref="GOA:A8ZQ52"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ52"
FT                   /protein_id="ABW33113.1"
FT                   /translation="MDAIQRVIDHAERRCKENGSRLTKKRKLALSLLLKSSKALSAYEL
FT                   VEAYKTELGDTMPAMSMYRILEFLMAENLVHRLDLINKYVACEHIKCEQEHAQTQFLIC
FT                   GQCQKVKEVAISAPIMDLLKKNTSDAGFHLASPQLEINCICQDCMSTELRAYSVGRY"
FT   gene            complement(65315..66523)
FT                   /locus_tag="AM1_F0072"
FT   CDS             complement(65315..66523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0072"
FT                   /product="cobalamin synthesis protein/P47K family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33112"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL44"
FT                   /protein_id="ABW33112.1"
FT                   /translation="MRHTNKLPVTVLSGFLGAGKTTVLSHILNNREGKKVAVIVNDMSE
FT                   INIDSAIVQSEVSLNRSEEKLVEMSNGCICCTLREDLLEEVNKLAREGRFDYLVIESTG
FT                   ISEPLPVAETFTFTDEDGASLSDVADLDTMVTVVDAVNFLEDYEKARSLKDTGESLGEE
FT                   DERSVADLLVDQVEFADVILISKTDLVLPSDIERLTAILKTLNTHAKIVPIAQGQVNID
FT                   HVLSTGLFDFERAQQAAGWLKEMRGEHVPETEEYGIGSFSYVARRPFHPEKFYQFLSSR
FT                   DKYGKLIRSKGYFWLASRPQFAGHWSQAGGIARHGVAGMFWKAVPKENWPQDEEYLAAI
FT                   KKQWVEPFGDMRQELVFIGQGLDKERITQALDECLLSEEEIVRGHTYWKSLNDPFPEWG
FT                   HSA"
FT   gene            66754..66882
FT                   /locus_tag="AM1_F0073"
FT   CDS             66754..66882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33111"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL43"
FT                   /protein_id="ABW33111.1"
FT                   /translation="MKAISSKHPWKISKNFPENGNLLESFYFLIQAVLFYHRHFSE"
FT   gene            67045..67470
FT                   /locus_tag="AM1_F0074"
FT   CDS             67045..67470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0074"
FT                   /product="ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33110"
FT                   /db_xref="GOA:A8ZQ55"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ55"
FT                   /protein_id="ABW33110.1"
FT                   /translation="MQQQADKIIQTLKAKGLRVTPQRFAVYADLLARSDHPTAEQITNH
FT                   LNQDGPTSSQATVYSSLQALREVGLVREVLLEEGVCRYDANIEPHHHFRCQSCGAIEDI
FT                   AWDQLQDLDFKALRPGLQVTHYEITVHGGYCNRCHPE"
FT   gene            complement(67624..68052)
FT                   /locus_tag="AM1_F0075"
FT   CDS             complement(67624..68052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0075"
FT                   /product="ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33109"
FT                   /db_xref="GOA:A8ZM98"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM98"
FT                   /protein_id="ABW33109.1"
FT                   /translation="MYDANSLKAELNDRGWRLTPQRETILNVFIDLEKGKHLSAEDLDT
FT                   LLQEQGKPISLSTIYRTVKLMARMGILRELELAEGHKHYELNQPYPHHHHHLICVKCNE
FT                   TIEFKSDAVLKIGSKTAKKLGFHLLDCQLSIHAICPQC"
FT   gene            68356..69561
FT                   /locus_tag="AM1_F0076"
FT   CDS             68356..69561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33108"
FT                   /db_xref="GOA:A8ZQ57"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ57"
FT                   /protein_id="ABW33108.1"
FT                   /translation="MGWGRWLILKNYDNDNHYIKLLLAASLSMKETNSSYDVVIVGAGP
FT                   AGVGCAVALQELGLENFILLERQQVGASFSRWPTEMNLITPSFPSHGFGLLDLNAITLK
FT                   TSPAIAFRREHLNGQQYALYLQTVVNHFQLPVKTGTDVLAIKPLSQCRGFILKTSGGDV
FT                   KTQFVIWAAGEFQYPRLNPFVGADHCIHNSQIRSWKNLPGDEFTIIGGYESGMDAATHL
FT                   VELGKKVRVLDRTGAWDNPDTDPSIALSPYTVQRVKLATQTGRLKLIGNVSIEEVKKVS
FT                   EGYAVFSKYEKWLTVHPPILCTGFETSLQQIASLFDWTEGYAMLNDQDESTLTPGLFVA
FT                   GPSVRHHNVIFCFIYKFRQRFAVVADAIARRLDLDPAPLEIYRRQGMFLDDLSCCDNDC
FT                   IC"
FT   gene            69606..71285
FT                   /locus_tag="AM1_F0077"
FT   CDS             69606..71285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0077"
FT                   /product="membrane transporter protein"
FT                   /note="Shows limited homology to ferrous ion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33107"
FT                   /db_xref="GOA:A8ZQ58"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ58"
FT                   /protein_id="ABW33107.1"
FT                   /translation="MPLLTSPAQRSIVVIGKENTGKSQLVASLTGCLPDSINFRGSTIA
FT                   CDTYIGGGLTVVDTPGILYRSDRVTTQAALAQLETHDTVLLVIKATHIDEDLADLWPLV
FT                   VGKRGIVVITFWDKASQAGFTQQIVQCWDQTSNLAFIPVDARHLTPAQHHDIRAALQEP
FT                   TIFSPEWQPIPTGWRIEPRPTVLEHPQFGWLVAISFLLLPTLLAVWFANSFAAVADPLM
FT                   QALLQPLVDVLANIPLSLPREMLIGRYGLLTMGPLLWVWAVPTVILYALCLGTYKASGL
FT                   VERITVALHPLLHPLGLSGRDLVRVVMGFGCNVPAVISTRACSSCARQTCMSAIAFGSA
FT                   CSYQFGATLAVFSAAHRPSLVIPYLGYLTVTTLIYTRLLAPKSARSSHNRLMIEHRTFL
FT                   ERPRWATIWRETQGMLHQFFTSAIPIFVAITLIASLLDELSLLTAAASIIHPLMQIFRL
FT                   PPEAALPMILASIRKDGLLLIAEPETLSALTPLQILTGVYLAGVLLPCLVTALTIAREQ
FT                   SLRFALALMGRQAIMATCFSLILAWGGYWCSSALANVVFPLP"
FT   gene            71337..71549
FT                   /locus_tag="AM1_F0078"
FT   CDS             71337..71549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33106"
FT                   /db_xref="GOA:A8ZQ59"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ59"
FT                   /protein_id="ABW33106.1"
FT                   /translation="MEDAITLGPPLILCNRLRYLTRRDLPGVRVESWYQQPLKQSRYYK
FT                   MIMIIILITLEICNHTVLIQDAIRR"
FT   gene            71552..71941
FT                   /locus_tag="AM1_F0079"
FT   CDS             71552..71941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0079"
FT                   /product="ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33105"
FT                   /db_xref="GOA:A8ZQ60"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ60"
FT                   /protein_id="ABW33105.1"
FT                   /translation="MPEKLTPNQRRVLEVLFSTPQEFSAQDLHKEFKKQQQRVGLATVY
FT                   RALKVLQKCGKVHTRLLQNGEAVYSIPSAHQHHLTCVSCGSSMPLMNGPVHELEKELAQ
FT                   TQKFQVFYHTLEVFGLCQNCIEAKV"
FT   gene            72093..72599
FT                   /locus_tag="AM1_F0081"
FT   CDS             72093..72599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33103"
FT                   /db_xref="InterPro:IPR013472"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ61"
FT                   /protein_id="ABW33103.1"
FT                   /translation="MTHVSMYYPIFGPETLCPHCRQVMPALTLTDTYLCKRHGAFEADP
FT                   NTEELVHLQSGRHWRLWDGQWYRQHIHPDGIRFEIHEALDRLYTEGYRATKVIIAPRYR
FT                   TLINSFLEHSPWPDQTSSGHPYLYGLPVEFGPDPEQDPRWQVINFDLDKEPGIPINSPH
FT                   SQLLY"
FT   gene            complement(72568..72735)
FT                   /locus_tag="AM1_F0080"
FT   CDS             complement(72568..72735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33104"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ62"
FT                   /protein_id="ABW33104.1"
FT                   /translation="MELQGLPTQPLMQIAPAPPVRFGGRLFTEKAHHLTNETQKLRFRS
FT                   PNTIAENGEN"
FT   gene            72754..72912
FT                   /locus_tag="AM1_F0082"
FT   CDS             72754..72912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33102"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ63"
FT                   /protein_id="ABW33102.1"
FT                   /translation="MKQAPRASFLVENLNSSLRNYFTLLTHLGTPNLGHLQFFLNHRQF
FT                   MSRALST"
FT   gene            73166..73297
FT                   /locus_tag="AM1_F0083"
FT   CDS             73166..73297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33101"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ64"
FT                   /protein_id="ABW33101.1"
FT                   /translation="MWVLRSIIQFFMLSVIYPLQALFRGHSIMQTIVDGSRTDARIK"
FT   gene            73440..73937
FT                   /locus_tag="AM1_F0084"
FT   CDS             73440..73937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0084"
FT                   /product="HNH endonuclease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33100"
FT                   /db_xref="GOA:A8ZQ65"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ65"
FT                   /protein_id="ABW33100.1"
FT                   /translation="MGNVLVLNASYEPLNITSWRRAVVLVLKEKAEQVEHNGKFVYRDF
FT                   PLPTVIRLLQYVRVPYKEITLNRRNLLHRDNHTCQYCGYTGSDLTLDHVMPRSRGGGDT
FT                   WENMVTACVRCNVKKGNRTPKEARMILNKTPRRPHSSLYFEVTKHFRNGVHQEWRKYVI
FT                   GM"
FT   gene            complement(74154..75830)
FT                   /gene="metG"
FT                   /locus_tag="AM1_F0085"
FT   CDS             complement(74154..75830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="AM1_F0085"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33099"
FT                   /db_xref="GOA:A8ZQ66"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZQ66"
FT                   /protein_id="ABW33099.1"
FT                   /translation="MRYLITSALPYINGIKHLGNLVGSMLPADIYARFLRQEGEEVLYI
FT                   CATDEHGTPAEIAAIDAGLEVAEFCAKQYHKQKEIYKRFGLSFDYFGRTSAPENHELTQ
FT                   YFYQQLAKQNFIEEREISQFYALDDQRFLPDRYVTGTCPHCGYEQARGDQCENCTKVLT
FT                   PTELIKPRSTISGSTHLELRTSRHLFLRLDKLSDEVRNWVDKQTQWSTLTKSIALKWLN
FT                   EGLKSRCITRDLVWGVPVPTEGFERKVFYVWFDAPIGYISATKAWGDITNNDWECWWKE
FT                   SDDVHYTQFMAKDNLPFHTIMWPATILGSREPWKMVDYIKGFNWLNYYGGKFSTSSQRG
FT                   VFLDQALEIASADNWRYMLIANAPESADSAFTWEQFQKQVNKELADNLGNFVNRILKFT
FT                   ASRFGMTLPEGGTPGDAEAELQVTCNELVEKLRKYLHNLEFRRATETLNALWRTGNQYI
FT                   DVRAPWVLFKTDQDETAMVIRTCVNLIRLYAISSAPFIPHTTQALFDALQLTDVERRHT
FT                   MTEASDLTLLAAGRSFMVPAPLFQKIDDDLVAELKAQYGGE"
FT   gene            76426..76695
FT                   /locus_tag="AM1_F0086"
FT   CDS             76426..76695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0086"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33098"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ67"
FT                   /protein_id="ABW33098.1"
FT                   /translation="MQPNYRLCISCRQVAPKSELWRIVRVYPDHQIQLDQGMGRSAYLC
FT                   PQANCLKAAQKKNRLAKALRAKVPDSLYESLWERLELPSRIFID"
FT   gene            76734..76883
FT                   /locus_tag="AM1_F0087"
FT   CDS             76734..76883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33097"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ68"
FT                   /protein_id="ABW33097.1"
FT                   /translation="MAISPTSIRGMVLKKGFWVTLPSQNKSLIIDDWRSTSSQSGQTAL
FT                   WNRL"
FT   gene            complement(76951..78255)
FT                   /locus_tag="AM1_F0088"
FT   CDS             complement(76951..78255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0088"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33096"
FT                   /db_xref="GOA:A8ZQ69"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ69"
FT                   /protein_id="ABW33096.1"
FT                   /translation="MSLCINPGCADPQNSDDHLFCKSCGSELLLEGRYRVLGMRGQGGL
FT                   GRTYEVSDLGSSPKILKILTDNHPKHVELFQREVNLLSQLDHPGIPRIEPNSYFMFYPG
FT                   NSKEPLHCFVMEKIVGLDLQEYLNQRGFPIDERLAIQWLKQVLKILHVIHGRQVLHRDI
FT                   KPSNIMLKANGHICLVGFGSACIVGTTLNQPIGTRVFSSFYTPREQIQDQAVPQSDFFA
FT                   LGRSFIYLIIGKELSEFFDEGVGECNWNKSTQKVSTQFATILEWLIKPLASHRPANAEV
FT                   VLKQISILESSGRFNLNTHLKKVSEAQSSTVKETSSAESPPTNQYSSIERINPPTSSLN
FT                   QPILRQPPQTYEPTEESKSIAEPNVAKPISKIRPEFGKKCQQVLAEYIGPISSIVYQHV
FT                   LAQNPDVSEEELVELLVIKIPNPAQTEEFRRRLFS"
FT   gene            78402..78518
FT                   /locus_tag="AM1_F0089"
FT   CDS             78402..78518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33095"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ70"
FT                   /protein_id="ABW33095.1"
FT                   /translation="MGLKMPKTQSCKWISTFLTLEQFEIFISHYLHIGSRGL"
FT   gene            complement(79130..79333)
FT                   /locus_tag="AM1_F0090"
FT   CDS             complement(79130..79333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33094"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ71"
FT                   /protein_id="ABW33094.1"
FT                   /translation="MILIHWNANFLKTISRAWGSLREANNSHCRSCKFYHHNAYLKCAV
FT                   HPSKVLMAAAQDCSDYCLRQGR"
FT   gene            complement(79419..79547)
FT                   /locus_tag="AM1_F0091"
FT   CDS             complement(79419..79547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33093"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ72"
FT                   /protein_id="ABW33093.1"
FT                   /translation="MSELCHSNFFNQTLDTENEILHDFGPNIQQSIIQACSCCSKG"
FT   gene            79972..80451
FT                   /locus_tag="AM1_F0092"
FT   CDS             79972..80451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0092"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33092"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ73"
FT                   /protein_id="ABW33092.1"
FT                   /translation="MARAIAEKCRRCSKLPVEEAKSKECWVGQRCHVRRSSYKHRDRYN
FT                   RNKKRKYQLQTGKLIPEVKVEVPVKPAAIRRMYRARRDAPLHAMSAELWIGQKRVAIVE
FT                   PVHTLGWTNSDVTKYSRNILNRFSEHLDGKVLHQFDSQVEVDPSQCPIRPCPLFP"
FT   gene            80465..81130
FT                   /locus_tag="AM1_F0093"
FT   CDS             80465..81130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33091"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ74"
FT                   /protein_id="ABW33091.1"
FT                   /translation="MALQLELDLWQQLNQAEAVPVESDLQQLQERLDLVIAQLPLEEKL
FT                   STAGTALLQMAEILSRRAEVFLRDWRDTYNDDGPILDLDDEMGMVRQSMVLDDDLLAEP
FT                   EPVTRRTLPKEESESIVVLKDKASLLEELETELRVEQPDEVLQVLEEEDVLAWVHAIST
FT                   YLQGTSGMVPLVELKQELQLSLVPIWLGMLLGGFKFEQRGGFYDQNVWIETGALNSQP"
FT   gene            81244..81630
FT                   /locus_tag="AM1_F0095"
FT   CDS             81244..81630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33089"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ75"
FT                   /protein_id="ABW33089.1"
FT                   /translation="MTQQESIDHDGLFKELIETFFWEFLDLFLPQVLDYVERGPVTFLY
FT                   QEVFSSIGAEEKRIIDLLAQVQFRGQDSYFLFHIEPQSSVQADFEKRMFYYFARLHEKY
FT                   DLPIYPVVIFGSPGISVVAARYSV"
FT   gene            complement(81627..82871)
FT                   /locus_tag="AM1_F0094"
FT   CDS             complement(81627..82871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0094"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33090"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ76"
FT                   /protein_id="ABW33090.1"
FT                   /translation="MDNSIRIPLNLPDIRVLELSKTERGDWLIKIESTLQGTTCHQCGR
FT                   EITDLHCHDQPFRIRHLPLFEVPVYLEIRPKRYRCKYCDDHPTTTQHLEWHEPRSPNTK
FT                   AYERWLLRILINSTVSDVARKLGVSEDIVSGIIDRWIAAQVDWSEYADLKVMGMDEISL
FT                   KRGHRDFVVLITIPTTDGVDILAVLADRKQQTVANFLQSIPIDLRQTIERVCTDMYQGF
FT                   VSAVREQLPQAKIVIDRFHVTKAYRNCADTVRKREVKRLRRELSKQEYDSIKGAMWPFR
FT                   KRPENLKESEQQLLERLFAYSPQLKQAYNLREKLTQIFEGRYTKHGAKCAIRAWCKQVL
FT                   KSGIKEFDSFLTTINNWMDEMTNYFLEGWTSGFVEGFNNRVKVLKRRCYGIFDIERLFQ
FT                   RISLDLNGYQTFAVT"
FT   gene            83081..83557
FT                   /locus_tag="AM1_F0096"
FT   CDS             83081..83557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0096"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33088"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ77"
FT                   /protein_id="ABW33088.1"
FT                   /translation="MNWRDFLKRDNPVASALMAKMQIAKEDRPRVKVECLRMLATLQLD
FT                   PARTEFISQFIDTYLRLEANEEQRFQTEIDTLELGEREAIMQTLTSWEERGWQKGEVSI
FT                   VLRQLNRKFNQLSPEMETQIQSLEVDQLESLSEALLEFESLDDLNAWLQNLENS"
FT   gene            83667..84788
FT                   /locus_tag="AM1_F0097"
FT   CDS             83667..84788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0097"
FT                   /product="xenobiotic reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33087"
FT                   /db_xref="GOA:A8ZQ78"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ78"
FT                   /protein_id="ABW33087.1"
FT                   /translation="MTATGTSPTLLSSFNLHNLPLANRIVMAPMTRSRAGEEMLANAMM
FT                   AEYYAQRASTGLIVTEGTFISDQAIGWQHVPGIYTQEQTQAWQVVTKAVHEKGGKIFLQ
FT                   LWHCGRASHSSFHQDYQLPVAPSAIKLEGDSIHTPQGKQPYETPRALSTDEIPLVVEDY
FT                   RQAASNAKTAGFDGVEIHSANGYLLDSFLQSKTNQRQDRYGGTLENRYRFLKEVVEAIS
FT                   QVWSTQRIGVRLSPNGVYNDMGSPDYRETFLYVAQQLNVFDLAYLHILDGLAFGFHELG
FT                   EPIHLSEFRTVYNGTIIGNCGYTQKDADDRISNGHADLIAFGRPFISNPDLVERFTNGW
FT                   PLNPPAEQSIWYSFEREGYTDFPTYLESQVKTT"
FT   gene            84938..85561
FT                   /locus_tag="AM1_F0099"
FT   CDS             84938..85561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33085"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ79"
FT                   /protein_id="ABW33085.1"
FT                   /translation="MASTLDEPEQVDVLQLWDGMLPELQALSQHERLQVAGEMALGITE
FT                   VFCQQAGLLIQDWEDRHNTQGPVLDDDFLAGMVQETMFLDVSDLCRQPKSRKRRQGFSG
FT                   KPVESVVGEVSKDAVLEFVEELESGEAIALKVSHEEDVSAWVGAILEYLEGTEGEVSFG
FT                   ELVNGLRMPVVAVWLGVLLGEFRVEQRGGFFEGEILIEASHPYQ"
FT   gene            complement(85546..85698)
FT                   /locus_tag="AM1_F0098"
FT   CDS             complement(85546..85698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33086"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ80"
FT                   /protein_id="ABW33086.1"
FT                   /translation="METILQWPRFKACWGLWGNGTINNVVYCSIAPQTPSTALPIDFNR
FT                   NYWYG"
FT   gene            85901..86761
FT                   /locus_tag="AM1_F0101"
FT   CDS             85901..86761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0101"
FT                   /product="peptidase, M48 family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33083"
FT                   /db_xref="GOA:A8ZQ81"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ81"
FT                   /protein_id="ABW33083.1"
FT                   /translation="MKDAVSQLPISKRVVVATTLATSLAISTPNPAQAIPLRDLIFRGV
FT                   QVIQLSNLSHQQERELGEQIHRNLQNQGMRLHQGRTLNRYVNRIGQRLVQAGAKRRKVV
FT                   YRFQVVDDKRVNAYATMGGRVYVTTGLINAADNEAQLASVIGHEIGHIDRKHLVKQIRK
FT                   TMVAQGLTTAITGSNRSQVANIGVNLLVSRPQSRSDEYEADREGLRLLRAADYATSAMP
FT                   AFMQKLVSNRSTPTFLSTHPATPDRIERLEQYIQSGPKNVCDRNPDLRSCGLSESRYRQ
FT                   IVGSR"
FT   gene            complement(86721..87293)
FT                   /locus_tag="AM1_F0100"
FT   CDS             complement(86721..87293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0100"
FT                   /product="molybdenum cofactor biosynthesis protein B,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33084"
FT                   /db_xref="GOA:A8ZQ82"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ82"
FT                   /protein_id="ABW33084.1"
FT                   /translation="MIFHLKGLRSSHGHPLAEKVIVLDDIYKIRAVVSRWIADESVQPI
FT                   ITTGGTGVTGRDGTPEAIQPVLDKEIQGFGELFRMISYEDIKTSTIQSRALSGVANGTY
FT                   LFCLLGSSGACRTGWDDLIQDQLDVRHSPCNLAELMPRLREYAVGSFYINLTGSLGTLG
FT                   FCSSTELTSIRTLVLNDCQRFADSDFH"
FT   gene            87258..87395
FT                   /locus_tag="AM1_F0102"
FT   CDS             87258..87395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33082"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ83"
FT                   /protein_id="ABW33082.1"
FT                   /translation="MTRPQPLQMKDHQTSLQSFWEIIVATRHEEVITIMAFTRKSGQFI
FT                   "
FT   gene            87403..87525
FT                   /locus_tag="AM1_F0103"
FT   CDS             87403..87525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33081"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ84"
FT                   /protein_id="ABW33081.1"
FT                   /translation="MFDFVSSSNPLQTVKGRNIQWFNEVVVGCRTPLSILQWSS"
FT   gene            complement(87666..88967)
FT                   /locus_tag="AM1_F0104"
FT   CDS             complement(87666..88967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33080"
FT                   /db_xref="GOA:A8ZQ85"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ85"
FT                   /protein_id="ABW33080.1"
FT                   /translation="MIFDHLRQFRQTLYSCFGASKDALFELMDAVLMSPSLRSFVCLSQ
FT                   HPIFRRQWSSTYSALHDGRIHRAKLHRYLVRQVSTQDQPLFVGDSSPWLRPEAKTLKNR
FT                   GFHHQGGHTVGVGQSYSTLSWVPDESQHWALPLRHERITSFETALTKATFQLKQVCRHL
FT                   PVRPLAAFDRHYGNGIFLNHTAGIEVDLLLRLASNRCVYGIPLAYSGRGAPRKHGHKFK
FT                   LNAPNTYPEASEILEIEDTQLGQVRVTRWSQFHFRNSAKREMEILRVEIIQPKGKRRKF
FT                   KPLWLAWTGECMPSLERLWRRYLQRFSIEHWYRFAKQRLYWTTPQLTSNEATERWSTLI
FT                   GMISWQLWFARSDCMDTPLPWQSPQQVLSPGRVAQAFPSIIAAIGTPAQAPKTRGKSPG
FT                   RKQGQSQPPRTRYPTVKKRVSKRRKAKIVSKTAA"
FT   gene            89130..89327
FT                   /locus_tag="AM1_F0105"
FT   CDS             89130..89327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33079"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ86"
FT                   /protein_id="ABW33079.1"
FT                   /translation="MFPFCCQPNTGHQTKSRENYRQHQLEFLKMIQDHLEAGLAAVSAA
FT                   INTIDAQVQNSDSQQEGDAA"
FT   gene            89278..89406
FT                   /locus_tag="AM1_F0106"
FT   CDS             89278..89406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33078"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ87"
FT                   /protein_id="ABW33078.1"
FT                   /translation="MLKFKTLTHNKKGMPPDDLTDEGDAHLKTLDLCQSELVLNPA"
FT   gene            89449..90663
FT                   /locus_tag="AM1_F0107"
FT   CDS             89449..90663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0107"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33077"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ88"
FT                   /protein_id="ABW33077.1"
FT                   /translation="MRIKGLLKASHQVRDQLKIGIPINEVPQFKQYVKDSIKVTEQICA
FT                   KAKTSPNQLPLPSRKAYKFLKSVDLKNLPIIQQCSTLQSQKRISIRQIRPQHQRLQRQI
FT                   AEVANGSGLNSKQGQDLVQQLQHTAQDIEVLCNRQVATPANLTGQSRQIYCWIKFLLSD
FT                   DNLQSHLNAVQTFYQLLQLGLEQKKPSDNTNWQQLKDPKNLSIEFAHISALYRCKLGTE
FT                   QGSIKVNEGFILADELILEALVNSILNGKTPKTTSVFYEYSLSEEFAELLMEMELLVED
FT                   LNETAQGSTYNLEEVYQKVNQAYFDGTLDKPKLCWSRTYSKRKFGHYEPSRDQVVISLN
FT                   LDTKKVPRYVVEFVMYHELLHKVHGHRTQNGRQMAHTPEFRRDERLFQKYLQAEEHLQR
FT                   LARAS"
FT   gene            90757..91455
FT                   /locus_tag="AM1_F0108"
FT   CDS             90757..91455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33076"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ89"
FT                   /protein_id="ABW33076.1"
FT                   /translation="MTTDNNYSKVLLELKTKYEQTLAELEAQTNQLKTKLNSLSPLIEN
FT                   PALGADILSILQDASDSITPTATNSASTVIETVEPKTKSKSQKAAPKASTSTSKKSTST
FT                   SKKPPSQAKTKKTPQKKNTGRSSSTKLPMKKPYDQMTKMDAIEKFMQGNPGKVIHTDNL
FT                   IKELFGELSQEQHKAERGRMKTAMYRGVRLKRWIKVPKKQMCFVYESHLAAESKKATTT
FT                   KTQKSRKKTK"
FT   gene            complement(91483..91764)
FT                   /locus_tag="AM1_F0109"
FT   CDS             complement(91483..91764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33075"
FT                   /db_xref="GOA:A8ZQ90"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ90"
FT                   /protein_id="ABW33075.1"
FT                   /translation="MDNLLSFQGVSPHKIRVYHPKSFEDAEEAINTMRTDDMLLVNLVA
FT                   VKPTLAQRLADYFAGSTFALSGEYIEIGKKVFLLAPPSFSVKRMMASA"
FT   gene            91741..91854
FT                   /locus_tag="AM1_F0110"
FT   CDS             91741..91854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33074"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ91"
FT                   /protein_id="ABW33074.1"
FT                   /translation="MKGKKVVHKPVLLCDLVQAHPQRSVNTPGSLFIHAQA"
FT   gene            complement(92010..92834)
FT                   /locus_tag="AM1_F0111"
FT   CDS             complement(92010..92834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33073"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ92"
FT                   /protein_id="ABW33073.1"
FT                   /translation="MKDNDQTTKQYSSKDLKQRKTWYSPAAEAYNRTRPHYPDTLISRV
FT                   VELTQLENGSRILEIGCGPGTATVSFANLGFSMLCLEPNPDFYEIARRNCSHYPNLEIK
FT                   NTSFEEWKPEAKPFNAVLAATSIHWIPAEVAYPKVANALQDNGVLILLWNVPAIPYREF
FT                   HQVLQDVYQIHAPSLSHYKGRDTHEAELRELGQIVATSDQFEGIVFEQIIWETSYSVDE
FT                   YLTLLSTFSQYLELDEKSRKDLFVGLQKKIDNHFAGHIKLLNISAFHIARKR"
FT   gene            93113..93355
FT                   /locus_tag="AM1_F0112"
FT   CDS             93113..93355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33072"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ93"
FT                   /protein_id="ABW33072.1"
FT                   /translation="MTDFKHRPTNLGQHLWSLRNLAEQTHAAAQSAELHSRTVGQASLS
FT                   QKLLDIQRQLCILQLRLKDPEIQEWTGKQMQLPFR"
FT   gene            complement(93877..94620)
FT                   /locus_tag="AM1_F0113"
FT   CDS             complement(93877..94620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0113"
FT                   /product="two-component transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33071"
FT                   /db_xref="GOA:A8ZQ94"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZQ94"
FT                   /protein_id="ABW33071.1"
FT                   /translation="MPEFMNNQSNKQHSILVVDDEGPIRRILDTRLSMMGYHVFTAADG
FT                   VEALEIFDRQHPDLIVLDVMMPRLDGYGVCRAIRKTSRVPIIMLTALSEVGDRITGLEM
FT                   GADDYMVKPFSPKELESRVRCIIRRMGSLKPFNYRVTGVLNIGSLHIDTNKRKVFRGQE
FT                   RIILTHMEFSLLELLASTPGAVVSRQELLEKVWGYSNGSIVDSRVVDVHVSRLRNKLKA
FT                   NQVGTELIHTIRGVGYTLKCEQSPN"
FT   gene            complement(94763..95374)
FT                   /locus_tag="AM1_F0114"
FT   CDS             complement(94763..95374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33070"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPQ7"
FT                   /protein_id="ABW33070.1"
FT                   /translation="MTPPIVALNPEPVPKTIPQPPKSVPSAPKLVSRTAFPKKTPEGTR
FT                   PAKREQGHEELRGIRRSSRRPSQSTKPEFTPKTRSSEAPQVNQLRTPRVSAELERRFRN
FT                   LELKQKNLVEQTRTRGELEYLAVSKNESEECLITVAGTGKPFVRNTFATPEFCWECAVE
FT                   IEENFEIGEVIELRPPETMERIGEMVGVWLERERVSRVWG"
FT   gene            complement(95793..96266)
FT                   /locus_tag="AM1_F0115"
FT   CDS             complement(95793..96266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33069"
FT                   /db_xref="GOA:A8ZPQ8"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPQ8"
FT                   /protein_id="ABW33069.1"
FT                   /translation="MIESRPSLSLNVRLTEEQLGFLDYLYPNVDPEDALIRLLERARNR
FT                   AILKAEQQVHILHPRQEEAEQPETSPDQPISQVDEQVKNPIGQLQELCQKQQISLPRYE
FT                   FSEISEGFRCLVQSMGLQGVGEGASKKKAKMGAAEMLLKRPEEGLCHISPSKG"
FT   gene            complement(96263..97339)
FT                   /locus_tag="AM1_F0116"
FT   CDS             complement(96263..97339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33068"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPQ9"
FT                   /protein_id="ABW33068.1"
FT                   /translation="MPSASIDKLNQLKRQLQDCINPTAAKLLKSTIAKLEAQLNIGQDQ
FT                   IEVSKIDQIKTTNTNSSKIAQRKAAHKKSERKSRQKASQKQRTTLKPPSLNKIEPKPEV
FT                   ISQSKNLPNPAQEKLHVKTVDTPNRKNSNSKDQKQAKTTSKSKSGELSEKPPLLPGNGT
FT                   HRAWCRIPGIIRVREKEFEAGRTKSLYFVEVDGQPIKLFLSKKSFKKVKSVLDKPVLVF
FT                   GYPNIMNGQITSLQLTGTSQRASAKTENWVLIGVWRADKQRVLIQRDQERDPEIHIRQH
FT                   SPLVSEDCLEKLKDGKLYEFICHRDGVTVKVVAVGERSTPKSNATESTDQEITDPEIKD
FT                   QDIIDQVLSKLESSTLQV"
FT   gene            97327..97569
FT                   /locus_tag="AM1_F0117"
FT   CDS             97327..97569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33067"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPR0"
FT                   /protein_id="ABW33067.1"
FT                   /translation="MQRAWEPPWDRTCGHSSVENWDLGKVKVFSTNHYWVFNLGLRSEI
FT                   MNTCALQGILLEKSLRYTQEKRAIAEFVIEINPLK"
FT   gene            97660..97776
FT                   /locus_tag="AM1_F0118"
FT   CDS             97660..97776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33066"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPR1"
FT                   /protein_id="ABW33066.1"
FT                   /translation="MQGQLRINKVTHRLGNEEYVDQQASLIVDKINRIYDPD"
FT   gene            complement(97806..98195)
FT                   /locus_tag="AM1_F0119"
FT   CDS             complement(97806..98195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0119"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33065"
FT                   /db_xref="GOA:A8ZPR2"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPR2"
FT                   /protein_id="ABW33065.1"
FT                   /translation="MLNYVSVGVTDIDQATSFYDVILGIMGYVRLYEDPGQVVGYGETW
FT                   PEFWITQRSDLSQDSEVRKETYISISAPSFEAVDAFYKTGLEVGAEASDSPGYRPTYGH
FT                   EFYSASIYDLDGNHIEASYYELSSF"
FT   gene            complement(98368..99711)
FT                   /locus_tag="AM1_F0120"
FT   CDS             complement(98368..99711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0120"
FT                   /product="cytochrome P450 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33064"
FT                   /db_xref="GOA:A8ZPR3"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPR3"
FT                   /protein_id="ABW33064.1"
FT                   /translation="MTANASQLPLHDEAHRISGLAALRELFTFARNPIEFVTKSAQEYG
FT                   DTAILSLGSIEIFLFHHPDLIAEVLNTQYQSFIKDVSYRSLSKVLGNGLVLSDGELWRR
FT                   HRQLMTPAFSQERISAYASIVVEETSHLLKHWKKGGILDIYQEMRQLTVKVIAKALFGI
FT                   DVTQTALEIGDALEAISLQIYHRAQTNFLLPDWMPTKSNLRANRAIQYLNKIVISIIEQ
FT                   RYQSPKDDLLSTLLSVKDEDGNQLSFEELRDEVMTLLLAGHDTTANALTWTIMLLAQHP
FT                   TVANQLRKETQTELDGKIPNITFLPRLAYSQKVIRESMRLYSPAWILTREAIQDCQIGP
FT                   YRLKKGAGVVVSQWVVHRDPRFFEEPEKFLPERWQDNFEQKLPRCTYFPFGAGPRVCIG
FT                   KAFSMMEATLILAMIANQFHFKLVPDQSIELLPSITLRPKQGIKMILD"
FT   gene            100199..100315
FT                   /locus_tag="AM1_F0121"
FT   CDS             100199..100315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPR4"
FT                   /protein_id="ABW33063.1"
FT                   /translation="MSLQWENMDGRFSHLINPLRMLIFLMKAILSKDHLTAQ"
FT   gene            complement(100457..100606)
FT                   /locus_tag="AM1_F0122"
FT   CDS             complement(100457..100606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33062"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPR5"
FT                   /protein_id="ABW33062.1"
FT                   /translation="MYLGGSADLHGLLTVKETLMLKKVFLEDFDNSYLNRKSKWFIHRL
FT                   FEQH"
FT   gene            100510..103041
FT                   /locus_tag="AM1_F0123"
FT   CDS             100510..103041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0123"
FT                   /product="haemagglutination activity domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33061"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPR6"
FT                   /protein_id="ABW33061.1"
FT                   /translation="MNYRSLLEKPFLALGFLLLSANHVNPQILPDTTLGPESSISMPNQ
FT                   LINGIPSIRLTGGATRGSNLFHSFLEFSINNGQAVYFDNPLSVKTILSRITGNKVSLIN
FT                   GVLGSTSNADLFFVNPNGIIFGRNAVLDINGSFFGSTANHLRFMDDSIFSANQTHQAPL
FT                   LTNSLPKSLEFEGGNGPIQVIGEGNRLTDFTILPIFNPFDRPLGLALRPQNTFALIGGE
FT                   IQSQGGVIRSSSGRIELSSITKGKVLLNQLNSDWTFEYSEVDSFGDIALNQRSLIDTSG
FT                   LVGGPINLQAKNILLNDGSTVLIQNLGNLPSSDITVNATDTVTVSGVSNDPRFTLPEIA
FT                   LIAGDELNVKIPSTFLTEALGLGTSGNIKIFSPTILVNGGGQILARTNGPGTAGDITIT
FT                   SPESVQIDGFAPNLPVVFSNISTATFNRGNAGNLAIFTNQLLVTNGANVGSSTFGLGNG
FT                   GDVLINAKDITLKGIVPVLFIPSAISSATFSFGSAGTLTLNTSTLTLLDGGRLGTSTVS
FT                   SGNAGKVTINASQLIKVSGTVPGSINPSLIDSSANIVDPALREQLGLPGAPLPNIPSGT
FT                   AGDVTIRTKTLLVNNGGLISVRNDGTGDAGTLRIFADSIKLENRGNIAASTAVGNGGNL
FT                   VFQIQDLLFLNQSSNITTSAQKFGIGGNIDINSGVIALSNNSVISGNAEQASGGNIRIE
FT                   TQGIFVSSDSKITASSQLGPQFSGNIEINTPNIDFTKATLDLAVRPEVEEVAISCNIDP
FT                   GEVASEFTRPGSGGVASNAEKTGELRVVKNRNNNLQTQEYYLDPETGEPKVYPKVVGWK
FT                   RNPNGTIAMTSDPTEAVQTQAFCSRTAHNNL"
FT   gene            103048..104751
FT                   /locus_tag="AM1_F0124"
FT   CDS             103048..104751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0124"
FT                   /product="surface antigen variable number"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33060"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPR7"
FT                   /protein_id="ABW33060.1"
FT                   /translation="MITIKKTVVLGIAGPCFFAHPAIAQADSLNPSDLIPRKSPFPEIP
FT                   RLPQSDKPLKTPLLPGQNPPVLVDESVQVETFIFKGNTVYSDLDLSKIAVPYLQEPQTL
FT                   SDLQELTQKISEFYANAGYVATSATIAQQENSKITPDKAVITILITEGKLEAVDIQGAD
FT                   RLEKYIRRRLPKPNTIINEDTILEDIRLLQANPLVKQISASLIKGAYRDRFTLNVEVVP
FT                   AKQRSLALILDNDRSPSIGSFQRSVDFTDRNLLGLGDTVNFKFSNTDGSNSVQFSYFLP
FT                   VNSQNGTVGVKYFYGSSKVVEDPFDEVDISAVADYTEVFFRQPIIHEATADSVQEFALG
FT                   LSFSRETSDFTLLGIPFPVSRGSDPMGETKTSVLRFSQDWSKQSAENVFFARSQFSFGL
FT                   PILDATINSTGPDGRFFLWRLQGLWGRRLFDDWTITFRSELQLADSPLVPAEQFTLGGF
FT                   SSARGYRQNLLLGDNGWLGAVELGIPLYSGSLGNLSLAPFFEVGTVWDNQPQLIATPST
FT                   LASTGLGLRFQAKDCLSARIDWGIPLINMPDNRSTLQESGVYFSLRCDIL"
FT   gene            104736..107204
FT                   /locus_tag="AM1_F0126"
FT   CDS             104736..107204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0126"
FT                   /product="TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33058"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPR8"
FT                   /protein_id="ABW33058.1"
FT                   /translation="MRYSLAILLSTTMVLTGLPVWADAIEDAGQYAAKGQSLLEQGNPS
FT                   AALETWRKALQIYKKEKSETGEKNALVNMSVAHQAKGQYPSACWVLMDALEVDRSAICR
FT                   NVNRPTPEEVDNALNIIKKQPDTSLTLKALQELGITLRVIGNLDESVSVLELALASAQR
FT                   QNLGLEQNAIRMSLANVQADMIRQAQNRFSLSDNPLTKAQFVAVPTSTLPEVSQTYLDL
FT                   AEQGPEFLQARLNWLKLFLAIHQWANQDPTNPKLSALRASLLPHLASTLNKAVVADYTI
FT                   ESPIESIYSRIKLAKYLLEIQQNDLPVSTEKHPLIHAFELVNSARNDALNIKNKRAESF
FT                   AIGVLGKLYKTSQQIEQAQEAFEAARVLAATSESSDSAYEWEWELAQLYREKGQTQEAI
FT                   SAYERSFKHLDQVRGDLLPIDSELLFRFSDKVKPVYQQYISLLLESDSPDLEKVVLTNE
FT                   QLQVAQIENFLHCGKLIFVSTTKIEDAPTTIHILELEDRFEILVPNNETWARFSADGER
FT                   VRGLARKLLIELQDQGFSDTDDNYLLAESQSLYQLLLGPIEQQGLLPDQEDTIVFVTDG
FT                   LLSNIPLSILHDGKEYLIERYSIATNLGRLQAPKATNPERLKLLIAGISKASPSLSAPQ
FT                   VPQDLEVLTETEEEANLISSSIRASTLLNKNFTADNLQRKLNDDYNALHISTHGQFSSD
FT                   PNQTFLLAWDKPLPLQELDSILRQGTQVAANNLELLFLSACQTAKGDPLSSLGIAGVSI
FT                   QAGARSTVASLWLVDAQSTAQLAGSFYESLANGKTKAEALRKAQLALLDKPATRHPYYW
FT                   ASFFLSGSWL"
FT   gene            complement(107165..108064)
FT                   /locus_tag="AM1_F0125"
FT   CDS             complement(107165..108064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33059"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPR9"
FT                   /protein_id="ABW33059.1"
FT                   /translation="MAQVQPKNDACEPIGRILKTNQQNLVGKLLCNGDQIVSQIKGGMV
FT                   LCYFSGSEQPCQPKKQTRNSRKKCPLSSRSFCKRIKGGQGSGETPRIITPYGRWLLETR
FT                   PSFTWLAVPGATKYQLEVADQEKGLWSITTTSTSAAYPTEQAPLSSENHYKVSVVAYRN
FT                   DVPIVADSSIFRLLDSAKTRRLQQTIQLIRRLNLDPDQEAYLDLNAAYLDEGLLNQSIK
FT                   ALRDRVQSGSNHPEIFRVLAERYIDAKLLSEARKQYLKAKQLAKAQGNQIALKKATEGL
FT                   QALDRYQSQLPERKNEAQ"
FT   gene            complement(108180..109916)
FT                   /locus_tag="AM1_F0127"
FT   CDS             complement(108180..109916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0127"
FT                   /product="serine/threonine protein kinase with TPR repeats"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33057"
FT                   /db_xref="GOA:A8ZPS0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPS0"
FT                   /protein_id="ABW33057.1"
FT                   /translation="MSYCPNPNCDQRQNPDHLECCQGCGVSLLIGEKYRLLKPLNDLHP
FT                   LRRTDIYEAQAGDDDIKIIKILKDVQPKLVTMFEREYVALRSIRHPCVPRAEWWEYYTI
FT                   KLNPIQSPSEIYGFVMERFEGQNLKEWLKTHDPVPPHQALNWLKQLAEILHAVHNERFF
FT                   HRDIKPSNIIVRPDGTLALIDFGAIRPISETYIAKLATPENTDDITERFDDITLIQSMG
FT                   YSPLEQVNGKALPQSDFYALGRTIIEILTGIQPYKLPIDKQTGQPIWQDQAPRLHRRFA
FT                   NLLDKMTSIQPGDRHQSTQYLLQDIGKLELWEKTSRSPYFKCSVGFLAVLLAVLGSFAI
FT                   REIKGEYDQFMAERHFIKGRDEQLNNQLDAAKQNYQQSLRLNPNNEEAYNNLGLVCEVQ
FT                   GNLPCAIENFQKAAQTNPNYWISTFNLAAMYEDQGNNNLAERYYKLVIDNATDIQVVGS
FT                   ASNLSRLKILQGNYEEAKVLVIGALDKAAEDLSRARLLKNLGWAEFKLGDYRQAEGRLQ
FT                   QAIRSDPEMAAAHCLIAQVYQEQGNDTLAQQSWKACLRLDSFLPEVEEWKDGVLDKIFQ
FT                   KP"
FT   gene            complement(109932..111305)
FT                   /locus_tag="AM1_F0128"
FT   CDS             complement(109932..111305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33056"
FT                   /db_xref="GOA:A8ZPS1"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPS1"
FT                   /protein_id="ABW33056.1"
FT                   /translation="MEEFYAWVDDQSLKIRGKKLNEVENYILRGSIEGLSYEALADKSR
FT                   FEKVYLCNTAGPGLWRFLQEAVGDEHKIGKPYIQGFVRNLLQSVDELPKNGELWIDKAQ
FT                   PLIGYLPTHENIYGRAKEVETLLKDTQANHCVVITGPVGIGKSSLAAKLVDTVRQSPDY
FT                   EYALYIWKSIGYSPKMEDLCRDIIRDVNPEAFDKDKAYTSDDFIELLKTNRCLLVLDEC
FT                   ESILKGNSFNPYGEENSSYGIFLRRVIEESHQSCIVLTSREIFKDLDELGNTGKPVKTL
FT                   QLLGVTADESVGIYKEYDLSGKKEWIKIAGQYRGNPLALNSIASRIKEFFGGQVSRFVE
FT                   YETTWLGDPFLSKFDQQFSNKGNYNLLEIQILVFVAQQLEQNESITLDSLVQYLVEECQ
FT                   CVTSKSQILEALNSLTERSVIEKEFTARALELKMPPVLQKYLNTDPTGAVKSRITQAA"
FT   gene            111633..112217
FT                   /locus_tag="AM1_F0129"
FT   CDS             111633..112217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33055"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPS2"
FT                   /protein_id="ABW33055.1"
FT                   /translation="MLEHNSIPEQIQPQLLKLSLIELDEGIQPRQKLSQEVITEYAEAM
FT                   RQGATFPPVIVFFDGNKYWLADGFHRIAAKKANGDLEIITEKKLGSRRDAILYAVGANA
FT                   TYGLQRSNDDKRKVIKKMLSDHQWCQWSNREIARRCKVSYEMVRNIRNELPDNRCQIQK
FT                   LTKISRKGDRRLVLRKGKTYSMNISNLKHPK"
FT   gene            112417..113517
FT                   /locus_tag="AM1_F0130"
FT   CDS             112417..113517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0130"
FT                   /product="streptomycin biosynthesis operon possible
FT                   regulatory protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33054"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPS3"
FT                   /protein_id="ABW33054.1"
FT                   /translation="MPPQKPQSNSSEPTVQSIVIANIRVDGGTQPRSQLYEEVVAEYAE
FT                   EMKEGADFPPVTVYFDGKEYWLADGFHRVRAKETLGEKKVAAEVYCGTQRDAVLYAVGA
FT                   NAKHGLRRTNADKRRSVERLLRDYEWSRWSDREISRKCGVSSTMVNNLRKSIESPEQSS
FT                   AKDDNFISDDLSKIRLAQRGGKTYEIDTTNLSKINQKKTLSPRRKRAKKQPKSTSESIE
FT                   APPKRVRPGEVWKLGRFHFLFCGNPDSDEFQQLLPSEISLLLVFPQSSEQWPQTRPQNA
FT                   RSVVVFDTPFGEDLHLETLRGIIENSLAGTTDANDPVVIINLLDPSLFILIDDLQCRCC
FT                   CAEPDPQRCSDALTAWSVTNQPSKRL"
FT   gene            114112..116133
FT                   /locus_tag="AM1_F0131"
FT   CDS             114112..116133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0131"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33053"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPS4"
FT                   /protein_id="ABW33053.1"
FT                   /translation="MNAEPVFYGHENKSRVPHRRTHDPLPADPVGQRLALLFPNGWDWI
FT                   FASAPDPGNPVDWETVKKFPLSPVEMWSHHQDPDCLIGVRPSAQTRWLVLDIDKDSRYH
FT                   PSSDPEWLPKIRHALEDIGICRSLLCQSSHSGGLHLYLPLPESVSSFWLSVCIKLNLEA
FT                   EGIKFYGGQCELYPNPKRYVPKGKGYSLFAAFRLPMQPGSGFHPLDADLNPLPWSLETW
FT                   LEAFELCADGQDMGRLSHAIADAQQNFKVRKSGNASSLATWQERIHEEKQQGWTGPCQT
FT                   NEKLKIIACEARVFLGMDSPEQIAEYVCQTAQNTPGFNEHCRHQHEIERRSYEVATWAM
FT                   RYYWPAGSAPTRDAKYHDKQVAPADFGYHQSKREAAQNRIKQAVLELKRVDKLPPGIAA
FT                   RASAIAKLAHTSQKTLYRKSNLELWHPHHLPPEPPQKAPEALQKGTITQLGSNNTHLLN
FT                   QRKLELLLFRSFLQLYIYVGFVIQTIRIQAAVALAPKGQRAAKAALESSEDLDRGGLGG
FT                   NSKVIPIQNWDQLHLSLPPGLQQKISNAKRQQKRELELEQRRRQRLKARKSQRKAHSEA
FT                   NTELRPQQEQLPLHLVTTGDQPIERQARLSEREEFDRWYRLAQQCKLVADYSWRDGEYW
FT                   VLAEEQWQPYSELSAVFTLRAMERMFGVSFDFGDGRDD"
FT   gene            116126..116362
FT                   /locus_tag="AM1_F0132"
FT   CDS             116126..116362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33052"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPS5"
FT                   /protein_id="ABW33052.1"
FT                   /translation="MIKKTIFILKDEESFVKDFDFKQQQLMLTKEVSDAYCFNLIEATE
FT                   VVRCLGWLASERLVIKPFKGKFAPGQIILTRSM"
FT   gene            complement(116455..116586)
FT                   /locus_tag="AM1_F0133"
FT   CDS             complement(116455..116586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33051"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPS6"
FT                   /protein_id="ABW33051.1"
FT                   /translation="MGSDERNEGRYLQAKYCLKKTVNRASKGYTFAVFLLRKVRKQN"
FT   gene            116667..117098
FT                   /locus_tag="AM1_F0134"
FT   CDS             116667..117098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33050"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPS7"
FT                   /protein_id="ABW33050.1"
FT                   /translation="MLTVNSSQVTTEPVEDRQQPQISKATPELVKEVYQQQYRETYAEL
FT                   AITVQQSLGFPVLGTFEALFQLGCREPEKSKLIDQGVAEHPLLKDWPMGQEDCIGLISQ
FT                   GPYVQSQLNYHGVAVGDMMQYVYELFRDRTVEFAEVSNA"
FT   gene            117156..117371
FT                   /locus_tag="AM1_F0135"
FT   CDS             117156..117371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33049"
FT                   /db_xref="GOA:A8ZPS8"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPS8"
FT                   /protein_id="ABW33049.1"
FT                   /translation="MQPLSHPIGRRLSFNLSIKTILAVIFGLGLGLPIGYFAILSFLQP
FT                   TSPSTGQNAIENAGVELGKGVRPLTP"
FT   gene            117393..117890
FT                   /locus_tag="AM1_F0136"
FT   CDS             117393..117890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33048"
FT                   /db_xref="GOA:A8ZPS9"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPS9"
FT                   /protein_id="ABW33048.1"
FT                   /translation="MSSLAPYVLWPHGRARHARQHYLKRYFHRYTHHLTFVLTFLGVLL
FT                   LNAQSALSQNPGQTLGQGARNTGTRSGAASSSCLGWMCGPKSAIAASPHFNDSGSLVDL
FT                   AFLLLQIVVIMIVVVPVVIGAWKASRHEEYGGFIAFAFVVFVGLIFSNALAGYVMGTGN
FT                   LA"
FT   gene            117904..120951
FT                   /locus_tag="AM1_F0137"
FT   CDS             117904..120951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33047"
FT                   /db_xref="GOA:A8ZPT0"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPT0"
FT                   /protein_id="ABW33047.1"
FT                   /translation="MSDNTIQYTPSLDKAPDRFFIPGQFLIPWIAIITGVAVLYLLVAS
FT                   VTPVSPWPFGLLLVVLIASHWIIVGDKPWKFGGSLHRPKEYVTAHAEYKTTSTSLKPKI
FT                   GPKVVGGARKRKAFPIEDEVDLACMAIIRLQGYVVGAYLLQVGRRFRFVWVFDSPGLSS
FT                   TLSVDQAKAAAQKLEEGLMDLPHAEQMTLHMGTMADCQERLNQLEDLKRRAPSDQFRFL
FT                   LSWLKERVKSLTRRGQYNPKFLRFYVTYTVGVGMSQQDDQIQAVAQSLQEMWQEHMGSG
FT                   GSNIYARTEQMLLDAFRHGFLPTLDFFEKVGLKVTPMTADQIWAFSYQRVNSGKVPPIP
FT                   QWVQLDENGITWGKKSELRIASVLFGQGIFMDKRFVHLPGRNLYCGGVVLNKRPAREYD
FT                   PDTGRLQQLMDASSPINAKKVSNTELIVEFTPDNQQDVLKSSQKRTGQSNLSLVMSQNR
FT                   KKLDGGAIHNTNTDLAAEMKLRQGARVVRCAWMALIYRSTPDALDVALKRFRTNQSLFA
FT                   GECLVRERGYFDQLWLEAQPYTWRTLLAGGGLLKISSFERRIRETTPAVLGITPVMLDR
FT                   RPHKKGVELLTDNGTPLYVDPLASEPKHNHMIILGGTGSGKSFAVSACCEQVLAEGGQV
FT                   LIIDATRGDGSGTYDELTTFLGGAYFNTTTDSFNLIEGTDFRQLLGNQDAYKSAQQTFR
FT                   QFVQTALMDLCLPEDVNSEKRESVSRALTFLLDNFFKEPSILTRYNRAFDAGMGTPAWE
FT                   QIPTLTTLTEYIDPSNVPPEVLTQDIIAAIDTLKVSLSALLRRPIGAIISRPTTFNTDA
FT                   NLVVYALGNIDNDEDMAPLALAAQASVLSRSLGQKPTLLVGEEGSKLHKFKSYRQMLGS
FT                   FYSIGRKNGIWTIWVGTDLQVLAKADNAAEILANVGTYLVGAINEEEVPLLVKLGIPRE
FT                   LLIQNVDEEFIPSRKDACSKWLISSNGNHQFGRYHPSFANFGLTMNGPDEVPVKASYKA
FT                   QCPHEPYRWVSELAHHLKSQSHDANH"
FT   gene            120963..121997
FT                   /locus_tag="AM1_F0138"
FT   CDS             120963..121997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32994"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPT1"
FT                   /protein_id="ABW32994.1"
FT                   /translation="MSPHKSIICSVLLLSVLSPLSVYANPQPGDSPYNVSDVFTPSGDQ
FT                   PKSKGGLLGKLAKVSNSKEFKSVQDIAKYVNLGAGLLRTTGLNVTPYLNYPNILLGLLS
FT                   LQQKPDSDLQNPEAIAESQSLLEVLGAAGLPDPEKAKIVFSDYDLDAEADSENNIFGVP
FT                   PALQKRISNNLSQIKAGQAELNLLLGSKGQELIKSARSSIAQAVASSASIADQAEQATS
FT                   SQDVLKLARRQEAETAKIGQATYEEAVQTRAAIYQGNKQLYNLAEIAQERKKAEQIERS
FT                   FVNSGQMGEMGRLAGLVGPATPNRPTRNNRSVPQSQLPRLPRLPGNPVPPATPSSPRTP
FT                   PFRP"
FT   gene            121994..122215
FT                   /locus_tag="AM1_F0139"
FT   CDS             121994..122215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33046"
FT                   /db_xref="GOA:A8ZPT2"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPT2"
FT                   /protein_id="ABW33046.1"
FT                   /translation="MNHLFTLLPEVMGRLEVSQSLNLAIDDLWQQTPFSFWFLTATHVS
FT                   ALIAAILFSTGCMRWIKRSTRSLFPPLS"
FT   gene            122212..123288
FT                   /locus_tag="AM1_F0140"
FT   CDS             122212..123288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33045"
FT                   /db_xref="GOA:A8ZPT3"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPT3"
FT                   /protein_id="ABW33045.1"
FT                   /translation="MNILIAQAREDQASRILENTLESSATLRTAIDTTWQQTIKGPLFV
FT                   ALGDVGAIIAVVFIGFWFISWVKILVSDDAIVGPHALQELIVPILLLFLLGNPTNRGNL
FT                   LGETILNSNKVMQNISDYVIVSLRQDIKDFNPVHEAAVQMSATRIYRRATKDCLKYEFG
FT                   DKNRRACLLDADQKIFDLLYPYRTRSWYREFREQVKIPVQLLSTGIPDIGEIRGQDPRE
FT                   VSHFLTGLSDVVSDAVTSILFGMGVAFVIAIEHAKLLTALVAPVFLGASILPVPGKPIT
FT                   WWGTTYSGLGLLEILYKTLVGLGSLSILNAGPTDPLIFPLVISLFGIFIAILLAGGGGI
FT                   ALFSGIARMGTAGLPRRY"
FT   gene            123288..124028
FT                   /locus_tag="AM1_F0141"
FT   CDS             123288..124028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33044"
FT                   /db_xref="GOA:A8ZPT4"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPT4"
FT                   /protein_id="ABW33044.1"
FT                   /translation="MTFFDRLERRSINLQPILTLLNTGICGALLLVIVGQGFNINGLRR
FT                   QVETLEARPVVVQAGQNQELVNVEAVDPRNNMRNFVEESLPLLFLLSKRVPEEIIPGGL
FT                   DEGIDLHDIGRIPSIVHASSFILSSEYQPTFLAGIPNLMPEDYEHGGSKVLRVNRTATP
FT                   KPVKDEPGHWRIYTQATLYQFDAQQKPVQARTFNRDVYVRPVSPPKSSATLTPVQALIN
FT                   ATRNRGYEIYDIAVNPTEVARHAQ"
FT   gene            124018..125871
FT                   /locus_tag="AM1_F0142"
FT   CDS             124018..125871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33043"
FT                   /db_xref="GOA:A8ZPT5"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPT5"
FT                   /protein_id="ABW33043.1"
FT                   /translation="MPNEGTTTVVEPVVADTAGEHNLEADVGATPKDAATPEAALEPHW
FT                   QAYIDAAPSSLNTSDEVGAEQGDEGGDETPEDEDAPQLQMDTYGTEAVTDPYTIKTTYN
FT                   FVNSPYTRVAIIVGGLSLGIFFLFGLYKVFVTARSQPPENPILSDAYAEYPQDYGPEGS
FT                   PREQELENQLDDSQQRNTYTDQLDEVTTFNQQAQTPQKPPTPTVTQRPAAPSPRLVAAR
FT                   SPIPLRPLAVPPTPQPQPQVARPTAVSTTRPEPEADPVAQFGSVENVGFYGAPASESYT
FT                   PVATAPDPAPPSNTTATAQPQFPIEVAQASPTQSLIPSPSAPPSPPVDGYQPPTEGTSQ
FT                   PLTEGTTISLLSPQPPASPVGTGSPPQTYPAPSTGTHLRAQLPTTAISSPAQGVPPSPS
FT                   APAPSADSRILTMDSKGKAKLKRAVAWRPNSPDVLNGQSYSLELTKTFKNTAGVEIFPK
FT                   GSQAIARVTEATRDGLVMMEVTAIKTQNRTIPIPSGAMEVQTKDTNFLEAKLEQKGGTS
FT                   FGNRLLNGLFRMGAQGIANSTSLINRPLSQSSFSSSNGTVVTQQNPEADLIAGFAEGAT
FT                   SELSEIVKDSAPNQDAVVSSFYKLSKGKSLDLYVLRDISIN"
FT   gene            125882..126349
FT                   /locus_tag="AM1_F0143"
FT   CDS             125882..126349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33042"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPT6"
FT                   /protein_id="ABW33042.1"
FT                   /translation="MRLPPRLLGPLVGLSFTLVSTPSVQAKPVNTKDTVQIPSDWLNSR
FT                   VYEGLKVDPSGVIITLRTGEKVGGLTILPWQHVDVKPLNGQLCAGGGQCNGTAPTIIQL
FT                   FRKSPQRVKGLVYNADGTSLMTITTNAGNTYQFRLEPTSAAPKRKININPQ"
FT   gene            126354..128966
FT                   /locus_tag="AM1_F0144"
FT   CDS             126354..128966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0144"
FT                   /product="peptidase, M23B family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33041"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPT7"
FT                   /protein_id="ABW33041.1"
FT                   /translation="MKRPLTLLIAAGLVVSPWSLPVNAQIVRPANRPTSRQQAVNQSRP
FT                   TTPQSTTSPGLIYSPSGERAPSFSQMSGATAPGQIELPAHVQMDYQFSRAFPRGATPDQ
FT                   MTKWGDIPNNPQFVGFHKMTLRELSRSSGQDIAGVPLNEIDLIQGMTVEEVTQLYHGLE
FT                   DKPLDQAPKILQIAAGITNDPKGTLKQSKGAALTFGQKALIAELAKKPALKGISLERLS
FT                   KGDWGNILTPGEQGEVAKILTKVNGKIPLEKLFPMTQGVIVGDWESVRKQAQAEATRQG
FT                   SKVLVKELMKNEKFRKMPLGSLTLEELDLEETLPGLIDQPIATIPKIADKYLSDIPGMS
FT                   EVPVDHLPFDLKFTPSKDDVIARMDVAYAGPTETPITRVISGGTKNQKFKPEPCLQQRC
FT                   SHFELDNVDGGGPPSKVSGKAWVAGKDQPTPGGKGFLALVNNGKEPAGIVPWTTAAHVK
FT                   ISLENIKEGGNGEPASAQLWAHFQFCKKVPLLGLQCTPHFIPFPTPFKLKEKSLMLIAT
FT                   SGGLPAYLQNARNQQNFCTPAVANALQANASQGSASDTAAVSSPSPDQHIAPATSNQAD
FT                   QNLRQYLKRIAAGESTGGTDWRQHPDTGAYGVYQFTPESRATMLRRTGIDPWSKDRATA
FT                   DKAAVFWIQMIGGEQGVDLLGTIQKGDFAKADQILSPKQFTSLPGGPEQSKIWNNPQNL
FT                   QVYGPNGSAPDGAPTGATGFGPCASTSGFIGPEGDGIATGRLKNPTPGAVITSGYGPRV
FT                   PPAPGASSFHAAVDLALPLGAPILAADGGVVEYSGVKGGYGNYILINHGNGLATWYAHN
FT                   NANNVRVGQKVTAGQQIGTVGSTGISTGPHLDFGVVDGYKAGNLYSGQAVNPRKHVRF"
FT   gene            128977..129351
FT                   /locus_tag="AM1_F0145"
FT   CDS             128977..129351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33040"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPT8"
FT                   /protein_id="ABW33040.1"
FT                   /translation="MKKLLTTLLILSAVALPSQVLAQNSSIDASCIPETGSRIPVEKAV
FT                   IYATTTQDATTYHYVVLHPKDLSQSLGVVLVEVTGGQCKGHLVDFAGNTLPFEQFVPAP
FT                   VAKELVDQATRNWNNRQTSP"
FT   gene            129399..131174
FT                   /locus_tag="AM1_F0146"
FT   CDS             129399..131174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0146"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33039"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPT9"
FT                   /protein_id="ABW33039.1"
FT                   /translation="MHPPIAQIQTSQTESTPTHPHPPQPSTPFGGINPQLLLMGGCMAL
FT                   LLVPMLFQKYSGQRKGILARARFATAREIHQSKIYARKLIQQNKHNKVALWIQEPKGII
FT                   INHQKRQIEIPPDNNSFYVSHLEEHSLILGNTGSGKSYSVLDPFKRSVIKRGQPLFDYD
FT                   YKGHEESPHSLAPSSSIAGYALDHGYKVYVVAPGFPDTDKFNILDVLKHPQDGANAFQL
FT                   SNVLNENFKLSASDQGADFFSLAGNQLIQALFMLVKGSEVCADIALAHKILALPNFSKR
FT                   IAEVQLPQYQKVAFDNYLASADSPETAASIATTASIMFSRFMIPEVLSTFCGQSTMPLE
FT                   ITGRTMVIFRLNPQIEFAVAPLLASIIYLMINRNIYMARKDPVHFFLDEVQTLKVPSLS
FT                   KVLQVARSAGGCFYLGTQGIDLLESTYGVKETENILTGCKTVFVGQLSHNGTAEYYSKY
FT                   FGMEDISYKNKSRSHGKGGTNRSEGDQQNTRPLVEIQQLLELPQGQFYCRNRGIGNKKA
FT                   VRIPVHHQTVIPPWELRDMDKGKQTWKKYRKLRIKQSKIQPLTDQDLETRESVARSLVP
FT                   DHANVAAGQQAAVRY"
FT   gene            131179..132084
FT                   /locus_tag="AM1_F0147"
FT   CDS             131179..132084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33038"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPU0"
FT                   /protein_id="ABW33038.1"
FT                   /translation="MKITCPICKWPLYLPEQPQEGEEMGCRHCHSSFAMTHTHVVESWA
FT                   VTTQHQIPSAYLAILFIREGKTHRVQLDRDIPPGLNCIALTPLHGLGKHQPILLLDLQT
FT                   AGVYPLTHPRRLSRRYQLQGALLIAAIAAGIGMELNLPQNVTTGAGITSSLAGAYGIAR
FT                   FNHGRERDPKRRTQLLRSQSLLKQSHQLGERVRELERELSQSQTLSQQLQELSNRPTVV
FT                   GQSKETILQRGHKVIEGKNAVLQRLIDCCRNSKDLIDVELMAAQLSEQLPDGIDQQLLA
FT                   YQSEIEKLEEEYEGMLLTTV"
FT   gene            132107..132508
FT                   /locus_tag="AM1_F0148"
FT   CDS             132107..132508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33037"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPU1"
FT                   /protein_id="ABW33037.1"
FT                   /translation="MPKLFTPEKIEVISQLRPEIQQLRERYPFTFAEYAETILAGQTDP
FT                   FPPGHQFEQFAVYYGDTARRPGYLFMDGKATIDFVEPIDTGVIQARGNWDWVYFQVEGY
FT                   VLLNRIEQAALPQMPTLDELANMVAAATE"
FT   gene            132596..134248
FT                   /locus_tag="AM1_F0149"
FT   CDS             132596..134248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33036"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPU2"
FT                   /protein_id="ABW33036.1"
FT                   /translation="MPIHQAAQNQTHEVQEANARAVEGSARMIAEAMRMSFRLMRMAQR
FT                   NAQQLSQQYGSGASDSDTPDPDTPDLDEDIELNPREENELSQEADIQLNPEQDITIKVG
FT                   KTTVYPIPEDTQLEQADVDNLIAALENPEQLQEEVTVFATQTLPDGSKSNENVFHAVPG
FT                   EVKYDPHKLVEAFAQQKVEQQDETLSQDQEPAQIVIEGETRPMSWDTPVVNQAAAPIIE
FT                   NIKNKVTQGAEAIKDRAANALERQNLLNMAFKGGTVARAAYDQAAQIPGRAEKLKEVVA
FT                   QVKEKTGQAIAEVREKAKDLDPKQLIQGKDPVQGPELPSLDDRISTLQSQVGDLQWQMN
FT                   DLQDQLKSVDAKLDVIVNRTNPPEQSNNVDKWHNNLGGMVKEKLQQIKEKITTAIQSIK
FT                   DKISEVINNFKATAFDKVEQAKEKVTEVKDNVTSRVDNTVQSVRQGIADIQAGMTNAAV
FT                   AKLVQQYGQEQPDGSRVYNGDRFSYQTQGDSVTISAKGRGNVFQNGQLTDKANVQDAQA
FT                   IQALPAKVEQEFAHQQSEKATASQAVGAGGRRR"
FT   gene            134425..135321
FT                   /locus_tag="AM1_F0150"
FT   CDS             134425..135321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33035"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPU3"
FT                   /protein_id="ABW33035.1"
FT                   /translation="MQTAILRVGDASLLVTPDGKPLPHKDAEQPTFHIMPKLFNTGAGI
FT                   GLENITLYGAHVLAFGKSGDDEKDYINVLPKDVRLTNPCPNIRYVIAGTADRKMGWDIP
FT                   LDPSKPPQQLRLWWLLETQTDSTIIEHYIDLEFELTQRGNVFSMASLNFAVGEGPRAVS
FT                   FVDPEQACEFFTRNDPAYQIGYKGADLIIRQSNKIQSCAWSDLGLEEFEEMVHLRDMTP
FT                   VDKHLAKINYIIIAVGFQNSFHIFDQRCPPPVGTHFNPLIFHELPQTLNQIEMGRIAWQ
FT                   LKQGNSPFGPLCLHLID"
FT   gene            135902..137638
FT                   /locus_tag="AM1_F0151"
FT   CDS             135902..137638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0151"
FT                   /product="transposase, putative"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33034"
FT                   /db_xref="GOA:A8ZLS0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLS0"
FT                   /protein_id="ABW33034.1"
FT                   /translation="MPNKRIDSYHTRVYMNGRDLGLKQADAAYIAEISTRTGQRIEAGT
FT                   HQPNRGRLQDQRTVPDPLADVWEDELEPMLRRDPRLKPMTLYEYLQDKYPGQYPQVLRT
FT                   LQRRVRTWKALHGPSPEVMFELRHEPGVQGFSDFTELKGITITIAGKPFEHLIYHYRLG
FT                   YSGWRYAQIIEGGESFVALSEGLQNAFAACGGVPTQHRTDSLSAAYRNMGGRRSKNLTR
FT                   LYDELCDHYRLEPTRNNKGVAHENGSIESPHGHLKNRIKQAIYLRGSADFTSVAEYQAL
FT                   IDAQVAKLNQQCQTKYEQEKDHLQPLPKYRTPDYEVLTAKVSKRSTIDVRCILYTVPSR
FT                   LIGRQLELHLYHDRIVGYLERHPVVELPRKRVSGKGKRRDRCINYRHVIGSMRLKPRAF
FT                   IYCTWQSDLLPNPEYRQIWEQLKAQFDLEQAAKIIVEALYIAAVQDKEQAVAVYLQQQL
FT                   RSSSLTLNRLKKQFEPPQMKQVPELSIEQHSLELYDKLLPSCSVPAEPLPAPEPLFKKA
FT                   QALPHVDPLGIYRIPSHAGKLVLCGILTSLVRNGGPTKRTSSSKTCPHRSQAPKRKKFY
FT                   QL"
FT   gene            137379..138197
FT                   /locus_tag="AM1_F0152"
FT   CDS             137379..138197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0152"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33033"
FT                   /db_xref="GOA:A8ZPU5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPU5"
FT                   /protein_id="ABW33033.1"
FT                   /translation="MTNSSPPAQSPLSPYQHLSLYLKKLRLSHMLTHWESIESQAMQEN
FT                   WSYAEFLLALCETEAQRREQARLKRALTEARLPNAKSFTNFDFSHCPQLNPAPLMQLAA
FT                   DPGWLERAENCLILGPSGVGKTHLATGVSKKMLEFGKRVKFFAANALVQQLQQAKLQLQ
FT                   LHPMLKKLDRYDLLILDDLGYCKKSEAETSVLFELIAHRYERKSLLITANQPFSQWDDI
FT                   FTDSMMAVAAIDRLIHHGLIIEIQADSYRRKSATQRTAQTQSQPQKSQSK"
FT   gene            complement(138311..138775)
FT                   /locus_tag="AM1_F0153"
FT   CDS             complement(138311..138775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33032"
FT                   /db_xref="GOA:A8ZPU6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPU6"
FT                   /protein_id="ABW33032.1"
FT                   /translation="MSLVRPISTESLRLLHRIYHSSRHHQVRQRAHCLILFAQGWTPYT
FT                   LASLFSVSPKTVYNWLKAWNNRGFAGLYNHPGRGRKPMFNRDQQQQIYEWTQASPIQLN
FT                   QVLAQIEQQWSVRVSKATVKRVLKQMDISLLDVNPIGDVATTTRRINPQI"
FT   gene            138903..139400
FT                   /locus_tag="AM1_F0154"
FT   CDS             138903..139400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33031"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPU7"
FT                   /protein_id="ABW33031.1"
FT                   /translation="MPPHILKQAIQDAIWTDDMQESIWNKSSGYEQSPALQRLCRWWNE
FT                   NAPNPEYRRAANIVLWVRVEDDSEYWAGWYECPNIDIGVLTSEMSANVGQHVIVQFLQG
FT                   RDAYTPIGGYGCMIWGVDGCEYIDVGATVDEVDEAYYGHHMLKDFPDRFPVAWKCLHDL
FT                   AQ"
FT   gene            complement(139441..141429)
FT                   /locus_tag="AM1_F0155"
FT   CDS             complement(139441..141429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0155"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33030"
FT                   /db_xref="GOA:A8ZPU8"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPU8"
FT                   /protein_id="ABW33030.1"
FT                   /translation="MEVTQIQNAEVVNVFSTVKVPQAPLDTAKPLSRDEHRWRKVLLSK
FT                   VQQFWIDGVLAKSLHSQVLIELGLEERNNYVYTPLEGVEEFPPESKQAFPEGTSATHIF
FT                   EDIGAGRTLLILGEPGAGKTISLLKLAESLISRTEADLNQPLPVVLNLSSWSRQRKSIE
FT                   EWLVEELFDKYTVSKSLGKSWIVKEQLILLLDGLDEVEAKHRNDCVHALNQFLQAHGRT
FT                   EMVVCSRIHDYEALSDKVTLRSAIYVKPLTPQQIDEYLEQAGESLIALRAIVNQNSEIK
FT                   SFASSPLILSIMSLAYQGSDWDNLPRSVTSEIFRQRLFDTYIKRMFQRKGTTRNYLQEQ
FT                   ATLWLIWLAQEMSRTSQTVFLIERIQPSFFQTKFQKLRYRLESGLISWLFFGLFFGLIF
FT                   GLLTTLSSWLIFGLLLELKFASTFELFSELRYQLFQGLKIGLSYGLIIGLIVGFSGNIK
FT                   TVETLKWSWREAKSIFRKRLILGLILGPILGLLVALSFEMYWGLINALIEGLILGLRYG
FT                   LILGLLSVVIGGLRGPDMLNTFQPNQGIWKSAINALNFGANFGVILGVILGVIEKSLLS
FT                   GVFFGVSAGLFFGLIGGGTTCLRHFTLRLMLYRMGHIPWNYARFLDYAADRLFLQKVGG
FT                   GYIFVHRMLLEHFASMELESHQQLRLR"
FT   gene            complement(141539..141973)
FT                   /locus_tag="AM1_F0156"
FT   CDS             complement(141539..141973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33029"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPU9"
FT                   /protein_id="ABW33029.1"
FT                   /translation="MSEEKPSQSISISGGQNSNVQIGGIAGGDQTVTQTQQIGTDGTEV
FT                   QLTQADVVDLITQLEALLKSTELPKEQASKALRHLESAKEEVQAEEPDKDYAAKSLKKA
FT                   TTVLKEAGETVAAGSNLWKKIKPIVEKVTPWLGVASGFLL"
FT   gene            complement(142129..148185)
FT                   /locus_tag="AM1_F0157"
FT   CDS             complement(142129..148185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0157"
FT                   /product="conserved hypothetical protein"
FT                   /note="Shows homology to DNA helicase but no HMM support"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33028"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR024385"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPV0"
FT                   /protein_id="ABW33028.1"
FT                   /translation="MDYYSPDVSKSVQKKGKGKTVSEAESKAAALRKLVRAQWYGYGAY
FT                   ALGLQGNVHRADFKKVFYGYNLEGERLRGFPKNEKHKERVGDDFTFSMPKSASMVLHIG
FT                   CDYRLFDAHLQAVKRTLDIVQERYGQTRVMIGGVRHTLNTKNLVIALINHHTSRANDPQ
FT                   VHTHALVMNTTQMPDGTWRSRKNDLMYMQECLGQIYRQYLAENIQNLGYKIYATKDAFE
FT                   IEGITREQVETFSKRSQQIFKQLEKDGLEATTANKQTACLKSRKAKEPGQKLTDLQAVW
FT                   QQAAQTLDYRMPQPDLSPQFEYRPDQVTTALHSAINHLSERSITFTREQIEQFVFGNIR
FT                   QFRFEDISQAMSACEELLTLRDQVNNTERFTTVAALEREAAIHQSWDLGRQTQTPLMSE
FT                   YSVRELLKESGLNVGQLEAVAKTLAHSDQFILWHGLAGVGKTRTLGQLKQVLTHLNLDI
FT                   QGYAPTTKASKVLGKELGIKTNTVAKLLVSKPSLAPHQLWIVDEAGMIGSQQMLELLGR
FT                   ARAANARVLFVGDTKQNPSITAGSPMRSLIRAGATTFHISQIVRQRNTVQKRAVSLIAK
FT                   GQGLNAVSLLKEHGYIQEIKDEDIRQQTFADYYLQLSPEERAETLLVTGTNKERLAIMS
FT                   LLRQGLKAEGTLGEEDHHIQQLASRHLTIEQKRLVQFYQVGDYIQLQKKNYRSTPLQKD
FT                   KLYRVERRLGDELLVSSSGGRLYHFNPSKYKHKEVYEVQNLNVAVGDDLRWTHNNKEQK
FT                   WSNGDEVKVVAIEGSTLHVIDEEGQHRTISLDHPVCLDYALVHTAHRAQGQSRKRVVIS
FT                   STNDPTSSKEPFYVKISRQSHEIVIYCQSFKKLDERVSESIAQDNATELLKDYHEQSGS
FT                   QIGHDSGAPEDYPGRTANPSHGDGNSQSVRSRSGGENRYIEPPRQPGVGDVTPSRQGRT
FT                   PALHRTAPRRLGRPEVGEDGGIHRQINESNGGSDPEDELLRYDLPATERGSGDGGRGDQ
FT                   VHQTTTPEQRSLDFSDAHQRQERSQLGDALAGLARSWTAYQNAQLIVASGLDQAVNQLS
FT                   EGMEEPQPPTYDMGNLAASITQRQEQQDLTEHLTQIQYVLDQIDEAVEQVTYREQIRAM
FT                   DAGLQEWQASRGLTDAIAEVEADQPDAVEHLDAALERAEAQPVLYPQMQRLVRSIREWQ
FT                   SQQQLVNALAPIAETIQQLQGHQYQGMAGLAKTITQHQNIQALSESGVLEQIQQQVERL
FT                   NSPIYPSMGALAEKIQTVQAQREIYESLAQLTEALEQLPIQPYQYQGMGQLAQTWQTHQ
FT                   DMQALDQLGLLDKLDRLTQQVAQVNQADYAGMAKLAGTIHDINAEKTLLNSGLEASLAE
FT                   LATSIEQLQSQPSIYEYEGMKNLAEAIAQRRAEAAITQHLEGVDEAVKQVQQMIGQTLE
FT                   MQELGQTVRDMREVGAVAEGPITEELKTLAERLQGKGINITPKPKFIKVFWTPETNPKK
FT                   LMEASFPIAEGHWQELLAGSGIHPDLAELNCETIAGQEILERLLSTKIEDMGAGQVVVK
FT                   EISEEFAKLRDVPDGGFWIKAGVLASSLDDPEPTESLWGSLKPDHPRMDYRRNRPQKYE
FT                   HPADVSREIFLTHVPEWLAQTIYDQYGITPRPGKHFWSVVKDNPQIPINITEGGKKTLA
FT                   VNSQGHVTIGLPGVNGGYRANDDNKKKLPIRQLHPGLAVFAVPGRHFNFLYDQETKPLT
FT                   IVNVRQDLVRAGELLVKEGCSVSASKWDNQHKGVDDLIVGAGPKQLELAISRTRPFEEI
FT                   ALKHYQYRYRKLVEFVQRRDGDLAPERMDLEVFMEASRRGELEDGYRFIEAGSKHIYER
FT                   EYLMEKALELQKHKTEVGMAMVPIVQAMAQKHGSQHGRVRVYFTPSWVMTHGPLTTMIR
FT                   EKESNRVLLRYRAGHLLHVTAQAQTLSEFQKTTQPIDQEVENQRNSLASQTCAAVRVIT
FT                   HAYGQEEAQGGDYVSEGDNWRLRSGRGYTSITDKHTGQVILEVKVGQILRMSDNPEVQA
FT                   KFEDLGQLANEITQEQQQHQRRSPRR"
FT   gene            complement(148267..148572)
FT                   /locus_tag="AM1_F0158"
FT   CDS             complement(148267..148572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33027"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPV1"
FT                   /protein_id="ABW33027.1"
FT                   /translation="MTDAKLRKRTLAAWKYRCALRPWVRTYGYAHVHHTNYKRYGHEWI
FT                   WLDLLPLSPGSHTFIHQWLGGAKTVTEQNQRGRYPNLLQRLIHAWCRATWLFVRFL"
FT   gene            complement(148696..149109)
FT                   /locus_tag="AM1_F0159"
FT   CDS             complement(148696..149109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33026"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPV2"
FT                   /protein_id="ABW33026.1"
FT                   /translation="MGSFGADWGQSGATQGQSGATFSQPNFSAFNMLILGKPGTTWGKH
FT                   GAAWGHSGAETGQIQGRRQFGALPQAPAKIPHHTPTIWQSRMMKLAEISVRFNFFKTDS
FT                   ISSAMRIILCPKVITFPRENSTSIHKENSDESL"
FT   gene            149424..150449
FT                   /locus_tag="AM1_F0160"
FT   CDS             149424..150449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33025"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPV3"
FT                   /protein_id="ABW33025.1"
FT                   /translation="MLHEFGEPNLTTSIWLEFAGSAYVLGDFAKQFAVSGLQLSKQKFE
FT                   LGITKALALIAWIAQDNGLEKGASIALGVVLPWREYKDRRAFEDQLCLQVQNYIFRGQS
FT                   VGYQLDLFTCYPEGWGVLNNMMFSEGLNNAAVWMWGFRDTTVLWAANRQREGSTEPWGF
FT                   RRFIERFQERARLPICDAQEVEIDELYLARVLGSVTSLEPEQLRSHLSPLVSGLSVLYQ
FT                   EDALTQLCEQYERIYQLYFQDAISVFERNTPQHIERIIPCGGTAWLYRSLLNEYLKQKP
FT                   GVQQSWATQQERAVMDTFGKKVVKAEGLQYRLDDPMGIFGLVRAQVKHRQPSAGGLKVA
FT                   R"
FT   gene            150439..150837
FT                   /locus_tag="AM1_F0161"
FT   CDS             150439..150837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33024"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPV4"
FT                   /protein_id="ABW33024.1"
FT                   /translation="MPDNRFDRRLRVRADKGSIEQAIVEEIEDPCTPPGRVGETILRMG
FT                   QAFFGHRAARRIHRSELEVKSAARDSIRLLREQITYIALDSGLKDELPLLLGFPQFSMN
FT                   GVSTEQGVAPVEESTSDIPDLSEAFKDN"
FT   gene            150840..151466
FT                   /locus_tag="AM1_F0162"
FT   CDS             150840..151466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33023"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPV5"
FT                   /protein_id="ABW33023.1"
FT                   /translation="MPQTKNQLIEQVAKPNEVNDEQANQLIELLQMQEGKGKKYPDEQV
FT                   QLFERACQLTRKGQPVPDAAQMALNEAQQEPQPPAPQEQADAPPKQSTLDGGVQDLVEI
FT                   AETAGESTAERLSQRPEMLSDQTIHEFDKAFFVSLGYHLQRKLSARDQSPTPIDVKVEP
FT                   AGLGILKGVQERLQAKEEAERKVLVAATQTTDQPTEPAEVVSEQQ"
FT   gene            151453..152016
FT                   /locus_tag="AM1_F0163"
FT   CDS             151453..152016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33022"
FT                   /db_xref="GOA:A8ZPV6"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPV6"
FT                   /protein_id="ABW33022.1"
FT                   /translation="MSSNSLKQSPQLMSSDEMEVVSREVYDVASADAQRLIEAIHKHRD
FT                   INHQSVLEAYNLVFTRELNRLLQSQKVLGAVAIDKVSPDRVRLPVNGAPNEADLIQLAQ
FT                   RQLFLVLVAVAAQHEKVQEIKERRCEHGITLLRNLTDLLRELFGSLLGLVLLLAMFYGL
FT                   GVATGVNLPGEVICRVRIAQCAGE"
FT   gene            152054..152236
FT                   /locus_tag="AM1_F0164"
FT   CDS             152054..152236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33021"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPV7"
FT                   /protein_id="ABW33021.1"
FT                   /translation="MPTLRAEIADIITQNSVERAALEILALLEEKGLSLVENGWLDDDT
FT                   ISQLNHISEEKNDEK"
FT   gene            152226..152588
FT                   /locus_tag="AM1_F0165"
FT   CDS             152226..152588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33020"
FT                   /db_xref="GOA:A8ZPV8"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPV8"
FT                   /protein_id="ABW33020.1"
FT                   /translation="MKSKFALLMATAIGILVVQPAMAANLSSSEIDQMLQNIAIPIAMI
FT                   ASSILAIHIFSSGQLSYVQMRKQPGKIRELIGITCMSFALCSLPSLVVGEFGSGNVTLL
FT                   LINGALIAFGLMIRSQ"
FT   gene            152698..153297
FT                   /locus_tag="AM1_F0166"
FT   CDS             152698..153297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33019"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPV9"
FT                   /protein_id="ABW33019.1"
FT                   /translation="MDCAATRTPEEREFLRLKGRDMAFGYIQMARRCPRPEEIANMALT
FT                   DWGQGNIFNGVVDQLGLIWEDVDGKIVYRKNPQRELEKEQALDRYRCASKEPPFKQYPD
FT                   LQEMSLDALLSELESWHKIGGFDERYDEERVEALVWMLCYRIASVMAEDHCILLEMAAY
FT                   AIGYEHKTHPTAIPEWKDWGMAMCDRVLGSIYTKPD"
FT   gene            complement(153613..153975)
FT                   /locus_tag="AM1_F0167"
FT   CDS             complement(153613..153975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33018"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPW0"
FT                   /protein_id="ABW33018.1"
FT                   /translation="MIKLIMCLHRRADITREAFQDYWQNSHGPFFMKNAAVMRTQKYVQ
FT                   SHTLSSPLNESMRQSRSMAEEFDGVAEVWFESENDLMEAMGSTEMAELGPKLIEDENNF
FT                   IDHSRSCAFLVEEIEF"
FT   gene            complement(154133..154705)
FT                   /locus_tag="AM1_F0168"
FT   CDS             complement(154133..154705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33017"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPW1"
FT                   /protein_id="ABW33017.1"
FT                   /translation="MDSDERKRLIFLKASANKQRRNRNTFLESLAPPLSQALSSAPCVY
FT                   TPESHDIISTFLPATADGIGSGSQTRPNEYHYTEVAWPDKAMNLIQQIHNVDPNTDCHL
FT                   MITPPNAIQQGGKGYWVPTCPLFVVDFASAQRSVPQLWPIAGHFLAIVSCKLEFGMIID
FT                   HYCGYLENDFNPTEIVYEVARWPTKAA"
FT   gene            complement(155295..155537)
FT                   /locus_tag="AM1_F0169"
FT   CDS             complement(155295..155537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33016"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPW2"
FT                   /protein_id="ABW33016.1"
FT                   /translation="MFDCPICSHELLPHISHGQICWFCHYCWQDFPNLEEVSVEQPPKA
FT                   VILKDPTKGYCGTTPKSDDSAMNWVVDPVLKLIEV"
FT   gene            complement(155786..156088)
FT                   /locus_tag="AM1_F0170"
FT   CDS             complement(155786..156088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0170"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33015"
FT                   /db_xref="GOA:A8ZPW3"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPW3"
FT                   /protein_id="ABW33015.1"
FT                   /translation="MKTLLIGLIQFYRRFISPLFLPSCRFQPTCSAYAIEAISTWGVLK
FT                   GSWLALKRICRCHPFHPGGYDPVPTAAVKPSAQIDSECADPNKERHGPSSRKISG"
FT   gene            156523..157041
FT                   /locus_tag="AM1_F0171"
FT   CDS             156523..157041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33014"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPW4"
FT                   /protein_id="ABW33014.1"
FT                   /translation="MRKTISIPESLASELEQFKDRLNASEICTLALRREVKRLKALDSL
FT                   EAGADVERFQLERQRDGDHWEAKGKIAGIQTAVRLGYRPLSEVCASVELCTREGLPVID
FT                   QIAQIPGVIELIEDCMKDDECLSVFTDDYAHGYGLGALEAWDTLHTQAGKGAATGETNS
FT                   EINSETPNR"
FT   gene            157442..157669
FT                   /locus_tag="AM1_F0173"
FT   CDS             157442..157669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33012"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPW5"
FT                   /protein_id="ABW33012.1"
FT                   /translation="MTTNPFSDYYEQAWIDHQTDYGQHPDPCIGLPSDQIQDRVASLLS
FT                   EFNPLISPESETALSIWVGIIQRFYRDISV"
FT   gene            complement(157635..157802)
FT                   /locus_tag="AM1_F0172"
FT   CDS             complement(157635..157802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33013"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPW6"
FT                   /protein_id="ABW33013.1"
FT                   /translation="MGSNLAIEWLIGSTHGATMENRSVRSKDHLKYFSLSKTQSTTIAS
FT                   RPRYPGKIAG"
FT   gene            157801..158031
FT                   /locus_tag="AM1_F0174"
FT   CDS             157801..158031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33011"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPW7"
FT                   /protein_id="ABW33011.1"
FT                   /translation="MSEPTYSEEIEEPTADQTVFRPYPYCLWCRYLAAHYDFCAVVPFG
FT                   WTNGLIERCPEFDSEYGDAETLAVFDDIIPF"
FT   gene            complement(158248..158427)
FT                   /locus_tag="AM1_F0175"
FT   CDS             complement(158248..158427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33010"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPW8"
FT                   /protein_id="ABW33010.1"
FT                   /translation="MTNLNSQASDISPEIAALKMQLAISLKFHHRSKLERLPLEAAVRV
FT                   MAEVWDACDHQRNS"
FT   gene            complement(158638..159462)
FT                   /gene="rpoD"
FT                   /locus_tag="AM1_F0176"
FT   CDS             complement(158638..159462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="AM1_F0176"
FT                   /product="RNA polymerase sigma-70 factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33009"
FT                   /db_xref="GOA:A8ZPW9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPW9"
FT                   /protein_id="ABW33009.1"
FT                   /translation="MALEHDSLHFYLKEIARYPILSHEEEILLARQVNAGNLRAKQRLI
FT                   ECNLRLVVSIAKKHQNRGLPLQDLIQEGSIGLSNAVDKFDLAQGCRFSTYAYWWIRQGV
FT                   TAALRAKSRPIYLPQYQWEMISKIKKHFRELNQQLGREPSLSELAKATNLKPKTISRTL
FT                   HLFQKVSSLDQPVGHQQKDTLLDLMAGEDQPTLYLESLQLDEQLSQVMAHLDKREQFVL
FT                   SQRFGLEDDQPKSMREIGEQIGLSREGIRLILNKIMKKLQKNTDQTTMERTA"
FT   gene            159674..159817
FT                   /locus_tag="AM1_F0177"
FT   CDS             159674..159817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33008"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPX0"
FT                   /protein_id="ABW33008.1"
FT                   /translation="MQEFSLLGFRYDYYRENDHCYGCLAYSCRSQPKIWLGFSWRTKTP
FT                   QH"
FT   gene            complement(159857..160234)
FT                   /locus_tag="AM1_F0178"
FT   CDS             complement(159857..160234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0178"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33007"
FT                   /db_xref="GOA:A8ZPX1"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPX1"
FT                   /protein_id="ABW33007.1"
FT                   /translation="MPRKKKQAKPLTGKDLIAKVKQLSDYTREEKAKACGYISTDKDGS
FT                   ERIKTIAFLNALLDAEGIDLGSQSPNGNGNGGRKPSYKVSVQTNGNILVGRAYTQALEL
FT                   EPGDEFEIAVGRKHIHLTKVA"
FT   gene            complement(160409..160651)
FT                   /locus_tag="AM1_F0179"
FT   CDS             complement(160409..160651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33006"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPX2"
FT                   /protein_id="ABW33006.1"
FT                   /translation="MPSTQDPIRGIPLKDKPEGISRCGMSHATIAQHLFTSQWYELTAN
FT                   GQVIGSAIDLDFYKQDATQGQNSVSTAKTKELSKV"
FT   gene            complement(160852..161217)
FT                   /locus_tag="AM1_F0180"
FT   CDS             complement(160852..161217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0180"
FT                   /product="glyoxalase family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33005"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPX3"
FT                   /protein_id="ABW33005.1"
FT                   /translation="MPIEKDKWYTRPVFSVASVQKSLSYYRDLLGFTQSWKYDEAGEVL
FT                   VAQVSRGDFELILASNLDRKGQGRVFISLTESETSRFKEMIESMHITYEEIYWGYPSIK
FT                   LQDPDGNELIFPQETED"
FT   gene            complement(161649..161765)
FT                   /locus_tag="AM1_F0181"
FT   CDS             complement(161649..161765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33004"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPX4"
FT                   /protein_id="ABW33004.1"
FT                   /translation="MCDYAKQDASLQEQIQPQLSGGLLILPKLPLISVEISL"
FT   gene            161837..161953
FT                   /locus_tag="AM1_F0182"
FT   CDS             161837..161953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33003"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPX5"
FT                   /protein_id="ABW33003.1"
FT                   /translation="MALTEVEMESQYPRLMRLLQPAVADEDTTLMMLAPVER"
FT   gene            complement(161991..162443)
FT                   /locus_tag="AM1_F0183"
FT   CDS             complement(161991..162443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0183"
FT                   /product="pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33002"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPX6"
FT                   /protein_id="ABW33002.1"
FT                   /translation="MGIDLEACNLGLQNLAHASFAKANLTNAILHGATFIGTSFQQANL
FT                   QAAGLISANLSGANLKEANLTNALLTTANLTGADLRSSILCRAVLTDAILQGANLRDAD
FT                   LRETDFKNADLTGADLSGAKVNLKNLEDAILNETIFPDGRIVSLEQ"
FT   gene            complement(162828..163241)
FT                   /locus_tag="AM1_F0184"
FT   CDS             complement(162828..163241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33001"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPX7"
FT                   /protein_id="ABW33001.1"
FT                   /translation="MNCIPSLKPQQSELLSIAIKHPNEIINLSYEFPVTGQDEPPSQHP
FT                   AFIQDLIDENLIQVQVTGLHIQRSKVQQESWSVYCNDIHSPSQKDWELWRKAFTAQRAG
FT                   SIIPDMTPGAGFEEFSNVWIREIDLQVIQPQKL"
FT   gene            complement(163540..164118)
FT                   /locus_tag="AM1_F0185"
FT   CDS             complement(163540..164118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABW33000"
FT                   /db_xref="GOA:A8ZPX8"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPX8"
FT                   /protein_id="ABW33000.1"
FT                   /translation="MVVQGHSILSSLLKSDSQAWALSIIVGGLSILAGNYYWRRANQAA
FT                   QGARAEETVGATLNQLRAYNWTIEHDIPVPRWGNIDHLAISPSGKHFCIDTKSGKGTIV
FT                   LKGHELSKQYGRKIYPFPKGKSILKAVKGQAGQLQKSRAVTWVKPVLCFVGSQVDQSIL
FT                   NTKVQGVLLTDVHSIASILQSMSVHQSLS"
FT   gene            164220..164423
FT                   /locus_tag="AM1_F0186"
FT   CDS             164220..164423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32999"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPX9"
FT                   /protein_id="ABW32999.1"
FT                   /translation="MLLQLQPQLNTIAGQDKQAGRDDSRHKSGHQSIEKIVKAVVSTLN
FT                   VGVNLIEAFKNLTLKVFWLWSR"
FT   gene            complement(164426..164656)
FT                   /locus_tag="AM1_F0187"
FT   CDS             complement(164426..164656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0187"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32998"
FT                   /db_xref="GOA:A8ZPY0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPY0"
FT                   /protein_id="ABW32998.1"
FT                   /translation="MDMKQLRERLNKRPEEIAVELNVALSTVRNWESGRHEPRLPISEI
FT                   PQFLKTYQCSLDDAIAAAAASHKKFHGKKQS"
FT   gene            164997..165626
FT                   /locus_tag="AM1_F0188"
FT   CDS             164997..165626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0188"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32997"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPY1"
FT                   /protein_id="ABW32997.1"
FT                   /translation="MKQGLTLVEMAQAVQDQAEAKRDFVADTRTLEMNPDGSITVESEE
FT                   VEETFTTTEHTHGQISQRLSIPLKYYRRMQSSAPQLLAENVNHWFNTNPERRMIRTLDG
FT                   SARAFLSDRYRRVDNFEIAETVLPVLAEFGPGLKIMSVGLTDSRLYIKAVNERVQLDVR
FT                   KGDAVQAGVVISNSEIGLGSIRIEPLVYRLVCLNGMISQDYSFRGN"
FT   gene            165776..167437
FT                   /locus_tag="AM1_F0189"
FT   CDS             165776..167437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0189"
FT                   /product="transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32996"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZMN7"
FT                   /protein_id="ABW32996.1"
FT                   /translation="MSMRPTDLLDIPSETIEVARAAFPDGNLYMQLRDELGIIYHDHDF
FT                   ADLFPKKGQPALSPWQLVLVCIMQFLENLSDRQAADAVRARIDWKYALSLPLRDSGFNY
FT                   SVLSEFRKRLIAGDKEQQLFDSFLEHLQAKGFLKEHHQQRTDATHILASIRTLNRLELF
FT                   GETFRAALNSLVVADPQWLSEHMHDDWFDRYGRRIENYRLPKPDSERKALGSTIGQDGL
FT                   TLLDAIYAPSSPPWLKHLPAVETLRQVWLQRFYPPNADGTVEWRKVKDMPPSDSSIHSP
FT                   YDVEARYSNKRSMDWVGYKVHLTEVCDPESPRLITHVHTTSATVPDDQVVEPIHLALAK
FT                   KQLLPKEHLLDGGYLSAEHLVNSKAEYDMDVIGPVRQNHSWQAKAGNGFDSSFFLISWD
FT                   QQKVVCPQGHFSTKWLPGKDIHGKDVIQARFQGTTCRSCPVRSQCTKSKTQPRELTFRP
FT                   RELHQALNERRQVQRTTEFKEKYSLRAGVESTHSQGIRRFGMRQSRYIGLAKSHLQNVF
FT                   CAIALNFVRLDAWFNDVPLAKTRVSLFKRILQPLPA"
FT   gene            167637..169784
FT                   /locus_tag="AM1_F0190"
FT                   /note="fragment; similar to N-terminus of transposase"
FT   gene            170396..172126
FT                   /locus_tag="AM1_F0191"
FT   CDS             170396..172126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_F0191"
FT                   /product="RNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_F0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32995"
FT                   /db_xref="GOA:A8ZKQ7"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKQ7"
FT                   /protein_id="ABW32995.1"
FT                   /translation="MSKARVKPMMEWSAIPWPKLERKVFKLQKRIFRARQRGDVKVVHR
FT                   LQKTLMRSWSAKCLSVRRVTQDNQGKKTAGVDGVKSLSPEARLPLVGQLKLGSKAPPTR
FT                   RVWIPKPGKDEQRPLGIPTLYERARMTLVKLALEPEWEAVFEPNSYGSRPGRSCHDAIE
FT                   QIFAAIKQKAKYVLDADIAQCFDRINHEALLKKLKTFPTLRRQIKTWLKAGVIDGHQFL
FT                   QTSEGAPQGGTISPLLANVALHGLEYRIKQAFPIRKIADGNKRKRIATPDVIRYCDDFV
FT                   ILHEDLSVVQRCQSLVHEWLKDMGLELKPSKTHISHTLKRYEAENPGFDFLGFSVRQFP
FT                   VGQHQSGRLCGTLLGFKTIITPSRKKQKVHYNRLVSIINAHKAAPQAALIRHLNPVIRG
FT                   WTRYYSTMASKETFSRLDHLLYQKLQTWANHRHPGKSRKWVVNKYWQTVGGDKWVFATR
FT                   VTKSRTEKLLKHRQTPIIRHVKVKGDASPYNGNLVYWSSRTGKHPEAPKRVSMLLKKQK
FT                   GKCAQCGMFFREEDLLEVDHILPTSMGGLDVYKNLQLLHRHCHYVKTAKEKSSQAKWYV
FT                   "
FT   gene            172290..172728
FT                   /locus_tag="AM1_F0192"
FT                   /note="fragment; similar to C-terminus of transposase"
XX
SQ   Sequence 172728 BP; 45375 A; 40956 C; 40444 G; 45952 T; 1 other;
     gcttgaatgt cgttgagaat tggaatagtg ccaatgactt catcttctat ggcaagaatg        60
     gtgactttgc cagtaatcaa acggctatgc aagagctatc catgctgtgt ttgcacctac       120
     tacaaatcag cctggtctat atcaatacgc tgatgattca aaaagtactt tctgagccga       180
     cgtggatgaa tcgtatgcaa gaagaagatt tgagggcgtt aacgcccctg ttctaccttc       240
     atatcaatcc ttatgggcgt ttccgactaa acatgaatga gcgtctggtg attgaaaact       300
     tggctgcgta gggagtagct gcagtgaggt tgctgagttg aggcccatct cagcaaggca       360
     acctttgctc gactatcgag tagtacagcg gcaaaaaata cttaagtaaa acttattgat       420
     tagaggtgaa tttgccctgt tttggggggt gatctatttt gattgcagct ggtgtcagcg       480
     accctgacac tgttggcgaa atattccgca atgatctaag tcggctgaaa atagcttcta       540
     acacttgatg cagtaagcct tttgtggatt gaggtatggt actgctaaaa ctcaaactca       600
     atcacgctca ctctggaggc tcattgttat gtctatgcgc ccgacagact tgttggacat       660
     ccccagtgaa accattgaag tagctagggc tgcctttcct gatggcaatc tgtatatgca       720
     actacgtgat gaacttggca ttatctatca cgatcacgat tttgctgatc tgtttccgaa       780
     gaaaggacaa ccagctctat ccccctggca gcttgtgcta gtttgcatca tgcaatttct       840
     tgagaatctt tcagaccgtc aagcggctga tgccgttcga gcccggatag attggaaata       900
     tgccctgagc ctaccgctga gagactctgg atttaattat tctgttttga gtgaatttcg       960
     caagcgtctg atcgcgggtg acaaggaaca acagctattt gatagcttcc ttgagcacct      1020
     tcaagcaaaa gggttcctta aagaacacca tcaacaacga acggatgcga cccatatcct      1080
     agcgtcgatc cgaaccctca atcggttgga gttatttggt gaaacctttc gggctgctct      1140
     caatagtttg gttgtcgcag atccacagtg gttaagcgaa cacatgcacg atgactggtt      1200
     tgatcgctat ggtcgacgaa tagagaatta tcgcttgccc aaacccgata gcgaacgcaa      1260
     agctttgggc agtactatcg gtcaagatgg tttgacactg cttgacgcca tatatgcccc      1320
     tagttcacca ccgtggttaa agcatctacc tgcagtggaa actctgcgac aagtctggct      1380
     ccagcgattc tacccgccca atgcagacgg cacagtcgaa tggcgaaaag tgaaggatat      1440
     gcccccttct gattcatcca ttcattctcc ttacgatgtc gaagcccgct atagcaataa      1500
     aagaagtatg gattgggtgg gctataaagt tcatttaaca gaagtgtgtg atcctgaaag      1560
     tccacgtctc atcactcatg tgcacaccac cagtgcaacg gttccagatg atcaagttgt      1620
     tgaacccatt cacctggctc tggctaaaaa acagttgttg cctaaagagc atttgttaga      1680
     tgggggttac ctctcggcag agcatttggt gaatagcaaa gcagaatatg acatggatgt      1740
     tattggtcca gtgcgtcaaa atcatagttg gcaagcaaag gcaggaaacg gatttgattc      1800
     gagcttcttc ctcatcagtt gggaccaaca gaaggttgtc tgtcctcaag gccacttcag      1860
     tacgaaatgg ttgcctggaa aggatattca cggaaaggat gtcattcaag caaggttcca      1920
     ggggaccact tgccgaagtt gtccagtgcg atctcaatgt acgaaatcaa agacccagcc      1980
     aagagagttg acgttccgtc cccgtgagtt acatcaagcc cttaatgaac gacgtcaggt      2040
     acaacgaact actgagttca aggaaaaata tagcctgcgg gctggtgttg agagtaccca      2100
     ttcacaggga atacggcgat ttggcatgcg ccaatcaagg tatatcgggt tagcgaagag      2160
     ccatctacag aatgttttct gtgccattgc tctcaatttt gtccgcttag acgcttggtt      2220
     taatgatgtt ccactagcaa aaactcgtgt atctcttttc aagaggatac ttcagccatt      2280
     accagcgtga cttcttggaa ttcgccaaca gtgtcagggt cgctgacacc agctgcaatc      2340
     aaactagatg gccttccaat agtaacggag caatttggcc agtagactgt ataagctaat      2400
     cacgaaagca agtgagaaca agcatttcaa gattctggct tactcctcgt tcaaaatcgc      2460
     atgaatgcag ataggagagg gaacacaact gttccattat tgtgtgtaaa tagaacagta      2520
     taaaccttaa attcataccc tataaggctt tcaagataat taagctaaac tgcccaataa      2580
     ccgtaaatgg aacagtccaa tccttactgg ccaaattgct ccgttactat tggaaggcct      2640
     agatcacccc tcaaaacagg gcaaatttac tgctaatcaa taagttttac ttaagtattt      2700
     tatatcgctg tactacttta tatgggagct aaggttgcct tgctgagatg ggccccaact      2760
     cagcaacctg attacagcta ctccctacgc agccaagttt tcaatcacca gacgctcatt      2820
     catgttgagg cggaaacgtc cataaggatt gatatggagg taaaacaacg gtgttaacgc      2880
     cctcaaatct tcttcctgca tacgattcat ccaggtgggt tcagaaagta ctttttgaat      2940
     cattagagta ttgatgtaaa ncaggctgat ttgcagtagg tgcaggcaaa gcatggacag      3000
     ttcttgcatc gccgtttgat tactggcaaa gtcaccattc tttccataga agatgaagtc      3060
     attggcacta ttccaattct caacgacatt caagccttca ttgatctctt gccgtaaggc      3120
     ttcatcatgc aaatactggc acaggaagat ggtcttaatg gctcgcccta attcagccaa      3180
     agccaagtag gtggggtgct tgatgttgtt gcgagtgaat cgactcagaa tggcttcagg      3240
     ttcggcagtg ccttgcttca tcgcggttgt gaactggatc attggctcat attgctcccg      3300
     aaccagatcc caacgaatgg gtcgctttaa aatcgcctta agatggaaat acttcttctt      3360
     ctgcccggac atcggcaggt agagcttctg cttgttgatg cccttaaagc gaggcatcag      3420
     ctggaaattc aataaatagc aaaatgcaaa ccccacctcg ctttggccat gggtatccac      3480
     atagctttta ttcactgaca tttgcgtgca gtgtcgaagt acgcccttca ccataaaggc      3540
     cacctccgaa gaagaacact tcttcagttg cgagtagata catacggatt ttttctcgac      3600
     atggttaacc taagccggag gatcactcct ccgacttggc ttcaaaaccg tgcgtaaatc      3660
     tttcgattta cacggctcct cagtggcttg gtgcttgtca tacataccat ttggcctgag      3720
     aggacttctc cttggccgtt ttaacataat gacaatgtct gtgtagtagt tgaagattct      3780
     tgtatacgtc caatcctccc attgatgtag ggagaatgtg atccacttca agtaaatctt      3840
     cttctcggaa gaacatgccg cactgagcgc atttcccctt ctgcttcttc aagagcatag      3900
     atactctctt cggagcttct ggatgcttcc cagtccttga actccagtaa actagattgc      3960
     cattgtaggg acttgcatcc cccttgactt tgacatggcg gataattgga gtctgtcgat      4020
     gtttgagtaa tttttcggtt ctagatttag ttactctagt cgcgaagacc catttatctc      4080
     ccccgacagt ttgccaatat ttattcacca cccatttcct ggatttgcca ggatggcggt      4140
     ggttagccca tgtttgaagc ttttgataca gtaaatggtc tagacgggag aaggtctctt      4200
     tactagccat ggtcgaataa tatctcgtcc atcctctaat cacgggattg aggtggcgga      4260
     ttaatgccgc ttgcggcgct gccttatggg cgttgatgat actaacgagc cgattgtaat      4320
     gtactttttg cttctttcga ctgggggtaa tgatggtctt aaatcccagc aatgtcccgc      4380
     ataatctccc cgattgatgt tgaccgaccg ggaattgtct aactgagaat cctagaaaat      4440
     caaatccagg gttttcagct tcataccttt tgagagtatg ggatatatgc gttttgctag      4500
     gttttagttc caaccccatg tcttttagcc actcatgaac taagctctga catctttgaa      4560
     ctacggataa atcctcgtga agaatcacga agtcatcaca gtatcgaatg acatcaggag      4620
     tagcaattct ttttcgctta ttcccgtcgg caatctttct gataggaaag gcttgcttga      4680
     ttcgatactc taggccatgg agggctacat ttgccaacaa aggagagata gtcccccctt      4740
     gaggtgctcc ttcagatgtc tgtaagaact gatgaccatc aattacccca gcttttagcc      4800
     aagtttttat ttgtcggcgt agagtgggaa aggtcttcag ctttttgagc agtgcttcgt      4860
     ggtttattcg gtcaaaacat tgggctatat cagcgtccaa cacatatttt gctttctgtt      4920
     taatggctgc aaaaatttgt tctatcgcgt catgacatga acggcctggt cttgaaccat      4980
     aggagtttgg ttcgaaaacc gcttcccatt caggttccag ggctagtttg actagtgtca      5040
     ttcttgccct ttcatacagg gtcggtatac ccaaaggacg ttgttcgtct tttcctggtt      5100
     taggaatcca cacccgtctg gtgggagggg cctttgagcc gagtttaagt tgacccacta      5160
     ggggcagacg agcttctggg gacagagatt taactccatc cacacctgcc gtcttttttc      5220
     cctggttgtc ttgtgtgacc cgtctaactg aaaggcattt ggctgaccag gacctcatca      5280
     gagttttctg gagtctatgt actactttga catcgccacg ttgtctggct ctgaatatgc      5340
     gcttttgcaa cttaaacact ttccgctcta gttttggcca ggggattgcg ctccattcca      5400
     tcatcggttt gacccgtgct ttagacatat ttattgctac ttgttcctat tcattccaag      5460
     tcaccgtgag tctgtctgct tatcctcacc attacagtgg ggcttttgct tttgacccaa      5520
     tccttcccac cgcctaactt ctggttagca cctactctta gccaatcgac ctccaagaga      5580
     gataggcggg ggttacttcg ttcctaatag ccattgattg aactgttaga gtgatgcgct      5640
     ccaccgggtt tattggaagt gctaactggt cgctactgga cacgccagct ccgtatatcc      5700
     ttgccctttt gggactccca gcgttatcaa cctaatttcg ctggttaatg attacggtgg      5760
     gttaaccaca tcttcgcttt cgctactcat aagttcttgc tcgaaggggt tcagagctag      5820
     gctccctgtt acctcctttt ttccccgctt caggcgttga tggctagtcg cgaacctggg      5880
     ggaaatgctg tcaccgctgc acctgcggga taggactaga gcggtctagg atactgactc      5940
     tcacctatat ggctattaag ttgtcaaggt acagttggga tattttcccc ttctttacgc      6000
     ttgcggctaa tcccctcaaa ccctattcag gtctagtttc tagccaacga atcgcaccca      6060
     gtagatcatc accccccggc cgccatagcg aacgtgccat tccgtcatca aattctggtc      6120
     ccaagattca aagtgccgag aatcagacgc acaagccgtg gtggcttccc cccagatatg      6180
     agaaaggcga atccggaaaa tcgcattggc cacatccgta atggcacagc tgagggcaat      6240
     cttgcttaaa aacttgcgtc ggacataatg caattcaaag tatcctgcat cggcttctga      6300
     atgagcgatg cgcttaattc ctaaattggt gcccagtccg taaatacaca acagtaggcg      6360
     ctttcgcagg gactgggggc tcaatatttc acgactagcc gcactcttga aatgctgggt      6420
     gaaatcaatc cgaaagtccg cttctttgag gacgtccaat aaatgcgtta gggaccaccg      6480
     gtggttgatc tcttccttga gtttttgaat gttcatgggt tccggttgtg cctcaagcgg      6540
     ggacacctta attcgtcctc ctcgcttact caagatctca actttggaat tgtgaggcat      6600
     tccctgattc agtagggtca aagcgttttc catatcagtc tggatttgag tgatgaaggt      6660
     ctccacctct aggggctgtt gtagatcctg gtaatactcc tctcgccgct cgtcaaagtc      6720
     ttggggtaaa tccaggtcgg gatttcgata gcgattggca ccggcgaccc aaatttcctt      6780
     acaccgtagt ttctctcgca aggccctgag gacgcacatc tcataggcga tgcgatctac      6840
     tttgtctggc tggtcttcat cctgacccaa taccgtctct tgccagtctg cactgacgac      6900
     cccttcgatg ggaacgtcgt ctgctgaggc ataaggtttt cggggggtgt ccacataggc      6960
     tttgagtaaa tccacagcct gcaggatggg ctggtattgc ttgttattgc accgaaagtc      7020
     aatcacttcc agtaccgcag gaagcatttg ccgataatga tgaccgtagg aagaacggat      7080
     cctcgagtgt agaagttgtc ggtaagtctg accgccatca ttgtaggagt caacaaatgc      7140
     ttccagagtt tgctcactgg caacggggta gataacatct ctgaccaagc catctggtgt      7200
     ggctagggct gcggtggcca cctgataaaa cagttgggtg tgagagtccg tttttttgac      7260
     tttagcgatc acctctgacg tcactttatt cttgctgcgt gtatcaatgc gatggacgat      7320
     ctgaatcagc aaatccatga tgttgtcgat gatctcttgg catcgctgcc agcaaaaact      7380
     cgcgagtaag gtgagtcgga tgactttggg gtgatgcctc aactctgata atgtttccgt      7440
     ttccactcgg agccgataac actccagaac tcgtggggtc agatgagaaa acaaggtatc      7500
     tggcaaagcc acttggcgga gtcgttggag tttgatgatt tctgaaagca ggctattgag      7560
     accgactggt cctgggtctt ttttcaacgc acttagggga ggatctggga tctctttacc      7620
     tggggtcacc ttgggttctt ggatcaattc atcaagctca gtttgagttt gcttggacaa      7680
     ctgctggaga gttgaggaaa aaagctgatt ctcaaatagg cgttgagcag accgaattaa      7740
     acgctcaatt ctagcaggag tgggaggttc aatctgaagg gtacgcagtt gagcatagac      7800
     cttcaatttc agatgatgat aatcctgctc ttgactcaag acggtatcga ctaaccaagt      7860
     gcgtagttgg ttttggtccg ccacagtggc ttgtcgaaac ccggtgaatt tacgaatctg      7920
     ggcccggtga taatagctat ttctcccatg ccagtcatag cttttgaaca gctcgggcag      7980
     tagtgctaac tggtctgcaa cgaaggtcaa ggccatatga ggtatctcat acttctgttc      8040
     aggaaagcgt ccttcatatc ggaagaattt aagcaacagg acaaatccta agcagtttgc      8100
     tccttgacgt ttggccaaca aatgctcttc gtcaggctgg atagaccaat gctcaagcag      8160
     ctcttctgga tgccatttac gtttcatgca attacgctcc tatgaaagtg aattcattag      8220
     agcgtaaggc aagtttttgt actataagtg tagattatga attgagggtg atggaggtca      8280
     atagaattta cagttcttaa tgcctatagc cgttgctagg taaggatttc agccttgatt      8340
     gcagctggtg tcagcaaccc tgacactgtt ggcgaaatat tccgcaatga tctaagtcgg      8400
     ctgaaaatag cttctaacac ttgatgcagt aagccttttg tggattgagg tatggtactg      8460
     ctaaaactca aactcaatca cgctcactct ggaggctcat tgttatgtct atgcgcccga      8520
     cagacttgtt ggacatcccc agtgaaacca ttgaagtagc tagggctgcc tttcctgatg      8580
     gcaatctgta tatgcaacta cgtgatgaac ttggcattat ctatcacgat cacgattttg      8640
     ctgatctgtt tccgaagaaa ggacaaccag ctctatcccc ctggcagctt gtgctagttt      8700
     gcatcatgca atttcttgag aatctttcag accgtcaagc ggctgatgcc gttcgagccc      8760
     ggatagattg gaaatatgcc ctgagcctac cgctgagaga ctctggattt aattattctg      8820
     ttttgagtga atttcgcaag cgtctgatcg cgggtgacaa ggaacaacag ctatttgata      8880
     gcttccttga gcaccttcaa gcaaaagggt tccttaaaga acaccatcaa caacgaacgg      8940
     atgcgaccca tatcctagcg tcgatccgaa ccctcaatcg gttggagtta tttggtgaaa      9000
     cctttcgggc tgctctcaat agtttggttg tcgcagatcc acagtggtta agcgaacaca      9060
     tgcacgatga ctggtttgat cgctatggtc gacgaataga gaattatcgc ttgcccaaac      9120
     ccgatagcga acgcaaagct ttgggcagta ctatcggtca agatggtttg acactgcttg      9180
     acgccatata tgcccctagt tcaccaccgt ggttaaagca tctacctgca gtggaaactc      9240
     tgcgacaagt ctggctccag cgattctacc cgcccaatgc agacggcaca gtcgaatggc      9300
     gaaaagtgaa ggatatgccc ccttctgatt catccattca ttctccttac gatgtcgaag      9360
     cccgctatag caataaaaga agtatggatt gggtgggcta taaagttcat ttaacagaag      9420
     tgtgtgatcc tgaaagtcca cgtctcatca ctcatgtgca caccaccagt gcaacggttc      9480
     cagatgatca agttgttgaa cccattcacc tggctctggc taaaaaacag ttgttgccta      9540
     aagagcattt gttagatggg ggttacctct cggcagagca tttggtgaat agcaaagcag      9600
     aatatgacat ggatgttatt ggtccagtgc gtcaaaatca tagttggcaa gcaaaggcag      9660
     gaaacggatt tgattcgagc ttcttcctca tcagttggga ccaacagaag gttgtctgtc      9720
     ctcaaggcca cttcagtacg aaatggttgc ctggaaagga tattcacgga aaggatgtca      9780
     ttcaagcaag gttccagggg accacttgcc gaagttgtcc agtgcgatct caatgtacga      9840
     aatcaaagac ccagccaaga gagttgacgt tccgtccccg tgagttacat caagccctta      9900
     atgaacgacg tcaggtacaa cgaactactg agttcaagga aaaatatagc ctgcgggctg      9960
     gtgttgagag tacccattca cagggaatac ggcgatttgg catgcgccaa tcaaggtata     10020
     tcgggttagc gaagagccat ctacagaatg ttttctgtgc cattgctctc aattttgtcc     10080
     gcttagacgc ttggtttaat gatgttccac tagcaaaaac tcgtgtatct cttttcaaga     10140
     ggatacttca gccattacca gcgtgacttc ttggaattcg ccaacagtgt caacccttca     10200
     attacccctt ttaagaagta tcacgttggc ccacaggttg gtgaaagtga tgcagccgta     10260
     gaattgttca gcgacgaaac ccgcgaagct gacgatagag cgctattgct caaagttcga     10320
     gacatggtgc gcggtgcggc tgatatcgcc aagttcaccc aaattgttga gcagatgcga     10380
     gatgccaccg agcggaagat tgagggtaac ccggtcactg ccgtggaggt attaggcgat     10440
     aagctcaacg ttaatcagga agagcgctct ggaattctca cccatctgat ccagggtggc     10500
     gacctgacag cttacggcat gatgaacgct gtcaccagaa catcccaaga tgttgagagc     10560
     tacgaccgag ccacggagtt agaagcgatg ggatctcagg ttctgagtct tcccaaggct     10620
     acctggcgag agattgcggt agctcggtag ttctgtcctc agccctggct atctgctggg     10680
     gctgaagccg atcagattca ataccctatt atctacgact tatctttgta gacatctctc     10740
     ctgtgagcaa tattgacaac cagtatggtg agttttttgt cttgaatctg ataaatgacg     10800
     cgataagccc ccttcctgat tttccaaaga tcttcagccc cctttaattt tgccgatcca     10860
     gatgggtgtg gatcatcggt caaagtttta aggatgggaa caatctgagc cttaacttta     10920
     ttgggtagct ttttgagttg tcgctcagcg gcgggtgcta ggaaaacgga ataggacacg     10980
     cttaggtcaa tcctcaagcc cgatttcact taaaacgtct tccaaaggtc taacccctac     11040
     taatcgagcc tcggcaatag ctgtttgggc ctcggctaga tctagagcat cttggaacgc     11100
     ttcaattgct tccaattcca agatggctaa atttccccta ccgatttgtt caagaaactc     11160
     agataccgag tatccatatt ttttggcagc ttcctgaact cctgaccagc cctcatcagt     11220
     taaagaaaca ccatgccgac tcttagtaga ttcatgcaag gttgttcgtc cgggagattt     11280
     gccggggcga agattttgaa gacttttagg gttgatctta cgtttagttc ccacaatttt     11340
     agaagagaga gtattccata ttaatagcat acttattcag gtagaaagca gtaaaaaagc     11400
     attgacaatc tatatatatt cataatatta tagatataac aacaaaagac cgggcgacag     11460
     cgaccttccc ccaaccgcta gcaaccacct ggagctggtg atgcgaccgt aaggcgatgc     11520
     cgactaaggc taaaaactag agacaaaact ttcattgaaa gagccgctga ccttccgtga     11580
     caagaaacct cagcggctct gactctgtaa acctacaaga ggtactacaa atgtctgaca     11640
     ttctaaccca agcttggcaa cccagaaccg acgctgagat gagccagcct tggactactc     11700
     ctaagaaatg gctctcagtc ccgacccagg acggctacca gcatcaaccc tatgattctg     11760
     gagattctcg tcatttcgtc cctgataccc acccagaaga cacctggaac taaccccagg     11820
     tcaagcaagg ggcatctctt gcccctgccc cgtctcaggc aagttcagag gaccaactta     11880
     tgaccattac agaagcaacc caagccacca ctattgccca gctcaatgac cgctttcgtc     11940
     aaggcgacca taccctaggc caggtctaca ccactcagct tgttcaaggt ctttcttcag     12000
     aagagcagca agaactcttc cgactggtcc gcacgtttga tgatttcaat ctcagtaatg     12060
     atccaagagg agagcataat tttgggcgca tcaaattcaa gggtgaggtc ttcaacttca     12120
     agattgatta ctattcccct gacttgattc atggctcgga ggacccagag gatttaacga     12180
     ttacaatcag ggttctaacc cttatgcact ccagcgaata ctgacgcccc ctcccgctgc     12240
     accctggctt ccgggctggg gtgcccttct tggagagtga ttaaaaccgg gggatatgtt     12300
     gatataccgt ctttagaacg acattcatct agcaaagatt gagttgattg gagggaattc     12360
     caaaaccttt gctatagcag tagatcactt acctaagcaa tctcgcttag atgcatgtgt     12420
     tggaaagccg gaagccccac tctacataat ttcccccgac attattcact ttctacacaa     12480
     acataaatac cgaattagtc aagcttaggc tcttagtatt ggcaatgaaa gcaattactt     12540
     catcagcgcc aggcgtatta agaaatagga ggtggcctga tgaataggat tggaggcgat     12600
     agtctccact gctccctgac aattgaattt gatccccttg gacactctga aagtcataga     12660
     tataggcata attagctgtg ccataggtgt tgtcgatgcc atcgttatag aaaactgctg     12720
     acgcatctcc taagacaaac atatctgcat tctgtccacc cacaagcaca tctacctggg     12780
     aagctgaatt gggtgaattt gtatcaacgc ctatcaatga atcattgccg gcaccacccc     12840
     aaagggtgtc attatcaagt ccgccataca gctgatcggc accagcatcc ccatagagcc     12900
     tatcttgtcc agcttctcca tagagcatgt cgttgccaaa ttgtccccgc aggatatcat     12960
     ttccgccacg accaaaaatg ttgtcattgc tgtctgtacc gatgagttgg tcgttgccag     13020
     gggtccccac tagcggtgct tcaacgggtg gtgtcagtgg gggattgact ggggcaggcg     13080
     gggtgttcgg attggagggg ttaccagctg tagtattgcc atcggtttga gcaacatagg     13140
     tgcctgtgac accccctgcg ccaaatactt gagtccagta gtgggagtaa cgctgattgc     13200
     cagtatcgtt ttcaagcaaa tcatacccaa ttcccatgtg tgtgaaatta ggatttagaa     13260
     tattggcccg atgcccggag ctgcccatcc aggcattgag aacagcctct ggtgttgcct     13320
     gccctgcagc aatgttctcc ccccaagtgg accagccagt gtatcctgct gcttcaatac     13380
     gatctccagc gctggttcca gtttgtggat ctctatgggc aaagaagtca cccgttgcca     13440
     tgcgagcaga atgctgatca gcagcttgat caagattctg gctgagttgt aggggtctca     13500
     gcccgcgaga ttcgcgttcc tggtttacaa gatctaagag ttgttgatca aagcgatcct     13560
     gttcaaggat tgtcatgttg ttcattgttc ctcatttcat cgcgagtaat gttatcgctc     13620
     accagtgaag atatagtgaa tttcgacatt caatagattg gcctcactgc aactcagtcc     13680
     aagtctttcc cacccaataa tttagacaat atccctgtgc tttctcccac accaatcagc     13740
     cccctggttc accactgggg ggcttccttc tgaatcactg gaggtaatcc catgaaaatc     13800
     caggctgcca aaatcgaagt ctggaatggt tgctccttcc agtggattga tttccagatg     13860
     gctcaaaccc agaacagtct tggggcagtc caggccatcc tagatcggac caagctaagg     13920
     tttgctgatt ccaaagcttg atgccagctt ttcttttccc tgattggttg agaacttgat     13980
     taatatgtac ccagatttac aacttgattc ggtctagaga tgtagtctaa taccctaaca     14040
     ataagtggca ttatccagta tttaagcctc aatacatcat ttttaagttt cttctctcac     14100
     cgattgggtt tgtcactcga tcttcggcta ctccctaaaa ccccggcatc tcctgtctgg     14160
     ggttttccct ttttagccac tggcggaata tatccaagcc ttgccaccca atgacagccc     14220
     cctccccgaa cctttctctt tcatttctta tttagcccct tagcatcccc cgctaagggg     14280
     ctgtcattag atttagcgga ggtgactcta tgaaaatgta cattgccaac atcctggtct     14340
     ggaatggccg agagtttatg atgctcccct tccagcaagc tcaaactcag gaaaatcttg     14400
     gggtagtcat cagggagtac gttgctgcga tggggttgcg gctggtgtat tggagtaagg     14460
     tttgaggctg aggttgagaa acagcggata ttccaggaga attctgtatg gatgttttaa     14520
     tcctagaaat actctccatt catctcaagg ttggcgatgt cttagagtta gctttgattg     14580
     acaagaagtt cgcaacggag caaatgatcg aaatccctat tgcttgcaag ctggtaaaaa     14640
     aggatgcaat cgttgttcac ttccaccacc atgaattgga cttagacttc aatacggtag     14700
     acatacactc caaaaatgac catcggtatc tgaccattca tagtctggag attgttgatc     14760
     ctgagaaagg atatctagtc attaatgaag aggatggagc tgttcgctat caagtggcat     14820
     ggaagaaaat atcgactact tacgaataga gtgagcatca tatcctttcc cactcctcct     14880
     cccccaaacc ttctctttta tttcttatct tttttaatgc agccccctgg tatcccccac     14940
     caaggggcct ttttcatgat gcccagaggc aatcccataa agatgtacgt cgccaaaatc     15000
     gaagtctgga atggccgctc tttccagttg attgatttcc agcaagccca gacccaggaa     15060
     agccttaggt tagtcatcag ggagtgtgtt gctgcgatgg ggttgaagtt aatctattgg     15120
     tatgagtctt agattcaatt attagataag acattggata tcttatccaa aacgatgaaa     15180
     ctcatcattc tagataagga cggaactctc actaccccca aaagtggcaa gaattttgtg     15240
     caaaaaccag aggaccaaat tttacttcct ggtgttttgg atgccgtgag atggcacacc     15300
     ttacaagggc atatgcttat catcgcctca aatcagggag gtgtatcagc agggtataaa     15360
     acgattgcgg aagtgatctt agaaatgaaa tattgcttac atctactccg tgggatacag     15420
     tcagcctatt tctgtcctga ttttgagggc aatcaatgct ggcatgtaga acgacagagc     15480
     agctctcaag tagaggtgct gaggttcagg ggcagaatgc gaaaacctgg agatgggatg     15540
     attcagcaag cgcttttaga ccatccttgt gtgtctgaaa tactattcat tggagatcgt     15600
     ccagaagatg agcaagcggc ccaggctgct ggagtcgatt tccaagacgc agagagttgg     15660
     aggcaaccca gagaataaga caaacttcga catgagcgga tgcgatcact ggcggttcat     15720
     ttgcaatcgc atccacctac aagctagctc aaatcatttc ccttacttca cacctattaa     15780
     tccatttcac acctattaat tcccctggct gattcgctgg ggggttcgca tatctggaga     15840
     aaatcctatg actgtttccg ttcctccccc cacacttacc tcaaattctc agatcccttc     15900
     ccatcagacc tatgtgcgtc cccttggatt tggtgagagt ccttctggct tagctatatt     15960
     ctgcaaccga gccaatacga acacttggta tacccttagt caagactctc agcccgtgga     16020
     actcccctat cctgcgctca cgggctatct gaccagcatt gaatttatca aaggggagta     16080
     taaaaggaag cccacctgca aactccgatt caggatgatt gcccatcgtc cctgtactct     16140
     agaggcgggt tccgagtcca cgttcacgaa ggggttcttg agtgcgatcg caagcttgtc     16200
     cccggagcaa ctccgcagtc cgatcaccat cgaagcgatt cctgctgatg aagaaactgt     16260
     gcttttttgt tcggtatggt cgggaggtca gaaggtcaga acccaatggg atgatcagac     16320
     caactggcga gaggtcgcta gacgagccaa ggataatgtg gctcaacttc agagtagctg     16380
     atgaatccaa cctcgactgg caagcactga aaactctgac ggagtattgc cgggaagata     16440
     tcaaaggctt tttcgaggat gagggattcc agatttatcc tggtcgcctc catccctacc     16500
     aagctctatt tctcagcaat ttttttgtgc aactggtcgg tacgcgaggg gtattgtgct     16560
     tattactggc aggcccagta agcctttgag ttgttctggg cagagctacc ggatgatggc     16620
     agtgatagcc agctgacgaa atcttgatgg cttggtgtga ggggagcttg agacaaaaaa     16680
     agacagcttc ggtaacgaga agctgtcgag atatgttctg atagttatgg agaagttatc     16740
     cgtactcata actatgagga tgccccaatt gaggcaaagg atgacaaaat agtatggaaa     16800
     agggcaactg gagtgtagtg tgtcgcccct aaagagattg ctgttcacaa tcgcatcaga     16860
     atttaccaca gcagcaaaat aatctgttcg atgtttataa aatcttttgc cgctgagtta     16920
     atgaatttag tgaaagggca attcatagtt aataaaattg ccctagttaa agcattttgt     16980
     gcttctattt cctaataaaa aatctatcat atttatcaag ataaaccttg ctaggtagat     17040
     atttctgcaa gttccgccct actgtattta tgaagaattt aggcaattac aatagttttg     17100
     attcccacgt tattttggga gaatcattat ggcaatcacc gtcattaacc ttcgctacaa     17160
     tcgtaatgtc aagggctacc gctgcgaccg tgccagcgtc cttggtaatc cctttcacat     17220
     gttccaagaa tctgagcgcc tggcagtcgt cgccgcattc cgcgaatacc ttcatgaagt     17280
     tgccaatctg ggagccaatc ccgttgatgt ggtccttctt ctggctgaaa agtactaacg     17340
     tcacggtttc tggaatgtgg aagcacccca gtcgtactca agtgatggca gagctagtca     17400
     agctggaggc catgccagac atgaagttgc tgtgttggtg cgttcccttg gcctgccacg     17460
     gcgatgtcgt taagtcctac ctcgagtgga agcacgaaga agcttgcaga taaggctgtc     17520
     ttgataaagt gcgtgaaaaa caaagaggca gtttcgttga gaaactgcct aaattagaca     17580
     aatgattttt tgttcagaat tcccactgaa gaagtgcagt gagcagtcct tatctagtca     17640
     ttctagatac tcttgcaaga gtaattcaga tattacagag caaatttata agtaaaaagg     17700
     cgacccccat ctaggaagaa tcgcctcaag ttgaatcgtt gaaaatttcc tatctaggag     17760
     aaatctatca tgtttcaata tcaaccggtg cggctctaag aggtgccgtt agttcgttgt     17820
     tgccatagtg gtcgcaaatt gaagtttgcg atggtctccg accggcctta ggccatcgca     17880
     tctcaagtct tgatccacaa atcctctggt cgcccctgct gtcgctggct gtgcaaagac     17940
     tgcggtaagt cacggggaat ttatccgaca ccaaaatttc tgatgaatct gcgagagatg     18000
     gacgaaggag gcgagacgga ggtgggcctg aaggtcttgg cccaagtttg attggagaga     18060
     aagtcatggc tatctattcc gcatcctact tcgagcctca taaccatcac ggagcgctgg     18120
     tatccatttc gagatcgcac ccccgatcct tccaggtcga tgatcggttg cccttcctgg     18180
     ctccgtcccg gcaattgctt gacgattgga agcatcgcca gctcaccgag gcaggatata     18240
     ccgaccgata tcgccaagaa ctacagcagt cttggtccca ggtaaattct tggttagcct     18300
     cagtaacccc agagggagat tgcacacttc tgtgctggga aaaggcgggc gagttttgcc     18360
     atcgaaactt agcgatgaag gttattcgca agcatcgacc cgattgctac ggtggccgcg     18420
     atatttccgc tgatccgggc ctgagatgtt cgaaatgcca gacagtcatt attccagggt     18480
     tggatcaaag tttttgcccg tgctgtggcg agtggttagc tacaccaata taaatactag     18540
     attcatctat acctggaata tcaagggcaa cccacggcaa gaaagttgcc ctactacaac     18600
     gcatcagttt ccgctaagtg aaatttacca cgtttaccca cagctacatt cggctcccct     18660
     gctgatagcc gccacaacaa gattatgact tcaacaggag ggtgaaatcg tcatccttct     18720
     gtttgcttat caatagaaat aggagacagt tccatgcgca atttagtgta ttcgcctcag     18780
     cattacctgg tgtacttcct cggaacgctc aggagacaaa acggcacccg tctcaaggtg     18840
     ttctcaacag tctccagaca gcatgttctg atgatttcca aggacaaatc cgggaagtgg     18900
     agtaaagact tcaccactgt cagaatcacg gatttacacc ccgctgtccg attcagattg     18960
     tgttgttagg aggtgaggag tctgtgtaaa ctcaatattt cccaggctaa actgcctctc     19020
     aaagctggtg caaatgagtt gactgagtta caaattctat tcttgaggca gatggctttg     19080
     aatgacttct aataactctg agaatcgaaa aggcttatca ataaagccat ctgctcctaa     19140
     tcccagagcg agattctttt tctcgctata tgcagtgagt acaataatgg gcagcgtaaa     19200
     gccttgctga cgaagggttt ggagcactgc cctgccacta atgataggta gccccaagtc     19260
     aagtagaaca agatcatagg attcatgata aatctgattc aaggcttgct ctccatctgt     19320
     aacaagggtg ggacaatagc catgtttgag cagccctttt tcgataaaac tggcgacacg     19380
     cttttcatct tcgaccagga gaatccgctt catatgaatt gggagttata agcccatgct     19440
     aatactccga tgttacagaa gtcctgcaat ggatattctt tgacgatatc tcaatttact     19500
     actacgaaag attagagaat tctcatcctc tctgaggcac gcctctaacc tataccatgg     19560
     cttacgaata tcacagaaat cctgatgagt ttttgatctg tgaagggttc tgggttgcgg     19620
     cccctggctt tattcaaaac aaagtacatc gaccgaatta ctttgaacag acctggcaag     19680
     aggcgaccgg gaaggttaag cagctctcgc tagtttgaac gacttgaaaa ataatatttg     19740
     gagggtttct gatggtagta cccagagtcc taaacgactt ctatcccact ccagccaccg     19800
     ttacagaaaa gctccataac tcagtcttca tcagtgggaa tgtctttgag ccatgtgtgg     19860
     gcaataatgc agtcactgat gttctaaacc aatgtctagg tatcaccgct atagagtctg     19920
     atctacgctg agatattccg gaatgacaca ctacgaatga tgcaacccat tcaaggttct     19980
     ggaaggagtg gggtaagtct gaattgttag taagtgacta agccgccttt tagcacggtg     20040
     gagaaaatac tacctctggc ctatgaaaat gccgatgttg gtgttgcttt tctgtcgcgc     20100
     ttcagctaga tggaactctt taacagtcga gcgaagtgga tggaagacta tacagatcat     20160
     ttgcagacaa tcatcgtggt cagatcctgc gtcaaattcc gcactaacat caatggatct     20220
     gattctgtga cctgtgcctg gtttgtgtgg caaaagaatt ggagctggaa aaagttaggc     20280
     gtagattgtc catttcaaat ttttacgaaa ttggaggaat tgaacgatgg aaaatagcga     20340
     aattgagtgg acgaaccaca cgttcaatcc ctggatcggc ttttcacact acagccctgg     20400
     ctatgtaaat tgttatgctg agacgcagat ggataagcgg tatgatcgcg tgaagtgggg     20460
     ggttgtgggc actagaacac gtacctcaga atcttactgg aagctgccct ataagtggaa     20520
     tcgcaaggcc gctgagcgag ggggcactga aacggtattc tgtggttctt tggctgatgt     20580
     gtttgaagat agagatgatc tgattgattg gcgattggat ctgtttgata ccgtcatcga     20640
     taaaaccccg aatctaactt ggctgctact caccaaacgg attgatatgg ctgtcctttt     20700
     cctgacttgg gtgcgagtcc ctcctaatgt ttggctgggt cacagcatct gcacccagcg     20760
     agaaagcgat gttgtcattc ccaagctggc aaagctccag cataaagtag gcggcatttt     20820
     cctaagttgt gaacccttgc ttgaaccctt ggacctgggt gcccttcccg tgaattgggt     20880
     aattattgga ggtggctctg gccctagtgc tcggccttgt gatgtggctt gggttcgctc     20940
     gattcgagac caatgtaaat cagtagatgt ccctgtgctt atcaagcagc tcggcagcaa     21000
     tcccgtaggg gttcccaagc ttcgttctgc gaagggtgga gacattctgg aatggcccaa     21060
     ggatcttcga gtgtgggaat tcccggagtt tggttgatgg aggtgtcggt ggatgaagag     21120
     agagtacatt cagggctggc gagttggcat cacggatcat cctggtaggc gggaacttga     21180
     gattgaggga ccgggggagc tgcatatcgt gattcggaag ttcaaaactt ctaactttta     21240
     ccaagagaac tacatcggct atatggaaga tgggagtttt gatgaagtcc tgatctgcac     21300
     ctatatctgt ccaggaggaa ccagtctcta ccaagaagat gtctggcagc aaaatagtga     21360
     tatcaacttt gaaatcttct acctgagtga acccgcacat gcctatttgt atattggctg     21420
     tgcccactgg tttattccag tggcgtttgc ggagagacta ttcagcgtat tccagacggg     21480
     caaggccaat gcttgtccag gttggacagc ggattagcga ggttcttcac tttcctctat     21540
     ctggtgtctt ttgagaaatg attcagcacc tgcgctccct caatgctcaa atccaaaaca     21600
     ttattcaaaa tagaagtaag gatatcaatt caggctaatg tatcttccca agatttagag     21660
     gagagagcca tgagcgagta tggcgatttt agtaatcata ttcctacacc ccagcttgac     21720
     cctctgcgtg tgggagaagt catgggttcg gatgcattct ccgtgggaga ttgggcgtta     21780
     ctcagaacct gggagaataa acctgttaag gttacgagtc ttcaccaaga ccttattttc     21840
     gtggatcgag ggagaggaga gagtcttgag ggtaccctcg cgaatcatta tccagcagag     21900
     ctgggttacc ccttggatca tcggttttgg agtctgcatc agaagaaaag ttatctacga     21960
     tgtcattttg accgcaggct tctcaaacga tgggagaaaa cttctagagt tttcgatcac     22020
     ttctctgatg tcctcaaagc tttccttata ggagcgatgg ttagtatatt tgctctgatg     22080
     atttttgggt tttggttgta ttacaaggta tccggtcggt ttagtactgc aatcaatagt     22140
     tcatccaatc cataacccca tccccatcgt gagcaagtct gattgctcca ctttgtccga     22200
     aagccagaat tcgggtcttc gttcacaatg gggatataga cctgatgcca gatcagcgca     22260
     tcctcttgaa accgctgagg gggtcaacac atgccaacct atgattttga gcagcagttt     22320
     gagatcggga ctcatcatga acaaaccctc gatgagtatt ttcagcagta cttctggatt     22380
     gaatccacat ctcgtcagga gcagcgacag gggatagacc gctggtttca agcacccgat     22440
     gggtcatgga tgtcggtcga gtataaagcg gataagacag cgggcaggac gggcaatgca     22500
     ttcatcgaaa cgatcagcgt agatgtcaga gcggttcagg gctgggccta ttcgtccgag     22560
     gccgatgtgt tggcctatta tgttccccct cgccataccg tttggctgat ctgctttgta     22620
     gagttgaggc aatatctagc tgagtggcac cagcgttatc ctatccgtca gatacccaat     22680
     cacggttatt gcactgaggg tcttctagtc cccctggtct tattgagcaa tattgcgttt     22740
     gaagtttgtc atgtgacgtg aaacgagttt ttggggatct ggttggtcgt aagcgggctt     22800
     ccagcctaga agggcagtcg ctgcatccaa gtattcatca caacttagtc gttgcccaac     22860
     ccccatcagg aacacctgag atatcgagca gtcataggta gataattggt ttgcttatga     22920
     tgacatttct actcaccctc tgcgcttaat ttattgagac atatagatta gtggcttttg     22980
     ggggatgaat gcagatgaaa agtatctcct tcataaggca agctagtggc agtattacca     23040
     ggcataacaa catcttcttc cgtcaatggg agtcaggtac tcgaaaaagt ctatcagggt     23100
     cgccagacct atgaatttcg agaaggcttc aatattccgt tacatccgca tgatgtgtgg     23160
     attgtttgtc gaggggtggt gcaattaaat acttttcatg gtgatgggaa tgaagccatt     23220
     cttgggttag tgtatccaga catgcccttt ggtgtccccc taacccaagt cgatccatat     23280
     gaagcaattg gattgacgaa tgtcgtattg atgcgggtca gtcagcaaga aatagaacgg     23340
     tctctacatt tatctcaatg gatgctggtt cagttacaga agcgtctaca acagacagaa     23400
     gccttccttg ccctgaacag tcaacgtcgc gttggagacc gtctccagca attgctgctg     23460
     ttgttgacaa aggacgtggg ggaggtaata ccggaaggaa tgcgcctcaa ggtgcgattc     23520
     actcatcaac aactcgcaga gctagtggga acgacccgaa tctcagtcac tcgaattctc     23580
     ggatcattcc gcaaagaagg ttggttatcc atcgatggga ctcgtcactt tgtcatccac     23640
     gaatcttccg ttgtggatct ccagtaatgc tttgcatctg cacactaatc attagctctg     23700
     cctagtctcc ctccccccaa cgatcagaaa ccctaatcct ccaatccttg tagcaccaga     23760
     gcatccacgc taccctagtg actaggcagt gggactcccc cacccagagt tttttctcca     23820
     aatccacctc accacgactc cccatcgagc ctgatttttg ctgagggtat attctcacgc     23880
     gaggtcaaaa caaccacttg cgttttctca atatccacat gcccgactcg cttacacatg     23940
     ccagtcgtgc cctatccact attcattatt caaaggacaa cactcatgaa attgattact     24000
     tctatcaaac tccagcaagc cgatcacacc gaggtcatcg acagtgctgc tacccaagtg     24060
     ggcctagctg caaacaaagc cttcctgttc gtcgtccgca aggaaatcca aggctggaaa     24120
     aacttcactg ccctctgctc ctggtgcctg tccaaagtga gccagaagca tggacccatc     24180
     tttgaggagg tcaaagagcg tgctgtagct gtctaccgca agggctgtca gcaagagaca     24240
     gcctttgtcc aagcgcttat caagtcccag atcacggatc ggcttgatgc tcactggaag     24300
     cttcacgatc aggctatcga ttggttcaag gaccagaccc aggcattcct ggccgacagc     24360
     ccggtcgagg atacttctga ggtcgaggtt gaggatctat ctcctgacag ttcggaagac     24420
     ctggaggaga ttgcacctgt ggatgagggt gaggagcctt ctatgactat cttggatgag     24480
     gctccggtcc cggtccttgg tccgcctgtt gatcctgacc cactggatga tgagttgacc     24540
     gttcctcaag acccgactcc tgttgtggct agtggtggag gaaagcgtcg gactaggaac     24600
     aagtccaaga gaacaccgct tggtgccatg atgcttagcc aagccaaaac aggaaaacct     24660
     agttagatat ctggcgtacc tggctcctgg ggagacctgg gagctggtta gttggtgcag     24720
     actaaatttc tacaaatatt tttagtttta ttaagggatt aatagaaaag aggatggtgt     24780
     aatttgcttt gacctaatct atcattgaca ggaatgtaca atgactcttc tacaaaagat     24840
     atgactgtta gtcgaattgc tgttgctggt cgtaaaggag gtgtaggaaa aacaacaatt     24900
     gcctgtggaa ttgcatcgat tctagctagt atgcagcaaa gagtactagt tattgatatg     24960
     gatccccaat cgaatgctgc ttatgtgctt ggagttgatc caacaaagcc tggaaccgcg     25020
     tctctgctgg ttggtgatca tctagaaccc ttgaaagtgg gtgattacct atgggtatta     25080
     ccaggtggcc ctgaactcat gaatcataat attcaatcct gtgatcaaga agagcttgct     25140
     gatgcagttt ttggtatgga ttatgatgtc gttgtttttg actgccctcc tgggaatgaa     25200
     catttagaaa gacttgcaat aaaagctgct gatacggtgc tcatagtttc tgatgcacat     25260
     ccacttgcat tagttggagc gagtcgtgta attaaagaat tgaagctaaa tagtcaaaaa     25320
     ggtagaaaag gagcttcaag gtgggcgatt attcaatcaa aaattgatgc acgtcgagcc     25380
     atggatcgta cttttgattc tgatctggca gagtcatttc caaatttaca acggtttgtt     25440
     gttcgccaag acacacagtt atcccttgct gctgcagacc aaatcccact catgacttac     25500
     gatgctaagt gccgtggagc ccaagatttg atagttgttg cacagtgggg actcaatggc     25560
     tcagcgtaaa accaatacaa agcgttttca acaagcttta aatgtagctg atgatatgtc     25620
     agtgattgac caagctatat ctaatgatac taattcaaat cgatacttaa agacggctat     25680
     cttattagat caaataaagc tacgcagtga agacactagg gaactaaatc aagatcatgt     25740
     atttgcttta tcagagtcga ttgaggtatt gggattaatt gaaccattag tggttgatac     25800
     taggaatcgg ctattggctg gaggtcatcg cctatcagca atacatttcc tccgtgacaa     25860
     taagcaggaa cgatatgatg agcaatttcc tggttctaag atacctgttc gagtaatgcc     25920
     ttttgatgcg gatcaagatc ctgaaaaagc tttgcaatgt gaagtagcgg aaaatgaaca     25980
     cagacgcgat tatacagcta cagaggttag gaatttagcc gaaaggctta aaaaagctgg     26040
     atacagtcac ggcaagggac ggccaagaaa gggaaagaaa gccttgctac ctgcactaga     26100
     ggtgattatt ggtaagcata ctagaacaat tcaacgctat cttagtgacc atcaaaaaga     26160
     aaatacgaca aatgtcgcat taactgctga aaccaagaaa ctgaaaagga ttgagaaaga     26220
     tcttctggct tggaaaaatg aaaatatgca ctgcactgct aattccaaga aggctttgct     26280
     gcttaaacga attccatcaa tggcaaaact aatcaaccaa gttcttacgg aaattcaaac     26340
     tcaagatggg aattaatttt tgtcgagatt actatcaatc aaatcattct gagggaatga     26400
     ttgttgagtg ttcaatgcaa tcggtaaact gattgctcat acttgtcaaa gatcttcaga     26460
     ctaattttgc tgcatgagcc ttagcagttc atcagtgctt accttgccac tcatgtcggc     26520
     cccttctaag agactatctg ccaagtctcg cttttggttg tgcagttcaa caattttttc     26580
     ttcaatcgta ccctttgcta caagtcgata aattgtaacg ggacgctgtt gaccaatccg     26640
     atgagcccga tctgaagctt ggtcttccac ggcagggttc caccaaggat ccatatgaat     26700
     gacatagtct gcagccgtga gatttaaccc agtgcctcct gctttaaggc taatcaagaa     26760
     aatctcaccc tctccagcct ggaatgcatc cactcgttta tgccggtttt tcgctggggt     26820
     actaccgtct agatattgat attggatttg ttgttcatct aagtaacggc gaattatttc     26880
     gagatgatcc acaaactggc taaagactaa tgccttatgt ttgttatcga gcaattcatt     26940
     gagtacctct gcaaagagct gcaacttcgc actgggtaaa tctgtttctg gaaggaccaa     27000
     gcgaggatta caacaagccc ttcgtaagcg cattagttca gccagaacct ggatatgttt     27060
     aggaccactg gcagcgtcac tctcgttcaa ttttgccaat gcgtcctgtc ttaaagcctc     27120
     atagaaggct agctcttctg ggcttaaatc gacttgtaga acaatttcag ttcgagaggg     27180
     caattcctct aagacttggc ttttcgttcg tcggaggatg aatggttgga ttaacttctt     27240
     taagcaactc cgagcggctt tatcttggtg ccgttcaatc ggaatggcaa aacgttgatt     27300
     aaagctatct aaagatccca ataatcctgg attgatgaat cgaaataggt tccataattc     27360
     acctaaatga ttctcaatag gggtgcccgt tgtaataatc ttcaattcac cctggagttt     27420
     catagcggct tgagatcttt tcgttgaaaa attctttatc gcttgggcct catctagaac     27480
     aattgtttgc cacctcacct gagctaacat ctcagccact tccgcttgct gcaagagccc     27540
     gtagctacaa ataagcatgt caaagggctt gagatgctct aataactgtt gccgattact     27600
     attgtcaaat tgcagtggtg tgagagtggg agcatatctt ttggcctcct tgtgccaatt     27660
     catgccaaca gaggtgggag ccacaatcag agttggacca tgaggggcac gggtaagaat     27720
     cactgctagt gcctgcagag tttttcccag acccatgtcg tctgcaagac aagctccaac     27780
     tccccaatgg gaaagtttag ccaaccagcg aaatccttca atttgatagt ctcgcaattg     27840
     gacttgcaat gttgaaggaa tctcaggttc aaaatttttt atctggttta gcctttgttt     27900
     ttgatcacgc cagtgtttat ctgcttgtag gttcccgata tcctcaacca gatcttctag     27960
     ggctactgag gctagagggt gaaaccttaa acccttccca ttgggttcgg ataaagcctg     28020
     caattccgcc agtcgcttgc gaaaagactg ggttagggcc agaaactgac cctcttctag     28080
     tttgataaac cgcccagatg tctcatcgag caaagccaat agcttttgaa ggtctaggac     28140
     aagagtgtta tcaacattta cctcaccttg gatcgcaaac caatcttgtt gttggctaat     28200
     ctttaatttg aaatggtcta agtctgctcg atgtgaaatc cgaaattttt cgccttcggg     28260
     ccattccacg atgacttgat cggagaggga ttgtagagcg tagaggagtt ctaaacagtc     28320
     ttctggctcc gtgatttgcc attctccatt atcatctcca tattggctaa gggtggggca     28380
     tgaatggatg gtcttctgtg ccaattgttc ttcttccgct aaatcgcgat tggtttgcaa     28440
     ccgtcttcct tcaatttcgg taatcaccgt gctcccccca gatccaggag gaaaataaga     28500
     accacagttc ctaaaaggcc gaaccctaat catggctttg aggccatccc ctgcaggaaa     28560
     gagatggaca tgagggatcg gatggggcgc aactaactca gcgttttcag tgccaccgcc     28620
     tatatccgac tgaactgtaa caagtcctga tatagagcta atagctgaaa gcacttgctc     28680
     tttagccgtc ttgggtacat tgaggcagtt gtattttccc aagatcttgg caatgcggcg     28740
     gtgactttca ttgatttcaa tgactttcag gcgagtgggt gtttcttgag tgaccagaat     28800
     gtctttcgct ctgggtattg gaggatgtag ttctaaagtg agctttccct gatctttttc     28860
     tttgaccaat agctcaggtt cgcctttgat gatgtcaatg cgggtggagg gcagacccgc     28920
     ccaaaagaca gcgggatgac ccaccaattg agcaatggct tgttccttga actgatattc     28980
     cgttttatgg tagccaaaat agtagctcac ttggtcttca atctcagcac aagttttcaa     29040
     gtcttgagtt gtgagatagc ccaggctttt gggttgattg aacagacggc tcagggcaat     29100
     cttgcgcccc ttgctccacc ctcccttggc attgcgtttc tgttctttgg gttcgagtgt     29160
     gacgttctca gatccgatag acacaaacca agccagccga gaaatggctc ccgttccgtc     29220
     atttagtaga aattcggaat ttaactgttc taaggctttt aagctgagct gccaatcctc     29280
     ctgagcagtg actaatttgg ctaggggaaa ctgaggtgtc ggcaggtcag gcaactttgg     29340
     tttagtagca ggttgttcag aagccagttg ttgaattaaa gctttcgctt cagaagccag     29400
     ccaaccatat ccagagttat aggcttgaca acaatatgga acaaggactt cgactaaagc     29460
     tgtttttgct gagctggggt caacccaatg gacacataat gcactgatca gggtttgtaa     29520
     gctttggcca tattggtagg gcagtacaga ggtattgatc actgagtttt ggtaggataa     29580
     gtcaccttgt tggatcaata ggactttttt gagcagggaa taaatctgag agagccaatg     29640
     gtcttcggac tcaaggatca agtcgatata gcaaatcgct gaactgagtg atgccctgga     29700
     tccttcatgg aggagtgtca ataaatagaa aatgccgctg atggactcaa aataaacttt     29760
     gcgtttgcta gtgagtttcc ttaatgcttt caatgcctcc acatatgcag caatcgcggc     29820
     atcaaaatta ccttccaaac aggccaacca tccttggata gccagggcat catgttcata     29880
     gtctgcaggg atatcaacga gacaggcttt agcttcttca atccgtcctc ttaatatcag     29940
     ttgttcggct aatacaatac tgagatagtt tccgcctacg tcctcacaaa tttcaatgag     30000
     aacctctaac ttgtcatcag cagagaacaa catgagggaa tcggtgagta acccattgac     30060
     cagaaataga tcagctagtt ccatgggaat ggtccaaaac cagtaccgat caaagggatt     30120
     attacaaacg aggtcaagaa cctcatctaa cgcaatcttg tcactcctgt agccgtaggc     30180
     atagtaatct tggcaatact cagcaatggc ttcaaaatct ttctgataaa agcccatgcg     30240
     aaaagcacgg ataaattcct ggtaatcatc aaaactcagt cctttaccat tccatcctgg     30300
     cttaaatgga ataatggatt ctaccgcttc aaccattgct ttgaacttac ctttggccac     30360
     ggcatctctt gtggcaatct caatgattaa ggggtgtact cggagcttag tattctccat     30420
     cagtagaact tctaagttaa ggagattttc aatgtagggc cgaatggttg agctagtcag     30480
     ctttttttgc tttgggctaa gggttcctat cgttgccaag caagataaca gggcagtgcg     30540
     gcttgtggat gtgtaaataa ctgaaacagc ttgaataatt tctcgttcta gatcagaaag     30600
     ttgttcatac ttgttgacta ggcttgctct aacggcagat aaatcttcct gcttctcggg     30660
     ggaatttgtg gatagggaca cgtcggtagg gactcgctag tatctaaacc agtttagaac     30720
     gggtctccat tactcattag atctggaaaa acttttttaa gtcgtcttta tcgactccag     30780
     agactatgca ggcgccaaat ctatctcacc tgtatattgt tccgggtttt cttaacctgt     30840
     atagatttga aatttgccgt tctgttgatt agccaacacc gaagtaattt gtctgttctt     30900
     ggatttattc taaaaatatg cgttcttccc ctccctaact atgtttcggg agggatttca     30960
     ttgctcatta ccaattcttg ttaatctagt ttgcatctga ctgcttaatc ttaaggagac     31020
     tcattagaag aaccattatg gctaggaaat ctaaaggttt tagtgaatta ctccatcaac     31080
     aacaagatga tgagcaaaca accgctcaat ccttcaatcg gttgcaaaaa aaagttaaga     31140
     aaacaactgg aaaagacctt attaaggaca tagccactag cccaaagggc attaccaaaa     31200
     tgtctgacgt tttggaggaa tttattgatc cctacaaaga aacaacttct agttttgaag     31260
     atgtggaatc cttgctgagt attgctgttc ttgcctggaa tatcgcctta ttacccgatg     31320
     aggaccgcca agaagctata gaaattattt tgtcagaagc tgcctctggg atgaaccaaa     31380
     agagtcgagc ggagttgcaa accttaatcc atcagatgat tgagcgcaaa gactgttatt     31440
     tttcaagttt tcagcgctat attgctaatt ttgacttgca gcctcaagga gatagttatt     31500
     tcctttccgt tgcttcttct ctcaaagaat agactttata ttatcttctc aatcagtgtg     31560
     aattagatga gcctaatgct atgggcgctg tgatggggaa gtttaaccgt tctcagttag     31620
     aaaaagagga agcttctttt tccgcaatca cggcaacggt acggtctgat tctgataacc     31680
     aacaggagct tttcagcgca gtttttatgt ctagaccgtt ttagggcagt gctattacag     31740
     tgactacatc tcttagccat gagtccaccc aggcttgttg tctcaagtct aaaggaagag     31800
     ccagatagtg tcagttaaga gtaatacaca tacctttaag ctgacttaca tttatggggt     31860
     aatttgcctg tctttcgtcc cccaatcatt gaactcaacg agtgggtttt gtatggatat     31920
     ctatgtcacc gaaattcaat tttaacctca atggtcacga gaaggatctg gtatgggctt     31980
     agcgattgat aaagccattg ctgaagccca tcgaggtcga gtcgagctaa taagtgagcc     32040
     tggggtgggt tcaaccttca ctatcagcat ccccttcaga gacagtatga gttgattcaa     32100
     caatggctag aaaagaaagc tgaaaggatg cttccccacc aaaactaata caccccatgg     32160
     agagtaatct gatcattttg aaaccgctat tcaagcaaaa ttcgctttgc ggctgaaggt     32220
     aatgaattca gcctccgcca cttaaaaagc tttttgccac ccgcttttca aaagccaatc     32280
     ggtttcaagt tgtggtccat ttagggattg atgcacggga aatgcaaaat ctatcgctag     32340
     tctgtaacca gcaaggttcc cttagccaac agcaaagacc gcagtgatta gaaggattct     32400
     tgtctctcaa ctcatcgtaa actgaggagc cgacagcgca gtcactctta gaagggttag     32460
     tgaaagcgta cgcaacgaag tgccataaga gcaaaaataa agcctgaaac aacgtaaact     32520
     cgttgagcga tcaagggata tcttatttca taggactatt atagttcaaa agaaataagc     32580
     tataaccttt atttagtaat gctttcaggc ttattactct tgctttcagc tacgctttca     32640
     ccaccccaag ttcaacaatt cgtagcgcga agttttgatg cggtctcgac catattgata     32700
     agtgaaggct tcacttccga ccattggcga gtcttgagac cacaatccgg gttgacccag     32760
     aggtgctcac gcggtaacac agcttccgct tttgacatga gattactcat ttcatcggtg     32820
     gggggtaccc gtggtgagtg gatgtcatag acacctggac cgatctcatt tggatactta     32880
     aagtctacaa aggcatcgag cagctccata tttgagcgcg aggtctcaat ggtgatgacg     32940
     tcagcatcca tagcggcgat agagtcgatg atatcgttga actcggagta acacatgtgg     33000
     gtgtggattt gggtttcatc ctccacaccg caagcactga ggtgaaatgc cttcactgcc     33060
     cagttgagat agttatccca ctcgctcctg cgtaacggca gaccttcacg gaaggccggt     33120
     tcatcgatct ggatggcggc aatcccggca gcttcgaggt ccaccacttc atcacgaatg     33180
     gccagggcaa tctgatgtgt ggtgacggag cgcggctggt cgtcacgcac gaagctccac     33240
     tggaggatcg taaccgggcc ggttagcatc cccttcatcg ggcgatccgt caacgattga     33300
     gcatactcag accagtagac agtcatgggc ttggatcggc tgacatcgcc aaaaatgatc     33360
     ggtggtttca cgtagcgagt gccaaagctc tgcacccaac ccgtgctggt aaaggtaaag     33420
     ccttcgagat tttctccaaa gtattccacc atgtcattgc gctcgaactc gccgtgaaca     33480
     ggcatatcaa tcccgatctc gtcttggaac gcaacgcatt tagcaatttc ttccttcatg     33540
     aactggtcgt agtccgcatc gcttagcttc ccttttttcc actgggcgcg tgctaggcgc     33600
     acctccttgg tctgagggaa tgagccgatg gtcgtggtcg ggaattccgg caaacggagt     33660
     ttggctcgct gcttggtctg gcgttcaacg aaggctgagg cgcgatcgaa atcgctgggc     33720
     ttaaccccag caaggcgctt tttcacagca tcattgtgga tacgcttgct agactttcga     33780
     gaagcaacgg cggcacggtt ggtttcaagc atttcttcac ttccgacttc atcgagaagc     33840
     tgccggagtt cggtgacttc cgtgagtttc tcgtcggcaa aggccagcca acttttcagc     33900
     tcatcatcca gcttttgttc gttttgcagg gtgacgggcg aatgtagcaa tgaacagcta     33960
     ggtgcgaccc aaagccgatc cgcgccaaca acaaccttgg ccttcttcaa aaattctagt     34020
     gaggcatcgt aatcattttt ccagacattg cggccttcga cgattcctac ggagagaatt     34080
     ttgttagtcg ggaaggtatc cagaacagag tcaatgtctt ctgaacctcg cacgaaatca     34140
     aaatgcaagg cgtcaaccgg caacgcaagg tagtcatcaa gattatctct cacgccacca     34200
     aaatatgtgg tgacgagcaa ctttgctgag ccttggacct tagagagacg atcgtatgcc     34260
     accttcaaag cttcgcgctg taaattgctc aggtcggtgg aaataatcgg ttcatcgagc     34320
     tgtatccatt ccgccccttc ggcggcaagc ttgtcgagga tctctacata gacggagaca     34380
     agattgtcga ggagagtcaa cggatcgaag tccgggttgt tagaaccctg taccttgcct     34440
     agggagagat aagtcacggg accgacgagc actggcttcg cgttaatccc cagttcctta     34500
     gcctccgcga gttcatcaaa gactttggtg ctgctaaggg agaatgttgt gtccccccga     34560
     aactcaggca cgatgtagtg gtaattcgta tcgaaccact ttgtcatctc gctagcaaaa     34620
     gtggaaacct tgctcgtctg gcagtccttc tcatcctcaa cccaagaagt gccgccttcc     34680
     gtaccacgag cgatggtgaa agcggtgttg atgtctgtct gcccgccttg ccactgaaag     34740
     cgcggtggca cattgccaag caggcagctc atgtcgagca cttggtcata aaaggagaag     34800
     tcattgaccg ggatgagatc tagtccggcg gcctgttgct tcttccagtt ggtttcgcgc     34860
     aaagtcttgc ccgtgacgag cagctcggaa agaggaaggt cgcctttcca ataggcttcc     34920
     gtagcctttt ttaattcacg cttggctccg atgcgcgggt atcccagcga atgtgttttg     34980
     atcggggact tattgcattg actcataaac ttggctccga tgtgcgggta ttatcccagc     35040
     gatttttttt gaggtgattc ccttgttgcc cattggcatg gcaatgatgc tatcagcgtt     35100
     aattgatgaa tacaaatggt tattattcat gaaataatga gtaaaattca ttgaaggccg     35160
     ataacattgc tcgaacgtag ccaccttgag atcatccgtg cggttgacct gcatgggact     35220
     atgaccgccg ccgcgaatgc gctacaccta acgcaatcgg cgctgagcca cagtatgcgc     35280
     aagctggaag atcagattgg ggtgaagctt tggtatcggg aaggacgcag ccttcgtctc     35340
     acccaagctg gcacccattt gttggccgtg gccaaccgcc tgattcccca gttcgtccac     35400
     acagaagaac gattagaaca attcgcccgt ggtgaacggg gaacattacg aattggtatg     35460
     gagtgccatc cttgttatca gtggctccag aaaatcactg gcccttactt gcgtgcctgg     35520
     gaatcggtgg attttgacat taaacaaaaa ttccaattcg gcggcatcgg ggctttattt     35580
     gctcacgaaa tcgacctgct ggtaactccc gatccacttc tgaagaaaag gctacatttt     35640
     gtgcccgttt tcgattacga acaagtcttg gtggtcggat ctgagcatca acttcggggg     35700
     gaggattggg tgatccctca gcaacttggg gaagaagttc tctttacata tccggtttca     35760
     caggatcgcc ttgatatcta tactcgcttc ctcactccag tgggaatgac ggtcaggcgg     35820
     cagaaagtgg ttgagaccac agaaataatg cttcaaatgg tagcctgtgg ccgtggtgtt     35880
     gctgctttgc ctcgctggtt ggtagaagaa ttctctgaaa aatataccgt gcatgcagtg     35940
     cgcttgggac ctgaaggcgt gcaaaaacaa attttcctgg gcgtccgtca agctgatctc     36000
     gaagttgact atatcaatgc ctttatcgat ttggcccgca actaccatga acatccttga     36060
     aaaggttcat ggtagttgac ggtgcaaaaa aattagacta tctaaacata aaattacgct     36120
     gtctgtggca ccttcttctt tatgggttcg ctagatgcgg tgatgataga cgagttagcg     36180
     cctgaatgag ccgaggctcg aaaccatatg aatgtctctg agctatgtta tagtgtcgag     36240
     caaatcggtt ctgatgggaa acagccatca gacgtaaggg ggaaagtccg gtgtgaatcc     36300
     ggcgctgtcc cgcagctgta aggagagacg caactctcta agccagaatg cccaccggtt     36360
     gaaaacccgt tacataacta tctgcgaggt acaggtaatg tctgatagct tttttcgatt     36420
     tcaactggga aaccaagcgt ctggctgtag ccacgaacag gttgtggaga tataacctac     36480
     ttgccattgg tagcgccagt aacttcatct atcctcatgt ccctttagtt agcttggcat     36540
     cgctggcggg agtcactctt aatcgcagac aagccattgt ctctgctggg ttgatttggt     36600
     tggttaatca attctttggt tttaccgttc tgcaatatcc tctcagtgcg atctcactcc     36660
     tgtggggcct gtctatggga ctggggacca ttgcagttgc cttggttgcc tcaattcggc     36720
     ccccctttag tcgtcgcagt tggtgggcac aaagtttatg gctaggcatt tcattgttgc     36780
     ttggtttttg tctctatcaa agcggtacgc tgctggtcaa tcaatgggtg caaatgcatg     36840
     gtctcacggc tgatgtgttt ctatagatgc taggacgaga ggtgctgtgg gcaatcgcgc     36900
     tgtttgcgtt ctacaccgct ttagttctga gccatcaacg taacctgcaa cagactctgc     36960
     gctaagtctt tctatttgat tgaaggccaa cttcatcttc agcccagtga cattgatgaa     37020
     attaagccgc ttggagggca attttgccac acatctgagc aacttagttc cgctgtactc     37080
     tggttgactt aactgcaaac gctggaaatt tccgaagttc ggatccatga ccccatcctc     37140
     gtaatcagcg acatagaaga tccaaaagat gggatcactg aaacctgtca agcgcttact     37200
     tcagatgggc ctttccagac taaggctgaa atctactcta aatctttaga gcagcctcta     37260
     aaaacttcaa ttaaggacgc taaagcaatg ccagacacaa aagagttaga gtctgctccc     37320
     ttatcaatac tgcctcctat tcagggtggg tctgtggagg ggcttgacgc cgagtacaaa     37380
     gtcattcgcc gcaatggcag cgttgttggg tttgaggcgg acaaaatcgc gatcgcaatg     37440
     accaaagcgt ttcttgctgt caaaggtgtg cagagtggag tctctgcgcg agtgcgtgag     37500
     ctggtggcaa cgctgaccac caatgttgtt accgccttga agcgccgtca gcccactggc     37560
     ggcacctttc acattgaaga tattcaagat caggtggagc tggctttaat gcgctctggc     37620
     gagcatgatg tcgctcgcgc ctatgtgctg tatcgcgaaa agcgttctca aaaacgtacc     37680
     caacagcatg gcatagaggc agctccaatt tacctgatgg atggcggtga tcgcgtatta     37740
     cttgatttgg agcgcttcaa cgatttggtt gattccgctt gcatcaacct cggagatacg     37800
     gtgagtggca aggcgatcgc tgatgaagcc ctcaaaaata tttacgatgg agcgtcggtg     37860
     gtagaactac ataagtcagc gatattggcg gcgagatcgc acattgaaaa agatccagac     37920
     tacagcaaag tcacggcaag acttcttctg cacaggattc gccaggaggt cttgggtgca     37980
     gaagtaactc aagcagagat gcaagcccgc tacgctgaat attttcccca ctttattcag     38040
     caaggtattg caaccggact actagacgaa aagctcgctc aatttaactt gcagaaatta     38100
     ggttcggtcc ttgtcgctga gcgtgatctt cagtttggct atctggggtt acaaaccctc     38160
     tatgatcgct attttctgca tacagaagat cgacggattg agctacccca ggcatttttt     38220
     atgcgtgtgg ccatgggact tgccctgaac gaaatcgatc gtgaagaacg ggcagcggag     38280
     ttctacgaca tcttatcgaa gtttgatttc atgagttcga cccccacgct gttcaactcg     38340
     gggacggtgc gatctcagct ttcttcttgt tatttgacga cggtaccgga tgccctcgac     38400
     ggcatttata gcgcaataaa agacaacgcg ctgctctcca aatatgccgg ggggctgggg     38460
     aatgactgga caccagtacg ggcgctaggt gctcatatta aaggcaccaa cggtaaatct     38520
     caaggcgtag taccgtttct caaggtcgtt aacgatacgg cagttgctgt gaatcaagga     38580
     ggcaaaagaa agggagccgt atgcgcttat ttagaaacct ggcatttgga tatcgaagag     38640
     tttttagaac tccgcaaaaa taccggagac gatcgccgcc gcacccacga cataaacacc     38700
     gccaactgga ttcccgacct atttatgaag cgggtgatgg aagatggcga ctggacgctg     38760
     ttttcgccgg atatagtacc ggatctccat gacaaagtgg gcaaagaatt tgaaactgct     38820
     tacctggcct acgagcagca ggctgcaaag ggcgaactga agcctttcaa gaccgtgccc     38880
     gccaataccc tctggcgcaa gatgctgtcg atgctgtttg aaactggcca cccctggatt     38940
     acgtttaaag acccctgtaa tgtgaggtcg cctcagcagc atattggcat ggtgcatagc     39000
     tcaaaccttt gcaccgaagt tacgctcaac acgaatgaaa atgaaatagc cgtgtgcaat     39060
     cttggctcag tcaatcttgt taatcacatg gtggagaaaa acggtcaaat gcagctcgat     39120
     caagccaagc tgcaacacac catcaccatt gccatgcgga tgctggataa tgtgatcgac     39180
     ctgaactact atgccgtcag cacagcgcgg aattctaacc tcaagcatcg ccccgtgggt     39240
     ttggggatta tgggcttcca agactgtctg caccaactgc gcctgcccta cgcctctcaa     39300
     gatgcggttg actttgcaga tcgcgctatg gaagccgtct gctactacgc ctactgggct     39360
     tcgaccgaac tggcccaaga acgcggtcgg tactccacct acaaagggtc actgtgggat     39420
     cgcggtattt taccccaaga taccctggca cttctcaaag aagtacgcgg tggatttgtg     39480
     gaggtggatg agtcttctac gatggattgg gatctgctgc gagaccggat tgcccagcat     39540
     ggaatgcgaa actcgaactg cgttgcgatc gcccccaccg caaccattgc caacatcatt     39600
     ggtgtctctg cttgcatcga gccaacctac caaaatctgt acgtcaaatc aaatctgtca     39660
     ggggagttta ccgtcgtcaa cgagtatttg gtgcgcgacc tcaaagtccg tgaactttgg     39720
     gatgaagtta tgattgccga ccttaaatat ttcgacggca gtttggcaaa aatcgatcgg     39780
     attccgccag agctacgcca gctttacgct accgccttcg aggttgaacc caattggatt     39840
     gtggaagctg cggcccgtcg cagtaagtgg atcgatcagg ctcaatcgct caatatctac     39900
     atggccggag catcgggcaa aaagctcgat cagatctaca agctggcgtg gcagcgtggc     39960
     ttaaaaacca cctactatct tcgctccctc ggtgccaccc atgttgaaaa atcgacggct     40020
     ccagccagta gcctcaacgc ggtatccaat aacggcagca gcaatggtat aggcaatata     40080
     ctcactacct caaaatctga aaacttgggt caggtttgta gcttatcccc tggcgatgcc     40140
     aactttgatg actgcgaagc ctgccagtaa gcaactggtc agtaaatttg ttaaccccta     40200
     aggagactct aatgatgttg gtgtgggaag aagagacgac cgctacagca cagaccaaaa     40260
     ctgttcagac cgaacccgtt caggcggttc catcaccgca agaagctggc cctcaaacaa     40320
     taatggctca accggaaacg caaccccctc gtcgcatcaa cgttgctgac aagcgcatca     40380
     ttaacggcca aaccgatgtc aatcagcttg tgccctttaa gtaccagtgg gcctgggaca     40440
     aatatctggc aggctgtgct aaccactgga tgccccaaga gatcaatatg agcagggata     40500
     ttgcactgtg gaaaaccact gacgggttaa ccgaagatga gcgtcgcatc gtcaagcgga     40560
     atctcggctt ttttgtcacc gcagattctt tagccgctaa caatattgtt ctgggcacct     40620
     atcgacatat cacggcacca gaatgccgcc aatatttact acgtcaagcc tttgaagaag     40680
     ccatccatac ccatgcctat caatatattg tcgaatcctt ggggctagat gagggcgaaa     40740
     tctttaatgc ttaccgagaa gtggactgca ttcgcgagaa agatgagttt ttaattccct     40800
     ttgtcgagac tttgaccgat cctacctttg aaaccggcac ccccgaaaac gatcaaaaac     40860
     tgcttaagtc tctaattgct ttctcttgtc ttatggaagg tctttttttc tatgtaggct     40920
     ttgtccaaat cttggccttg ggtcgccaaa acaaaatgac gggcgcagcc gagcagtatc     40980
     aatacatcct gcgggatgag tcgatgcact gcaattttgg tatcgatcta gtcaatgcca     41040
     ttaagcaaga aaacccgcat ctgtggaccc ctgaattttg cgaagagatc cgcgatctgt     41100
     ttaagcgggc ggtagagctt gaatatcgct acgccgaaga caccatgccc cgtggcgtgc     41160
     tcgggcttaa tgcctctatg tttaagagct acttgcgcta cattgccaat cggcgttctc     41220
     agcagattgg cctcgacccc atttttgctt ctgaagaaaa tcccttccct tggatgagtg     41280
     agatggtaga cctcaaaaag gaacgcaact tctttgaaac ccgtgtgttg gaatatcaga     41340
     ccggtggggc actcagttgg gattaagcca ttgatttacc gacaacccgc gattctggta     41400
     ttgcgaaaat gatgaacaca attgaccaac tctgggctaa attcagccaa tgttggtcta     41460
     gtcccactga gcatagcgga gaaactaagc tgtgaccgat catcctcaac cggactggca     41520
     acaagctttt atcacgacta acctgctggt cctaggctac aacgcctggt gtggatttct     41580
     gacaggggcg cggggtgcag tggtgtgtag ccttaactca ccgcagttgg ggatgaccgg     41640
     ggaaagcttt ccggcacact acatttcgcg cgctcgtctc gccccattcc tcaacgcttg     41700
     gttagctatt cccgatacgg ttattttgac tcatcaccac atcactagcc acattctcga     41760
     tgtggttgat ggctataatc ccgaaaccga cataattttg ctgttggaat cgggcgatct     41820
     cgcctctttt ttttacctgc gaaatttgcc catctctccc cctcaaagtt atgaggtggt     41880
     ttgtaaagga tgggatgaat ttaaacccat tgagcccgat tatcccaaaa ctcaactatt     41940
     tcaaaataat ctcaagtctt aaccctacct gcaatccatg acacaaacca ccttatttgt     42000
     ctgctccctc tgtcgatttt ccaaggatga agctagccgg gatggcattt ccggggggca     42060
     acacctgatc aaccagttgc atcagttcct caccgatagc ggactacaag atgtcgtgcg     42120
     gttagagccg ttgcgctgta tggcgggatg cagccaccct tgcaacgtca gtctggccgc     42180
     acccggtaaa ttgacctttg tcctcagcca gatatcaccg acagagggag ctaaggcggt     42240
     ttcagcattt tgccagcaat acgccacttc tcccgatggt aaagtcccct actcggaacg     42300
     tccgaactcg gttcgagagg ccactgcgtt tgtcctaccg ccactcccta ctgatgcccc     42360
     cacccgctaa tgattcagct tctattgaat tcagtaaagt ttgtcttttc ttcaaaggag     42420
     ttccttttat gcacaaaatt cccgttactg tggtcactgg ctttctcggt tcaggcaaaa     42480
     ccactctggt gcggcatcta ctgcaaaata accagggtcg tcgaattgca gtgttagtaa     42540
     atgagtttgg cgaagtgggc attgacggcg aactgctgag gtcatgccag gtgtgcaacg     42600
     acgaggagac tcctaacggc tctggcccca atattgttga actggccaat ggctgcctct     42660
     gctgcacagt gcaggaagag ttttttccca ccatgcagga gctattgaag cgacgcgatg     42720
     aaattgactg cattgtgatt gaaacctcag ggttagccct gcccaagcct ctagtgcaag     42780
     cgtttcactg gcctgaaatc cgcacgggag ctacggtaga tggggtggtg acggtggtgg     42840
     atggcgatgc tctggctcag gggtgtatcg tcaacaatct ggacgccttg cacacccagc     42900
     gacaggcaga tgacagttta gaacatgaaa ccccaataga ggaactgttt gaagatcaat     42960
     tagcctgtgc ggatatggta ctactggcca aaaccgatgt gatacaggag gaggatacat     43020
     gtagccgcat ccaacagtgg ctgcagcaac agacttcgac aggtgtcaaa gttgttccct     43080
     gccaccacgg tcaaattagc ccagatattc tgctcggttt taacgcggct gttgaagaca     43140
     atctcgatag ccgccccagc catcatgatc aggaagaaga gcatgatcac gatgacaaca     43200
     tcaactccat ctgcatagag ctggagcaga cctttgaccc aaacacactg atcgaacggt     43260
     tgcaagtctt ggtacagcag caagaaattt atcggatcaa gggcttcgtc gccgttccca     43320
     ataaagccat gcggttggtg ctccatggag tggggcaacg ctttgaccaa ttttatgatc     43380
     ggctatggca aactagcgaa ccccgtctga ctcaactagt gtttatcggc caaggactgg     43440
     actcccatca tattactgaa gcgatttctg cttaatgctc ctgacatggc attccttttg     43500
     ccatatgtgt tgctgttgat tgcccatcga agaggatttt cccatgaccc ttacgactcc     43560
     ttccctaaca atgtgtaggt gggacaaggc aaatgtttcg aactgttcta ggggcacgta     43620
     ggttggaaat cattcagggc tgtttcaagt tcgccagaga taattcgaaa gtactggaag     43680
     tctgtaaaag gcaaaagaac aacaaaggat ctgagaacac aaaaatattg gttccaaatt     43740
     ttctctcatg aacttgaaac agccctggga aatcattgat tagattgggt ttgggacatc     43800
     tgcactccta ataaacgtca aactaaaaga ctggagttat tttaattgat gtcgatgaaa     43860
     tactctgcag ggtatgggtt tcagaacatt tcaaccatga aataaaaccc gaaatcagtt     43920
     gattgatcgg cagtaagttg cagctttggt tgttttgggc ctataagggc tgttcaaatc     43980
     gagaactaat ctataatcct ttgctcagga tggagtacaa cgtggctaaa acaacaaatt     44040
     gggacactaa gatcgaagaa tcggatccac cgaaggtgga aagtttggtg gatttgctcc     44100
     gttatcgagc tgcttaccag ccggatcgga gggggattac ctttctggtt gatggagagg     44160
     aagaagccct ccatttcacc tatgcagagt tggatatcaa ggcccgtgcg atcgcagcag     44220
     cactacagtt agcctgccac cccggcgatc gagccctatt ggtctatcag cctgggttag     44280
     agtatgtggc tgccttcttt ggctgcctct atgcaggcgt tacggcagtt cccatctatc     44340
     ccccccgccc gaatcgctcc ttgatgcgtt tgcagagcgt catcgcggat tcccaagcca     44400
     tttttgccct taccacctct caaattctgt cgaaattaga gcgacggctg attgatgctc     44460
     cagaattgag agcgcttaag tggctagcaa cagatagcct cagcgttacg gaaccccgcc     44520
     aagcctggca agagactcat cctcaggggc aagatttagc ctttcttcaa tacacctctg     44580
     gttcaaccgc aacgcccaaa ggggtgatga ttactcatca caatctttta aagaatttat     44640
     ccttgattca tcaatgcttt gagcatagtt cccagagcct agcggtgatt tggctaccgc     44700
     cttaccatga tatgggtcta attggcggga ttttgcagcc tttatacggg ggatttccca     44760
     tggttctgat gtccccattt atgtttttcc agagccccat tcgctggctc caagccattt     44820
     cccgctatca aggaaccacc agcggcggac ccaatttcgc ctatgattta tgcttgcgaa     44880
     aaataaagcc ggaacagctc caaggactgg atctgagttc ctggcgggtg gcctttaatg     44940
     gagcagaacc catcagtgcc cagacccttg aagactttgc cactaaattt gctccttatg     45000
     gatttcggtc agaagccttt tttccttgtt atggtcttgc cgaagccact ctaatcgtgg     45060
     ccgggggcca accggatgcc caacccgccc tcaaaacggt ccaagggact gccttagaac     45120
     agcatcatgt ggtctcggcc caggccaatg atgtcgatgc ccgcaccata gtgggctgcg     45180
     gcacttcact tcaagaccaa gaaatcgtga tcgctaatcc tgaaactctg cagcaatgct     45240
     cgtcagaaga agtcggcgag atttgggtgt ctggggaaag tattgctcaa gggtattggg     45300
     gacaatcaga tgtatctgag gaaacctttc aggcccattt ggcagataca ggcgcaggcc     45360
     cctttttaag aacaggggac tatggctttt tggtcggctc tgaactttat gtcaccggcc     45420
     gcctcaagga cgtgattatt gtcaatggcc gtaatcatta tcctcaggat attgagtgga     45480
     ctgtggttca aagctatccc ggtattcgcc ccaattgtgc cgctgcattt tcgattactg     45540
     aagcggggga agagcggcta atagtggtgg cagaactgga aagaaactat atcaatcgct     45600
     atcggaaaaa cggtaagaag ccatcctctc agcctcctca gctcaatgat tttgtctcgc     45660
     ccacatcctt aactgccgat tcagaaccta ctaccgtcga aaaagatata ctcactcaaa     45720
     ttcgtcgggc ggttgccaaa gagcatgatt tgcacatcca tgccctttgg ctgctcaagc     45780
     ctggtagtat ccccaaaact tctagtggaa agattcagcg atttacctgt agatccaaat     45840
     ttttagaggg agacctagac agcgtagcaa gaagtatgcc ccgagcttaa aaaatggcag     45900
     tccacggatt ttttacaggc agaaagtcag tctcaactta gaggctgttt gagaagtgag     45960
     taaagctctc aaggggctaa tctgtcaata cacaaacatt ggacaggacc ttaagatgtt     46020
     gtttgggatt ctatgaccct tcatttaagc aatccttgtt ctaccccaat tgttctcgaa     46080
     gttcaatagt ccgcctcgtc caaatgttct gagacatctc ggtaaagatt aaaaatatgg     46140
     tggtctttta atccgtaaat cactgttcgt ccacatttac ggcggcgaac cattcgtgta     46200
     ttcctgagga ctctcagttg atgggacacg gctgattctg acatctcaac tgctgccgct     46260
     aactctccca cccgcatttc ttcaatggca agagccgata agattctcca acaattaggg     46320
     tcgctcaata cgcctaaaaa ttcagccatc cgctgtgcct tttcaaaaga caaaatttga     46380
     tcgaccaccg gcttctctga ccggggtttc tccaacaagg aatgagtgct gatatcaagg     46440
     tgagagtgcg acataacgtg actgaaggtg gcttgatcct aagataatta actctagatg     46500
     gctttctgca tacattacta atgacatttt aatacttgag cagttattca tatgttaggc     46560
     tgtgaagcat gaatgattgt tcatatattt agttatggag gtttgcaatg gcaaccgtta     46620
     ctcaaatgaa atgtgcttgc gagtcttgtc tttgcatcgt gacgattagt gatgcgattc     46680
     aaaaaggcgg tcagtatttt tgtggccaag cctgtgcaga tggacatccc tcaggctcgg     46740
     gttgtggaca tacgggttgt cgatgcagtt cataatttga actaagcccg cttttgtatt     46800
     gatctgaatg gatggaatta gaggagcttc aaaggatcga catcaatttg aagacgtaaa     46860
     ttttgtggac accgttgttg gcattcttgt ctgggaaacg gccagtgttc agactggccc     46920
     agtttagcct gggggcgttt aactaacaca tgccaataat atcgtcgggc tactctcaaa     46980
     atactagcgg gagcaggacc gagaatactg ccctcatagc gatgtaattg gatataagcc     47040
     tttaggtaat tggcaatatc tagggcagta ttctcaacca tcgtttcatt gagaccactg     47100
     atgcgtagga ggattagttg ttggaagggc ggataattgg cttcccggcg ctgcttgagt     47160
     tcattgatga gaaaggtatt cattgaatat tgttgaacgg cctgaatgac ggggtgttcc     47220
     ggagcatagg tttgtaggat tacttggcca ggatgctccc cacgacctgc gcgtcctgcc     47280
     acttgtagca gggtctgaaa ggtgcgttca ctggcccgaa aatcgggaat attgagtaag     47340
     ctatctgcag ccaaaacgcc aattaattga acttggggta aatcaattcc tttagtgagc     47400
     atttgtgtac caaccattag gtctgcctgg ccacgggcaa actgatttag aagctgacga     47460
     tgggctcctt tccgacgagt ggtgtcacta tcaaagcgaa tcactcgcaa ttcgggaaac     47520
     gttttgtcta attcctgcat gactcgctgg gtcccacttc caaaaaatcg gaagtaagag     47580
     gacttgcaga caggacaagc ttgcggttgg ggctgagtgt agttgcaata atggcatcgc     47640
     aacagagttt gacgggaatc agggctatgg tggtaggtca tagaaatgct gcagtgagga     47700
     cattcagcga cataaccaca actgcggcaa gagacaaaag tgctatggcc tcgacgaggc     47760
     ataaataata gcccttgctg atgcttctgc tgcagttctt gcaagcgttt tttcaatagt     47820
     cgactgaaga tggaatgatt gcgattggcc aactccaggc gcatatccac tatttcgatg     47880
     gggggcatgg ggcgagcatt gactcgctga gggagttgaa ggtaatgaac cttgctctgt     47940
     gatagatgag gctcacatcg ccgtgtttgg gaccaactct ctaggcaagg cgttgctgaa     48000
     ccgaggataa ggggacagtc ttcctgttgg gcgcgccacc gagcaacggt gcgagcatga     48060
     taacaagggg ctggctgatc ctgtttgtag ccggtatcat gttcttcatc tagaacgatc     48120
     agtcccatat tggctactgg tgcgaagatt gctgaccggg tgccaatgac gacttgggga     48180
     gtgctagtga ggaattgccg ccaggtatca taccgttctc catctgaaag ggcactgtga     48240
     tagacccgaa tgcgatcgcc aaatcgagac cgaaaccgat ccgtcagttg cggcgtaagc     48300
     ccaatttctg gcaccaggac aatcaccgac tgctggcgag ctaaaacagg tgtaatagcc     48360
     tgcaaataga cttctgtttt accggaaccc gtgacgccat gcagtaagac ctcagcgtaa     48420
     ccttgcagcc gattaagttg agacaggacc ttggcttggt cgggggttag cattcgaggt     48480
     tgatctggct gaatcggaga ggtttccaac cgtagtcgtt cctgttgctg cagggtgata     48540
     cagcctttac tagctaattt cttgagggtg ttgctacttg tatgggcaag tctcaacaga     48600
     tcttgtgccc ataactcccc accttcttga ttgagaaggg tcagaatttc ctgctgacgc     48660
     ttcgtcaagt ccggtacgtt gagggtcgtg aaggtaacca cttgttgctg tttaggctgg     48720
     gttggcgctt gagtttggag gtagctttta accagacctc gctgttggag ctctcttaag     48780
     ccgacctggg cttttttgac ctgacgacga aggtattgcc aggtatagtc ttgggttgga     48840
     ctttgttgca ggagcgttaa aatgtcttgg gcagctgttc ctaaaccgtg gacatcaacg     48900
     gaattgatgg aagtgtgcaa acgaatgcgg cgttgagatc gctgcaacaa acccggtggc     48960
     aaggctactc gaatgacggc catcaacgac gtgtgatagt aggcggcgac tttttctaaa     49020
     atctgccaat atcccggtgg aaataaatta cgacagacca catccacgac actcaaaatc     49080
     ctagtagtgg ttagttctgg cggaagatcc gacaagcaac gcatggcgat tgcccccact     49140
     tgtcgtgcac caaagggaac gttgagaata tccccagggc aaatattgag atcagaagga     49200
     atacggtaag taaaaagctt atcagtgcca ggacaatcaa cgaggacttc tacaaaagaa     49260
     gcccctttag atgtaggaat tactgtagga ggagctttgg gtgtcgacat atcggtgcac     49320
     cccggagatt attgtttgtg tgccagggtc caataaaatg tagcaccttg attcaacact     49380
     gcatcaaacc aaatttgtcc gtcatggcag cggatgatgc gctggaccgc aagactattc     49440
     gaatagactc taagttgtct tagatatgga aatatatata ggtctgtagg tattgcgacc     49500
     tgcaaaccta attccaattt ttcaattttt attcaaaatc aagatgagca gctatagtgc     49560
     gaaacgccac cagcattaaa aaacgcctta ggtcttagac gatagtattt atcttctacg     49620
     tcttgcgatt gctcatcata tggatagctc agtacttctt gcagctcttt aactaatgtg     49680
     tagtcaccct gcatggcttg ttggtaggcg gggacaatca accactctct ccatgtgtat     49740
     tttggattag tctgtttcat atgttttgat atctcagcca aattgccgtc cttaataacg     49800
     aggtcgcgcc agctttttag ccaagattgc cattgttcgt cgagttgttg tgacgttttg     49860
     ccatagaagc tctttttcaa agctgagaca tcctcaggta tgtgggataa ctcccggaag     49920
     aaaatggtgt aatctaccgc tgagttggtc attaactgca ttaattcctt aaacagctct     49980
     gggttaaact cagtcaagcc aagtttggct gtccacattt tttggacctg tttttccatg     50040
     acttctgcaa agctgcggcc tacttggtca aactgttcta aagcatcagc atcttctgac     50100
     agtagcggtc ttaccgcttt ccaaaacata taataattcg cttctgctgc gatgggctga     50160
     tagaagaatg aaaattgttc ggcgccgcca gtccaaggtt gaaaccaagg gtcaaaaact     50220
     tcacaaaacc caaaaggtcc atagtcgagg gtaaagccac cagcggcgca gttgtcgctg     50280
     ttaaaattac cctggcagta accaacacgt agccaattgg tcaccaggga agtgagacgt     50340
     tggcgaaata gcgtagccaa ctcaaccaat tgatcagcaa aaccaaggtt ttgattaata     50400
     tcgcttttgt attctcgctc cattaaatgg gacacgatca tgctcaactc ttctaaggct     50460
     cttggatgag ccttgttgcg agcgcggcgg gcaaataact ctagttgccc cacgcgcaaa     50520
     aaggaggggg caacgcgagt tgaaatggcc acaggatcgt ccatcaaaac atcagggtca     50580
     gtggagtagg agttttgaga ataccaaggc cgcttaacgg tctcagattt agaagcatac     50640
     agggtcaaag aacgcgatgt tggcacacct aaagcctgca tatattcttg cgcaagaaac     50700
     tcacgcacac tagaacggag tactgcgcgc ccgtcgccac cacggcaata aggtgtgggg     50760
     ccaccccagg gcgaccgcac atagaagtta acaaagcagt cgaattcgga agaggtggag     50820
     gataatgcct caaaaacaac gctcagcaag ccatgacatc ctctcccttt gcctcaatta     50880
     ttgaacactt cagcgactta gacgacccga gagcagccca ccgcatagag tattcgctag     50940
     aagatatcat catcatcacc ctatgcgctg tcctttgtgg agcagataat tgggtggaag     51000
     tggccaacta tggtcgttcc aaagcccagt ggttaaagca atggatagca ttgccaaacg     51060
     gtgttccctc ccatgacacc ttcgagtggg tctttgccag attgaaacct caacaattgc     51120
     agcagtgctt tctcaattgg actcaagcca tctatcaact gagcgcagga gaattgattg     51180
     cgattgacgg caagacactc cggggcgcga ttgcgccagg tgagcagtgc agcttgattc     51240
     acatggtcag tgcatgggcc agtcacaatc gtctagtttt aggtcaacgc accgttgacg     51300
     agaaatccaa tgagattacg gctattcctg aattactgaa agtgttagag cttgaaggag     51360
     ccttggtcag tattgatgcg atgggctgtc aaacagcgat tgccgagacg attattgagg     51420
     gccaaggtga ttatgtgttg gccctcaaag gggtaattga agggtcgctg acaccagctg     51480
     caatcaaaat agatcacccc ccaaaacagg gcaaattcac ctctaatcaa taagttttac     51540
     ttaagtattt tttgccgctg tactactcga tagtcgagca aaggttgcct tgctgagatg     51600
     ggcctcaact cagcaacctc actgcagcta ctccctacgc agccaagttt tcaatcacca     51660
     gacgctcatt catgtttagt cggaaacgcc cataaggatt gatatgaagg tagaacaggg     51720
     gcgttaacgc cctcaaatct tcttcttgca tacgattcat ccacgtcggc tcagaaagta     51780
     ctttttgaat catcagcgta ttgatataga ccaggctgat ttgtagtagg tgcaaacaca     51840
     gcatggatag ctcttgcata gccgtttgat tactggcaaa gtcaccattc ttgccataga     51900
     agatgaagtc attggcacta ttccaattct caacgacatt caagccttcg ttgatctctt     51960
     gccgtaaggc ctcatcatgc aaatactggc aaaggaagat ggtcttaatg gctcgcccta     52020
     attcagccaa agcaagatag gtggggtgct tgatgttgtt acgggtgaac cgactcagaa     52080
     tcgcttccgg ttcggcagta ccttgcttca tcgcggttgt gaactgaatc attggctcgt     52140
     actgctcccg caccagatcc caacgaatgg gtcgctttag aatcgttgtc aaatggacat     52200
     acttcttctt ctgcccagac atcggcaggt agagcttctg tttgttgatg cctttgaagc     52260
     gaggcatcaa ctgaaaattc agcaaatagc aaaaggcaaa ccccacctcg ctttggccat     52320
     gggtatccac ataactttta ttcactgaca tttgcgtgca gtgtcgaagt acgcccttca     52380
     ccataaaggc cacctccgaa gaagaacact tcttcagttg cgagtagata catacggatt     52440
     ttttctcgac atggttaacc taagccggag gatcactcct ccgacttggc ttcaaaaccg     52500
     tgcgtaaatc tttcgattta cacggctcct cagtggcttg gtgcttgtca tacataccat     52560
     ttggcctgag aggacttctc cttggccgtt ttaacataat gacaatgtct gtgtagtagt     52620
     tgaagattct tgtatacgtc caatcctccc attgatgtag ggagaatgtg atccacttca     52680
     agtaaatctt cttctcggaa gaacatgccg cactgagcgc atttcccctt ctgcttcttc     52740
     aagagcatag atactctctt cggagcttct ggatgcttcc cagtccttga actccagtaa     52800
     actagattgc cattgtaggg acttgcatcc cccttgactt tgacatggcg gataattgga     52860
     gtctgtcgat gtttgagtaa tttttcggtt ctagatttag ttactctagt cgcgaagacc     52920
     catttatctc ccccgacagt ttgccaatat ttattcacca cccatttcct ggatttgcca     52980
     ggatggcggt ggttagccca tgtttgaagc ttttgataca gtaaatggtc tagacgggag     53040
     aaggtctctt tactagccat ggtcgaataa tatctcgtcc atcctctaat cacgggattg     53100
     aggtggcgga ttaatgccgc ttgcggcgct gccttatggg cgttgatgat actaacgagc     53160
     cgattgtaat gtactttttg cttctttcga ctgggggtaa tgatggtctt aaatcccagc     53220
     aatgtcccgc ataatctccc cgattgatgt tgaccgaccg ggaattgtct aactgagaat     53280
     cctagaaaat caaatccagg gttttcagct tcataccttt tgagagtatg ggatatatgc     53340
     gttttgctag gttttagttc caaccccatg tcttttagcc actcatgaac taagctctga     53400
     catctttgaa ctacggataa atcctcgtga agaatcacga agtcatcaca gtatcgaatg     53460
     acatcaggag tagcaattct ttttcgctta ttcccgtcgg caatctttct gataggaaag     53520
     gcttgcttga ttcgatactc taggccatgg agggctacat ttgccaacaa aggagagata     53580
     gtcccccctt gaggtgctcc ttcagatgtc tgtaagaact gatgaccatc aattacccca     53640
     gcttttagcc aagtttttat ttgtcggcgt agagtgggaa aggtcttcag ctttttgagc     53700
     agtgcttcgt ggtttattcg gtcaaaacat tgggctatat cagcgtccaa cacatatttt     53760
     gctttctgtt taatggctgc aaaaatttgt tctatcgcgt catgacatga acggcctggt     53820
     cttgaaccat aggagtttgg ttcgaaaacc gcttcccatt caggttccag ggctagtttg     53880
     actagtgtca ttcttgccct ttcatacagg gtcggtatac ccaaaggacg ttgttcgtct     53940
     tttcctggtt taggaatcca cacccgtctg gtgggagggg cctttgagcc gagtttaagt     54000
     tgacccacta ggggcagacg agcttctggg gacagagatt taactccatc cacacctgcc     54060
     gtcttttttc cctggttgtc ttgtgtgacc cgtctaactg aaaggcattt ggctgaccag     54120
     gacctcatca gagttttctg gagtctatgt actactttga catcgccacg ttgtctggct     54180
     ctgaatatgc gcttttgcaa cttaaacact ttccgctcta gttttggcca ggggattgcg     54240
     ctccattcca tcatcggttt gacccgtgct ttagacatat ttattgctac ttgttcctat     54300
     tcattccaag tcaccgtgag tctgtctgct tatcctcacc attacagtgg ggcttttgct     54360
     tttgacccaa tccttcccac cgcctaactt ctggttagca cctactctta gccaatcgac     54420
     ctccaagaga gataggcggg ggttacttcg ttcctaatag ccattgattg aactgttaga     54480
     gtgatgcgct ccaccgggtt tattggaagt gctaactggt cgctactgga cacgccagct     54540
     ccgtatatcc ttgccctttt gggactccca gcgttatcaa cctaatttcg ctggttaatg     54600
     attacggtgg gttaaccaca tcttcgcttt cgctactcat aagttcttgc tcgaaggggt     54660
     tcagagctag gctccctgtt acctcctttt ttccccgctt caggcgttga tggctagtcg     54720
     cgaacctggg ggaaatgctg tcaccgctgc acctgcggga taggactaga gcggtctagg     54780
     atactgactc tcacctatat ggctattaag ttgtcaaggt acagttggga tattttcccc     54840
     ttctttacgc ttgcggctaa tcccctcaaa ccctattcag gtctagtttc tagccaacga     54900
     atcgcaccca gtagatcatc accccccggc cgccataacg aacatgccat tccgtcatca     54960
     aattctggtc ccaagattca aagtgccgag aatcagacgc acaggcagtg gtggcttccc     55020
     cccagacatg agaaaggcga atctggaaaa tcgcattggc cacatccgta atggcacagc     55080
     tgagggccat tttgcttaaa aatttgcgtc ggacataatg caattcaaag tatcctgcat     55140
     cggcttctga atgagcgatg cgcttaatcc ctaaattagt gcccagtccg taaatgcaca     55200
     acagtaagcg cttgcgcagg gactgaggtt tcaatatttc acgactggcc gcactcttga     55260
     aatgttgggt gaaatcaatc cgaaagtccg cttctttgag cacatccaac aaatgcgtta     55320
     gagaccaccg gttgttgatc tcttccttga gcttctggat gttcatgggt tcaggttgtg     55380
     cctccagagg agatacctta acgcgtcccc ctcgcttact caagatctca actttagaat     55440
     tgtgaggcat cccctgattc aaaagggtca aagcattttc catatcagcc tggatttgag     55500
     cgatgaaggt ttccacctct aggggctgtt gtagatcctg gtaatattcc tctcgccgct     55560
     cgtcaaagtc ttggggtaaa tccagatcgg gattgcgata gcgattggca ccggcgaccc     55620
     aaatttcctt acaccgtagt ttctctcgca aggccctgag gacacacatc tcataggcga     55680
     tgcgatctac tttgtctggc tggtcctcat cctgacctaa caccgtctct tgccagtctg     55740
     cactgacgac cccttcaatg gggacgtcat cttctgaggc ataaggtttt cggggggtgt     55800
     ccacataggc tttgagtaaa tccacagcct gcaggatggg ctggtattgc ttgttattgc     55860
     accgaaagtc aatcacttcc agtaccgcag gaagcatttg ccgataatga tgaccgtagg     55920
     aagaacggat cctcgagtgt agaagttgtc ggtaagtctg accgccatca ttataggaat     55980
     caacaaatgt ttccagggtt tgctcactgg caacggggta gataacgtct ctgaccaagc     56040
     catctggtgt ggctagggct gcggtggcca cctgataaaa cagttgggta tgagagtcgg     56100
     tttttttgac tttagcgatc acctctgacg tcactttatt cttgctgcgt gtatcaatgc     56160
     gatgaacgat ctgaatcaat aaatccatga tgttgtcgat gatctcttgg caccgctgcc     56220
     agcagaaact cgcgagtaag gtgagtcgga tggttttggg gtgatgcctc aactctgata     56280
     aggtttctgt ctccactcgg agccgataac actccagaac tcgtgggctt agatgagaaa     56340
     acagggtatc aggcaaagcc acttggcgga gtcgttggag tttgatgact tctgaaagca     56400
     ggctattgag accgactggt cctgggtctt ttttcaacgc acttagggga ggatctggga     56460
     tctctttacc tggggtcacc ttgggttctt ggatcaattc atcgagctca gtctgagttt     56520
     gcttggacag gtgctgaaga gttgaggaaa aaaacttgcg ttcaaacagg cgttgagcgg     56580
     accggattaa acgctcaatc ctagcagggg caggtggttc aatctgaagt gaacgcagtt     56640
     gagcatagac ttttaatttc agatgatgat agtcctgctc ttgactgagg aaggtatcga     56700
     ctaaccaagt gcgaagttgg ttttggtctg ccacagtggc ttgtcgaaat ccggaaaatt     56760
     ggcgaatctg ggctctgtga taatagctat tcctcccatg ccagtcatag ctctggaaca     56820
     gctcgggcag tagttctaac tgttctgcga cgaaggtcag tgccatacga ggaatctcat     56880
     acttctgttc agggaagcgt ccttcatatt ggaaaaattt aagcagcagg acaaatccta     56940
     agcggtttgc tccttgacgt ctggccaata gatgctcctc gtcaggttgg atagaccaat     57000
     gctcaagcag ctcttctgga tgccatttcc gtttcatgca attacgctcc tatgaaagtg     57060
     aattcattag agcgtaaggc aagtttttgt actataagcg tagattatga attaagggtg     57120
     atggaagtca atggagttta cagttcttaa tggctataag ctttactagg taagggattc     57180
     agccttgatt gcagctggtg tcagcaaccc tgacactgtt ggcgaattcc aagaagtcac     57240
     gctggtaatg gctgaagtat cctcttgaaa agagatacac gagtttttgc tagtggaaca     57300
     tcattaaacc aagcgtctaa gcggacaaaa ttgagagcaa tggcacagaa aacattctgt     57360
     agatggctct tcgctaaccc gatatacctt gattggcgca tgccaaatcg ccgtattccc     57420
     tgtgaatggg tactctcaac accagcccgc aggctatatt tttccttgaa ctcagtagtt     57480
     cgttgtacct gacgtcgttc attaagggct tgatgtaact cacggggacg gaacgtcaac     57540
     tctcttggct gggtctttga tttcgtacat tgagatcgca ctggacaact tcggcaagtg     57600
     gtcccctgga accttgcttg aatgacatcc tttccgtgaa tatcctttcc aggcaaccat     57660
     ttcgtactga agtggccttg aggacagaca accttctgtt ggtcccaact gatgaggaag     57720
     aagctcgaat caaatccgtt tcctgccttt gcttgccaac tatgattttg acgcactgga     57780
     ccaataacat ccatgtcata ttctgctttg ctattcacca aatgctctgc cgagaggtaa     57840
     cccccatcta acaaatgctc tttaggcaac aactgttttt tagccagagc caggtgaatg     57900
     ggttcaacaa cttgatcatc tggaaccgtt gcactggtgg tgtgcacatg agtgatgaga     57960
     cgtggacttt caggatcaca cacttctgtt aaatgaactt tatagcccac ccaatccata     58020
     cttcttttat tgctatagcg ggcttcgaca tcgtaaggag aatgaatgga tgaatcagaa     58080
     gggggcatat ccttcacttt tcgccattcg actgtgccgt ctgcattggg cgggtagaat     58140
     cgctggagcc agacttgtcg cagagtttcc actgcaggta gatgctttaa ccacggtggt     58200
     gaactagggg catatatggc gtcaagcagt gtcaaaccat cttgaccgat agtactgccc     58260
     aaagctttgc gttcgctatc gggtttgggc aagcgataat tctctattcg tcgaccatag     58320
     cgatcaaacc agtcatcgtg catgtgttcg cttaaccact gtggatctgc gacaaccaaa     58380
     ctattgagag cagcccgaaa ggtttcacca aataactcca accgattgag ggttcggatc     58440
     gacgctagga tatgggtcgc atccgttcgt tgttgatggt gttctttaag gaaccctttt     58500
     gcttgaaggt gctcaaggaa gctatcaaat agctgttgtt ccttgtcacc cgcgatcaga     58560
     cgcttgcgaa attcactcaa aacagaataa ttaaatccag agtctctcag cggtaggctc     58620
     agggcatatt tccaatctat ccgggctcga acggcatcag ccgcttgacg gtctgaaaga     58680
     ttctcaagaa attgcatgat gcaaactagc acaagctgcc agggggatag agctggttgt     58740
     cctttcttcg gaaacagatc agcaaaatcg tgatcgtgat agataatgcc aagttcatca     58800
     cgtagttgca tatacagatt gccatcagga aaggcagccc tagctacttc aatggtttca     58860
     ctggggatgt ccaacaagtc tgtcgggcgc atagacataa caatgagcct ccagagtgag     58920
     cgtgattgag tttgagtttt agcagtacca tacctcaatc cacaaaaggc ttactgcatc     58980
     aagtgttaga agctattttc agccgactta gatcattgcg gaatatttcg ccaacagtgt     59040
     caacccttca attacccctc aaaggcaatc aaggtgattt atataacgat gtggtgcaac     59100
     tgtttgacca tgcttgtcag actcaatttc aggggattga gcatgatagc tatcaaaccg     59160
     tcgagaaagg gcatgggcga attgagcatc gcacctattg gacaatgggg caaaccgatt     59220
     acttactggg ggctgagcgt tgggctcaat tgaagtcgat tgggtgcgtt gaatcgtgtc     59280
     gtcgtcagcc aggacaccca ggcacacttc agcggcgcta ttaccttttg agcattgaga     59340
     gtgatgcaca acggtttgcc gatgctgtgc gctctcattg ggggattgaa aaccagttgc     59400
     actggatttt ggatgtggga tttcgtgaag ataaactgcg tgcctgtcag ggatgcagtg     59460
     ctcaaaacct atccgtcatt cgtcatcttg cagctaattt gctgcagcaa gagtcaacgg     59520
     ctaaatgtgg gattaaggca aaacggctca aggcaggttg ggatgataac tatagcacta     59580
     cggatatatg ttagtacgct ctttgaaagc agcatccaca caatcacgaa aggtatcaaa     59640
     ttcatcccac cgctgcttca tccagttttt gagcacaaac caccatcgct cgattttatt     59700
     gagatctgga gaatagctcg gtagatacca aatctcacag cctgcttcag ctacgatttc     59760
     ttcgatcctc tggccatgat gaaaactggc attatcaatc acaatcacat cgccaagttg     59820
     taactgggat ataagactct gctgtaacca cgcttcgaat aacaaccgat tgcaagaccc     59880
     ttcaaaggtc atgggagaaa ataactggcc ttctttgagc gcagcaataa aactgactcg     59940
     ctctgtccgc ttgcctgatt tgaggtcata aaatcgttga cccacagggc agtatccata     60000
     aggatagtcc gctcgattat cgatacccgc ttcgtctaca tagacgatct gatgagggtg     60060
     tttggtctgt aatcgttcta taaatgcttg acgttgtgtt tcatctcgtt ctcgatagcc     60120
     ataggtcttt tttttcgact caatcccagt tttctcaagg catcactgat attttgctgg     60180
     gtgacattat ccccccatag cttagccatt tgggcctggg ttttaccccc atgctcttga     60240
     gcaaattcac gaaagcgctc ccaatctgtg atcttgtggc gagccccttg ttggtagttg     60300
     gtaatcgcct gacagtcacc tgtagcttct tcgcggacta tccatagatg caaggtatta     60360
     cggctgatgt tcaacattcg acagatatcg actttccgtt caccattctt gaaggcatca     60420
     acggctttac gacgaaggtc ataactatag ggtgctggca tactaatgta gggatatctt     60480
     ctatatcaat agtactaaca tagtttcgta gggctatacc tggtcaagat cctcagcgtt     60540
     gctgccaagg gaataccttc ttcatgaaga actatgtgcg gttgccctgg gggccacccc     60600
     ctttcaattg catttcccag cgttggccat tgatgattcc ttcaaacaca gatatcgccc     60660
     gaccatcgcc atagccgtta cccgtaccga agggacattg ttggttatat tcggtgccaa     60720
     gaatcgacag tgcataaccc gtcgtccagc caatctgacg cataggctca tgggcagcag     60780
     tgatatcacc cgaaaataca tggcgaaatt tttcattcag cgccagctca tcgcttaacc     60840
     caagttcctt aaaaaagtgc tgctatgagc tacgtattct ggttctgcaa gcggcgtggg     60900
     tgttacaggt acgaaatgtc cagaaaaaac ctggcgagca cggtgatcat cgccatcgac     60960
     cgtggcatca ggatcagcat ctaaggtgtc catcagagaa taatccgcca attgcacaaa     61020
     ctcatcgaag gtcgttacgc agggctcagc agacggttta gctggatatg acattgttgc     61080
     tagcgtcggt atggtcggga taggttctat gtttaatttt agaccttgca gaggtattgc     61140
     aacgattaac cacatgaaga accatagagc tgcaaggcaa tggcagtata tattctggct     61200
     tgcagtactc ccaaaccctg aatattgcga ggaaaattat aaaaaagggg tcttattaag     61260
     ggaagatcat cctttttgaa tgtttaataa aattgggcca tatcgcccta aaggatgccc     61320
     ttgtaaaggt tcagatagtc tggaaccttc ttgtgaagtt catctattaa agaagggact     61380
     gaaagtccca atctatagct gcgtcgtcaa cttatcgatc tgatgtgata tgaaaacctc     61440
     tagctgttag tgctataaat ctctattttt agaagtgtgt agcagctaaa gccttgcact     61500
     aaagtgcata gttttggact agcgtgttta ggataataaa aaaatatcga accccgcctc     61560
     ctctaatgcc tgttccctgt tagaactgaa tctataaaat tgactataca accgaccaca     61620
     agaatcaaat tctaagatct gaaaattaac cacttgcctt ctaataaaca gctgagtact     61680
     atatcttagt caatctatct tcactcagga tacgaagaac agtggttaca ctcaaagacg     61740
     cacgccggat cattgaagct gctgagaaaa aggcagagga aatcggccaa ccgatgaata     61800
     ttgcagtcgc agatagtggt ggcaatttag tttctcatgt aaggatggat ggagcctgga     61860
     ttggtagtat tgatatctca atcaaaaagg catatacatc gcgggctttc gatatctcca     61920
     ccaaagactt agctgaatat agccaatctg agggacaatt ctttggaata catgcttcca     61980
     atgggggaaa aatcatgatc tttgctggag gaatacctct ggttcaagat ggtcgagtgg     62040
     ttggcgctat aggtgtcagt ggtggctcag gagagcaaga tcatgctgtt gcagaggctg     62100
     gtgcagaagc cttttaaatg aactagccca ccctatagaa gcatgggact gacgccgatt     62160
     tcttcaattt ctcaagaacc agctagcaca gagataatgt ctctaaccgt tatgaaaagg     62220
     agacgcttga ggcagtccct ccaacatggg aaagacgcta caattcgccc tgtactgtgg     62280
     gcaactccgc ccatacctgg tggaaagcgt tccgttagaa atagcaaatg ggtcaaactc     62340
     acagttcata acttgatata ggaggctgca actcgggttg gcttaatgct gattcacagg     62400
     atgctgctca gtaaatcggg gggtgaggca gtagggacaa tccaaccact ctggtaacag     62460
     cgcggcttta cagacgtggc agttgagggc tgtcttgcgt ttggccttca attccgtttt     62520
     caagccgcta tccgagaaag tgacccgttc aacttcctct agagaggttt caccattctc     62580
     aaccagcttt aagctatagg ccaatagggt ttgcattcct tcttcgacgg ccacttcttt     62640
     aatgtgctcg gtgggggctc cttccgtgat gagtgccttg agtttttcgc tcacctgcat     62700
     cacctcatag accccgcacc gccccaagta accaatgcct gaacaggtgg gacaggcatc     62760
     ttcagtgtta gccgtcgcca gaatatcgtc agaggtagac gtgttggctt tatagaaagt     62820
     aatgtcagtc ttcccagacg tcactaatcc aaactgcgcc agtctctcct gggacggtcg     62880
     atagggaata cggcaatcgg gacagaggcg tcgcaccagt cgctgagcga cgactcctag     62940
     caaggaggcg gagaccataa agggttctac gtccatctcg gccaagcgga caatggcact     63000
     agccgcatca ttcgtgtgca aagtggttaa caccaagtgc cccgtgagcg cggcttcaat     63060
     agcagttttg gcggtttcct tgtcccgtgt ctcacccacg agtaggacat cagggtcttg     63120
     tcggagaaag gctcgcagga tcgaggcaaa gtccatgcct ttttctcgca gcacctgcac     63180
     ctgggtaatc cctggcagtg tatattcaat cggatcttca acggtactga tattaacttc     63240
     gggggtattg cgttccgtca aagccgaata caaagtggtc gttttaccag aacccgtggg     63300
     acccgtgact aaaattagac cgaacggacg atcgaccatg gacctcacca actccaggct     63360
     cattgggtca tcaatcaaat tgtcgagacc cagctgcatg gaagagttgt ctaagatccg     63420
     caacaccact ttctcgccat agcgactcgg caaggtgctg acacgaaagt caactttacg     63480
     tccttgaaac agtcgaagaa tacgtccatc ctggggcaga cgccgttccg caatatctaa     63540
     attggcaatg attttaaatc gagagaccag ggcaggcgta attcgccgtg gaagaggttg     63600
     gaaggcgtta tggaggaggc cgtctttccg aaagcgaact cgcaggtttt cttcttgcgg     63660
     ttcaatatga atatccgaaa tctgattctg taaggccttc gctaaaatct tattaaccaa     63720
     agaaatgatg ggtgctgcat tttcgtctag cagtgcttca tctaagttga tgtcggcatc     63780
     attggtggcc agatcttcaa tgccgcctaa gcgatcgaga tcatcttcca gcccatactc     63840
     aacgggcaaa ttctcttgga tcgtggcttg gcgtttggct tgagcgtcca aaaacttggc     63900
     gatcaacatt tggtaagtat ccaaatccag gacgacccgt tggaaggtca tgccattgga     63960
     gcgcaataag tagccaatat catcaatggc gctgaggtga tcgggattga ccataccgat     64020
     ccgaacaact ggcggatcct cttcttcatt gagtgaaagt ggtaacaact gatagcgacg     64080
     gcagtagtcg aggggaataa cggtgcgaat cagccgatca atttcatcga agtcaacttg     64140
     agtaagctca ggatccagac actctaggcc atagaggatt tttaactcaa agagttgctg     64200
     gcgcttgatc tgccgtaaca agcggggagg aagtggcttc cccgtcattt tctggagaat     64260
     caccagcaga gatcgacctt tgcgccgact ctcataaatc gcttcgcgca agcgtgcttg     64320
     gtctacataa ccacttttta ttaatttttc atttgaagga gaaaagttat ttctaacgag     64380
     taaatctcgc ttggatgagt cattccccat gagataaaaa cgctataaat ttaactgaat     64440
     ttgaagctaa aaaaccgtgt attcacgagt acattaggtt gtcgaaaacc caaggccaat     64500
     gcagacttac tcagtcgcca cctaccaata ccacaaatat cctttcggca gcaattgttg     64560
     acatgttgct cccatgacaa tcaatacctt cccacactgt aagctctcaa ttctgttgac     64620
     atacaatctt ggcatataca gtttatttct agttgtgggc tcgcaagatg aaagcctgca     64680
     tcgctagtgt ttttctttag caaatccata attggtgcgc ttatcgcgac ttccttaact     64740
     ttttggcatt gaccacagat taaaaattgc gtctgagcat gttcttgttc gcactttatg     64800
     tgttcgcaag cgacatactt attgatcaga tcaaggcgat gcaccaagtt ctctgccatt     64860
     aaaaactcta aaattcgata catagacatg gcaggcatgg tgtcacccaa ttcagtttta     64920
     taagcctcca ctaactcata agcagagagt gctttgctcg atttaagtaa cagtgatagc     64980
     gctagttttc tttttttagt taaacgcgag ccgttttctt tacagcgtcg ctctgcgtga     65040
     tcgatcaccc gttgaatagc atccattctt tatctcaatg aaattgcatt tttagtagag     65100
     gccaacgtta ctgtgctctg cttgatttct gttgcccgca tcacatcact tttttactcc     65160
     ggggaacttc aataaatagg gccattacac aagtcaatct ttaaggcctt tacagctaaa     65220
     acactagctc gcagatattt cgctgtgggc actttcatca tgttcttctg agttcattac     65280
     atctgttaaa agtgagtaat tcatattagt gaactcatgc gctgtgaccc cactcaggaa     65340
     atgggtcgtt taatgatttc caataagtgt ggccccgcac aatttcttcc tcgcttaata     65400
     gacattcatc aagcgcttgt gtgatgcgtt ctttatccaa accctggccg ataaaaacta     65460
     gctcctgacg catatcacca aaaggctcta cccattgctt tttaattgcg gcgagatatt     65520
     cttcgtcttg cggccagttt tccttgggta cggctttcca gaacatccct gcgacaccgt     65580
     ggcgagctat gcctccagcc tgactccagt gacccgcaaa ctgagggcgc gaagctagcc     65640
     agaagtaccc tttagaacgg attaacttac cgtatttgtc tctactggac agaaactggt     65700
     aaaacttttc tggatggaaa ggtcgtcgcg caacgtagct aaaactgcct atgccgtatt     65760
     cttcggtttc agggacatgc tcacctcgca tctccttgag ccaaccagcc gcttgttgtg     65820
     cgcgctcgaa atcgaataat ccggtgctaa gcacatgatc aatattaact tggccttgag     65880
     caatcggtac tattttcgcg tgcgtattca gcgttttaag aatggctgtt aagcgttcga     65940
     tatcagaagg gagcaccaag tcggttttgc ttatgagaat gacgtcggcg aactccactt     66000
     gatcgaccag caaatcggcg acactgcgtt catcttcttc acccaaagat tcacccgtat     66060
     cctttaagga tcgcgccttt tcatagtcct ccagaaaatt gactgcatcg accacggtca     66120
     ccattgtgtc tagatcggca acatcagaaa gcgaagcgcc atcttcatcc gtaaaggtaa     66180
     aagtttcagc tacaggtaaa ggttcagaaa taccagtgga ttcaattact aaataatcaa     66240
     agcgaccctc ccgtgcaagc ttgttaactt cctcaagcaa atcttcccgt aaggtgcaac     66300
     aaatgcagcc attactcatt tcaacaagct tttcctcgct gcggttgaga gaaacttcac     66360
     tttgtacaat cgccgaatca atgttgattt cactcatatc attgacaatt acggcgacct     66420
     tcttgccttc ccggttgttc agaatgtggc tcagcacggt ggttttaccg gccccaagga     66480
     aacctgagag tacggtgacg gggagtttgt ttgtatgtct cattgatttc tattacattt     66540
     caatatggtt cgtctttggt ttggccaact gattgaatat tgaaaacaaa tgatatgata     66600
     catcgtatca ttttattctt ttgaatttcg tggagcagcc taaaagtcac tgtctgtaac     66660
     cattcgttgg cccagtaatc agtagatgga gcatgatagc cctctcgttt aggcttaaag     66720
     atcgcgaatc tgcatccaag taccacgtga tcgttgaaag ctatatctag taagcatcct     66780
     tggaaaattt ccaaaaactt tcctgagaac ggcaatttat tggaaagttt ttattttttg     66840
     atccaagccg tgttgttcta tcacaggcat ttctcagaat aaatcttgtc tagaagttat     66900
     taggcaacat ttattacttt gatttttgat taatatttag atgtgggtac ttacagttat     66960
     gaatactagg tttcacatag atgttttttg accccagatg ttccttctta gagatggcta     67020
     gcacttttct gtaggtactt atagatgcaa caacaagcag ataaaattat ccaaacttta     67080
     aaagcgaaag gcctgcgagt cacaccccag cgttttgcag tctatgcaga cttactagct     67140
     cgctcagacc acccaactgc ggagcaaatt acgaatcatc tgaatcaaga tggacctacc     67200
     tcttctcagg caacggtcta ctcctcactc caggccttac gcgaagtggg gcttgttcga     67260
     gaggttctct tagaagaagg tgtttgtcgt tatgatgcca atatcgaacc tcaccatcac     67320
     ttccgatgtc agtcttgtgg agcgattgag gatattgcct gggatcagct tcaggattta     67380
     gattttaagg cgcttcgccc tgggttacag gtcactcatt atgagatcac ggtacatggt     67440
     ggatattgca atcgctgcca ccccgaataa aagcaaaaag cgtttagata ccccgttaat     67500
     cttatatcct gcaatcgcag agtgatgacc cattaccaat gatttgccca ggacttttcg     67560
     caatttttcc cagacttaat tcaccattga caagcccttg attcagatgg gtagtaagga     67620
     ccgctaacat tgaggacaga tggcatgaat tgataattga caatctaaca gatgaaatcc     67680
     taattttttg gctgtcttgg aaccgatttt cagaacagca tcacttttaa actcaatggt     67740
     ttcattgcat ttaacacaaa ttagatggtg atgatggtgg ggatagggct gattcagttc     67800
     atagtgttta tgaccttcag ctaattctaa ctctcgcaaa atccccatgc gagccattaa     67860
     tttcaccgtt cgataaatgg tcgataaact aatgggctta ccctgttctt gcaggagagt     67920
     atctaaatct tcggcactca aatgtttgcc tttttcgagg tctataaaca cattaagaat     67980
     ggtttcccgc tgaggggtga ggcgccaacc tcgatcgttc agttctgctt tgagcgagtt     68040
     agcgtcgtac atagtctttt ctcaagaaca taagcttatt gaaagtctaa ctatacatgg     68100
     atgctttagc aacaagaaga ttttattgag aaaagaatag cggatttttt gctctctgta     68160
     attgctgatc gcctgcatta acagggtgtt tgagcgatca accttatcct tgctcagcga     68220
     tatgaagcgc tagtccagcc ccatttagag tcccaatctg actgatggtg acagatttta     68280
     ctatgctaaa tctcggctct atggactttc cctagaattt agtccaccag cttatgctta     68340
     tccgttctgt accagatggg atgggggcgt tggctgattc taaaaaatta tgataatgat     68400
     aatcattata ttaaactctt gctggcagca agtctatcca tgaaagagac aaattcttcc     68460
     tatgacgtgg tgatagtcgg tgcagggcca gccggggtcg gttgtgcggt tgcacttcaa     68520
     gagctgggac tagaaaactt tatcttgttg gaacgacagc aggtaggagc ctcctttagc     68580
     cgctggccaa cggagatgaa cttgataacc ccctcgtttc cgagtcatgg ttttggccta     68640
     cttgatctca atgccattac cctgaaaaca tcgccagcga ttgcctttcg ccgagaacat     68700
     cttaatggcc agcagtatgc gctctatttg caaacggtgg tcaaccactt ccagttacct     68760
     gtgaagacag gaacggacgt tttggcaatt aagccccttt ctcagtgtcg cggctttatc     68820
     ctcaagactt ctggcggaga cgtcaaaacc cagtttgtga tctgggctgc tggggaattc     68880
     caatacccaa ggttaaatcc atttgtggga gcagaccatt gcattcacaa ttctcagatt     68940
     cgctcttgga aaaatttgcc aggggatgaa tttacgatca tcggtggcta tgaaagtggt     69000
     atggatgccg cgacccactt agtcgaatta gggaagaagg tcagggtttt agatcggact     69060
     ggggcttggg acaacccgga tactgatccg agtattgcgt tgtcacccta tacagtgcag     69120
     cgtgtaaagc tagccactca aacgggtcgc ctcaaactga tcggcaatgt ctccattgag     69180
     gaagtcaaaa aagtgtcaga gggctatgcc gttttcagca aatacgagaa atggctgaca     69240
     gttcatcccc cgattctgtg tactggtttt gagaccagct tgcagcagat tgcgtcgctg     69300
     ttcgattgga cggagggtta tgccatgttg aatgatcaag atgagtctac tctgacgcca     69360
     ggtctctttg tggctggccc ctcagtccgt catcacaacg ttattttttg ctttatctat     69420
     aaatttcgcc agcggtttgc ggtagtggct gatgcgatcg cacgccgttt agaccttgac     69480
     cctgcaccat tagaaatcta ccgccggcaa ggcatgtttc tagatgacct gtcttgttgc     69540
     gacaacgact gtatctgcta acccctgtat ctgctgaaaa atttctaagt tgctcaacat     69600
     ccgctatgcc cctgcttact tcaccagctc agcgttctat cgtcgtaatc ggtaaagaga     69660
     atacgggcaa atctcaactg gttgcctcgc tcacgggatg tttgcccgac agcattaact     69720
     tccgaggctc tacgattgcc tgtgacacct atatcggagg cggactgact gttgtggata     69780
     cccccggtat tttgtaccgt tctgatcggg tcaccactca agctgcactg gcccaattag     69840
     aaacccatga caccgtgttg ttggtgatca aagcaaccca tattgatgaa gatctagcgg     69900
     atttatggcc cttggtggtg gggaagcggg gcattgttgt gatcacgttt tgggacaaag     69960
     cgtctcaagc tgggtttacc cagcagattg ttcaatgctg ggaccaaacc tcgaatctgg     70020
     cgtttatccc cgttgatgcc agacatctaa ccccagccca acaccacgac attcgggcag     70080
     ccttgcaaga gccgactata ttttccccag aatggcaacc cattcccacg ggatggcgaa     70140
     ttgaaccgcg accaacggtg ttagaacatc cacagtttgg ctggctggta gcgatcagtt     70200
     ttctattgct gccgacccta cttgcggtgt ggtttgccaa tagtttcgca gcagttgccg     70260
     atcctctgat gcaagcgctg ctccaacctc tagtagacgt tctggctaat atacctctgt     70320
     ctttgcccag ggaaatgctg attgggcgtt atggcttgct aaccatggga ccgttgctat     70380
     gggtctgggc tgtaccgacc gttattctct atgccttatg tctgggaact tacaaggcca     70440
     gtggcttggt agagcgaatc acggttgccc tccatcccct gttgcacccc ttgggtttat     70500
     ctggacggga tttggtgcgg gtcgtgatgg gatttggctg taatgtgcca gcggtgatca     70560
     gtacccgtgc ctgttcgagt tgcgctcgcc aaacatgtat gtcggcgatt gcctttggtt     70620
     ctgcctgttc gtatcaattc ggtgccaccc tggcagtgtt tagtgcagcc catcggccta     70680
     gtttggtgat tccctacctg ggttatctca ctgtgacaac gctgatttac actcgcttgc     70740
     ttgcccccaa gtcggctcgt tcgtctcaca accggctgat gattgaacac cgcacatttt     70800
     tggaaaggcc ccgctgggcc accatctggc gagaaaccca gggcatgctt catcagtttt     70860
     ttaccagtgc tattcccatt tttgtggcca ttaccttgat cgcgtcgctt ttagacgagc     70920
     tgagtcttct gactgctgct gcatcgatca tccatcccct aatgcagatc tttcgcctcc     70980
     ctccagaagc agcgttgccc atgatcctgg cctctattcg caaagatggt ctgctgctca     71040
     ttgctgaacc tgaaaccctc tctgctctca caccactgca gattctcaca ggggtgtacc     71100
     tggcaggtgt tttattgcct tgtttggtca cggcactgac gattgcccga gaacagtctc     71160
     tccgatttgc cctggcgtta atgggtcgcc aggcaatcat ggcaacttgc ttctccttga     71220
     tcttggcctg gggtggatac tggtgctcga gtgcattagc caacgtggtg ttccccttgc     71280
     cttaatagcg gttcaccctt gagcgtaacc cattgtttct aaactctagg aagaggttgg     71340
     aagatgcgat cacgcttggg ccaccattga tcctctgcaa ccgcctgcgg tacttaaccc     71400
     gacgagactt gccaggggtt agggttgaat cttggtatca gcagcctctc aagcaaagcc     71460
     gctattataa aatgataatg ataatcattc tgataactct tgagatctgc aatcacactg     71520
     ttctcattca agatgcaata agaaggtgag tatgccagag aaactaactc ccaatcagcg     71580
     acgcgtgttg gaagtcctct tttccactcc tcaagaattc tctgcccaag atctgcataa     71640
     agaattcaaa aagcagcaac aaagagtggg attggcaacg gtttaccgtg cccttaaggt     71700
     ccttcagaag tgtggaaaag tgcacacgcg cttgttacag aatggagaag cggtttatag     71760
     tattccctct gctcatcaac atcatctaac ctgtgtgagc tgtggcagtt ccatgccttt     71820
     aatgaacggt ccagtccacg agttagaaaa ggaacttgcc caaacacaga aatttcaagt     71880
     tttttaccac accctagaag tctttggtct gtgtcagaac tgcattgaag caaaggttta     71940
     agccagaaga aaggtgatta ggtgagccta aatctccttg acttcataac accgggtatc     72000
     taactgattg cttatcaaaa acgccagctc tttgaaggtt ataatgatgc cacctttgcg     72060
     acaacccacg ttcttcggct ctctctgact tcatgacaca tgtcagcatg tactatccaa     72120
     tttttgggcc tgagacgctc tgcccccatt gccgacaagt gatgccagcg ttgaccctaa     72180
     cagataccta tctttgcaaa cgtcatggtg catttgaagc agatcccaat actgaagagt     72240
     tagtgcactt acaatctgga cgccattggc ggttatggga cgggcaatgg tatcgccaac     72300
     atatccatcc agatggcatt cgtttcgaaa ttcatgaagc gttagatcga ctctataccg     72360
     aaggatatcg ggcgacaaaa gtcatcatcg ccccgcgcta tcgcacgttg attaactctt     72420
     ttctagagca ttctccctgg cctgatcaaa cctcatctgg gcatccctat ttatacggtc     72480
     tacccgtaga atttggtcct gatcccgagc aagatccccg ttggcaagtg attaattttg     72540
     atctcgataa agaaccagga attcccatta attctcccca ttctcagcta ttgtattagg     72600
     gcttctgaag cgaagctttt gtgtctcatt agtcagatgg tgcgcttttt ccgtaaacaa     72660
     gcgacctcca aagcgtactg gaggggctgg ggcgatctgc atcagaggct gagttggaag     72720
     tccttgcaac tccatgaagc gatctaaaat gcgatgaaac aggcacccag agccagtttc     72780
     ttggtggaga atctaaactc tagtctgcgc aactatttca cgcttctcac acatcttggg     72840
     acacccaatt taggacatct tcagttcttt ctcaaccacc gacaattcat gagtagggca     72900
     ttgtcaactt aacgaccgat cacacaaaat gggcactatt tttaacaata ggctcaggat     72960
     ggagggttaa gcagcagtgc ttagacccgt cacatcacgc tagctttcaa aacgctgact     73020
     cagcgtactc aaaattcagg agcagattgt tgatgttgca agggatgaaa atgtcctcgt     73080
     atgggttcaa atgtagagaa aaacgttgag cgtggccggg agatttgaag cgtcccatcc     73140
     gcgtttctct catccttgtc ggtcgatgtg ggttctccgc tcgattattc agttctttat     73200
     gctgtctgtg atctaccccc ttcaggctct ttttcgtggc cacagcatca tgcaaacgat     73260
     tgtggacggt tcccgcactg atgcacgaat aaaataggtg gcgtaacaac tcaacgacac     73320
     ctcaataaga tgaatggcag gggttagggt tgaatcttgt ctcaacggtc tctcaagcag     73380
     agtcgctatc ataaaatgat aatgataatc attccgataa ctcttgagga taaggatcta     73440
     tgggcaatgt tctcgttctg aatgcctcct atgagccgct caatatcacc agttggcgtc     73500
     gagcggttgt tttggtcctt aaagaaaaag ctgagcaagt ggaacacaac ggtaagtttg     73560
     tgtatcgaga ctttcccctc cccacggtta ttcgattgct ccaatatgtc cgtgttccgt     73620
     ataaagaaat taccttaaac cgtcggaact tactgcatcg agataatcat acctgccaat     73680
     actgtggata tactggcagt gatttgaccc ttgatcacgt aatgccgaga tcccgtggcg     73740
     gcggtgatac ttgggaaaat atggtgacgg cctgtgtgcg ctgcaatgtc aaaaaaggca     73800
     accgcactcc taaagaggca cggatgatac tgaataaaac cccgcgtcgc ccccatagta     73860
     gcttgtactt tgaggttact aaacattttc ggaatggggt tcaccaagaa tggcgcaaat     73920
     atgtcattgg catgtaatgt gcatcttcgt ttttggctga aaaatatatg tgaggtgagt     73980
     attcctccct atccatttgg gggtatcttc acatcaaggt gataatcttt tcgaatagga     74040
     tcggagaaaa taagagatat atctgctctg ttagctaacc tgctgaatat gggttagcaa     74100
     tctcttgtac tgaatgtgta ctaaattgcc ttatatcgca gtttcagata aagtcattcg     74160
     cctccatact gggccttgag ttcagcgacg agatcgtcat ctatcttttg aaagagggga     74220
     gccgggacca taaaggagcg acctgcggct aaaagtgtta aatccgatgc ttcagtcatg     74280
     gtgtgacggc gttctacatc agtcagctgg agggcatcaa acagagcttg ggttgtgtgt     74340
     ggaatgaatg gagcgcttga gatcgcatac agccgaatta ggttaacgca ggtacgaatc     74400
     accatcgcag tctcgtcctg atccgtctta aacaataccc acggagcccg cacatcaatg     74460
     tactgatttc ctgttctcca aagggcattt aaagtctccg ttgctcgacg gaactctagg     74520
     ttatgcagat atttgcgtag tttttccacc agctcgttac aggtcacctg cagctcggct     74580
     tcagcatcac caggggtgcc cccctccggc aaagtcatcc caaatcgaga tgctgtaaat     74640
     ttgaggatgc gatttacaaa attacccaga ttatcagcca gctccttatt cacctgcttc     74700
     tggaactgtt cccaagtaaa agcagagtca gccgattcag gagcattggc gatcagcata     74760
     tagcgccaat tgtctgctga ggcgatttca agggcttggt ctaaaaagac ccctctctgg     74820
     gaactggtcg agaacttgcc gccgtagtag ttaagccaat taaacccctt aatatagtcc     74880
     accatcttcc acggctcacg gctgcctaaa atcgtggcgg gccacatgat cgtatgaaag     74940
     ggcaaattat cctttgccat gaactgggtg tagtgaacat catcgctctc cttccaccag     75000
     cattcccagt cattgttagt gatatcgccc caagcctttg tggctgaaat gtagccgata     75060
     ggagcatcaa accatacgta gaagaccttc ctctcaaatc cttcagtggg cactggcaca     75120
     ccccagacta aatcacgggt gatgcatcgg ctttttaatc cttcattaag ccacttgaga     75180
     gcaatcgatt tagtcagggt cgaccattga gtttgtttat cgacccaatt gcggacttca     75240
     tcactgagct tatctagcct taagaacaaa tgccttgaag tacgcaattc taggtgcgtg     75300
     ctgccggaaa ttgtagaacg aggtttaatc agctcggttg gagtgagaac tttagtgcag     75360
     ttctcgcact gatcgcctcg ggcctgttca tagccgcagt gcggacaggt accagtgaca     75420
     tagcgatcag gcagaaaccg ttgatcgtct aatgcataga actggctgat ttcacgttct     75480
     tcgataaagt tttgctttgc tagttgttga taaaagtact gggtgagttc atgattttca     75540
     ggagccgacg tccgaccaaa ataatcgaaa gagagaccaa agcgcttgta gatttccttc     75600
     tgcttgtggt actgctttgc acaaaattct gctacttcta gccctgcatc aatggccgca     75660
     atttcagcag gagtcccatg ctcatcagtg gcgcagatgt agagaacctc ttccccctct     75720
     tgtcgtaaaa aacgtgcgta tatatcagcg ggaagcattg agcccacaag atttcctaaa     75780
     tgcttaatac cattgatata aggaagagca ctggtaatga gatatcgcat gtatgagtga     75840
     ctcgtacgga aaacatctag attatcgagg gctgtgaggt tcgagaatac ctcagtatgt     75900
     tattgttgac actccccgga ctaaagtcac ggggctacca agctaccgta ttctttcccg     75960
     tgtattgaag ctacctgttt gcaggggtaa ttgaagggta gacactgttg gctaaagtat     76020
     tacaagtaca actacaagag tattacagaa tcataactgc aacggaactt ggtcagttga     76080
     gctgtgcgta gtatttaaat tctatacttg cagctcattc gccaacagga accgttgcta     76140
     ttggaaagct aaacggtgcc gctgtattaa tacctcctgc tcccatggcg attcaagcac     76200
     ttcggcgtgc gtggacaaat ccggcttgtc gagcaaataa gtctcggaat gtactcatgc     76260
     cttgctaaat cgtgttggtg ataccgacaa agggaagcat tgttgagagg gcaacagaac     76320
     tgaaacaaac accaatggtg acacaatttt atggtctcaa tgggaaactt tgctaagtcg     76380
     taacgtaagc tagctatagc tactgttcat gacttgctcc ggtccatgca gcctaactat     76440
     cgtctgtgta ttagctgtcg ccaagttgcc cccaaatctg agctttggcg aattgttcgg     76500
     gtctatccag atcatcaaat ccagcttgat cagggcatgg gacgctctgc ctacctctgt     76560
     ccccaggcaa actgtctcaa ggctgcccaa aagaaaaatc ggttagcgaa ggctctaagg     76620
     gccaaggtgc ccgatagcct ttatgaatcc ttgtgggaac gattagagct cccctcaagg     76680
     atcttcatag actgattggc aaaggcagat aattagtggg ctccccattg actatggcaa     76740
     tttctcccac cagcattcgt ggcatggttt taaaaaaggg attttgggta acacttccaa     76800
     gccaaaataa gtcattaatt atcgatgact ggaggtctac tagctcccaa tctggtcaga     76860
     ctgctctttg gaatcgcttg taaaaactgc agaatattta tgcttctaaa tccaataacc     76920
     ctcaagaaac gctgttattg gaaagctcct ctaagagaaa agccttcgac gaaactcttc     76980
     agtttgggct ggattgggaa ttttgataac aagtaattca acgagttctt cctcagacac     77040
     atctggattc tgagctaaaa catgctgata gacaatcgat gaaatcgggc caatatattc     77100
     tgctaagact tgctgacatt tttttccaaa ctcaggccta atctttgata ttggtttggc     77160
     tacatttggt tcagctatgg acttagattc ctctgtgggt tcataagttt gaggtggttg     77220
     tcggagaatg ggctgattca atgaggaggt tggcggatta attctctcaa tagaagagta     77280
     ttggttagta ggtgggctct ctgcactcga agtctctttc acagttgatg attgagcctc     77340
     tgaaactttt tttaagtggg tatttagatt aaatcggcca ctactttcta gtatggaaat     77400
     ttgctttaaa accacttcgg cattggctgg gcggtgactg gctagtggtt tgattaacca     77460
     ctccaagata gtggcaaatt gagtcgaaac cttctgggtt gatttattcc aattgcattc     77520
     acccactcct tcatcaaaga actcactgag ttcttttcct atgatcaagt agataaaact     77580
     acgacccaaa gcaaaaaagt cggactgggg gactgcctga tcctgaattt gttcgcgggg     77640
     tgtgtaaaag gacgaaaaaa ctctcgttcc tataggttga ttgagggtag tgccgacaat     77700
     acaggcacta ccaaagccaa ccaagcagat atgaccattg gctttcaaca taatgttgga     77760
     cggtttaata tctctgtgca agacttgacg accatgaatg acatgaagaa tcttgaggac     77820
     ttgcttgagc cactgtatcg ccaacctttc atctatggga aagcccctct gatttaaata     77880
     ttcttggaga tctaagccaa cgattttttc catgacgaaa caatgtagag gttctttact     77940
     attgcctgga tagaacatga aataagaatt gggttcaatt ctaggaatac cggggtggtc     78000
     taactgactt agaagattta cttcccgttg gaataattcc acgtgctttg ggtgattatc     78060
     ggtgagaatc ttaagaattt tagggctact acctaagtca ctgacttcat aggttctccc     78120
     aagaccgcct tgaccccgca tccctaggac acgatagcga ccctctagta ggagttctga     78180
     accacagctt ttacaaaata gatggtcgtc agaattttga ggatcggcac agccgggatt     78240
     aatacataga ctcataatga agaaatatgc ctaacaggtc tgtggaaact agcaactcat     78300
     ttcggattta catcatgggt caaatcatct gaaatccttt tactgaatag ctttccttcg     78360
     atacagacta aaatggatcc agccattagt ttgacgttcg attgggattg aagatgccta     78420
     aaactcaatc ctgtaaatgg atttcaacat tcttaaccct tgagcagttt gaaatattta     78480
     tctcgcacta cttgcatatc ggtagtagag ggctttagtc aaagctttct ctacatgccg     78540
     ccttcaacta tattttaatg ttcctgcata ctgcacccca tgtcgtaata agcacaattt     78600
     ttaccacagg atcactaaaa ggttctcagt taaagggttg cagagattca aaatctattt     78660
     tctcgatcac aagtattatc attcttactt aaatatatta ataacagcta aaaaccttaa     78720
     ttagtaaagg ttccatctat attgatagtc aatcctaaat tcatctattt gtttgggaat     78780
     atggtattaa cacgcaaata attgattgtt caatctagtg agggtagatt cccctctgct     78840
     tgcagcgaag aaatggaatt gcaatccaaa tctacggttt gggagcaaat cgtattccat     78900
     accccgtctg cttgcagcgg ggcagttgat ttggcagcaa accatactta gaatagcttt     78960
     cagaatttat ccatagaaaa tttgactatc taggataaag atgttgaatt ttgagtcttc     79020
     aaaagtccct tgctatatgt attacggcat ggggtgctat agacgaaaca tccattgctg     79080
     ccaaaattaa gatcgtatcc catgtgaatt cccttcattc gagcgaaact caccttcctt     79140
     gtcttaaaca atagtctgaa cagtcttgtg ctgctgccat taagacttta ctgggatgta     79200
     cagcacactt gagataagcg ttatggtgat aaaacttaca gctacggcaa tggctattgt     79260
     tagcttctct caaagaaccc catgcacgac tgattgtctt caaaaagtta gcattccagt     79320
     gaatcaggat cataagtgag atcaccatcc atacccccaa aataatagag atattatcgt     79380
     tgatggcaga aacttcattt acatgagatg tatccaatct atcccttgga acaacaacta     79440
     caggcctgta tgatcgattg ttgaatattc ggcccaaagt catgtagtat ctcattttca     79500
     gtatccagag tttgattaaa aaaattgcta tggcatagtt ctgacatgct caaaaagctg     79560
     aaagaaacct acgttcagtt cgttgttata tatcaacttc agaatctatt aacgggctta     79620
     ttgaccgctt tttaatcaat attttctacc ccaaacctag agataaaatt tgagcattat     79680
     gtgagaaaaa ttccatttat cttggcgtag gtgtactcca cacccatcag cagaatgacc     79740
     acttccttga aaatagaaca ttcactaaga atctaaccat gatcacagat gactggtcac     79800
     atttgtaatt tttagtgtac gtcaatggca atttccgtac acatatccca attaatcatt     79860
     atttggactt tgactaaact ttgactaata agcatggtaa gctatggggg gatttgcaga     79920
     aagagagcaa atccttggct gaaacccatc ccctaactac ggtttaaaac gatggcccgt     79980
     gcgatcgcag aaaaatgcag gcggtgttcc aagctacccg tggaagaagc caagtcaaaa     80040
     gagtgctggg tgggccagcg ttgccatgtc cgtcgttcct cgtataaaca ccgcgatcgc     80100
     tataaccgaa acaaaaagcg taaatatcag cttcagacgg ggaagctgat acctgaagtt     80160
     aaggtggaag tccccgtcaa acctgcggcc attcgacgga tgtatcgagc gagaagggat     80220
     gcccccctac atgccatgtc agcggagctg tggataggcc aaaagcgggt tgcgatcgtc     80280
     gagcctgtcc ataccctggg gtggactaac tctgatgtga cgaagtactc aaggaatata     80340
     ctcaaccgtt tctctgagca tctagacggt aaagtactgc atcagtttga ttcacaagtc     80400
     gaagtggatc caagtcaatg cccgattcgt ccctgccctt tgttcccgta ggaggctgtt     80460
     cacgatggca ttacaactgg aactcgatct ttggcagcag ttgaatcaag cggaagcggt     80520
     tccagtggag agtgacctcc agcagttgca ggagcgattg gacttagtga tagcccagtt     80580
     gccattagag gagaagttat ctacggcggg gactgccctt ttgcagatgg cggaaatctt     80640
     gagtcggcga gcggaggtct tcctcaggga ctggcgagat acctacaacg atgacggtcc     80700
     catccttgat ttggatgacg aaatggggat ggttcggcaa tccatggtgt tagacgatga     80760
     tctacttgct gaacccgagc cggtgactcg gcgaacatta cccaaagagg agagtgagtc     80820
     gatcgttgtg ctcaaggaca aggcatcgtt gctggaagag ctggagactg agttaagggt     80880
     tgagcaacct gatgaagtct tgcaagtctt ggaagaagag gatgttttgg catgggtaca     80940
     tgccatctca acgtacttac aagggacatc tgggatggtg cctttggtcg agctaaagca     81000
     ggagctacag ctgtcacttg ttcctatctg gctaggaatg ctactcggtg gatttaagtt     81060
     tgagcagcgg ggtgggtttt acgatcagaa tgtctggatt gaaacgggtg ccttgaacag     81120
     ccagccttga agactatcac ccttttttcg aagacctatg caagaagccg tacctggata     81180
     actcggatga gatgccagtg atacactcaa tcagcgaatc gaatacgaat cacggagcag     81240
     cgggtgacac aacaggagtc cattgaccat gatggtctgt tcaaagaact gatcgagacg     81300
     ttcttttggg aattcttaga tttgttttta cctcaagtct tagactatgt ggagcgcgga     81360
     cccgtcacgt ttttgtatca ggaagtcttc agcagtattg gcgcggagga gaagcgtatc     81420
     attgacttgc tggctcaagt ccagtttcga ggacaggaca gctactttct atttcacata     81480
     gaaccccaat cgtcagttca agcggacttt gagaaacgca tgttctacta cttcgcacga     81540
     ttgcatgaga aatatgattt gcccatttac ccagtggtaa tttttggctc tccgggaatt     81600
     agcgtggtag ccgctagata tagtgtttag gtcacagcga atgtctgata cccattgagg     81660
     tcaagagaaa tcctttggaa gagtctttca atatcgaaaa taccgtagca tcgtcttttt     81720
     aagactttga ctcggttatt aaatccttcc acaaaaccac tggtccaccc ctccaggaaa     81780
     tagttggtca tctcgtccat ccaattattg atagtggtca gaaaactatc gaattccttg     81840
     atgccactct tgagtacttg tttacaccaa gctcggatgg cacatttagc tccatgcttg     81900
     gtgtacctgc cctcaaatat ctgcgtgagt ttctctcgga gattgtacgc ctgtttcagt     81960
     tgtggagaat aagcaaacaa tcgctcaagg agttgttgct ctgactcttt cagattctct     82020
     ggtcgttttc taaaaggcca catcgcgcct ttgatgctgt catactcttg cttagaaagc     82080
     tctcgtcgta gacgtttgac ctcacgttta cgaaccgtat cagcacaatt acgataggct     82140
     ttggtcacat gaaagcggtc aatgacaatt ttggcttgcg gcaattgttc tcggactgca     82200
     ctgacaaatc cttggtacat gtccgtacag acgcgctcaa tggtttggcg taaatcaatg     82260
     ggaatcgatt gaaggaaatt tgccactgtc tgctgtttac ggtcggctag aactgccaat     82320
     atatccaccc catccgtcgt aggaatcgtg atcaaaacca caaaatcacg atggcctcgt     82380
     ttgagagaaa tctcatccat ccccataact ttgaggtctg catattcgct ccagtcaact     82440
     tgagcggcaa tccaacgatc aatgattcca ctgacgatat cctcactaac gcctagtttt     82500
     ctggcaacat ctgagaccgt tgaattgatc aagattcgca gaagccaacg ctcatatgct     82560
     tttgtattgg gactgcgagg ttcgtgccat tctaaatgtt gagttgttgt gggatggtca     82620
     tcgcaatact tgcatcgata acgcttgggc cgaatttcta agtaaacggg gacttcaaat     82680
     aatggcaggt gacgaatccg aaaaggctga tcatgacaat ggaggtcagt aatctcacgt     82740
     ccgcattggt gacaggttgt tccttgaagc gtactctcaa tcttgatgag ccaatcccct     82800
     ctctcagtct tcgatagctc tagaactcga atatcaggaa ggttgagcgg gatgcgaatt     82860
     gagttatcca ttacgccatt gctctgaagt actacctcag atcattccat agggatgaaa     82920
     aaggaaacac actaaatgta ggactgctac acgctaattc ccagagagcc taattttttc     82980
     ttatgacagc ccccaaaagg aagcagacaa tagctacaaa gttgagtttc ccgatttcca     83040
     ggttctgcag ttcaattttc gagacattca actgaatcgt ttgaactgga gagattttct     83100
     gaaacgggat aaccctgtgg cgtcggcatt aatggccaag atgcagattg ctaaagagga     83160
     tcggccacga gtcaaagtgg agtgtttgag gatgctggct accttgcagc ttgatccagc     83220
     tagaacagag ttcatttctc aatttatcga cacgtatctc cgactagaag caaacgagga     83280
     gcaacgcttt caaacagaaa ttgatacatt agaattagga gaacgagaag ccatcatgca     83340
     aactttgact agctgggaag aaaggggttg gcaaaaagga gaggtgagta ttgttctacg     83400
     tcaacttaat cggaagttta atcagctttc tcccgaaatg gaaactcaaa ttcaatcctt     83460
     agaggttgat caacttgaat cactgagcga agcacttttg gaattcgaga gcttagatga     83520
     tttgaacgct tggttgcaaa atttggagaa ttcctaaatt agctctaggt aactggttat     83580
     gttaggtgtg tgttgctagt aactaagact tcacacgctt caagatacaa ttttctggtt     83640
     attaccttat tcaattgaat agagatatga cagcaacagg aacatccccg acattactca     83700
     gcagtttcaa tcttcataat ttgccactcg ccaatcgtat agtcatggct cccatgacaa     83760
     gatcgcgagc tggggaagaa atgttggcga atgcaatgat ggctgaatat tacgctcaac     83820
     gggcatcaac aggcttgatt gtcacagaag gaacctttat ctcagaccaa gccatcggtt     83880
     ggcagcatgt ccctggaatt tacacccaag agcaaaccca agcttggcaa gtagtaacta     83940
     aagctgttca tgaaaaaggg ggtaagattt ttctgcaact ttggcattgt gggcgagctt     84000
     ctcacagcag ctttcatcag gattatcagc ttcctgtagc cccctcagct atcaaacttg     84060
     agggggattc aattcatact ccacaaggca agcagcccta tgaaacccca cgtgctctaa     84120
     gtaccgatga gattccactg gttgttgaag attatcgaca agctgctagc aatgccaaaa     84180
     cggctggctt tgacggtgtg gaaattcaca gtgccaacgg ttatctgctc gatagcttct     84240
     tgcaaagtaa aaccaatcaa cgtcaagatc gttacggtgg aactttggaa aatcgctatc     84300
     gatttctaaa ggaagttgta gaggcaattt cccaagtctg gtcaactcag cgcatcggtg     84360
     tgcggctttc gccgaatggc gtctataacg acatggggtc tccagactat cgtgaaacat     84420
     tcttgtatgt agctcagcag ttaaatgtct ttgatttagc ttatctccac atactagacg     84480
     gtctggcttt tggattccat gagttaggtg aacccataca tttatctgaa tttcggactg     84540
     tctataacgg aaccatcatt ggcaactgtg gttacactca aaaggatgca gacgatagaa     84600
     tttcgaacgg tcacgctgac ttaattgctt ttggccgtcc attcatcagc aatccagatc     84660
     tagtggaacg atttacgaat ggctggccct taaatccacc tgccgagcaa agtatttggt     84720
     attctttcga gagagaagga tacactgact ttccgactta tttagaatcc caagtcaaaa     84780
     ccacctaatt cagggtttgc tactatttct cttctgtacc atcatttgtg ggccaaccca     84840
     gcgacgaggt aacaatatga aactatcagg agaggtttgc taagcattca catcaagtgc     84900
     cttcctctat ccaacttgag ctagattttc cagtacattg gcttctactt tggatgaacc     84960
     cgagcaggtg gatgtccttc aactctggga tgggatgctg ccagagttgc aagccctctc     85020
     tcagcatgaa cggctccaag tcgctggcga gatggccctt gggattactg aagtcttttg     85080
     tcagcaggca gggctgctga tccaggattg ggaggatcgg cataacaccc aagggccagt     85140
     gctggatgat gacttcttgg ccgggatggt tcaagagacc atgttccttg atgtctcgga     85200
     tctgtgtcgg cagcccaagt cacggaagcg acgccagggg ttttcgggaa agcctgtgga     85260
     gtccgtcgta ggtgaggtta gtaaggatgc tgtgttggag tttgtggagg aactggaaag     85320
     cggggaggcg attgctctga aggtcagcca cgaggaagac gtgtcggctt gggtgggtgc     85380
     gatcttagag tatttggaag ggactgaggg ggaggtttcg tttggggagc tggtgaatgg     85440
     gctaaggatg cctgttgtgg cggtttggct tggggttcta cttggggagt ttcgggtgga     85500
     gcagagagga ggattttttg agggtgaaat actgatagaa gcatctcacc cgtaccaata     85560
     attccgattg aagtcaatcg gtaaagctgt agaaggggtt tgtggggcaa tggaacaata     85620
     aacaacgttg tttattgttc cattgcccca caaaccccaa caagccttaa atctaggcca     85680
     ttgcaaaatt gtttccatgc ctttcttagc aaggctttag gaggttggcg acatcataaa     85740
     agatttcaaa tgggttctgt aagattggcc taaggacagg aaactcctgg ggtcaatcag     85800
     cgtcatattt agcacatagg aattgcgtaa ctctatgctc actatgctca agcgggcaga     85860
     gcgatacgcc tataatgctg tttcatcgtc tggtgacttt atgaaagatg cagtttccca     85920
     gctgcccatt tctaagcgtg ttgttgttgc tactacttta gcaacaagtc ttgcgatctc     85980
     aactccaaat ccagcccaag caattccttt aagagatttg atcttccgtg gagttcaagt     86040
     gattcagctg tccaatcttt cacatcaaca ggaacgggag ctaggcgagc agatccaccg     86100
     caacctgcaa aaccaaggca tgcgcttaca tcagggacga accctcaatc gctacgttaa     86160
     tcgcattggt cagcgtttgg tgcaagcggg tgccaaacga cggaaagtag tttaccgatt     86220
     tcaggtggtg gatgataaac gagtgaatgc ctatgccacc atgggagggc gagtctatgt     86280
     caccacgggt ctgattaatg ccgcagacaa tgaagcccag ctagctagtg tgattggcca     86340
     tgaaattggc catattgatc ggaaacattt ggtcaagcaa attcgtaaga cgatggttgc     86400
     ccaaggatta accacagcca tcactggctc aaaccgaagc caagtcgcca atattggggt     86460
     caacttattg gtcagtcgcc cccaaagccg gagtgatgaa tatgaagcag atcgcgaagg     86520
     attaaggctt ctgagggcag cagactatgc gacctcagcc atgcctgcgt tcatgcaaaa     86580
     actagtgtct aaccgatcca ctcccacttt cttaagtacg caccccgcga cccctgatcg     86640
     cattgagcgt ctggaacaat acattcagtc cggtcctaaa aatgtgtgtg atcgcaaccc     86700
     cgatctcaga agttgcggtc tcagtgaaag tcgctatcgg caaatcgttg gcagtcgtta     86760
     aggaccagcg tgcgtattga agttagctca gtagacgagc aaaaacctag cgtaccaagc     86820
     gaacctgtta ggttgatgta aaaactacca acggcgtatt cccgcaatcg aggcataagc     86880
     tctgccagat tgcagggaga atggcggaca tctaattggt cttggatcag gtcatcccaa     86940
     cccgtgcggc aagcaccgga tgaaccaagt aggcaaaaca ggtaggtgcc attggccacg     87000
     cccgataatg cccgagactg aatcgtggag gtcttaatgt cttcgtagga gatcatgcgg     87060
     aagagttccc cgaatccctg aatttcctta tccagcacgg gttggatggc ttctggcgtg     87120
     ccgtcacgcc ccgtcacgcc tgtccctccg gtggtgatga tgggctgtac agattcatcg     87180
     gcaatccagc gagaaaccac agctcggatt ttgtagatgt catcgaggac aataactttt     87240
     tcagctagag gatgtccatg actagaccgc agccccttca gatgaaagat catcagacca     87300
     gtctccagag cttctgggag atcatagttg caacaaggca tgaagaggta ataacgatca     87360
     tggcctttac tcgaaaaagt ggacagttca tttaagctgc aagtgtttga tttcgtatcc     87420
     tccagtaatc ctcttcaaac tgtgaagggg cgcaatatcc aatggttcaa tgaagtcgtt     87480
     gtcggttgta gaacacctct atccattctg caatggtcgt cttagctatc gctcgattag     87540
     cgaaggtttt gggataaatt aactcagttc ttgagtttgg actaagttta aatctccaga     87600
     cagagtaaaa tatcccatgg cccttgaaag cctgagcata agtttttctg gtattaactc     87660
     agcagttaag cagcggtttt tgagacaatc tttgctttcc tgcgtttgga gactcgtttt     87720
     ttgaccgttg gatatcgagt tcttggtggt tgagattggc cttgcttgcg tccgggtgat     87780
     ttaccgcgag tttttggtgc ttgagcaggt gttccaatcg ccgcaataat acttgggaat     87840
     gcttgagcga cgcgtcctgg tgatagaact tgttgaggag actgccaggg taaaggcgta     87900
     tccatacagt ctgaccgagc aaaccacaat tgccaagata tcatcccaat caaagtactc     87960
     catcgctctg tcgcttcatt ggacgtgagt tgaggggtcg tccaatagag ccgttgtttg     88020
     gcaaatcgat accaatgctc aatgctaaag cgctgcagat atcttcgcca taatcgctcc     88080
     agacttggca tgcattctcc agtccaggcc agccaaagcg gcttaaactt tcgtcgttta     88140
     cctttcggtt ggatgatctc aacgcgcaaa atttccattt ctcgtttggc cgaattacgg     88200
     aaatggaatt ggctccagcg agttactctg acctgtccaa gttgggtgtc ttctatctcc     88260
     aatatttcgc tggcttctgg atatgtatta ggggcattca atttgaactt atgtccatgc     88320
     ttacgaggag cccctcgtcc tgaataggcg aggggaatac catagacaca gcgattggat     88380
     gctaagcgca ataacaggtc gacttcaatc cctgcagtgt gattgagaaa gatgccatta     88440
     ccgtagtgac ggtcaaacgc ggctagagga cgcaccggca aatgacgaca gacttgcttt     88500
     aattgaaacg tggctttggt caaagcggtc tcaaagctcg tgattcgttc atggcgtagg     88560
     ggcagtgccc aatgctgact ttcgtctggg acccaagaaa gggtgctata actttggcct     88620
     accccgacag tatgtccccc ttgatgatga aaacctctgt ttttgagggt cttggcctcg     88680
     ggacgcagcc aaggactact atctcccacg aagagcggct ggtcttgagt ggaaacttgt     88740
     cgaactaaat atcggtgaag tttggcacga tggatacgac catcatgcag ggctgaatag     88800
     gtactcgacc attgacgacg gaagatagga tgttgagaca aacacacaaa tgaacgcagg     88860
     ctcggactca tcaataccgc atccattagc tcaaataacg cgtctttact ggcgccaaag     88920
     cagctataca gagtttggcg gaattgacgc agatggtcga aaatcataag ggcaatgagt     88980
     gtgatgattc attgacctta aagcagtcgg tgtacttcat tgactgcttt tctcgtttgc     89040
     tttagtccaa actcaagtca ttaatcctca cctcagtatc ctccagaagt acgtcatcat     89100
     agagtgagtg atgtcttgga ggatcagtga tgttcccatt ttgctgccaa ccgaatactg     89160
     gccatcaaac gaaatcgaga gagaactatc gacagcacca gcttgaattc ttgaagatga     89220
     ttcaggatca tttggaagcg ggtttagcgg ctgttagcgc agctattaat accattgatg     89280
     ctcaagttca aaactctgac tcacaacaag aaggggatgc cgcctgatga tcttacagac     89340
     gaaggggatg cccatctaaa gactttggat ctttgccaat ctgaactcgt cctaaatccc     89400
     gcataagttt gatattctgc agttggttaa tccaacggca ggcgtttcat gagaattaag     89460
     ggactgttga aagcctcaca tcaagtcaga gatcagctta aaattggcat cccgatcaac     89520
     gaagttcctc agttcaaaca atatgtgaaa gattcaatca aagttacaga gcaaatctgt     89580
     gccaaagcca agacttcgcc caatcagtta ccactcccct cccgaaaagc ctacaaattc     89640
     ttgaagagcg ttgatctgaa gaatttgccc atcattcagc agtgcagcac actccagagc     89700
     caaaaacgga tctccattcg tcagatccgt ccccaacatc aacgcctgca gcgtcaaatc     89760
     gctgaggttg ccaacggctc tggtttaaat tcaaagcaag gacaagatct ggtccaacaa     89820
     cttcaacaca cggcacagga cattgaggtt ctatgcaatc gccaagtggc aacgcctgcg     89880
     aatttaacgg ggcaatcccg gcaaatctat tgctggatca agttcctctt gagtgatgac     89940
     aatcttcaat cccaccttaa tgccgtacag accttttatc agcttttaca acttggtctt     90000
     gaacaaaaga agccttccga caatactaac tggcaacagc tcaaagatcc taaaaaccta     90060
     tccatcgagt ttgcccatat atcagcgttg taccgctgca aacttggaac tgaacagggg     90120
     agcatcaagg tcaatgaggg atttattctt gccgatgaat taatactgga agcattggtt     90180
     aactccattt tgaacggcaa gacgccaaaa acgaccagtg tgttttatga gtactcctta     90240
     tcagaagagt ttgcggaact cctaatggaa atggaactct tggtggagga tctgaacgaa     90300
     actgctcagg gaagtactta taaccttgag gaggtgtatc aaaaagtgaa tcaagcttat     90360
     ttcgatggaa ctttggataa acccaaactc tgctggagcc gcacctacag caaacgcaag     90420
     ttcggacatt atgaacccag tagggatcag gtggtgatca gcctaaactt agatacgaag     90480
     aaggtcccca gatatgtggt tgagtttgtg atgtaccatg aactactcca taaggttcat     90540
     gggcaccgaa ctcaaaacgg acgccaaatg gctcatactc ctgagtttcg gagggatgag     90600
     cgtttgtttc agaaatattt acaagcagag gagcatcttc aacggcttgc cagagcgtcc     90660
     tagcgaagga tgcatgttca ttgataaatt tattcttggg aatgctaatc cttagcatcc     90720
     aaatattgct taatctacaa caattgaaga tagcctatga ccactgataa caattattcc     90780
     aaagtcctcc ttgagttgaa aaccaaatat gagcagacac tcgctgaatt ggaagctcaa     90840
     acgaatcaac tcaaaactaa actcaattcc ttaagtccgc taattgaaaa tccagccttg     90900
     ggtgcagata tcctttctat ccttcaagat gcatccgact ccatcacccc aacagcaaca     90960
     aactccgcct caaccgtcat tgaaactgta gagcctaaaa ctaagagtaa gtctcaaaaa     91020
     gctgctccaa aagcttcaac ctctacctca aagaaatcaa cctcaacttc taaaaaaccg     91080
     ccatctcagg ccaagaccaa gaagacaccc cagaaaaaaa atacaggtcg ttcttcatcc     91140
     accaagctgc cgatgaaaaa gccttatgac cagatgacca aaatggatgc aatcgaaaag     91200
     ttcatgcaag ggaatcctgg caaggtcatt cacacagata acttgattaa ggaactgttt     91260
     ggtgaattga gccaagaaca gcataaagct gaacgtggaa ggatgaaaac tgccatgtat     91320
     cggggtgttc gactgaaacg gtggataaaa gtacccaaaa agcaaatgtg cttcgtctac     91380
     gaatcacact tagcggctga atctaagaaa gcaactacaa caaagactca gaagtctcga     91440
     aagaagacca aatgaaacga tagtgtttga tgtgccaaaa actcaagcag aagccatcat     91500
     tcttttaacc gagaatgatg gtggagctag tagaaaaact tttttgccaa tctcgatata     91560
     ctcacccgac aacgcaaaag tgcttccagc gaagtaatct gcgagccgct gagccagcgt     91620
     gggtttcacc gccaccaaat tcacgagaag catatcatcc gttctcatcg tgttgatcgc     91680
     ttcctcggca tcttcaaatg acttgggatg atacacgcgg attttatggg gtgatactcc     91740
     ttgaaaggaa agaaggttgt ccataaacca gtactccttt gcgacctagt ccaggcacat     91800
     cctcagcgtt ccgtgaatac tccaggcagt ctgtttatac atgctcaagc ctaggatctc     91860
     acctgatagg ttactctcca tgacatcaga gccagcggaa agttccagct ccacagattc     91920
     tcttggagtt cgcggttgac tgatctgaag gttttttgag gacactgact gaggtagtcc     91980
     gtccggaata gagttgaaaa ttgaagaagt tatctttttc gggcaatgtg aaaggcagaa     92040
     atgttcaaga gtttgatgtg acctgcaaag tgattgtcta ttttcttctg caatcctacg     92100
     aacaagtctt tcctgctttt ttcatctaac tccaagtatt gtgaaaaggt actcaacagt     92160
     gtcaaatatt catccacact atatgaggtc tcccaaataa tctgttcaaa aacgatgcct     92220
     tcgaattgat ctgaggtagc aacaatctgt cctagttctc tcaattcagc ctcatgagta     92280
     tctctgcctt tgtagtgaga cagggatgga gcatggattt gatatacatc ctgtaacacc     92340
     tgatggaact ctcgataagg aatggctggc acattccata acagtatgag cactccatta     92400
     tcctgtaatg cattggccac tttagggtac gcaacttctg ccggaatcca atgaatcgaa     92460
     gttgctgcta aaacagcgtt aaacggcttc gcttcaggtt tccattcctc aaatgaggtg     92520
     tttttgatct cgagatttgg gtagtgagaa caatttctcc gagcaatctc gtaaaagtct     92580
     gggtttggct caagacaaag cattgaaaaa cccaggttag caaacgaaac tgttgcagtt     92640
     ccagggccac aacctatttc aagaattctc gacccatttt caagttgagt taactcgaca     92700
     actcgactaa tcaatgtatc aggataatgg ggtcgtgttc tgttgtaagc ctctgctgcg     92760
     ggagagtacc aagtctttct ctgtttcaag tctttgctag agtactgctt ggttgtttga     92820
     tcgttatctt tcaccactca gcctcaaact caaaatgctc tctgtctatt ctgaaactac     92880
     attctaatca ataggattag atgcctaacc ttggatatct gtcggtcagc caggttaagg     92940
     gggtgaagtc aactctgaaa caaatcataa tgagacactc agataccaat aacggcaaag     93000
     aaaatatgta ggttaaattg tgcgatcgct tgtccaaatc aactgattga cggggaacta     93060
     tctggctatc aatagactca acttcaccaa cgcagataat agaaggtttc taatgactga     93120
     tttcaagcat agacctacta acttagggca gcacctatgg agtctaagga atttagctga     93180
     acagacccac gctgctgctc aaagcgctga actacactcc cgtactgttg gacaagccag     93240
     tctctcccag aaattactgg atatccaacg tcaattatgt atccttcaac taagactcaa     93300
     agatcctgaa attcaagagt ggactggaaa gcaaatgcag ctaccattca gataaaatgc     93360
     tcaactctcc caggttcata cctgttctta acaatgaagc tctcccacct tcaagaggat     93420
     gggagtttct aatgctaatc tagagctacg ccagtagacc atagatcaca taaaacaggc     93480
     cagcttctag ccttacgcct ggaacttttg ccagaacgta actgacggtc atttctgccg     93540
     atcagcttaa gaatgcctcg agctgcaata ttccgagacc cgttaatgtc agcatttata     93600
     ggaaagacct tttaacccca acactccgtt acccgctccc actcaagctc cgcctgaacc     93660
     ctctcccaga tccgcttcat cgccttctgt ggacgaagct taatcacttg taaaatctca     93720
     aagttctcct caatttcgac ggcgcactca aatcaacccc ccggtgtagc aaacgattcc     93780
     ctcacgaaag gcttccccgt tctcttcacc aaaactatta ttgccctaag ttattcttgg     93840
     agatggtcag cgtctctaac tcgcttcgac atccatctag ttaggagatt gttcgcattt     93900
     cagtgtataa cctacccctc gaatcgtatg gataagttcg gttccaacct gattggcttt     93960
     gagcttattc cgaagacgag acacatggac atcaactact cgcgagtcaa cgatgctccc     94020
     attactatat ccccacactt tctctaacaa ctcttgacga gaaactactg ctccaggggt     94080
     acttgccaat agttctaaca gactaaactc catgtgggtt aggatgatac gttcttgacc     94140
     tctgaagacc ttccgcttgt tggtatcaat gtggagtgaa ccgatgttca gcactccggt     94200
     cactcgataa ttaaaaggtt ttagagaacc cattcggcgt atgatgcatc gcactcgaga     94260
     ttctagttcc ttgggtgaaa agggcttgac catgtaatca tccgcaccca tttctaagcc     94320
     agtaatccga tctcctacct cagaaagtgc cgtcagcata atgattggaa ccctcgaggt     94380
     cttacggatg gcccgacaga caccataccc atccagtctg ggcatcataa catctaaaac     94440
     aatcaaatca gggtgctgac gatcaaagat ttctagtgct tctacgccgt cagcagcagt     94500
     gaagacgtga tagcccatca tggatagcct agtgtctaaa attcgtcgaa tcggcccttc     94560
     atcatcaact accaagatag aatgctgctt attgctctga ttattcatga attcaggcat     94620
     ctttggctac gctttagttc aacgtagcat ttatacctaa gcaataatgc ttaagacgct     94680
     tgatagaaat gattcttatg attaggtcat tttcgaggga aattgccaag tctgctgctt     94740
     cggcatttgc ccaaaactca actcatcccc aaaccctact cacccgctcc cgctccaacc     94800
     acacaccaac catctcccca atccgctcca tcgtctccgg tggcctcagc tcaatcactt     94860
     ccccaatctc aaagttctcc tcaatttcaa ccgcgcactc ccaacagaac tccggcgtag     94920
     caaaagtatt cctcacgaaa ggcttccccg tccctgccac cgtaatcaag cactcctcag     94980
     actcattctt ggaaacagcc agatactcca gctcccctcg cgtcctggtc tgctccacca     95040
     gattcttctg cttcagctcc agattcctga atcgcctctc cagctctgcc gacactctag     95100
     gggttctcag ttgattgacc tggggagctt ctgaggatcg tgtcttagga gtgaactcag     95160
     gtttggttga ttgagaagga cgcctagaac tccggcgtat tcctcgcagc tcctcatgcc     95220
     cttgttctcg cttggctggc cgggttcctt ccggtgtttt cttaggaaat gctgtcctac     95280
     tcaccagttt gggtgcggaa gggacggact taggtggttg tgggatggtc ttgggtacgg     95340
     gctcggggtt gagggcgacg attgggggag tcattgggga atcctcaaat gcactaaagt     95400
     ctcaatactt ggattgtttc acaattggaa aagtttgagg agcaaacaga taaacaccat     95460
     ttcctacttc tgtatattca ccacataaag agttagtaca acctgcaaga taattactta     95520
     ttctctgggc cgattttgga gatagatttt ctaaattgac gagtagcagt tgtccgttct     95580
     tcaggcaatg tgccgcttct ttagcctccc taaaagaact cggattcgac aaatatattt     95640
     cagatgaaga ttgtcctggg aatatgacta aattgttcac agaatgatgc tattacttgc     95700
     tcagaggtat gtcttaattc ttccatgaag gaatttgctt ttctttaatc gaaaaataag     95760
     tttaatgttc acatcacttc aaaatcgcat ccttagcctt tagagggtga aatgtgacat     95820
     agaccttcct ctggcctctt caacaacatc tccgcagccc ccatcttagc tttcttcttc     95880
     gatgctccct cgcctactcc ctgtaatccc atcgactgca ctaaacaacg aaacccttct     95940
     gatatctctg aaaactcgta cctgggcaac gatatttgct gtttctggca aagctcttgc     96000
     aattgtccaa tcggattctt cacctgttca tcaacctggc tgatgggctg atcaggggag     96060
     gtctcaggtt gctcggcttc ttcctggcgt ggatgtaaga tatgtacctg ctgttcggcc     96120
     ttgaggatag ctcggttcct agcccgttca aggagcctga tcaaagcatc ttctggatca     96180
     acattggggt acaaatagtc gagaaatcca agctgctctt cggttagtcg aacgtttagg     96240
     ctgagggaag gtcgagattc aatcatacct ggagagtgga agattccaat ttagaaagga     96300
     cttggtcgat gatgtcctga tctttgattt ctggatcagt gatttcctgg tcagtggatt     96360
     cagtagcgtt actcttaggc gttgaacgtt ctccaacagc cacaaccttg acggtaacgc     96420
     catctctatg gcagatgaac tcatagagct ttccatcctt gagcttctcc aggcagtcct     96480
     cactcacgag cggggaatgc tggcggatat gaatctctgg gtcgcgctcc tgatcccgct     96540
     gtatcaaaac cctttgctta tctgctctcc atactccgat caatacccag ttctctgtct     96600
     ttgctgatgc ccgttgcgag gtacctgtta actgcaaaga tgtaatctga ccattcatga     96660
     tattgggata accaaacacc aagactggtt tgtctaaaac tgacttgact ttcttaaagc     96720
     tcttcttcga taggaagagt ttgatgggtt gtccatcaac ttccacaaaa tacagagact     96780
     ttgttctccc ggcttcaaac tccttctctc gtactcgaat aattccggga atacgacacc     96840
     aagcccgatg agtgccattt ccagggagca gtggaggttt ctcggaaagt tcacctgatt     96900
     ttgacttaga tgttgtcttt gcttgttttt gatcttttga atttgaattc tttctgttag     96960
     gagtgtctac agtcttaaca tgcagctttt cctgggctgg atttgggaga ttcttgctct     97020
     gagagattac ttcaggtttt ggctctattt tgttgagtga agggggtttc aacgttgttc     97080
     tttgtttttg tgatgccttc tgcctagact tcctctctga ttttttgtgt gcagctttcc     97140
     gctgagctat cttggaagaa ttcgtattag ttgtctttat ctggtctatc ttagatacct     97200
     cgatctggtc ctggcctatg ttgagctggg cttcaagctt tgcaatcgta ctcttgagta     97260
     gcttggcagc agtggggtta atacaatcct gaagctgcct cttaagctgg ttcagcttat     97320
     cgatagatgc agagggcatg ggaacctccc tgggatcgga cttgcggcca ttctagtgta     97380
     gagaattggg atttggggaa agtaaaagtt ttttccacaa atcattactg ggtctttaat     97440
     ctaggcttaa gatcagaaat tatgaacact tgtgctttac aaggaatact cctagagaaa     97500
     tccctgcgat atacccagga gaaacgtgcg atcgcggaat ttgtcattga gattaaccct     97560
     ctgaagtaag gagaccccaa ggaaaatctc aaggccatct attggggaga gaatgaggag     97620
     aaagcacaca atgcattaca agctggcgac caactcattt tgcaaggtca actgaggata     97680
     aacaaggtga ctcataggtt gggcaatgag gaatatgtgg atcagcaagc cagtctaatc     97740
     gttgataaaa ttaatcgaat ctacgatcca gattaatcag caatcatcaa ggtttccact     97800
     ctgttttaaa agctagaaag ttcatagtaa gacgcctcta tgtggttccc atcaaggtca     97860
     tagattgaag cactataaaa ttcatgacca tatgttggtc gataccctgg tgagtcggat     97920
     gcttcagcac caacctcaag gccagtttta taaaatgcat cgactgcttc aaaggaaggt     97980
     gctgaaatgg aaatatatgt ttcctttcta acctctgaat cttggcttaa atctgatctt     98040
     tgtgtaatcc aaaactctgg ccatgtttcc ccataaccaa cgacttgacc agggtcttca     98100
     tacaatcgga catatcccat gatccccaga atcacatcat aaaatgatgt ggcttgatca     98160
     atgtctgtca ctcctacaga aacatagtta agcatttctg caaagcctaa aaaagatagg     98220
     tctctgtatt aaattttacc caaaaaaaga cctaatccaa gctaagggct gggttcttgg     98280
     agaactctag aaataatgct acatagtcag aagcaaggcg gatggtcagc ctggaagatg     98340
     gctggagagt aggcataatt ttaaggatca atccaaaatc attttgatgc cttgctttgg     98400
     gcgtaaagtt atcgatggta atagctcaat ggactgatct ggaacaagct taaaatgaaa     98460
     ctgattggca atcattgcta ggatcagagt tgcttccatc atcgaaaagg cttttccgat     98520
     acaaactctt ggccccgctc caaatgggaa ataagtgcag cgaggtaact tttgctcaaa     98580
     attatcctgc cagcgttcgg gtaaaaactt ctctggctct tcaaagaagc gaggatcacg     98640
     atgtaccacc cattggctaa caacaacacc agctcccttt tttagcctat agggaccaat     98700
     ttgacagtct tgaatggctt cacgagttaa tatccaggca ggtgagtaca gccgcatcga     98760
     ctcacgaatc accttctgtg agtaagctaa tcgaggaagg aaggttatgt tgggtatctt     98820
     tccatccagt tccgtttgtg tttctttgcg tagctgattt gcaactgttg gatgttgagc     98880
     caatagcatt attgtccaag ttagagcatt ggccgtagta tcatgaccag ccaacaacag     98940
     ggtcatgacc tcatctcgta attcttcaaa tgaaagctga ttaccgtctt cgtcttttac     99000
     agagagaaga gtagacaaca aatcatcctt aggggattga tagcgttgtt caatgatact     99060
     gataacaatc ttgttgaggt attgaatagc cctatttgcg cggagattac ttttagttgg     99120
     catccagtct ggaagcaaaa agttggtctg tgccctgtga taaatctgga gtgagattgc     99180
     ttcaagggca tccccaatct ctagggcagt ctgagtaaca tctatcccaa agagcgcctt     99240
     ggcgatgact ttaactgtaa gctgcctcat ctcttgatag atatcaagga tacctccttt     99300
     cttccaatgc ttaagcagat gggaagtttc ttccacgact atcgaagcat aggcggatat     99360
     cctctcctgg gagaaagctg gtgtcatcag ttgcctatgt cgtcgccata actcaccatc     99420
     gctgagcacc aacccattcc ccaaaacctt tgacagagaa cgatagctaa cgtctttgat     99480
     aaagctctga tattgcgtat ttagtacttc agcaatcaaa tcaggatgat gaaaaagaaa     99540
     aatctcaatt gaacccaagc taagaattgc agtgtctcca tattcctggg ccgatttggt     99600
     tacaaactca attggatttc ttgcaaatgt aaagagttcc ctcaacgctg ccagtccgct     99660
     gatcctatgg gcttcatcat gaaggggtag ttgggaagcg ttagctgtca tgaataattt     99720
     actccgtgac cttctgaata aagatggcta aacctaataa gtctcatcct attaatttga     99780
     actaggaaaa atagagctga gctggtttat cacatgaatt ccaaggctat caagagttag     99840
     tggtgactga aattctagtc tcaataagca ggggtgaaaa ctaatcttaa tattatgcag     99900
     aaaaaataaa aaattcaagg ctatacagtt aaattagtca gatcaactcg gtttttttga     99960
     aaataaccat tacaaaaatc tagctagtat gagtgcagca ataatacaga ctattaacca    100020
     gttagatcga ggagattatg cccatatcac ttgaacgaag gcaactttga atctcttttc    100080
     tgagaccgtt gattagctag taacaaattt taggaagtta cggaggattt cattttctgg    100140
     tactgcctca aaatcaaagt cagatccaat taccttagtc aaaagctcaa gcacatgatt    100200
     gagtcttcag tgggaaaata tggatggtcg cttttcccat ttaatcaacc cattacgaat    100260
     gcttatcttt ttgatgaaag caatactatc caaggaccat ctaactgctc agtagctaaa    100320
     ctaattagga gtttagattt tgatggtaat agcgttggaa aatgcatact cagggaagaa    100380
     actttgtgcg aaacctatgt atgtaatatc actggactag tgaaagcgct tgatcaccta    100440
     gatatgcgga taatttctaa tgttgttcaa acagcctatg gataaaccac ttactttttc    100500
     tattcagata tgaattatcg aagtcttcta gaaaaacctt ttttagcatt agggtttctt    100560
     ttactgtcag caaaccatgt aaatccgcag atcctcccag atacaacact cggacctgaa    100620
     agttcaatct caatgcctaa ccaacttatt aatggtatac cgagtatacg gttgactgga    100680
     ggagcgacaa gagggtcaaa tcttttccac agttttttag agttcagtat caacaatggg    100740
     caagctgttt attttgataa tccactaagt gtcaaaacta tcttatcgag aataactggg    100800
     aacaaggttt cactaattaa tggggtacta ggaagtacaa gtaacgctga tctattcttt    100860
     gttaatccta atggaattat ttttgggcga aatgctgtct tagatatcaa cggttcattt    100920
     tttggcagca ctgccaatca tcttagattt atggatgatt caattttttc cgcgaatcag    100980
     acccatcagg ctccactgtt aacaaatagc ttgccaaaaa gtcttgaatt tgaaggaggg    101040
     aatggcccaa tacaggtgat aggcgaaggc aatcgattaa ctgatttcac aattcttcct    101100
     atttttaacc ctttcgatcg tcctctcggg ctagccctaa gaccccaaaa tacatttgct    101160
     ttgatcggtg gagaaattca aagccaaggt ggtgttatta gatcttccag tgggcgaatt    101220
     gagttgagta gtatcaccaa aggaaaagta cttctgaatc aactgaattc agattggaca    101280
     tttgagtatt ctgaagtaga ctcttttggg gacatcgctc tcaaccagcg atccttaatt    101340
     gatacatcgg gtctggtcgg aggacccatt aaccttcaag ctaagaacat cctcctgaat    101400
     gatggatcaa ctgttttaat tcaaaatctg ggcaatctac cttcaagcga tatcacagtt    101460
     aatgctaccg atacagtaac agtgagtgga gtatcaaacg atcctcgctt tacacttcca    101520
     gaaatcgctc taatcgcagg ggatgagttg aacgttaaaa tccccagtac ctttctcaca    101580
     gaagcccttg gccttggcac atctggtaac attaagattt tttccccaac aatactagta    101640
     aatggtggtg gacaaattct ggctagaacc aatgggcctg gaactgctgg agatataaca    101700
     atcacatccc cagaatctgt tcaaatagac ggattcgcac caaatttacc tgttgttttt    101760
     agcaatataa gcactgccac ctttaatagg ggtaatgctg gaaatcttgc aatattcacc    101820
     aaccagttgc ttgtgaccaa tggggctaat gttggttctt cgacttttgg gcttggaaat    101880
     ggaggagatg tccttatcaa tgcgaaagat attactttga aagggatcgt gcctgtcttg    101940
     tttattccta gtgcaattag ttctgctact ttcagttttg gttcagcagg tacgttgacc    102000
     ctaaatacct ctacattgac attgttggat ggcggtaggc tcggaacatc gacagtatcc    102060
     tcaggtaatg caggcaaagt cactatcaat gcatctcaat tgatcaaagt cagtgggaca    102120
     gttcctgggt caatcaatcc tagcttgatt gattcttccg caaatattgt tgacccagca    102180
     ttaagagaac aactcggact gccgggtgcg cccctaccca atattcccag cggtactgct    102240
     ggggacgtaa ccattagaac aaagaccctt ctcgtaaata acggtggtct catcagtgtt    102300
     cggaatgacg gcacaggtga cgctggaacc ctgagaattt ttgctgattc catcaagtta    102360
     gaaaacagag ggaatattgc tgcttcaacg gctgtaggaa atggaggtaa tttagttttt    102420
     caaatccaag atcttttatt tcttaaccaa tcgagtaaca ttactacctc tgcccaaaaa    102480
     tttggtattg gcggcaatat tgatattaat tcaggtgtaa ttgcactgtc gaataatagt    102540
     gtcatatctg gaaatgctga acaagccagt ggaggtaata ttcgcattga gacccaagga    102600
     atatttgttt caagcgatag taaaatcact gcttcctcac aacttggccc tcaattttcg    102660
     ggcaatattg agataaacac accaaatatc gatttcacaa aagcaacatt ggatctggct    102720
     gtaagacctg aagttgaaga ggttgccata agctgcaata ttgatcctgg agaagtagcc    102780
     agcgaattta ctcgtcctgg ctctggtggg gttgcctcaa atgcagaaaa aacaggggaa    102840
     ttgagagtcg ttaagaacag gaataataat ctacaaactc aagaatatta tcttgatcca    102900
     gaaacaggag aaccgaaagt atacccaaag gttgttggct ggaaacgcaa cccaaatggc    102960
     acaattgcca tgacttcaga cccgacagaa gcagtccaga ctcaagcgtt ttgctcaaga    103020
     actgctcaca ataatctata atttttcgtg attacaataa aaaaaaccgt tgtccttggc    103080
     attgctggac cctgtttttt tgcgcatcca gctatcgccc aagcagactc tttaaaccca    103140
     tcggatctga tccctcggaa atcgcctttc cctgaaatac ccaggcttcc acaatcagat    103200
     aaacccctta aaactccctt gctgccgggg caaaatcctc ctgtcttagt ggatgaatct    103260
     gttcaagttg aaacctttat ttttaagggc aataccgttt attcggatct tgatttatct    103320
     aaaattgctg taccttatct acaggaacca cagacgttat ctgacttaca ggaacttacg    103380
     cagaaaatct ctgaatttta cgctaatgcc gggtacgtcg ctacctcagc aacgatagct    103440
     caacaggaaa actcaaagat aacgcctgac aaagctgtga tcacaatatt gatcacggaa    103500
     gggaaattag aagcagtcga tatccaaggc gcagatcggc tagaaaaata tattcgtcgg    103560
     aggctaccta agcccaacac gattatcaac gaagacacca ttttagaaga tatccgactg    103620
     ctccaggcca atcctttggt taagcagatt tccgctagct tgattaaagg agcctatcgg    103680
     gatcgcttta cccttaacgt tgaagtggtg ccagcaaaac agagaagttt agctctaatc    103740
     ttggacaatg atcggtcgcc ctccattggc agttttcagc ggagtgtgga ctttacagat    103800
     cgcaacctct tggggttagg agacaccgta aacttcaagt tctccaacac cgatggcagt    103860
     aattccgttc aattctccta cttccttcct gttaattcac aaaacggtac tgtgggtgtg    103920
     aagtacttct acggctccag caaggtggta gaagacccat ttgatgaagt cgatatcagc    103980
     gcagttgctg attatactga agtcttcttc cgacaaccga tcatccacga ggcaaccgct    104040
     gactctgttc aagaatttgc cttggggctg tccttcagtc gagaaactag cgatttcacg    104100
     ctactgggca taccattccc tgtttctcgc ggatctgatc ctatgggtga gacaaagacg    104160
     tctgttttac gcttctcgca ggactggtct aagcaatctg ctgagaacgt gttttttgcc    104220
     cgatctcagt tcagttttgg cttaccgata ttggatgcaa ccatcaactc tacgggtcca    104280
     gatgggcgct ttttcctatg gcgattgcaa gggttgtggg gtcggagatt attcgacgac    104340
     tggacaataa cttttcgttc cgaactccag cttgcggata gccccttggt ccccgctgag    104400
     cagttcacat tgggggggtt ctcgtccgct cggggttatc gtcaaaacct gttgttgggg    104460
     gacaatggct ggctcggggc agtcgagctg gggattccac tttactccgg ttcattgggg    104520
     aatttaagcc tcgctccttt ctttgaagtt ggaaccgttt gggataacca acctcaactt    104580
     attgccactc caagcaccct cgcctctacg ggcttaggat tacggtttca ggccaaagac    104640
     tgcttgagtg cgcggataga ttggggtata ccgttaatca acatgcctga caatcgctcc    104700
     acacttcaag aatctggcgt ttatttctca ctgcgatgcg atattctcta gccatacttc    104760
     tcagtacaac tatggtcctg acaggcctac ccgtctgggc agacgccatc gaggacgcag    104820
     gccagtacgc tgcaaaaggc caatctcttc tggagcaggg caaccccagt gctgcgctgg    104880
     agacctggcg gaaagctttg cagatataca aaaaagagaa atcagaaaca ggcgagaaaa    104940
     atgcgcttgt gaacatgagc gtagcgcatc aggcgaaagg ccaataccct agcgcctgtt    105000
     gggtactgat ggatgcgctt gaggtagata ggagtgccat ttgccgcaat gtcaaccgac    105060
     ccacgcctga agaggttgac aacgccctga atatcatcaa gaaacaacca gacacatcac    105120
     tcaccctcaa agccctacaa gagctaggta tcacgttacg agtgattggg aatcttgatg    105180
     aatctgtatc cgtcctggag ctagctctag cctcagctca acggcaaaat ctaggtttag    105240
     agcagaacgc gatcaggatg agcttggcga atgtgcaagc agatatgatt cgccaagctc    105300
     agaatcgatt ttctttatca gacaatccac tgactaaagc tcaatttgtg gcggtcccaa    105360
     cttcgaccct cccggaagtg tcgcaaactt atctggatct ggctgaacaa gggccagaat    105420
     ttctgcaagc gcgattaaat tggctcaaat tgttcttagc tattcatcaa tgggctaacc    105480
     aagatccaac aaatcctaag ctatctgcac tcagagccag cttgttaccc cacctggcct    105540
     ccacgctgaa caaagccgtg gtcgcagatt acaccatcga atcacccatc gaaagtatct    105600
     acagtcgaat caagttagca aaataccttc tggagataca gcagaatgat ttacctgtat    105660
     ccacggaaaa gcatccactc attcacgcct ttgaactggt aaattcagct cgcaatgatg    105720
     ccctgaatat caagaacaag cgggcggaat cctttgctat aggggttctt gggaagttat    105780
     ataaaacctc gcagcaaatt gaacaggcac aagaagcgtt tgaggctgct agagttctcg    105840
     cggccacgag tgaatcatcc gattcagcct atgagtggga atgggagtta gctcaacttt    105900
     accgagaaaa agggcaaacc caagaggcta tctcagccta tgaacgctcc ttcaaacatc    105960
     tcgatcaggt gcgaggtgat ttgctcccta tcgactcgga actactgttc aggttctccg    106020
     ataaagttaa acccgtttat cagcaataca tcagcctatt gttggaatct gactcaccag    106080
     atcttgagaa agttgttcta accaatgagc aactgcaagt cgcccaaatt gagaattttc    106140
     tccactgcgg aaagctgatt tttgtatcca caaccaaaat cgaggatgca ccgacaacca    106200
     tccacattct ggaacttgaa gataggtttg agattctcgt gcccaacaac gaaacttggg    106260
     cacggttctc agcggatgga gagagagtca ggggacttgc ccgtaagctc ctgatcgagc    106320
     ttcaagatca aggcttctct gatacggatg acaattattt gttagcagag tcccaatcgc    106380
     tctaccagct attgctaggc cccattgagc aacagggatt attgccagac caggaggata    106440
     cgattgtatt tgtcacggat ggcctgctga gcaacattcc gctatccata ctccatgatg    106500
     ggaaggaata cttaatcgag cgctatagca ttgcaactaa cctggggagg ttgcaagctc    106560
     ccaaagcaac gaacccagaa cgacttaaac tgctgatcgc gggaatatcg aaagcaagtc    106620
     caagcctatc tgctccacag gtgccccagg atcttgaagt cttgacagaa actgaagaag    106680
     aagccaattt aattagcagc agtataagag catctacctt gctgaacaaa aattttactg    106740
     ctgacaacct tcaaaggaag ttgaacgacg attacaatgc attgcatatt tccacccacg    106800
     ggcagttctc ctctgatccc aatcagacat ttttactggc ctgggacaaa cctctaccat    106860
     tacaagaact tgattccatc ctaagacagg gcactcaggt tgctgccaac aatttggagc    106920
     tactattttt gagcgcttgc caaaccgcca agggtgaccc cttatcaagc ctggggattg    106980
     cgggtgtctc catccaggcg ggtgcgcgat caacagttgc ctcattatgg ctagtagatg    107040
     ctcaatccac tgctcaactt gcaggcagct tctacgaatc actagctaat ggcaagacga    107100
     aagctgaggc actacggaag gctcaattag cattattgga caaacccgcc actcgtcatc    107160
     cgtactactg ggcttcattc tttctctcag ggagctggct ttgatatcga tccagcgctt    107220
     gcagtccctc agtcgctttc tttagggcaa tttgattacc ctgagccttt gccagttgct    107280
     tagccttgag atactgcttc ctggcctcac tgagtaattt cgcatcaata taccgttcgg    107340
     ctaagactct aaaaatctct gggtggttgc tacccgactg aaccctatcc cttaatgctt    107400
     taatactctg atttagtaga ccctcatcca agtaggcagc gtttaagtct agataggctt    107460
     cttggtctgg atcaagattt agacggcgaa tgagctggat agtctgctga agccgcctgg    107520
     ttttagcgga atcaagtaaa cggaatattg atgaatccgc gacaatcgga acgtcatttc    107580
     tataggcaac cacactgacc ttgtaatgat tctctgaact caagggggct tgttcggtag    107640
     gatatgccgc agacgttgag gttgtggtta ttgaccataa tcctttttcc tgatcagcaa    107700
     cttctagctg atatttcgtt gcgccaggaa cagctaacca agtaaagctt ggccgggttt    107760
     ctagcagcca acgaccatag ggagtgataa ttctgggtgt ttctcctgac ccttgtcctc    107820
     ccttgattcg cttacaaaag ctacgagaag aaagaggaca tttttttctg gaattcctag    107880
     tctgtttttt aggctgacac ggttgctcag atccgctgaa gtagcagagg accataccac    107940
     ccttaatttg tgaaactatc tggtcaccat tgcaaagtaa tttaccgacg aggttctgct    108000
     gattcgtctt caaaattcgg ccaatcggtt cacaggcatc gttcttgggt tgcacctgag    108060
     ccatagacaa agcaggccaa agaataagtg aggccgtcag agttaagcta acttgcaccg    108120
     cgaatttcat ctgaagaagg gtaaaatacc tattttttct ttgttaataa gattataggc    108180
     tacggttttt gaaatatttt atcaagaaca ccgtctttcc attcttcgac ctctggtaaa    108240
     aaagaatcta gccgcaagca agccttccat gattgctggg caagcgtatc attaccttgt    108300
     tcctgataga cttgggcgat caggcaatgg gcggctgcca tttcaggatc tgagcgaatc    108360
     gcttgttgta aacgtccctc agcttgcctg taatctccca gcttgaattc agcccatccc    108420
     aaattcttca gcagacgcgc tctacttaaa tcctcggcag ccttatccag tgcccctatc    108480
     accaaaactt tggcttcttc ataattaccc tgcaaaattt tgagacgaga taaattactt    108540
     gctgatccta cgacttggat gtctgtagcg ttatcaatta ccagcttgta gtatctctcg    108600
     gctaaattgt tattcccttg atcttcatac atggcagcaa gattgaatgt tgatatccaa    108660
     taattaggat ttgtctgagc agctttttga aaattctcaa tagcacaggg aagattcccc    108720
     tggacctcac aaacaagacc gagattgttg taagcttctt cgttgttggg attgagacgt    108780
     aatgactgct ggtaattttg ttttgcagca tcaagctgat tattcaattg ctcatcacgc    108840
     ccctttataa agtgacgttc ggccatgaat tgatcgtatt cgcccttaat ctccctaata    108900
     gcaaaggaac ccaaaacagc taataaaaca gctaaaaaac ccacactaca cttgaaataa    108960
     ggagagcggc tggttttctc ccaaagctcc aactttccta tatcttgaag taaatactga    109020
     gtactttgat gccgatctcc tggttgaatc gacgtcattt tatccagaag attagcaaat    109080
     ctgcggtgta agcggggagc ttgatcttgc caaatgggtt gaccagtttg cttgtcgatg    109140
     gggagtttgt agggctgaat ccccgtcagt atttcgatga ttgtccgacc tagtgcataa    109200
     aaatctgact ggggtagcgc ttttccatta acctgctcta gcggggaata gcccatgctt    109260
     tgaatcaaag taatatcgtc aaagcgctca gtaatgtcat cagtattctc aggcgttgct    109320
     aacttagcaa tgtaggtttc gctgattggc ctaattgcac cgaagtctat taaagccagt    109380
     gttccatcgg gtctcacaat gatgtttgag ggtttaatgt ctcgatggaa aaaccgttca    109440
     ttgtgtactg catggagaat ttcagctagt tgcttaagcc agttgagtgc ttgatggggt    109500
     ggtactggat catgagtttt tagccattcc ttgagattct gtccctcaaa gcgctccatc    109560
     acaaatccat agatctcgct tgggctttgg ataggattta gtttgatggt gtaatactcc    109620
     caccattccg ctctgggaac gcaaggatgg cgaatactcc taagtgcaac atattcacgc    109680
     tcaaacatcg ttactaactt tggttgcaca tccttgagga tctttatgat tttgatatcg    109740
     tcatcaccag cttgcgcttc atagatatcg gtacgcctaa gtgggtgaag atcattcaac    109800
     ggttttagca ggcgatactt ttcccctata agcaaggaaa caccacaccc ctgacaacac    109860
     tccaagtgat ctggattttg ccgctgatca cagtttgggt ttggacagta actcactggt    109920
     caacaacctt gttaagctgc ctgggtaatc cgacttttga ccgctccagt aggatctgtg    109980
     ttcagatatt tctgaagaac tggaggcatc ttcaattcca aggctcttgc tgtgaattcc    110040
     ttctcaataa ctgaacgctc tgttagggaa ttgagtgctt ccaggatttg ggattttgag    110100
     gtaacacatt ggcactcctc aactaagtac tgaaccaaac tatctaaggt gattgactca    110160
     ttctgttcta gctgctgggc cacgaaaact aggatttgta tctccagcaa attgtagttt    110220
     cctttattgc taaattgctg atcaaactta gaaaggaaag gatcacccag ccaggtagtt    110280
     tcatactcga caaatcgact aacctgtcca ccaaaaaact ctttaatgcg acttgctata    110340
     ctattgagcg caagtggatt tccacgatat tgaccagcaa tttttatcca ttctttttta    110400
     ccagataaat cgtattcttt atatatccct acagactcat ctgcagtaac tcccaacaat    110460
     tgcaaagtct tgactggctt ccctgtatta cccaattcat cgagatcttt aaatatttct    110520
     ctactggtta aaactatgca actctggtga gattcttcta taactcttct taagaaaatc    110580
     ccatagctgg agttctcttc tccatatgga ttaaaagagt tacctttcag tattgattca    110640
     cactcatcca gaactaacaa acatcgattt gtcttgagta gttctatgaa atcatcactt    110700
     gtgtatgctt tgtctttatc aaaagcttct gggttgacat ctcgaataat atctcgacat    110760
     aagtcttcca tcttggggga gtaaccaatt gacttccaga tatacagagc atattcataa    110820
     tctggggact ggcgaacggt gtcaaccagc ttcgcagcta aactgctttt tccaattcca    110880
     accgggcctg ttataacaac acagtgatta gcctgggtgt ccttcagtaa ggtttctact    110940
     tcttttgctc gaccatatat attctcatga gtcggtaagt agccaatcaa aggctgagct    111000
     ttgtcaatcc ataattcacc atttttaggc aattcatcta ccgattggag taagtttcta    111060
     acaaatccct gtatgtatgg cttcccaatt ttatgctcat cgccaactgc ttcttggagg    111120
     aatcgccata gcccaggccc agcagtatta cagagataga ccttctcaaa tcgtgactta    111180
     tctgccaaag cctcataaga caagccctcg atagaacccc gcaggatata attctcaacc    111240
     tcattgagct tcttgcctcg aattttgagg gattgatcat caacccaggc ataaaactct    111300
     tccaatgtta tagccatacc cgtccctgta tagattcttt gctagaaatc caaagtaagt    111360
     taatacagat aagtataaat gatagctatt aacctattga attaatatca ttatctgatg    111420
     aatattcaca gactcgatgg taattatctc tcaatctcat gtaagcaaga agccatatag    111480
     ccccatcaac agcactataa gtcagatgtc ataatagatt attaatcctt ttctagtgga    111540
     tatagtgaat tatctagtaa aaaaactatt aatttaattc tatatttgta gtaatcttgc    111600
     ttttaaggtc tactaaacct ggagtcaaga taatgcttga gcataattcc atccccgaac    111660
     agattcagcc acagctactc aagctctccc taatagagct agacgaggga attcaacccc    111720
     gacagaaact cagtcaggag gtgattactg aatatgcgga ggctatgaga cagggagcta    111780
     cgtttccgcc tgttattgtt ttcttcgatg gcaataaata ctggttggca gacggatttc    111840
     ataggattgc tgcaaaaaag gcgaatggcg atcttgaaat catcacggag aaaaagctcg    111900
     gctcccgtcg agacgcgatt ttatatgccg ttggagctaa tgcaacttac gggcttcagc    111960
     gcagtaatga cgacaaaaga aaggtgatta aaaaaatgtt gagcgatcac cagtggtgtc    112020
     agtggagtaa ccgcgaaatt gctcggcgct gcaaagttag ctatgagatg gtcagaaaca    112080
     tcagaaatga gctgcctgac aaccgctgtc agatacaaaa gttaacaaaa atctcgcgaa    112140
     aaggagatcg acgtcttgtt ctacgaaaag gtaaaactta tagcatgaac atatcaaatc    112200
     ttaaacaccc taaataaaaa aaagagaata ctgcctattt acaataagca gcgagggcca    112260
     gtttgaatcc tgcttatgca aagcaataaa gaaaaaaaac ttaatactat caaatcgctg    112320
     cagttgacga aacattttca attctcggaa tcactttatt gctgagggat ttacatgttt    112380
     ttataacgat atgctgttct ctatcgttag cttttaatgc cgccccaaaa gccccaaagc    112440
     aattcttcag aacccaccgt tcagtctatt gtgatagcca atattcgcgt ggatggagga    112500
     acgcaaccgc gctcccaatt atacgaagaa gtggtagcag aatatgctga agaaatgaag    112560
     gaaggggcag atttcccacc tgtaactgtt tactttgatg gcaaggaata ttggctagct    112620
     gatggcttcc atagagtacg ggccaaagaa actttaggag aaaagaaagt tgctgctgaa    112680
     gtctattgtg gaactcaacg agatgcagtg ctatacgctg ttggagctaa tgctaaacat    112740
     ggattgagac gaacgaatgc agataaacgt cgttctgtag aaagactact acgcgactat    112800
     gagtggagca gatggagtga tcgcgagata tctagaaaat gtggcgttag ttctactatg    112860
     gttaacaatc tgagaaaatc tatagaatcg cctgaacaaa gctctgcaaa agacgataat    112920
     tttatttcag atgatctctc taaaatacgc cttgcccaaa ggggtgggaa aacatatgag    112980
     atcgatacca ctaacctcag taaaattaat cagaagaaga cattatcacc aaggcgaaaa    113040
     agagctaaaa agcagcctaa atctacttca gagtctattg aggctccacc taagcgcgtt    113100
     cggccaggtg aggtatggaa gcttgggagg tttcattttc ttttttgtgg taatccagac    113160
     tctgatgaat ttcagcagct tttaccatcg gaaatttcat tgctacttgt ctttcctcag    113220
     tcatccgagc agtggcccca aactaggcca caaaatgcaa gaagtgtagt ggtattcgat    113280
     actcctttcg gtgaagacct gcatttggaa actttaagag gaattatcga aaattccctt    113340
     gcagggacta cagatgctaa tgatccggta gttatcataa atctccttga tccatcactg    113400
     tttattctga tagacgattt gcaatgcaga tgttgttgtg ctgaacctga tccacagcgc    113460
     tgctcagatg ctttaacggc atggtcagtg acaaatcagc catcaaagag gttgtaatat    113520
     tccgtcaaac ttatcattcg acctatcatt ttggaatttt tgctcagtaa taggtgagca    113580
     actctcattg aacacttaat atttttcaat cactcttcct actttgggac gtttgttgta    113640
     ggatctcaac aagctattga aacccctaat aacctttttc ggtcattctt atcctcctcc    113700
     taaggaggat agtcttaact tgccctagtt agattcggct aaatcaggct aattttccca    113760
     ggagatatat ctttacatct ccctagcgtc tactagttgt gtatcttagt atcgaaattc    113820
     gctgaatgct tgatcgatca agcgtttcag tgtatttaaa gtctagttca ttagttctgg    113880
     aggtgacaaa gaagaaaaag cccctttaaa cgacaaaccc ccaacttggc aggaggggag    113940
     agtcgtaaac atatattttg cggtagggcg ggaacctaag cttcttggca ggggcattgg    114000
     ttacctgggt tttaccgtgc ttagatttta gaacacattt gcggaaaaat gcaaccgtgt    114060
     acttaaacct ttgctacggc tcccttccgc tacacaaata gggagtatgc cgtgaacgcg    114120
     gaaccagttt tttatggtca tgagaacaaa tctcgtgtac ctcatcgcag aactcatgac    114180
     ccattacccg cagatcctgt gggtcaacga ttagctcttt tatttcccaa tggttgggac    114240
     tggatctttg cttcagcacc agatccaggt aatcctgttg attgggaaac agtgaagaaa    114300
     tttcccctct cccccgtgga gatgtggagc caccaccaag acccagactg cctgatcgga    114360
     gttaggccga gtgcccaaac ccggtggctc gtcctcgata tcgacaagga ctctcgctat    114420
     cacccttcga gtgatcccga gtggcttcca aagatccgac atgccctgga agacatcggt    114480
     atctgccgct cactcctttg ccaaagcagc cacagtgggg ggcttcacct ctacctgcct    114540
     ctccccgaat ccgtcagcag tttttggctg agtgtgtgta tcaagctcaa cctggaagct    114600
     gaaggcatca agttctatgg aggccaatgc gagctttacc ccaaccccaa aaggtatgtg    114660
     cccaaaggta agggctacag tctctttgcg gcattccgtc tccctatgca gccgggtagt    114720
     ggttttcatc cccttgacgc tgatctaaat ccgctcccct ggtctctgga aacttggcta    114780
     gaggctttcg agctatgtgc cgatggccag gacatggggc gcttgagtca tgcgatcgca    114840
     gacgcgcagc agaacttcaa agtccgaaaa tccggtaacg cctcctccct cgccacctgg    114900
     caggaaagaa tccatgaaga aaaacagcaa ggctggacag gcccctgcca aaccaacgag    114960
     aagctgaaga tcatcgcctg cgaagcccgc gtatttttgg gaatggatag cccagagcag    115020
     atcgcagaat atgtttgcca aactgctcag aacaccccag gctttaacga acattgtcgc    115080
     catcagcatg aaatcgagcg ccgtagctat gaggtggcaa cctgggccat gcgctactac    115140
     tggcccgctg gttcagcccc cacccgagac gccaaatacc acgataagca agttgccccc    115200
     gccgatttcg gctaccacca atccaagcgt gaagccgccc agaaccggat caaacaagcc    115260
     gttctagaac tcaaacgagt cgataaactt ccccctggta tcgcagctcg tgccagtgcg    115320
     atcgcaaaac tagctcacac cagccagaaa accttatacc gcaagtcaaa cctagaactc    115380
     tggcaccctc atcatttacc cccagaaccc cctcagaaag ccccagaagc cttacagaaa    115440
     gggactatta cacaactagg gtcaaacaat actcaccttt taaaccagcg aaagctggaa    115500
     ctactgttat tccgttcctt tttacaactc tatatttatg tagggtttgt aatccaaacg    115560
     attagaatcc aagccgccgt cgccctggcc cctaaaggcc aaagggcggc gaaagcggcg    115620
     cttgagagtt ctgaagatct agatcggggg ggtctggggg ggaactccaa ggttattccc    115680
     atccaaaatt gggatcagct gcacttatcc ctacctccgg gcctgcagca gaaaatctct    115740
     aacgctaagc gacaacaaaa gcgagagctt gagctggaac aacgccgacg tcaacggctg    115800
     aaagcaagaa agtcacagcg aaaggcgcat agtgaagcaa acacagaatt gcggccgcaa    115860
     caagaacagc ttccccttca cttagttact accggtgatc agccgataga acgacaggcg    115920
     cgactcagtg aacgagaaga gttcgaccgt tggtatcggc tggctcaaca gtgcaaactg    115980
     gtcgcagact actcttggag ggacggagag tattgggtac tagccgaaga acaatggcag    116040
     ccttattcgg agttatcagc ggtatttaca ctacgggcaa tggaaaggat gtttggagtt    116100
     tcttttgatt ttggagacgg tagggatgat taaaaaaacg atttttatcc tgaaagatga    116160
     agaatccttt gtgaaggatt ttgattttaa gcaacagcaa ctgatgctga cgaaagaggt    116220
     gtctgacgcg tattgtttca acttgattga ggcgactgaa gttgttcgtt gtctgggatg    116280
     gctagcgtct gaaaggcttg ttattaagcc ctttaaagga aaatttgccc ctggtcagat    116340
     tatactgact cgttcaatgt aaacgactgt aacagctagc tttgacgtat ttccctcgtt    116400
     ggcgctagag tactcccaag tgaatcaagt tttggtttcc aagacccaat tgatttaatt    116460
     ttgttttctc acttttctca ataaaaaaac ggcaaaggta tatcctttgc tagctctgtt    116520
     tacagttttt tttaagcagt atttcgcctg aagatacctg ccttcattcc gttcgtcaga    116580
     ccccatctag attaaaaaga caaccacggt ctgccaagtt ccagcgagtc agaccgtgat    116640
     ctactccctg tagaggagat gatttcatgc taactgttaa ttcttcacag gtcactactg    116700
     aacctgtcga agataggcaa caaccacaga tttctaaagc aacacctgaa ctcgttaaag    116760
     aggtttatca gcaacaatat cgagagactt acgctgagtt ggctatcaca gttcaacaat    116820
     cccttggctt ccccgtgttg ggaacctttg aggcgttgtt tcaactggga tgtcgcgaac    116880
     ctgaaaaaag caagttgata gatcaggggg ttgctgagca tcctctgttg aaggactggc    116940
     caatgggcca agaggactgc attggcctaa tttcgcaggg gccgtatgtt caatcccaac    117000
     tcaactatca tggcgtcgcc gttggagaca tgatgcagta cgtctacgag ttgtttaggg    117060
     acaggactgt tgaatttgca gaggtctcta acgcttaggt ttagcgttga acactggttc    117120
     tttttagttt ttttatcgct gttaacgagg tcaatatgca acctctttcg catcctattg    117180
     ggcgaagact gtctttcaat ctctcaatta aaacgattct tgcggtgatc tttgggttag    117240
     gtcttggact gcccattggt tacttcgcca tcctctcctt tttgcaaccc acttctccaa    117300
     gcacaggcca gaatgccatt gaaaatgctg gtgttgagct tggaaaaggt gttcgtccat    117360
     tgactcccta actcacgtat tggagaaacc gtatgtcttc cctagctccc tatgtactgt    117420
     ggcctcacgg tcgtgctcgt catgctcgac agcattacct taaacggtac tttcaccgct    117480
     atacccacca cctgactttt gtgctgacct tcttgggtgt actccttctc aatgctcagt    117540
     cagccctatc tcagaatcca gggcagactc ttgggcaagg tgccaggaat actggcactc    117600
     gttctggagc tgctagctcg tcttgcttag gctggatgtg tggtcctaaa agtgccatcg    117660
     cagcaagccc ccatttcaat gattcaggat cactggtcga tctggcgttt ctacttctac    117720
     aaattgtcgt gatcatgatt gttgttgtcc ccgtggtcat tggagcttgg aaagcctccc    117780
     gccatgagga gtacgggggc tttattgcct ttgccttcgt ggtgtttgtc ggtctgattt    117840
     tctctaatgc cctcgctggc tacgtgatgg gcacgggcaa tttagcctaa aggatgaggg    117900
     gttatgagcg ataacacgat tcaatacact ccctcactgg ataaagcccc agatcggttt    117960
     tttattccgg gacaatttct gattccctgg atagccatta tcacgggtgt agctgtttta    118020
     tacctactgg tggctagcgt aaccccagta agtccctggc cctttggctt attgctagtg    118080
     gttctgattg cgtctcactg gatcattgtg ggggataaac cctggaaatt tggggggagt    118140
     ttacatcgac ccaaggaata tgtgacagct cacgctgaat ataagaccac ctcgacgagt    118200
     ctcaagccca agattggccc caaagtcgtc gggggtgccc gcaagcgaaa agcttttccc    118260
     attgaagatg aagttgatct tgcttgtatg gcgattattc gccttcaggg ttatgtcgtg    118320
     ggtgcttacc tgctgcaagt ggggcggcgt tttcgctttg tgtgggtgtt tgatagtcct    118380
     gggttgtcca gcaccttatc cgtggaccaa gcgaaagctg cggcccagaa gttggaagaa    118440
     ggcttgatgg atctccccca cgcagagcaa atgaccctgc atatggggac aatggccgac    118500
     tgccaggaac gactcaacca gcttgaagat ctcaaacgcc gcgccccatc ggatcaattc    118560
     cgatttttgt tgtcttggtt aaaagagcga gtcaaatccc tgacccgacg gggacaatat    118620
     aaccctaaat tcctgcggtt ctacgtcacc tataccgtgg gtgtgggtat gagtcagcaa    118680
     gatgaccaaa tccaagcggt cgcccaaagc ctgcaagaga tgtggcaaga gcatatggga    118740
     agtgggggca gcaacatcta tgcccgtacc gagcaaatgc tcttagatgc cttccgccac    118800
     ggatttttac ccaccctcga tttctttgag aaagtggggc ttaaagtcac ccccatgacg    118860
     gcagatcaga tctgggcctt cagttatcag cgggtcaata gcggtaaagt tccccccatt    118920
     ccccaatggg tacagctgga tgaaaacggg ataacttggg gcaaaaaatc agagctacgg    118980
     attgctagcg tcctgtttgg gcaaggcatc tttatggata agcgattcgt ccatctaccg    119040
     ggacggaatc tctactgtgg gggtgtggtt ctcaacaagc gcccagcccg agagtatgac    119100
     cctgatactg gtcgtctcca acagcttatg gatgcgtcct ctcccattaa cgccaagaaa    119160
     gtcagcaata ctgaactgat tgtcgaattc accccagata accagcagga tgttctcaag    119220
     tccagtcaga aacggacggg acagagcaac ctctccttgg tcatgtctca gaaccgcaag    119280
     aagttggacg gtggagccat tcataacacc aatactgatc tggctgctga gatgaagttg    119340
     cgccaagggg cgagagtggt tcgctgtgct tggatggcgt tgatctaccg ctccacccca    119400
     gatgcgttag atgttgccct caaacggttt cgcacgaacc aatccctgtt tgcgggggaa    119460
     tgtctcgtgc gggaacgagg ctactttgat caactgtggc tggaggctca accctatacc    119520
     tggcgtaccc ttttggcggg gggagggtta ctcaaaatat cctccttcga gcgccgcatc    119580
     cgggaaacga caccagcggt gttgggcata acccccgtga tgctagatcg ccgtcctcac    119640
     aaaaaaggcg tagagctgct cacggataat ggcactcccc tttatgtgga tccgttggca    119700
     tccgaaccca agcataacca catgatcatc ctggggggta cgggatctgg gaagtcattt    119760
     gccgtctcgg cttgctgtga gcaggtctta gccgaagggg ggcaagttct gattattgat    119820
     gccacccgtg gggatggatc tggcacctac gatgaactga cgacgttttt gggcggtgcc    119880
     tatttcaata ccacaacgga ttccttcaat ctcattgagg ggacggattt tcgacagttg    119940
     ctaggtaatc aggacgccta taaatcggcc caacagactt ttcgccaatt cgtccaaacg    120000
     gccttgatgg atctgtgtct gccagaggat gtcaacagcg agaagcgaga atccgtcagt    120060
     cgggcactca cctttttgct ggataacttt tttaaagaac ccagcatctt gacccggtat    120120
     aaccgagcct ttgatgcagg aatgggaacc cccgcttggg agcaaatccc tacactgacg    120180
     acgctgacgg aatatattga cccatcgaat gtaccgccag aagtcctgac tcaggacatt    120240
     attgccgcga tagacaccct caaggtctcc ctctccgctt tactaagacg accgattggg    120300
     gcgattatct ctcgacccac caccttcaac acggatgcca atctcgtcgt ctatgccttg    120360
     ggcaatatcg ataatgacga agatatggca ccgctggccc tcgctgctca agcgagtgtc    120420
     ctcagtcgtt ccctgggtca gaagcctacc ttgctcgtgg gggaagaagg ctccaagctc    120480
     cataaattta aatcctatcg gcagatgctg gggagttttt atagtatcgg tcgtaagaac    120540
     gggatttgga ctatttgggt gggaacggat ctgcaggtct tggcgaaggc tgataatgcg    120600
     gctgaaatcc tagccaacgt gggcacctat cttgttgggg ccattaacga agaggaagta    120660
     cctctgctcg tcaaactggg tattccccgc gaactgctca ttcaaaacgt cgatgaagag    120720
     ttcataccct cccggaaaga tgcctgtagc aaatggctga ttagcagtaa cggcaaccac    120780
     cagtttggcc gatatcatcc cagctttgcc aactttgggc tgaccatgaa tggtcctgat    120840
     gaagtgcccg tcaaagcatc ttacaaagcc caatgcccac atgaacctta ccgatgggtc    120900
     tcagaactgg cccatcatct taagtcccaa agccacgatg ccaaccatta gcgaggaatc    120960
     cgatgtcacc tcataaatcc atcatttgtt ccgttctcct actcagcgta ttaagcccgc    121020
     tctctgtcta tgccaatcct cagccagggg atagtcctta caacgtcagt gatgtcttta    121080
     ccccatctgg agatcaaccc aagtccaaag gggggctgct cggcaagcta gcaaaggtct    121140
     ctaatagcaa ggagttcaag tccgtccaag atattgccaa gtatgtcaat ttaggggcgg    121200
     gacttctacg gacgacgggc ctcaatgtta cgccctacct caattatccc aatatcctgc    121260
     tggggttgct gagtctccag caaaagccag attcagacct ccaaaaccct gaagcgatag    121320
     ctgagtctca aagtctctta gaagttttag gggcagcggg tctcccagat cctgagaaag    121380
     ccaagattgt cttctctgat tatgaccttg atgctgaagc ggattctgag aataatatct    121440
     ttggtgtgcc ccccgccctc cagaagcgga tcagcaataa cctctctcag attaaggcag    121500
     gtcaggctga attaaatttg ctgctgggta gcaagggcca ggagctaatt aaaagtgcga    121560
     gaagtagtat tgctcaggcg gttgcgagtt cagcgtcgat tgcagatcag gctgaacaag    121620
     ccacttcaag tcaagatgtc ctcaagcttg ctagaaggca agaagctgag acggcaaaga    121680
     ttggtcaggc aacctatgaa gaagccgtgc aaacccgtgc cgcgatttat cagggcaata    121740
     agcagttgta caacttggct gaaattgctc aggagcggaa aaaagctgag caaatcgaaa    121800
     gaagctttgt caattcaggg caaatggggg agatggggcg attggcgggg ctagtcggtc    121860
     ctgcgactcc caatcggcct acccgaaata accgttcagt tcctcaatcc caactaccaa    121920
     gacttccccg tctacccggt aacccagttc ccccggcaac cccgtcgtcc cccagaaccc    121980
     caccttttcg accatgaatc acctgttcac actactgcca gaagtcatgg gcaggttaga    122040
     ggtcagccaa tctctaaacc tcgcgattga tgacctctgg cagcaaaccc ctttctcatt    122100
     ctggtttttg actgctaccc atgtcagtgc tttgattgca gccatcctct ttagtacagg    122160
     ttgtatgcgt tggattaagc gctctacccg gtctctcttt cccccattgt catgaacatt    122220
     ctgattgccc aagcacggga agaccaagcc tcccgcatcc tagaaaacac actggaaagt    122280
     agtgccaccc ttcggactgc tattgatacg acctggcagc aaaccatcaa aggtccgcta    122340
     tttgtggctt taggggatgt gggagccatt attgccgttg tctttattgg cttttggttt    122400
     attagttggg tcaagattct cgtcagtgat gatgcaattg ttggtcccca tgccttgcag    122460
     gaactgattg taccgatctt gctcctgttc ttattgggaa atcccaccaa tcgcggcaac    122520
     ctcctgggtg agacgattct gaactccaac aaagtgatgc agaatatctc ggattatgtg    122580
     attgtatcgc tgcgccaaga tatcaaggac tttaaccccg tccatgaagc tgccgtacag    122640
     atgtccgcta ctcgcatata ccgcagggct accaaagact gcctaaaata cgaatttggg    122700
     gataaaaatc gtcgggcctg cttattagat gcggaccaaa aaatctttga cttgttgtat    122760
     ccttaccgga ctcgttcctg gtatcgagag tttcgagagc aggtcaaaat tccagtgcaa    122820
     ctgttatcca cggggatacc ggatattggt gaaattagag gccaagatcc acgggaagtt    122880
     agtcacttct tgacgggact atcggatgtg gtgtcggatg ccgtgacatc cattctgttc    122940
     gggatggggg tggccttcgt tattgcgatt gaacatgcca agctgctgac ggccttagtt    123000
     gcccccgtct ttttaggcgc gtccatcttg cccgttcctg gtaagccgat tacttggtgg    123060
     ggaacgacct actcaggact gggactattg gaaatcctgt acaagaccct agtggggtta    123120
     ggatcccttt ctattctgaa tgcgggacct acggacccct tgattttccc cttagtgatt    123180
     tccttatttg gcatcttcat tgccattttg ctggcaggtg gcggaggaat cgccttattt    123240
     agtggcattg cccgtatggg caccgcaggc ttaccccgga ggtactgatg actttctttg    123300
     atcggctgga acgccgcagc ataaacctac agcccatttt gacactgtta aacacaggta    123360
     tctgtggtgc ccttctcctc gtgattgtgg gccagggctt caatatcaat ggtcttcgtc    123420
     gccaggtgga gacactggag gcccgcccgg ttgtggtgca agcgggtcag aaccaggaat    123480
     tggtgaacgt ggaagccgta gacccccgga acaacatgcg gaacttcgtt gaagagtccc    123540
     ttcctctatt gttcttgctg tcgaagcgcg tcccggaaga aattattccc ggtgggctgg    123600
     atgaggggat tgacctccat gacattggcc gaattccgag tatcgtccat gcctcatcat    123660
     tcattcttag cagtgagtat cagcctacct tcctggcggg aatacccaat ttgatgccag    123720
     aagattatga acatggcgga tctaaagttc ttcgggtgaa tcgtaccgca acccccaagc    123780
     ctgtcaaaga tgaacccgga cattggcgga tctacaccca agcgaccctg tatcagtttg    123840
     atgcccaaca gaagcccgtg caggcccgca cctttaatcg tgatgtttat gtgcggcccg    123900
     tgtctccccc caaatcatcc gccaccctga cccctgtgca ggctctgatc aatgccactc    123960
     gtaatcgagg ctatgaaatc tacgacattg ctgttaaccc cacggaggta gctcgtcatg    124020
     cccaatgaag gaaccacgac tgttgttgag ccagtcgttg cagatactgc tggagaacat    124080
     aacctggaag cagatgtagg ggcaacgcca aaggatgctg ccacccctga agcggcatta    124140
     gaaccccatt ggcaagccta tattgatgcc gccccatcct ccctcaatac ttcagatgag    124200
     gttggggccg aacaaggaga tgaaggtgga gacgagaccc ctgaagatga ggacgccccc    124260
     cagctccaga tggataccta tggtacggag gccgtcacgg acccttacac cattaagacc    124320
     acctataact ttgtgaactc tccctataca agggtggcga tcatcgtggg ggggctgagt    124380
     ttggggattt tcttcctatt tggcctgtac aaagtctttg ttaccgctcg gtcacaaccc    124440
     ccagaaaacc ctatcctcag tgatgcctat gcagaatacc cccaagatta cggacctgaa    124500
     ggctccccac gggaacagga gctggaaaac cagctggacg actcgcaaca acggaatacc    124560
     tacacagacc agttagatga ggttacgacc tttaatcaac aggcccaaac cccgcaaaaa    124620
     ccaccaacac ccacagttac tcaaagacct gctgctccat ccccgcgttt agtggcagcg    124680
     agatccccca tccccttgcg gcccttagcc gtacccccaa cgccacaacc ccagccccag    124740
     gttgcccgac ccaccgctgt atcgacgact cggccagaac cggaggctga tccagtggct    124800
     caatttggca gcgttgaaaa cgtgggcttc tatggtgccc ccgcatcaga gtcctataca    124860
     cccgttgcta cagcaccgga tcctgcacct ccctcaaaca ccacggcgac ggctcaacct    124920
     caattcccca ttgaagtggc ccaggccagc cccacccagt ccttaatccc atctccttca    124980
     gctcctccct cccctccggt ggacggatac caaccaccca ctgagggaac ttcccaaccc    125040
     ctaacggaag gaacaaccat ttctctactg tctccccaac cgcctgcttc ccccgtggga    125100
     acaggctcac cccctcagac ctatcctgcg cctagtacgg gaacccacct tcgtgcccag    125160
     cttcccacca ccgcaatctc atcccctgct cagggcgtac ccccttcgcc ctcggctcct    125220
     gctccctcag cagatagccg catcttgacg atggactcta aaggcaaagc caagcttaaa    125280
     agagctgttg cttggcggcc caatagccct gacgttctca atggtcaaag ctactcccta    125340
     gaactgacga agacattcaa gaacaccgca ggggttgaga ttttccctaa aggctcccag    125400
     gccattgctc gggtcacaga ggccactcgt gacggactcg tgatgatgga agtcacggcc    125460
     attaaaaccc agaaccggac cattcccatc cccagtggtg caatggaagt gcagaccaaa    125520
     gatacgaatt tcttggaagc caagctagag caaaaaggtg gaaccagctt cggcaaccgt    125580
     ctcctgaatg gcctctttcg catgggtgcc caaggtattg ccaactcaac ctccctgatc    125640
     aatcgccccc taagccagtc ctccttttcc agctcaaatg gcaccgtcgt cacccagcag    125700
     aatccagaag cagatctgat tgcaggcttt gcagaagggg ccacctctga actatcggag    125760
     attgtcaaag attctgcccc aaatcaggat gctgtcgtta gcagcttcta caagctcagc    125820
     aagggcaagt cccttgatct gtatgttctt cgagatattt ccatcaatta aggccaacat    125880
     tatgcgttta ccccctcgtc tccttggccc cctcgtgggc ttgagcttca ccctcgtgag    125940
     tacgccttcc gtccaagcaa aacccgtgaa caccaaagat accgtccaaa tcccttcaga    126000
     ctggctgaac agccgagtct atgagggctt aaaagtcgat ccttcgggag tgatcatcac    126060
     cttacgcacg ggggaaaaag tgggagggct gaccatcctg ccttggcagc atgtggatgt    126120
     caaacccctc aatggtcagc tttgtgcggg gggtggtcaa tgtaatggca cggccccaac    126180
     catcattcag ctttttcgca aatcccccca acgggtgaag ggcttagtct ataacgctga    126240
     tggcacctcc ttgatgacca tcacgaccaa tgccgggaat acctaccagt ttcggctaga    126300
     acccacctca gcagccccca agcgcaagat caatatcaat ccccagtgaa ccgatgaaac    126360
     gtcctctcac ccttctgatc gcagcgggcc tggtggttag cccctggtcc ctgcccgtaa    126420
     acgctcagat tgtccgtccc gccaaccgtc cgacttctcg gcagcaggcg gtgaaccaat    126480
     ccaggcccac cacaccccaa tcgacgacct cacccggatt gatttactcc ccgtctggtg    126540
     aacgggcacc cagcttctct cagatgtctg gggccacggc acctggacag attgagcttc    126600
     ctgcccatgt gcagatggac tatcaattta gtcgggcgtt cccgcgaggc gctaccccgg    126660
     accaaatgac caaatggggc gatatcccca ataatcccca gtttgtcggg ttccataaaa    126720
     tgaccctccg agagttaagc cgctcctctg gccaagacat cgctggcgtt cctctgaatg    126780
     agattgattt gatacagggg atgaccgtgg aagaggttac gcaactctat cacggcttgg    126840
     aagataagcc cttggatcaa gcccccaaaa tcctccaaat tgccgctgga atcaccaatg    126900
     accccaaagg caccctgaag cagtccaaag gggcagcgct cacctttggt caaaaagcgt    126960
     tgatcgcgga actcgccaag aaacccgctc taaaagggat tagcctagag cgtttgtcta    127020
     aaggggattg gggcaatatc ctcacccctg gtgaacaggg tgaagttgcc aagattctca    127080
     cgaaagtcaa tggcaagatt cccttagaga agctattccc catgacccaa ggggtgatcg    127140
     tgggggattg ggagagcgtg cggaaacagg cccaggccga agccactcgc caaggttcca    127200
     aggtactcgt caaggagctg atgaagaatg agaagttccg caaaatgccc ttgggttcct    127260
     tgaccctaga agaattggac ctggaagaaa ccttgccagg gttgattgat cagcccatcg    127320
     ccacgatccc caagattgcc gataagtatc tgtccgacat tcccggcatg tctgaggtgc    127380
     ccgtcgatca tctgcccttt gacctgaagt ttacccccag caaagacgat gttattgccc    127440
     ggatggatgt cgcctatgcg gggccaacgg aaacccccat tacccgtgtg atttcgggcg    127500
     gtacaaaaaa ccagaagttt aagcctgaac cgtgcctaca gcagcgctgc tcccatttcg    127560
     agctagacaa tgtggatggg ggtggtccgc cctcgaaagt atcggggaaa gcctgggtgg    127620
     cgggcaaaga ccaacctaca ccgggcggta aaggctttct cgccctcgtc aataacggca    127680
     aagaacctgc ggggattgtc ccttggacca ccgctgccca tgtcaaaatc agcctagaga    127740
     atatcaagga agggggtaac ggagaaccgg cttccgctca gctctgggca catttccagt    127800
     tctgcaaaaa ggtgccgctg ttgggattgc agtgtacgcc ccactttatc ccctttccca    127860
     ccccgtttaa gttaaaagaa aaatcattga tgctgattgc cactagtggg gggctacctg    127920
     catatctgca gaatgcccgc aatcagcaga acttctgtac cccagccgtg gcgaatgcac    127980
     tccaggcgaa tgcatcccaa ggcagtgcca gcgatactgc cgctgtatcc agtccctccc    128040
     cagatcaaca catcgcccca gccacctcca accaggcgga ccagaacctg agacagtacc    128100
     taaaacggat tgcggcggga gagagtacgg ggggaacgga ttggcgtcag catcctgata    128160
     cgggggcata cggcgtctat caatttactc cagaatcccg cgctaccatg ctgcgacgca    128220
     cggggataga tccctggtcg aaggatcggg cgacggcgga taaagccgct gtgttctgga    128280
     ttcagatgat tggcggagag caaggggtgg accttctcgg caccatccaa aaaggggact    128340
     ttgccaaggc ggatcagatc ctcagcccca agcagttcac ctctcttccc ggtggtccag    128400
     agcaaagcaa aatttggaat aatcctcaga acctgcaagt gtatggtccc aacgggagtg    128460
     cccctgatgg cgcacccacg ggggcaacgg ggtttggtcc ctgtgcctcg acgagtgggt    128520
     tcattggccc agaaggggat ggcattgcca cgggccgact gaaaaaccca acacctgggg    128580
     ccgttatcac tagtggctat ggaccccgag taccccccgc ccctggagcc tcatcctttc    128640
     atgcagcggt ggatctagcg ttacccttgg gtgcgcctat tctcgccgct gatggtggag    128700
     tcgttgaata ttcaggggtg aaaggagggt atgggaacta cattttaatc aatcatggca    128760
     atggtttagc gacctggtac gcccataaca acgccaataa cgtccgggtc ggccaaaagg    128820
     tcaccgcagg ccagcaaatc ggcacggtgg ggtctacagg aatcagtacg ggaccccacc    128880
     ttgactttgg ggtggtggat ggctacaaag ctggaaacct ttactcaggt caagccgtta    128940
     accctcgtaa acacgttcgt ttttaggaat ttaacgatga aaaaattgct tactacctta    129000
     ctgattcttt ctgctgttgc ccttccgagc caagtgctag ctcagaacag cagcattgat    129060
     gcctcctgca ttcctgagac gggatctcgc atccccgtgg aaaaggccgt tatttatgcc    129120
     acgaccaccc aggatgccac cacctatcac tatgttgttc tccaccctaa agacctgtct    129180
     cagtctctcg gtgtggtgtt agtcgaggta acagggggcc aatgcaaagg ccatttggtt    129240
     gattttgcgg ggaatacctt gccctttgag cagtttgtcc ccgcccccgt cgctaaagaa    129300
     ttggtggatc aagccacacg caattggaac aaccgccaaa ccagccctta gtagtgccac    129360
     cgccattttg ttagagtcct atctcgattg gtaaggttat gcatcctcct atcgcacaaa    129420
     tccagacctc acaaaccgag tctaccccca cccaccccca tccaccgcag cctagtactc    129480
     cgtttggggg aatcaacccc caacttttgc tgatgggggg atgcatggca ttactgttgg    129540
     tccccatgct gtttcaaaag tactccggcc aacggaaagg catccttgcc cgtgcccggt    129600
     tcgccacggc ccgtgagatc catcagtcta aaatctatgc ccgcaagctg attcagcaga    129660
     acaagcacaa taaggtggcc ctgtggattc aagaacccaa gggtattatt atcaatcacc    129720
     agaaacggca gattgagatt cccccagaca acaactcctt ttacgtcagc catttagaag    129780
     agcattccct gatcctcggc aatacggggt ctggtaagag ctattccgtt ctcgatccat    129840
     tcaagcgatc cgtgatcaag cgggggcaac cgctgtttga ctatgactac aaaggccatg    129900
     aagaatcccc ccatagcctc gcccctagtt ccagtattgc ggggtatgcc ctggatcatg    129960
     gctataaggt ctatgtggtg gcccctggct ttccagatac cgataaattc aacatcctcg    130020
     atgtcttgaa acatccccag gatggggcca atgcctttca actgtccaac gtcctcaatg    130080
     agaacttcaa gctctcagct agtgaccaag gggctgattt cttcagctta gcgggcaacc    130140
     agctaatcca agccctattt atgctcgtca aagggtcaga agtctgcgca gatattgccc    130200
     tagcccataa gatcctcgcc cttcccaact tttccaagcg aattgccgag gtgcagcttc    130260
     ctcagtatca aaaagtggcc tttgataact atctggcgtc tgcggattcc cccgaaaccg    130320
     cagcctctat cgctacgacg gcctcgatca tgttctctcg atttatgatt ccagaggtgc    130380
     tgtctacctt ctgtggtcag agcacgatgc ccctggagat tacggggcga acgatggtga    130440
     tcttccgact caatccccag attgagtttg cggtggctcc ccttttggcc tcgatcatct    130500
     atctgatgat taaccgcaat atctacatgg cccgaaaaga tcccgtccat ttcttcttgg    130560
     atgaggtgca aaccctcaaa gtccccagcc tgtctaaggt cttacaggtg gcccgttcag    130620
     cggggggctg cttctacctg ggcacccaag gcatagacct actggagagt acctatgggg    130680
     tgaaagaaac ggaaaatatt ctcacgggtt gtaagaccgt gtttgtgggc cagctcagtc    130740
     acaacggcac cgctgaatat tacagcaagt attttggcat ggaggatatc tcctacaaga    130800
     ataagtcaag aagccacggg aaaggaggca ctaaccgctc cgagggagac cagcagaaca    130860
     cccgtcccct cgtggaaatc caacaattgc tggagttacc ccaaggccaa ttctattgcc    130920
     gcaatcgggg tatcggtaat aaaaaagccg tccgtatacc cgtccaccat cagaccgtta    130980
     ttcccccttg ggagctgagg gatatggaca aaggaaagca aacctggaag aaataccgga    131040
     agctacggat caaacaatcc aagattcaac ccctgacgga ccaggatcta gaaacccgcg    131100
     aaagcgttgc ccgctccctg gtgccagatc atgccaatgt cgctgcgggt caacaagccg    131160
     ccgtgaggta ctaagttcat gaaaatcacc tgtcctatct gtaaatggcc actctacctc    131220
     cccgagcagc cccaagaagg ggaggaaatg ggttgccgtc attgccactc ttcctttgcc    131280
     atgactcaca cccatgtggt ggagagttgg gccgtgacga cccagcatca aatcccgtct    131340
     gcttatctcg ccattctatt tataagggaa ggaaaaaccc atcgcgtcca attggaccga    131400
     gatatcccac cgggattaaa ctgcatcgcc ttgactcccc tccacggttt gggtaaacac    131460
     caacccatcc tgctgttgga cctgcaaacc gctggggtct atccattgac tcatcctcgg    131520
     cggctgtccc gccgttacca gctccaaggg gcactgctga tcgcggctat agccgcaggg    131580
     ataggcatgg agttaaatct cccccaaaac gtgacgacag gagctggaat taccagcagc    131640
     ttggcgggtg cctatgggat tgcgcgattc aatcatggga gggaacggga tccgaaacga    131700
     cggacccagt tgttacgctc tcaaagcctg ctcaagcaga gccaccaact cggcgaacgg    131760
     gtgcgggaac tggagcgaga attgtcccag tcccagacct tgagccagca gttgcaggag    131820
     ctgtccaatc ggcccaccgt cgtcggccag agtaaagaga caattttgca gagaggtcat    131880
     aaggtcattg agggcaaaaa tgccgtcctg caacgactga ttgactgttg ccgcaacagc    131940
     aaggatttga ttgatgtgga gctgatggct gctcagttga gtgagcagtt accggacggc    132000
     atcgatcagc agcttttagc ctaccaaagt gaaattgaga agctggaaga agagtacgaa    132060
     gggatgcttc tcacgaccgt ttagtgaaca taaggagaca ttgtaaatgc ctaaattatt    132120
     tacacctgaa aagattgagg tgatttccca gttacgtcca gagattcagc agctacggga    132180
     gcgttacccc tttacctttg cagagtatgc agagaccatc ttagctgggc aaactgaccc    132240
     ctttccccct ggtcatcagt ttgagcagtt tgccgtctac tacggggata cggcccgtcg    132300
     ccctggttat ctgtttatgg atggtaaagc cacgattgat ttcgtggaac ccatagatac    132360
     gggagtcatc caagccaggg gcaattggga ttgggtctat ttccaggtag agggctatgt    132420
     gctgctcaac cggattgaac aggccgcact ccctcagatg cccaccctgg acgaattagc    132480
     caatatggta gccgctgcaa cggaatgaat ttacaacgac cactattgag catctttgct    132540
     tgatagcacc tgaactattc aaacaaattc aaatagtaag aagaggacat ggatcatgcc    132600
     catccatcaa gctgcccaaa atcagaccca tgaagtccaa gaagcgaatg cacgggccgt    132660
     tgaagggtcc gcccgcatga ttgctgaagc gatgcggatg agttttcgac tgatgcggat    132720
     ggctcagcgc aatgctcaac aactttctca gcaatatggt tctggggcga gtgacagcga    132780
     taccccggac cctgatactc ctgacttaga tgaggatatc gaactcaatc cacgggagga    132840
     gaacgaactg agtcaagaag ctgatatcca gctcaaccca gaacaagaca tcaccatcaa    132900
     agtgggtaag accaccgtct atcccatccc agaagatacc caactagaac aagcggatgt    132960
     agacaatctg atcgcggccc tggagaaccc agagcagttg caggaagagg ttactgtatt    133020
     tgcgacccag accttaccgg atgggagtaa gtcgaatgaa aacgtcttcc atgcagtacc    133080
     aggggaggtg aaatatgacc cccataaact ggtggaagcc tttgcccagc agaaggttga    133140
     acagcaggat gaaaccctta gtcaagacca ggaacccgct cagattgtga ttgaagggga    133200
     gacccggcca atgagctggg atacgcccgt ggtgaatcaa gcagcggctc ctattattga    133260
     gaacatcaag aataaggtga ctcaaggggc tgaggcgatt aaagatagag cggctaatgc    133320
     ccttgagcgc cagaatttac tcaatatggc gtttaaggga ggtaccgtcg cgagagctgc    133380
     ctatgaccag gcggctcaaa tacctggacg agcagaaaag ttaaaggagg tggttgctca    133440
     ggttaaagag aagacaggac aagccattgc ggaagtgcgg gagaaggcta aagacctaga    133500
     tccaaagcaa ctcattcagg gtaaagaccc cgtgcaaggt ccagagctgc ccagcttgga    133560
     tgaccggatt tccactcttc aatctcaagt gggggatctc caatggcaaa tgaatgattt    133620
     gcaagaccag ttaaagtctg tggatgccaa gctggatgtg attgtcaacc gcaccaatcc    133680
     acctgagcaa agcaacaatg tcgataaatg gcacaacaat ttaggcggaa tggtcaagga    133740
     gaagctacag caaatcaagg aaaaaatcac tacggccatt cagtccatca aagacaaaat    133800
     tagtgaggtg atcaacaact tcaaggcgac ggcttttgat aaagtcgagc aggcaaaaga    133860
     gaaagtcact gaggtcaagg acaatgtgac cagtcgggtt gataatacgg tgcaatccgt    133920
     gcgtcagggg attgcagata tccaagctgg tatgaccaat gccgccgttg ctaagctcgt    133980
     ccagcagtac ggccaagaac aacccgatgg cagccgcgtt tataacgggg atcggttctc    134040
     ctatcaaact cagggagata gcgtcactat ctctgcaaaa ggtcggggta atgttttcca    134100
     gaatggtcag ctcacggata aggccaatgt tcaggatgcc caggcaatcc aggcattacc    134160
     cgcgaaggtg gagcaggaat ttgctcacca gcaatctgag aaggctacag cgagtcaagc    134220
     agtgggggcg ggtggccgtc gtcgctaatc cagaacctgg atctttaatg ttgtgatggt    134280
     ttgcgtggct ggtcagggtt cattcccgcc gaccagctgc gcgatgaatc tctgaaatca    134340
     aaccttcaaa cttaggccga gggttagcgg ggagactgct gacctggctt tttataccca    134400
     tcctcacgtc aaaggagctg aaaaatgcaa actgcgatct taagagttgg agacgcaagc    134460
     ctcctggtga ccccggatgg taagccgctt ccccacaagg atgcagagca gccaaccttc    134520
     cacatcatgc ctaagctgtt taacacaggt gctgggattg ggctggagaa catcactctg    134580
     tatggtgccc atgttctagc ctttggcaag agtggagacg atgaaaagga ttacatcaat    134640
     gtcttgccca aagatgtcag actcaccaat ccttgtccga atatcagata tgtcattgca    134700
     ggtacggctg atcggaagat gggttgggac attcctttag accccagcaa gccccctcag    134760
     caacttcggt tgtggtggct cttagaaaca caaacggata gcaccatcat cgagcactat    134820
     atcgaccttg aatttgagct aacccaaagg gggaatgttt tctcaatggc atccctcaat    134880
     tttgctgttg gagaggggcc aagggcagtt agctttgtcg atcctgaaca ggcttgtgaa    134940
     ttttttacca ggaatgatcc tgcctatcaa attggatata agggcgcgga tctcatcatt    135000
     cgccaatcca acaagatcca gtcctgtgct tggtctgatc tggggttgga agagtttgag    135060
     gaaatggttc atctgagaga tatgacccca gttgataagc acttagctaa aattaattac    135120
     ataatcatcg ccgtaggttt tcaaaactct ttccacatat tcgaccaaag atgcccaccc    135180
     ccagtaggca ctcatttcaa tccactgata tttcatgaat tgccacagac gctcaatcaa    135240
     attgagatgg ggagaatagc ttggcaactc aaacaaggta attccccgtt cggcccactc    135300
     tgccttcatc tcatagattg attggctcgt atggataggg gcttgatcca ccacaatgac    135360
     ggtgggcaac tccacgtcag caaaaaaggt atcaatgcaa tgactgacaa cctcactggt    135420
     gatggtctgt tctgatgtat aagcatgtag cccttgtcgt cgactcaaaa accccagaac    135480
     attcaagcgt ttacttgaac gagtcggtat ttccagataa gtccctatgg gttgccatcc    135540
     atagggaata caggggacta acgaaaaacc actctcatcc ataaagaata gatggatgtc    135600
     tcccttctct tcctgttcct tgagatgttc taactgctgt ttttttcgag gtagtgggca    135660
     tataaaggct ggcctgatgt cccttggcga aagcgatgcc agcttatatt agacgacaat    135720
     cgagctgacg gattaatgac gatgtcacgt cggctatagc tatgaagaaa ccaggcatcc    135780
     cctgagaagg ataaaactag atctcaattc cctagaaatg atgtgtgaga tcgcgtttct    135840
     agaattcaat ctcaagaaaa aagacacttt ttacatccct aatcaataga gggctgtaca    135900
     agtgcctaac aaaagaattg attcctatca tactcgtgtt tatatgaacg gaagagacct    135960
     cggcttaaaa caagctgatg cagcttacat tgccgaaata tctacaagaa ccggacaacg    136020
     aattgaggcc ggcacccatc aacctaatcg cggccgcctt caggaccaac gcaccgttcc    136080
     cgacccctta gctgatgtgt gggaagacga gctagaacca atgctgcgtc gagacccacg    136140
     cctcaaaccc atgaccctgt atgagtacct gcaggataag tatccaggcc agtatcccca    136200
     agtcctgcgg accctacaac gtcgggtgag aacgtggaaa gccttacatg gaccaagccc    136260
     tgaagtgatg tttgaattgc gtcatgaacc aggggtacaa gggttctccg attttacaga    136320
     actcaaaggc atcacgatta ccattgccgg caaacccttt gagcacctga tttaccatta    136380
     ccgtctggga tacagcggct ggcgatatgc ccagatcatc gaaggaggcg aaagctttgt    136440
     cgccctctca gaaggattgc aaaatgcctt tgcagcctgt ggaggtgttc ctacacagca    136500
     tcgtactgat agtttgagtg cagcctatcg caacatgggc ggccgccggt ccaaaaacct    136560
     cactcgtctg tacgacgaac tgtgtgacca ctatcggcta gaacccactc gtaacaacaa    136620
     aggtgtagcc catgagaatg gctccattga atctccccat ggtcatctga agaaccgaat    136680
     taagcaggcg atctatctgc gcggcagtgc agattttacg agcgttgctg agtatcaagc    136740
     cttaattgat gcacaggttg ccaagttgaa tcagcagtgc caaaccaagt atgagcaaga    136800
     gaaagaccat ctacaaccac tgcccaaata tcgaacccct gactatgaag tgctcacggc    136860
     taaagtcagc aaacgcagca ccatcgatgt tcgctgcatt ctatacaccg tcccttctcg    136920
     actgattggt cgtcaattgg aactgcatct ataccatgac cggattgtcg gctatctgga    136980
     gcgacacccg gtggtggaat tgccgaggaa gcgcgtcagt ggcaaaggca aacgtcgcga    137040
     ccgttgcatc aactatcgcc atgttattgg ttcaatgcga ttgaagcctc gtgcttttat    137100
     ctattgcacc tggcaatcag acctacttcc caatcctgaa taccgccaaa tctgggaaca    137160
     gctcaaagcc caatttgacc tggagcaggc tgccaagatc atcgtggaag ccctgtatat    137220
     tgctgcggtt caagataaag aacaggccgt agcagtgtac ttacagcagc agcttcgctc    137280
     atccagcctt accctcaatc gcctgaaaaa acagtttgag ccgcctcaga tgaagcaggt    137340
     tcctgaactc agcattgaac aacattcact tgaactttat gacaaactcc tcccctcctg    137400
     ctcagtcccc gctgagcccc taccagcacc tgagcctcta tttaaaaaag ctcaggctct    137460
     cccacatgtt gacccattgg gaatctatcg aatcccaagc catgcaggaa aactggtctt    137520
     atgcggaatt cttactagcc ttgtgcgaaa cggaggccca acgaagagaa caagctcgtc    137580
     taaaacgtgc cctcaccgaa gccaggctcc caaacgcaaa aagttttacc aactttgact    137640
     ttagccattg tccccagctc aatccagctc ccttgatgca attagccgca gatccgggtt    137700
     ggttggagcg cgccgagaat tgccttattc tggggccctc gggtgttgga aaaacacatc    137760
     tggccactgg ggtgtccaaa aagatgctgg aattcggtaa gcgggtgaag ttctttgcag    137820
     ccaacgcatt ggtccagcaa ctgcaacagg cgaagctcca actgcagctg catccaatgc    137880
     tcaaaaaact ggaccgctat gatctgttga tcttggatga cttgggctat tgcaaaaagt    137940
     cggaagcgga aacgtccgtt ctgtttgaat taattgcgca tcgctatgaa cgaaaaagtt    138000
     tgttgattac agcgaatcaa cccttcagcc aatgggatga cattttcact gattcgatga    138060
     tggcggtggc tgccattgat cgcttaattc atcatggctt gattatcgaa attcaagccg    138120
     atagttatcg gcgcaaatca gcgactcaga gaacggctca aactcagtct caacctcaaa    138180
     aatcccagtc caaataatcg agcgatcact ggttgtcatt tcgatcacgg gttgtcgttt    138240
     tgttctgaag gtatcgtatg aggtctgaaa aagagctaac gcaaagggag tgtacgccaa    138300
     ataatacggt tcaaatttgg gggttgatcc gccttgtggt tgtcgcgaca tcgcctatgg    138360
     ggttgacatc caataagctt atgtccattt gcttcaaaac gcgtttaact gtggcctttg    138420
     acacgcgtac tgaccactgt tgttcaatct gagctaacac ctggttgagt tggatgggag    138480
     atgcctgagt ccactcataa atctgctgtt gttggtcgcg attaaacatc ggttttcgac    138540
     ctcgacctgg gtgattatag agtcctgcaa atcctcggtt gttccaagcc ttaagccagt    138600
     tgtaaaccgt tttaggactc acactaaaaa gggaggctaa ggtatagggg gtccaaccct    138660
     gagcgaacaa aatgaggcaa tgggcgcgtt gtctgacctg atgatggcga ctactgtgat    138720
     aaatccgatg caataagcgt aagctttcgg tggagatagg acggactaat gacatcaaat    138780
     caatggttgt aaacagatga ctcaggtagt ttacatccag ggaattctat gtaattaatt    138840
     tttttcatct gcttaccttc cacacccatt tagaagaatt cgcttcagat gcctgtatcg    138900
     aaatgcctcc ccacatccta aaacaggcga tccaggatgc catatggacg gatgacatgc    138960
     aggagagcat ctggaacaaa agcagtggat atgagcaatc tccagcattg caacgacttt    139020
     gccgatggtg gaatgagaat gcacccaacc ccgaatatcg gagggcggcg aatatcgtgt    139080
     tgtgggtgag ggtcgaggat gatagcgagt attgggctgg ctggtatgaa tgcccaaata    139140
     tcgatatagg ggttctaaca agtgaaatga gtgccaatgt tggtcagcat gtcattgtcc    139200
     aattcctgca gggtcgagat gcctatacac ctattggagg ctatggctgc atgatctggg    139260
     gtgttgatgg ttgtgagtat attgatgtcg gtgcaaccgt tgatgaagta gatgaagcgt    139320
     attacggcca tcatatgttg aaagatttcc cggatcgctt ccccgtagcc tggaaatgcc    139380
     ttcatgattt ggcccagtag ttttgtgttg agtttctatt aggtttaatc tcaatattta    139440
     ctatctaagt cgtagttgct ggtgcgattc tagctccatg ctggcgaagt gctcaaggag    139500
     cattcggtgg acaaatatgt agccaccgcc aactttttga aggaagaggc gatcagcagc    139560
     gtaatccagg aagcgggcgt agttccaggg gatatgtccc atgcggtaaa gcattaagcg    139620
     gagtgtgaag tgtcttaggc aagtagtgcc accaccaatc agcccaaaaa acagcccagc    139680
     acttacccca aaaaacaccc cagaaagcag cgacttctca attaccccaa gaattacccc    139740
     aagaattacc ccaaaattgg ccccaaaatt caaagcatta atggctgact tccaaatccc    139800
     ctggttcggt tgaaatgtat tcaacatgtc tgggcctctg agtccaccaa taacaacact    139860
     aagcagccca agaatcagcc catatctcag cccaagaatc agcccttcaa tcagcgcatt    139920
     aatcagcccc caatacattt caaaactcag cgcaacaagc agccccaaaa ttggccccaa    139980
     aattagcccc aaaattagcc ttttacgaaa aatacttttt gcttctctcc aagaccattt    140040
     caaggtttct acggttttga tgtttcctga aaatccaacg atcagcccaa taatcagccc    140100
     ataactcagc ccaattttca gcccctgaaa cagctgatac ctcagctcag aaaacagttc    140160
     aaacgtcgat gcaaacttca gctctaaaag cagcccaaaa atcagccaag aactcagcgt    140220
     agtaagcagc ccaaaaatca gcccaaaaaa cagcccaaaa aacagccaac ttattagtcc    140280
     actttctaga cgatagcgaa gtttttgaaa cttagtctga aagaaacttg gctgtattct    140340
     ctctatcaaa aacacagttt gagatgttcg agacatttct tgagctaacc agatcagcca    140400
     aagtgttgct tgttcttgga ggtagtttcg agtagttccc ttacgttgga acatacgttt    140460
     aatataggta tcaaacaatc gttggcgaaa gatttctgat gtaactgacc ttggaaggtt    140520
     atcccagtca gaaccctgat aggccaggct cataatgctc aatatcaaag gtgaggaagc    140580
     aaaggattta atttcagagt tctggttgac tattgctcgc aacgctatta atgattcccc    140640
     agcttgctca aggtactcat cgatttgctg aggggttaac ggtttaacgt agatggcact    140700
     tcgcaaagtt accttatcag aaagggcttc gtagtcatga atacggctac atacaaccat    140760
     ctcggtacga ccatgagctt gaaggaattg atttaaagca tgtacacagt cattccgatg    140820
     cttggcctca acttcatcca ggccatccag taataggatt aattgttctt ttacgatcca    140880
     agacttcccc aatgacttag aaacagtata tttatcaaaa agttcctcta ctaaccactc    140940
     ctcaatggat tttcgttgtc tagaccaaga cgagagattg agcaccactg gcaaaggctg    141000
     atttagatcc gcttctgttc gagaaattag actttccgct aatttcagta gggatattgt    141060
     cttgcccgca cctggctctc ccagaatcag tagtgtccgt ccagcaccga tatcctcaaa    141120
     tatatgtgtg gctgatgtgc cttctggaaa agcttgctta gattcaggag ggaattcctc    141180
     gacaccttct agtggagtat aaacatagtt gtttctctct tccaacccta attcaatcaa    141240
     cacttggcta tgcagcgact tcgctaagac tccatcaatc cagaattgtt gaactttact    141300
     gagtagaacc ttgcgccatc tatgctcatc ccggcttaaa ggttttgctg tgtccaaagg    141360
     agcttgagga accttaacag tactaaatac attgacaacc tcagcatttt gaatctgagt    141420
     tacctccaag tctctcccag caacgccacc aatctggacg tctttgagaa ctccaccaga    141480
     gaaatttata ctctgctttg atggttattt agactgttca ctcatagcag ggctagccct    141540
     atagcaggaa gcctgatgca actcctagcc agggagtgac tttttccacg attggtttga    141600
     tctttttcca aagattggac cctgctgcta cagtctcacc tgcttctttg agaacagtag    141660
     tagccttttt aaggcttttg gctgcgtagt ctttgtcagg ttcctcagct tgaacttctt    141720
     ccttagctga ttccaggtgt cgaagtgctt tgctggcttg ttcttttggt agttctgtac    141780
     tctttaataa agcttccagt tgggtgatga ggtcaacgac atcagcttgc gttagttgaa    141840
     cttccgttcc atctgtccca atctgttggg tctgggtcac cgtctgatcg cctccagcta    141900
     ttccacctat ctggacgttg gagttttgac caccgctgat actgatagat tgggaaggct    141960
     tttcttctga catagcttta gtagcaatgt aatttagtac tttgctaagt atcagtccag    142020
     ctactggata ttatgctttt ctttaataaa attagagctt taataattag agagtcaaag    142080
     ttcttcactc ttcatctgaa aaaaagctca aatttttttc tgtgaacctc accgacgagg    142140
     agatcgccgt tgatgctgtt gctgctcctg ggtaatctca ttcgccaact gccccagatc    142200
     ctcaaatttg gcttgcacct ctgggttgtc agacatccgt aagatctggc ccaccttgac    142260
     ttccagaatc acctgacccg tgtgcttatc cgtgatgctg gtatagcctc tgcctgacct    142320
     gagccgccag ttgtcccctt cagaaacgta gtcgccccct tgagcctctt cttggccgta    142380
     agcgtgagta atcactctca ccgcagcaca ggtttgactt gcgaggctgt tccgttgatt    142440
     ctcaacctcc tgatctattg gctgagttgt tttctggaat tcagaaagcg tctgagcctg    142500
     ggccgtcaca tgcaggagat ggcctgctcg atacctcagc aaaactcgat ttgactcttt    142560
     ctccctaatc atcgtggtta gtggcccgtg ggtcataacc caggatgggg tgaagtaaac    142620
     cctgactcgt ccatgctgag agccatgttt ttgagccatc gcttggacaa taggcaccat    142680
     tgccatacca acctcggtct tatgcttttg aagctcaagc gctttctcca ttaggtattc    142740
     gcgctcatag atgtgcttag atccagcctc aataaaccga tacccatctt caagttctcc    142800
     tcgacggcta gcctccatga acacctctag atccatccgc tctggggcaa gatccccatc    142860
     tcgacgctga acgaactcca ccagcttgcg ataacggtat tgataatgtt tgagggcaat    142920
     ttcttcaaac ggtctggtcc ttgaaatcgc cagctctaat tgcttcggac ccgcccccac    142980
     aatcagatca tcaacgcctt tatgttggtt atcccattta gaagcggata ccgaacagcc    143040
     ttctttgacc aacagttcac ccgctctcac taaatcctga cggacattca cgatggttaa    143100
     aggcttagtt tcttggtcat ataggaaatt gaagtgacga ccgggaacag cgaagacagc    143160
     caaaccagga tggagttgtc ttataggaag ttttttctta ttgtcatcat tggcccggta    143220
     tccaccattc acacccggca gaccaatcgt gacatggcct tgagagttca ccgctagtgt    143280
     cttcttgcca ccctccgtaa tattgatggg aatctgggga ttgtccttga ccactgacca    143340
     aaaatgcttc cctggcctgg gtgtgatgcc gtactggtca tagatcgttt gggctaacca    143400
     ctcagggaca tgagttaaga aaatctctcg gctgacatcc gctggatgct catacttttg    143460
     cggtctgttc ctgcggtaat ccatgcgagg atgatcgggt ttgaggcttc cccaaaggga    143520
     ttccgtgggt tctgggtcat ccaatgaact agcgagaacc cccgctttaa tccagaaccc    143580
     cccatcagga acatccctta gcttggcaaa ctcctcagaa atctctttaa cgacaacctg    143640
     ccctgcgccc atatcctcaa tcttcgtgga caacaaccgt tccaagattt cttgtcccgc    143700
     gatggtttca cagttcaact cagcgagatc tgggtgaata ccactgcctg ctagcagctc    143760
     ctgccaatgc ccctcagcaa tggggaagga tgcctccatg agttttttgg ggtttgtttc    143820
     tggagtccag aacaccttaa tgaatttggg cttaggtgtg atgttgatcc ccttcccttg    143880
     taatcgttca gctagggtct tcaattcctc cgtgatcggt ccctcagcca cggctccaac    143940
     ctcccgcatg tccctcaccg tctgccccaa ctcctgcatc tctagggttt ggccaatcat    144000
     ctgctggact tgcttcacgg cctcgtcaac cccctctaaa tgttgggtga tggcagcctc    144060
     agcccgccgc tgggcgatgg cctcagcaag attcttcatc ccttcatact cgtagataga    144120
     gggctgtgac tgtagctgtt ctatggaagt cgcaagttca gctagggaag cttctagtcc    144180
     actattgagt aaggttttct ctgcattaat gtcgtgaatc gtccccgcta gtttagccat    144240
     gcccgcatag tccgcttgat tcacctgagc cacttgctga gttaagcgat ccagtttgtc    144300
     cagcagtccc agttgatcca aagcttgcat gtcttggtgg gtttgccatg tctgagccaa    144360
     ctgacccatc ccttgatatt gatagggctg aatggggagt tgctctaggg cttccgttaa    144420
     ctgagcaaga gattcgtata tctctctctg ggcctgtacc gtctgaatct tctcggctaa    144480
     ggcacccata gacggataga taggagagtt caggcgttcg acctgttgct ggatctgctc    144540
     cagaacaccg ctctcactca gcgcctggat gttctgatgt tgagtgatgg ttttggctaa    144600
     tccagccatg ccttggtact ggtgaccctg gagctgctga attgtctccg ctatcggcgc    144660
     aagggcattc acgagctgct gttgggattg ccattctcgg attgagcgaa ccagcctttg    144720
     catttggggg tagagaacgg gttgagcctc tgcccgttcc aaggctgcgt cgaggtgttc    144780
     tacggcatct ggttggtcgg cctccacctc agcgattgca tccgttagcc ctcgactcgc    144840
     ctgccattcc tgcaggcccg catccatcgc ccggatctgc tctcggtagg taacctgttc    144900
     cactgcctca tcaatctggt caaggacgta ctgaatctgc gtgagatgtt ccgtgaggtc    144960
     ttgttgttct tgccgttggg tgatcgatgc cgcgaggtta cccatgtcat aggtcggggg    145020
     ctggggttcc tccatgcctt cggatagctg gttaactgcc tgatccaatc cactcgctac    145080
     gatcagctga gcattttgat acgcggtcca ggatcgggct aatcctgcga gggcgtctcc    145140
     gagctgggag cgctcttgcc gttggtgggc atcactgaag tcaagagacc gctgttctgg    145200
     agttgttgtt tgatggactt gatctcctct gccgccgtct ccactcccgc gttcagttgc    145260
     aggtaagtca taccggagaa gttcatcttc tgggtcagat cctccattgc tttcgttaat    145320
     ttggcgatgg attccgccat cttctccgac ttctgggcgt ccaaggcgtc ttggagctgt    145380
     tcgatgaagt gctggagttc gcccctgacg agatggggta acgtccccaa ctcctggttg    145440
     acgcggaggt tcaatgtatc gattttctcc tccactcctt gaacggactg actgagaatt    145500
     tccatcaccg tggcttgggt ttgctgtgcg tccaggatag tcttctggtg ctccagaatc    145560
     gtgtccaatt tggcttccag attgctcatg ataatccttt aataattcag tggcattgtc    145620
     ttgagcgata ctttcactga ctcgctcatc tagttttttg aaactctggc aatagataac    145680
     aatctcatgg gattgccgtg aaatcttgac gtagaaaggc tctttagagg aggtgggatc    145740
     attggtgctg ctgatgacca cccgcttgcg actttgccct tgggcacggt gggccgtatg    145800
     caccagcgca tagtccaggc aaacgggatg atcgagggag atagtgcggt gctggccctc    145860
     ctcatctatg acatgcaggg tgctgccctc gatggctact accttgacct catctccgtt    145920
     agaccatttc tgctccttgt tgttatgggt ccagcgcaga tcatccccca cggcgacatt    145980
     tagattttga acctcataga cctccttatg cttgtacttg ctgggattga agtgatagag    146040
     ccgcccccct gaactgctaa caagcagctc atctcctaac ctacgctcca cccggtaaag    146100
     cttgtctttc tgaaggggcg tactgcgata gttcttcttc tgaagctgga tataatcccc    146160
     cacttggtag aactgaacca gccgtttttg ctcaatcgtc agatggcgac tggccagttg    146220
     ctggatatgg tgatcctctt cccccaacgt cccctctgcc tttaggccct gacggagtaa    146280
     ggacatgatc gctagtcttt ccttgttcgt gcccgtgacg agtagcgtct cggcccgttc    146340
     ttctgggctg agctgaagat agtagtcagc aaaggtttgc tgtcgaatat cttcgtcttt    146400
     gatttcttgg atatagccat gctcttttaa gaggctgacg gcatttagcc cctgaccttt    146460
     ggcaatgaga gagacggccc gcttttgcac ggtgttgcgc tggcgcacaa tctggctgat    146520
     atggaaggtg gttgcccccg cccgaatcag agaccgcatg ggggaacccg ctgtaatact    146580
     ggggttttgc ttggtatctc ccacaaatag aacacgggca ttcgctgccc tggcccgacc    146640
     cagcaattcc aacatttgct gtgacccaat catccctgcc tcgtctacaa tccacagttg    146700
     atggggggct agactcggct tgctcactaa gagcttggcg acggtattgg ttttgatacc    146760
     cagttccttg cctaacacct tagaggcttt agtcgtggga gcataccctt ggatatcgag    146820
     gttgagatga gtcagaacct gtttcaattg gcccaacgtc cgggttttcc ccacccccgc    146880
     taacccatgc cagaggataa attgatctga gtgggccaag gttttagcca ctgcttctag    146940
     ttgcccgaca tttaaaccgc tctctttgag cagctcccta acgctgtact cggacattaa    147000
     gggggtttgg gtttgccgtc ctaagtccca gctctgatga atggctgctt ctcgctccaa    147060
     tgccgctacg gtggtgaatc gttccgtatt gttcacctga tctcgcaggg tcagcaattc    147120
     ctcacaggct gacatggctt ggcttatatc ctcgaagcgg aactggcgga tattgccgaa    147180
     aacaaactgc tcaatctgct cacgggtaaa ggtaatggag cgttcactaa gatggttgat    147240
     ggcactgtgc aacgccgtcg tcacctgatc cggtcgatac tcaaattgag gactgagatc    147300
     cggttgaggc atccggtagt ctaaggtttg ggccgcttgc tgccagacgg cttgtaaatc    147360
     tgtgagcttc tggcccggtt ccttggcttt acggctttta aggcaagcgg tttgcttgtt    147420
     tgcggtggtt gcttctaaac catctttttc gagctgttta aagatctgct gagagcgctt    147480
     ggagaaggtt tcaacctgct cacgagtaat tccctcaatc tcaaacgcat ccttcgtggc    147540
     atagatcttg tatcccaagt tctgaatatt ctcagccagg tattgccgat agatttgccc    147600
     caagcattcc tgcatataca tcaggtcatt cttacggctg cgccaggtgc cgtctggcat    147660
     ctgggtcgta ttcatcacta gggcatgggt atgcacctgt ggatcattgg ccctggaggt    147720
     gtggtggtta atcagggcaa tcaccagatt cttcgtattg agggtatggc gaaccccccc    147780
     gatcatcacc cgtgtttgtc catatcgctc ttggacgata tccagggtgc gcttgacggc    147840
     ttgcaggtgg gcatcaaata ggcgatagtc acagccaata tgcaggacca ttgaggcact    147900
     tttaggcatg gaaaaagtga agtcatcccc cacccgttcc ttgtgctttt cgttcttggg    147960
     aaaacccctc agcctctccc cttccaggtt gtagccatag aaaacttttt taaagtcagc    148020
     ccggtggaca tttccctgta aaccgagggc ataagcgcca tagccatacc attgagcgcg    148080
     gacgagcttt cgtagagcgg ctgctttgga ttcagcctca ctgaccgttt tccccttccc    148140
     cttcttctgt accgacttgg aaacatcagg gctgtagtaa tccaccagcc cctcatcctg    148200
     gaggtaatag tcttcttttt ctttgcagcc cgtctgcacg ggcacaatct tcagcatcgg    148260
     aaaaggctac agaaagcgaa cgaaaagcca ggttgcccgg caccaagcat ggatcaggcg    148320
     ttgtagcaga ttgggatatc tcccccgttg attctgttcc gtgacggtct ttgctccacc    148380
     tagccactgg tgaataaagg tatgggagcc aggggacagg gggagcaaat ccaaccagat    148440
     ccactcatgg ccatagcgtt tgtaattcgt gtgatggaca tgggcatagc cataggttct    148500
     gacccaagga cgcagggcac agcggtactt ccaagcagct agggtgcgtt tgcgaagttt    148560
     ggcgtccgtc atcaccacat ggatctaaaa aacatcgccg taatgacggt cgttaatgtc    148620
     cccgcccatc caatgaggcg catcagtggt gtgtatcgac ataccaaata aaaaataact    148680
     agaccgacga agatgtcaaa gtgactcatc ggaattctcc ttgtgaatag aagttgaatt    148740
     ttctcgtggg aatgtaatta ctttcgggca caaaataata cgcattgcgc tcgaaattga    148800
     atcagttttg aaaaagttga aacgaactga aatttctgcc aacttcatca tacgcgattg    148860
     ccaaattgtt ggcgtatggt gtggtatttt cgccggggct tggggcagcg ccccaaattg    148920
     ccgtcttccc tggatctgcc ccgtttctgc cccagaatgt ccccaggctg ccccatgttt    148980
     gccccaagtt gtcccaggtt tgcccaaaat gagcatattg aaagctgaaa aattgggttg    149040
     agaaaaagtt gccccagatt gtccctgagt tgccccggat tgtccccagt ctgccccaaa    149100
     agatcccatt tcaaggatat ggaatgttac gggaattgtg atgatggttg atggtttttg    149160
     acaaaagcca ctagaatgcc cctagaactt tgaacaccac cgaaaagatt tttaacaaaa    149220
     gcgacgccac ttcgcgagaa tgcggtcgca aattgggttg aagtttacta actaaatcaa    149280
     tgattgatgc aacgatcacg ttcgactttg gcggatcggg gtgccgtgct attgcacaag    149340
     taccgggtca gccagagcaa ctgtatttgc tatcaccgga gatggcgcag atcgaacgag    149400
     gccgaattga agataccttt gcaatgctcc atgaatttgg agaaccgaac ctaaccacct    149460
     ctatttggtt ggagttcgcg ggcagtgctt atgtgctggg tgactttgct aagcagtttg    149520
     ccgtgagtgg gctgcaactg agcaagcaaa agttcgagct ggggattacc aaggccctgg    149580
     ccctgattgc ctggattgcc caggacaacg ggctggaaaa gggggcttcc atcgccttgg    149640
     gggtcgttct cccctggcgc gaatataagg atcgacgagc ctttgaagat cagctttgtc    149700
     ttcaggtaca gaactatatc tttcgcggcc agtccgtggg gtatcagctg gatctgttca    149760
     cctgctaccc ggagggctgg ggggttctga acaatatgat gttctcggaa ggactcaata    149820
     acgccgctgt atggatgtgg gggttccgcg acaccaccgt actttgggcc gcgaaccgtc    149880
     agcgcgaggg cagtacggag ccgtgggggt tccgccgttt tatcgagcgg ttccaagaaa    149940
     gggcacggtt gcccatctgt gatgctcaag aagttgagat tgatgagctg tacttagcta    150000
     gagttttggg gagtgtcacc agcttagaac ctgaacaact gaggtcacat ctatctcccc    150060
     tcgtgagtgg tctgtcagtt ctctaccagg aagatgccct gacccaactg tgtgagcagt    150120
     atgagcgcat ctatcagctg tacttccaag atgcgatctc agtctttgag cgcaataccc    150180
     cccaacacat tgagcggatc atcccctgtg gggggacggc ctggttgtac cgttctctcc    150240
     tgaatgagta cttgaagcag aagccagggg tgcagcaaag ctgggcgact cagcaggagc    150300
     gggccgtgat ggacaccttt ggtaagaagg tggtcaaagc tgaggggctg cagtatcgcc    150360
     tggatgatcc aatgggcatc tttggcctcg tccgtgccca agtcaaacat cgccaaccat    150420
     cagcaggagg gttaaaagtt gccagataac cgatttgata gacggctgcg tgtccgtgcg    150480
     gataaaggca gtattgagca ggccattgtg gaggaaattg aagatccctg tacgccccct    150540
     ggaagggtgg gtgaaacgat tctgcgaatg ggccaagcct tctttggtca tcgtgcggcc    150600
     cgtcgaattc atcgctccga actagaggta aaaagtgcgg cgagggactc aattcggctg    150660
     ctgcgagagc agattaccta tattgccctc gacagtggct tgaaagatga gctgccgctg    150720
     ttattgggct ttccccagtt ttcgatgaat ggtgtttcca ccgagcaagg ggtagccccc    150780
     gttgaggagt ctacctctga catccctgat ttaagtgaag catttaagga taactagtca    150840
     tgccccaaac gaagaatcaa ctgattgagc aggttgccaa gcccaatgag gtcaacgacg    150900
     agcaagcgaa ccaactgatt gagctgctgc agatgcagga aggtaaagga aagaaatacc    150960
     cagatgagca agttcagctc tttgagcggg cctgccagtt gacccgcaaa gggcaacccg    151020
     taccggatgc ggctcagatg gcattgaatg aggctcagca agaaccgcag cccccagctc    151080
     cccaagaaca agcggatgca ccccctaaac agtccacctt ggatggaggg gttcaagacc    151140
     tggttgaaat tgctgaaaca gcgggtgaaa gtaccgccga gcgattaagc caacgcccgg    151200
     agatgttgtc ggatcaaacg attcatgaat ttgataaggc attctttgtc tcgttggggt    151260
     atcacctcca acgtaagctc tccgcaaggg atcagagtcc cactccgata gatgtgaaag    151320
     tggagcctgc gggactagga attttgaagg gggttcagga acgcttgcag gcgaaagaag    151380
     aagctgagcg caaggtgtta gtcgcagcaa cacagacgac ggatcaacct actgaacctg    151440
     ccgaggttgt tagtgagcag caatagccta aagcaatccc cccagctcat gtccagtgat    151500
     gaaatggaag tggtgagccg cgaggtatat gacgttgcct ccgctgatgc tcaacggctg    151560
     attgaagcaa tccataagca ccgggacatc aatcatcagt ccgtcttgga ggcttacaat    151620
     ctggtgttta ccagggagct gaatcggttg ctgcaatctc agaaggtttt gggtgcggta    151680
     gcgattgata aagtctcgcc tgatcgggtt agactccccg taaatggtgc accgaatgag    151740
     gctgatctga tccagcttgc ccaacggcaa ttgttcttag tcctggtggc cgtcgccgct    151800
     cagcatgaga aggttcaaga gataaaggaa cgtcggtgtg aacatggcat cacgttactg    151860
     agaaatctca cggatttact tcgggaacta ttcggttctc tgctgggttt ggtgttgctg    151920
     ctggcaatgt tttatgggtt gggggttgcg actggggtaa acctgccggg ggaggttatt    151980
     tgccgggtga ggattgctca gtgtgctggg gaataattct cgagactcaa tatgtggatt    152040
     ttggaggatt actatgccaa ctttaagagc tgagatagca gacattatta cccagaattc    152100
     tgtggagaga gcagcgttag aaatactagc gttgctggag gaaaaaggat tatcgctcgt    152160
     cgaaaatggt tggctggatg atgacacgat ctctcagctt aatcacatta gcgaagagaa    152220
     gaatgatgaa aagtaagttt gctctgttaa tggcgacagc aataggcatt ttggttgtcc    152280
     agccagcaat ggcggctaac ttaagctcaa gcgagattga tcaaatgctt caaaatatcg    152340
     ccataccaat agcgatgatc gcatcttcta ttcttgcgat ccatatattc tcctccgggc    152400
     aactctcata tgtacaaatg aggaaacaac caggcaaaat ccgggagtta attgggatta    152460
     cctgtatgtc attcgcgctt tgctcactcc cttctctagt cgttggggag tttgggagcg    152520
     ggaatgtaac gctgcttttg atcaatggtg cgttgattgc ttttggtttg atgattcgtt    152580
     ctcagtaaag gtagagaacg catgaggata tcgtttgaag ggctacaacc tgttagatac    152640
     cttctgcgat cgcaactctg ataccaatcc acggagctta gaccatagga gaaaatcatg    152700
     gattgtgctg ctacgcggac ccccgaggaa agagaattct tgcgtctaaa aggtcgagat    152760
     atggcctttg gctacatcca gatggcccgc aggtgtcctc gcccggagga gattgctaat    152820
     atggcgctta ccgattgggg ccagggcaat atcttcaatg gtgtcgtgga tcaactgggc    152880
     ctcatctggg aggacgttga cggcaagatt gtctatcgta agaatcccca gcgagagctg    152940
     gaaaaagagc aagcccttga ccgctatcga tgcgcgtcaa aagagcctcc tttcaaacag    153000
     tatccagatt tgcaggagat gtcgcttgat gcactactga gtgaattgga gagctggcac    153060
     aaaatcggtg gatttgatga gcggtatgac gaagagcgag tagaagcctt ggtctggatg    153120
     ttgtgttatc gcattgcctc ggtcatggca gaagatcatt gtattttgct tgagatggcc    153180
     gcatacgcga ttggctatga gcataagacc caccccacgg ccatccctga atggaaggat    153240
     tggggcatgg cgatgtgtga tcgggttctg gggtcaatct atacgaaacc cgattgagtt    153300
     cccagacgtt cacattccag gcggtttctg tgttgcctag ctgcgatgac cgaaggtcgg    153360
     tcttcgacca tcgcgcatcc aataccaact ccccagactt cccaccaaac agcagtaaaa    153420
     acgacccccc gccacttcta gtccaagagg tcgttgaatc ctttctttaa ttataatgag    153480
     gatcccaaat gacgacgaac ccctttatcg gctacttcga gcaagtttgg attgaccacc    153540
     agaccaacta cggccagcac gctgatccat gcttagcggt cttgtgtatc acctagtcag    153600
     ccataactta ctttagaact caatttcttc caccaaaaat gcacaagacc ttgagtgatc    153660
     aataaagtta ttctcatcct caataagctt cggtccaagt tcagccatct cagtcgaacc    153720
     catggcttcc atgagatcat tctctgattc aaaccacacc tcagcaacac catcaaactc    153780
     ttctgccatg cttcttgact gtctcatgct ttcatttaaa ggactggaga gagtatgcga    153840
     ctgcacatat ttttgagttc tcatcacagc agcattcttc ataaagaatg gaccatggct    153900
     attctgccaa taatcctgaa aagcttctct ggtgatatca gcgcgacgat gaaggcacat    153960
     tatcaatttg atcatgacac tcgaactctg atcgttttgg attaaaaatg gctaaagact    154020
     aagattacca ggcgggcgga ccaacgcgag tggcctctga agaaccaaaa gtctcaacga    154080
     agtgaacgac gaggaaacac tgaaaacgta gcctgctccg tgcattgact tgttatgcgg    154140
     cctttgtggg ccaccgtgca acctcgtaga cgatttcagt tggattgaaa tcattctcca    154200
     agtaaccgca atagtgatca atgatcattc cgaattcaag cttacagctg acaatcgcga    154260
     ggaaatgccc agcgatgggc cagagttgag gaactgagcg ttgggcggac gcgaaatcga    154320
     caacaaagag cgggcatgtc ggaacccaat atcccttacc gccctgttga atagcgttag    154380
     gcggagtgat catcaaatga caatcagtgt ttggatcaac gttatgtatt tgttgaatga    154440
     ggttcatcgc cttatcgggc caagcaacct cggtgtagtg gtactcgttc ggacgcgttt    154500
     gagatccgga cccgatgcca tcagcagtgg cgggcagaaa agtggaaatg atgtcgtgtg    154560
     attcaggtgt gtagacgcag ggtgcggaac tgagcgcttg cgacagcggt ggtgcgagtg    154620
     attcgaggaa cgtgtttcga ttgcggcgtt gtttgttggc cgacgccttg aggaagatca    154680
     atcgtttgcg ttcatcggaa tccatctttc gcgtcgggtt tgctgcgtaa ctattgatta    154740
     tataaatatt gtctggtaac tccagcttga gggctattat cttccaacta ctttttaact    154800
     ccgagataat gacattatca agtcagcatc ggataattcc aactccaagg gtgttgtcca    154860
     gtagttcacc gtactcacaa ggccaagttt aagaagttta agtcctaatc ttctttcctt    154920
     taccttttcg attcagatca ccaaatgagg ccaatatcgc gaggctataa aaatcagtca    154980
     ctagatgggg tattgtggaa caatccccaa aagtgacgat tctgaagaag atccgcccag    155040
     aaaacataca gcaaaccttt ttgagcaagg gacattaagt tcagcagaac cgttgcaaat    155100
     actaagctta aagtctcttc atattaatca accgtctact atatcaagag ttaggagaca    155160
     gctaaaatca ccccaaaaac actgtctatt aaatcgttaa atcctactta ggaggcagta    155220
     gtgtctatta atcgatttag gagacatcat tagaggcgaa atctgcacga gcgtgggttt    155280
     tcatactgag ggttttatac ctcgataagt tttaagaccg gatcaacaac ccaattcatt    155340
     gcagaatcgt cacttttggg ggttgttcca caatacccct tagtggggtc tttcagaatc    155400
     actgcttttg ggggttgttc cactgatacc tcttctaggt tcggaaagtc ttgccaacaa    155460
     tagtgacaaa accaacagat ttgcccatga ctaatgtgag ggaggagttc atgggagcaa    155520
     atgggacagt caaacatggg gaaacctctg gcgtagattg actcacccag aatcataggt    155580
     aagtgccctt cgttacgaac gatagttgat aaagttgaga atcctatgaa gattattgaa    155640
     aacaaacgat gttgactggg ctaaaggttg cagagatagg cattgttaaa gttttaggat    155700
     gccagcataa cacttttgca tggaccaaaa tccctgaagt ccttaagcag cagtagtggt    155760
     agccctagtc tcttcagtag aagtgttacc ctgaaatctt tctagaactt ggaccatgcc    155820
     gttctttgtt tggatcagca cattcagaat caatctgagc agatggtttg accgctgctg    155880
     tcggcactgg atcatatccg ccagggtgaa aggggtggca acgacaaatt cgtttcaacg    155940
     ccaaccagct tcccttgagg actccccaag ttgatattgc ttcaatggcg taggccgaac    156000
     aagtcggctg aaaacggcaa gacggcagaa ataaaggcga aatgaatcgc cgataaaact    156060
     gaattaatcc aattaatagc gttttcatac aactaactca aacagggata gaccataagc    156120
     ctatctctat ttaacaatag acattatcgg aaataaaatg agtgagaata acttcaaatg    156180
     tctatgtcgt aagtctttga ggtcgatttt tctccaaaaa taaaacgctt tcccagtaag    156240
     gttttcagct atttccgata aggtctaatg aaaatattga atacgaagtg ggtctatgat    156300
     ccatattcta ccaacctggg gtcggttcaa atcagggtaa cgctttcgct taaggggaaa    156360
     aggctgcatc tgctcctgta caagggcttt aggggttttg attatataaa agtgttaccc    156420
     tgacatccta gaacttgaac catgtccgac agttaattat tacgtaaata ctttttggat    156480
     tacgcataat agcaatattg ttacgtaact aaggaaaatg ttatgcgtaa aactatcagc    156540
     attccagagt ccctagcgtc tgagttggag caattcaagg atcggctgaa tgcctctgaa    156600
     atctgcacat tggccctacg aagggaggtt aaacggctta aggctttgga tagcttagaa    156660
     gctggtgctg atgttgagcg cttccaattg gagcgacaac gggacggaga ccactgggaa    156720
     gctaaaggca agattgctgg tattcaaacg gctgtaaggc ttggttatag gccattaagc    156780
     gaggtatgcg cttcagtcga gctatgtact cgggaaggat tacctgttat cgatcaaatt    156840
     gcccaaattc ccggagtgat agagctgatc gaggattgca tgaaagatga tgaatgctta    156900
     tctgtattca ctgacgatta tgctcacggg tatggtctcg gagcgcttga agcctgggat    156960
     actttacata ctcaggctgg gaaaggggcg gcgacaggcg agacaaattc ggagataaac    157020
     agtgaaaccc ctaacagatg atcagatcaa agaacaaaca caggaatctt gtggtcactg    157080
     acccccgact aaagtacgtg ggcttgcctg gtctcagcca ggagctaagg agtgactaga    157140
     ccatgagcta cagacagttt cgtacttccg ggtatttccc tagctcggat aatctacaag    157200
     ccttctgaga gaaggcgtgg ggtaaagccc agaaatgctg actgtagtgg tcttagggac    157260
     atacaactcg aaagaggatt atctcaaatg atgttaagag tacctgtcat atcagcagaa    157320
     ggggaagcac ttatgcccac caagcccaga cttcccaccc agctacagta aaaacgacct    157380
     ccaacttctt tctatcccag aggtcgttga atcctttcat taattataac gaggatccca    157440
     aatgacgacg aacccctttt ccgactacta cgagcaagct tggattgacc accagaccga    157500
     ctacggccag cacccagacc catgcatagg actgccatca gaccagatcc aagaccgggt    157560
     tgcgtccttg ttgtcagagt tcaatccgct gatatcacct gagtctgaga ctgctctgag    157620
     tatctgggtg ggtattatcc agcgatttta ccgggatatc tcggtctaga tgcgatggtc    157680
     gttgactgcg ttttggataa ggaaaaatat ttaaggtgat ccttggagcg aacagaacga    157740
     ttttccattg tggccccatg agtcgaccca attaaccact cgatagcaag attagatccc    157800
     atgtcagaac caacttatag cgaagaaata gaagaaccca ctgctgatca aacggtgttt    157860
     cgtccctatc catattgcct ctggtgtcgg tacttagctg cacattatga tttttgtgcg    157920
     gttgtgcctt ttggctggac taacggccta atcgagcggt gcccagaatt tgactccgaa    157980
     tatggggatg ctgagacttt ggcggttttt gatgacatca ttccgttttg aatttgtggc    158040
     ggttgtgatc cctccaccca cattccccac aatcccagtg actcctcggt ggtgttgtct    158100
     cccggatcgg tctctggcag ttggggcatc gtcccgtgaa aatcggatgc cagtccaaca    158160
     gttccagctt ctgttcgttc gtcagatgat ttgagggtga cgtgatgggg gtgccgttgt    158220
     agaagacttg ggtgggttcc attggattta gctgtttcgt tgatggtcgc aagcatccca    158280
     aacttcagcc attactcgca cggctgcttc taggggtaaa cgctccaatt tgctcctgtg    158340
     atgaaacttc agactgattg ctagctgcat ctttaaggca gcaatttctg gagaaatatc    158400
     tgatgcctgg ctgttgagat tcgtcatata aaccactaat gcgtctagag gctattattc    158460
     ccctctctga tgatttccac atcttgcccc actgttttgg gtatgcccag ccccccaact    158520
     atccccagat ttgattgata ggttttgggt tgaggctcgt ttgaagtctc taatgcagaa    158580
     tgtagactcc ctggagatgc tgtgctgtag ggggttttat tttgtccctg gcaagagcta    158640
     ggcggttctt tccattgtcg tttggtcagt gttcttctgt aatttcttca tgattttgtt    158700
     gagaatcagt cgaatccctt cacggctcaa tccaatctgt tcaccgattt ccctcatcga    158760
     cttgggctga tcatcctcca gtccaaacct ctgactgagt acaaactgct cccgtttatc    158820
     cagatgagcc attacctgag agagttgttc gtcaagttga agtgattcca ggtaaagagt    158880
     gggttggtct tctccagcca ttagatcaag gagagtatct ttttgttggt gaccaacggg    158940
     ttgatcgagg gacgatactt tttgaaatag atgcagtgtg cgactaatgg ttttcggttt    159000
     gaggttggtg gcctttgcta attcagacag ggatggttct ctgcccagct gttgattgag    159060
     ttctctgaag tgctttttga tcttgctgat catctcccat tgatactgag gaaggtagat    159120
     ggggcgtgat ttagctcgaa gagcagctgt aaccccttgc cgaatccacc aataggcata    159180
     agtgctgaaa cgacaacctt gagcgaggtc gaatttgtct actgcgttac tcaacccaat    159240
     actgccttct tgaatgaggt cttgcagggg taatcctcga ttctgatgtt tcttggcaat    159300
     ggagacaact agacgcagat tgcattcaat caaccgttgc ttggctcgga gatttcctgc    159360
     attgacctgt ctagcgagta gtatttcttc ttcgtgggaa aggatgggat atcgggctat    159420
     ttctttgagg tagaaatgga gactgtcatg ctcaagagcc atcactgaac ctcgcaaaca    159480
     tcattggtag agaattaccc cgaattgctt ggaatgggaa ggataattga tgtttcttaa    159540
     ggttatgagg gatataaaaa gctggcaggt taaacggatt acccgccagc ttgattgata    159600
     ggactcgagt gattgaataa gatgatttca gtctatcagc cttaaccttt tccttgtagt    159660
     ctttaatctc tgaatgcagg aattttcgtt gctgggtttt aggtatgatt actatagaga    159720
     gaatgaccat tgttatggtt gtctagctta ctcttgcaga tcccagccca agatttggct    159780
     gggtttttca tggcgaacaa aaactcccca gcattagacc aaacagggga gtttgttgca    159840
     tcagtatttc aatggactaa gcgaccttgg tcaaatgaat gtgtttgcga ccgacagcaa    159900
     tttcaaattc atccccaggt tcaagttcta atgcttgggt ataagcacga cctaccaaaa    159960
     tattgccatt ggtctgcaca ctgactttat aacttggctt gcgtccacca ttgccatttc    160020
     cgttcggaga ttggctacct aaatcaattc cttctgcatc caagagggca ttgaggaagg    160080
     cgatagtttt aattcgttca gagccatctt tgtcagtcga aatgtatccg caagctttcg    160140
     ctttttcctc acgagtgtaa tcactcagtt gctttacctt tgctattaag tcttttcctg    160200
     ttaagggttt agcttgcttc ttctttctcg gcatgattta aaaaatctct ctagcagtat    160260
     cactttgacc cctaaatgat tgcatagagc tattagttta tggttagcgg ataaccgatc    160320
     caatcagtca ggatgatatt ggatatcgaa ctttcactta agaagtctca attaaaaatg    160380
     aatgagagaa tctgttagta acccagcttt aaactttaga taattccttg gttttagctg    160440
     tagacacaga attttgccct tgggtagcat cctgtttata aaagtctaag tctatggctg    160500
     agccaatgac ttgaccgttt gcagttaatt cataccactg acttgtgaac agatgctgag    160560
     caatcgttgc atgagacatc ccacacctag atattccttc tggtttgtct tttaggggaa    160620
     tacctctgat gggatcttga gtgctgggca tttgaaatat ctccccagtt caatcatctg    160680
     gacacatgct agaaacctta ctcaggtaac tttagattac ccatcagcac gtccattgct    160740
     aactccatgt cgcttttgcc cagaatactg tcgatggctt tacccttgat gtcgtctgca    160800
     atgttcagaa tgcctttgag tgtatggtca attatgtgtc gccgacttta tttaatcctc    160860
     tgtctcttgg ggaaatatca attcgtttcc gtcgggatct tgtagtttta ttgaaggata    160920
     tccccaataa atttcctcgt aagttatgtg catactttcg atcatttctt taaaccggct    160980
     tgtttcagat tcggtaagtg aaataaatac cctaccttgc ccttttcgat caaggttgct    161040
     agccaaaatt agctcaaaat caccccgcga tacttgtgcc actaatacct ctccggcctc    161100
     gtcatacttc cagctttgcg taaaaccaag caagtcgcgg tagtaactaa gggatttctg    161160
     aacactggca acggaaaata ctggtcgtgt gtaccattta tctttttcta ttggcatgat    161220
     gctctcagcc tactagacac ataactatcg ttggaagcgt attagatccc tagtttgcaa    161280
     taaatttgtc aaaaattact aaaatttgcc agaaaataga tgattattca gaatagaata    161340
     gagacctatt atgcttcctc tgcttgatca atgaccgtat tgagggcatc aacaattggg    161400
     ccatcgtctg agtagctttc tagctctgct actcagacca ttgcatcgtc attttcaaag    161460
     ctacctggcc cccatgtgcc catagctcaa agtcctgatg aactcaaaaa aataatctac    161520
     tttgaggaca gaggataaac caatgaatga aagaagaata agtttgctaa gactcaattc    161580
     gttaagctaa ggctagtaga gttaacgagg ttacggcatg aggaaacgaa tcaccgcagc    161640
     gctactgact acaggcttat ctctactgat atcaggggta gcttgggcag aatcagaaga    161700
     ccgccggaaa gctgaggctg aatctgctcc tgtagtgacg catcttgttt tgcgtaatca    161760
     cacaatcacg atgactgctg cgccagaagg ccatctttat acagtgggta atgctgtttc    161820
     tggagaaatt ctccatgtgg ctctcacaga ggtggagatg gaatcgcaat atcccagact    161880
     aatgaggttg ttacagcccg ctgtcgcgga tgaagataca accctgatga tgctagctcc    161940
     agttgaaaga taagtctcat ttaaacttga agattcctag ccatcggcct ctactgctca    162000
     aggctgacaa ttcgaccatc agggaaaatg gtctcgttta agatggcatc ttccaaattc    162060
     ttgagattga ccttagcccc ggatagatca gctcccgtta agtcagcatt cttaaaatca    162120
     gtttctctta aatctgcgtc cctcagattt gctccttgta ggatggcatc tgtcaggaca    162180
     gctcgacaga gtatcgaact tcgcaaatcc gcccctgtca aatttgctgt ggtgagtaag    162240
     gcattagtga gattagcttc tttcaaattt gctccagata aattggctga aatcagccct    162300
     gctgcttgca agtttgcctg ttggaatgat gtaccgataa atgttgcccc atgcaggatg    162360
     gcattggtga gattcgcttt ggcaaaagag gcatgggcta ggttctgcag gccgagatta    162420
     caggcttcca agtctatccc cataaaagaa cgttgacctt gagcgtacct tttggggatg    162480
     tctgttttat cttcagccat agtttgacga cgtttaagcg tcgatataca caactagagc    162540
     ttctactata tctttactag caatctctca tatcctgcac caagatatgc gtgaaaaact    162600
     gccgaagaaa taaacagagg tcgcaagctt ttctctaaga aataatattg atgatcacaa    162660
     aaaagacaag ggtaaaccag agaaggccaa cgaggacata gatggtgttt ctcataacga    162720
     aacctcctaa gtagcaatcg ctaaatatgg gctaagcaca catcaataag ccactgaagc    162780
     aactgagacg attctgcttc gaactttccc tgaaaacctt gattccatca tagcttttgg    162840
     ggctggataa cttgaaggtc aatctcgcgg atccagacgt tactgaattc ttcaaaccca    162900
     gccccaggtg tcatgtcagg gatgatgcta cctgctcttt gggcagtaaa cgcctttcgc    162960
     cacaactccc aatctttttg ggagggggaa tgaatgtcat tacaatacac tgaccagctt    163020
     tcttgctgaa ccttggaacg ctggatatga agtcctgtta cttgtacttg aatcaggttt    163080
     tcatcgatca agtcttggat gaatgcagga tgttgactcg gtggttcatc ctgacccgtt    163140
     acaggaaatt catatgaaag attaatgatt tcattgggat gtttgatggc gatactaagc    163200
     aactccgact gttgtggttt cagtgatggg atgcaattca tggcttcagt tcaggggtat    163260
     tgatgcctag gataaatgat gtggagagaa ttctgtatct acctagaagc tgagatatct    163320
     caatgattgt tttagtaatt tgttgaaact agatttgcga acgcatctct gataccacca    163380
     cactcaaact tccctcacgc ccccgcccga acaaccaccg agggatctgc gggcctagcg    163440
     aacagccaga ggtagatact agaggttccg aggacaagac cgaggagcag gctgtggttg    163500
     ttttgagttg agtgatacgg gttgcgatcg gtgctttagt tagctcaagc tttggtggac    163560
     actcatactt tgcaaaatgc tggcaataga atgaacatcg gtcagcaaaa cgccctgcac    163620
     cttagtattc aagattgatt gatcaacttg gcttccaaca aaacataaaa ctggttttac    163680
     ccaagtaact gccctacttt tttggagttg tcctgcttgt cctttcaccg ccttgaggat    163740
     gcttttgcct tttgggaaag ggtaaatttt tctgccgtat tgcttggata attcatgtcc    163800
     tttgagaacg atggttcctt tgcctgattt agtgtcaata cagaaatgtt tccccgatgg    163860
     cgagatggcg agatgatcga tattgcccca tcttgggaca ggaatatcat gctcgatggt    163920
     ccagttatag gctcgaagct gattcagggt tgcaccaacc gtctcctctg ctctggctcc    163980
     ttgggctgct tgattggctc gcctccagta gtagttgcca gccagtatgc taagcccacc    164040
     aacgatgatc gagagtgccc aagcctgtga gtcagacttg agaagtgaac tgaggattga    164100
     gtgcccttgc acaaccacga agagagctaa cccgaaagat atgaaagctt taagccttct    164160
     tagtcgagcc attcttctgg ttgattgccc tggcttagtc attagacttt gttactaggg    164220
     tgttacttca actgcaacca caactcaata ccattgcggg ccaggataag caggctggcc    164280
     gcgatgacag tagacacaag agcggtcacc aatccattga aaagattgtc aaggcggttg    164340
     ttagtacgtt gaatgtcgga gtcaatctta tcgaggcgtt caagaacttg acgctgaaag    164400
     tcttctggct gtggagtcgt tgatgtcatg attgcttttt accgtgaaac tttttatgac    164460
     tagcagccgc tgctgctatc gcatcatcaa gagagcattg ataagtcttt aagaactggg    164520
     ggatctcact aatagggagt cgtggctcgt gtctgccact ttcccagtta cgaacagtcg    164580
     aaagcgccac atttagttca acagcgattt cttcaggtct tttatttagt ctttctctaa    164640
     gctgtttcat gtccatagtc aatagactac ctcgacatca taacactgtt aactaaatta    164700
     attaactaaa ttagttaaca agtgtagtta actagactaa tatgtttata taccaaaggg    164760
     aaaggaaagc gccccgaaag gcttccacct caactaaata agtgagttct acgaagtgct    164820
     aggtcaccct gctgaatacc gcagacacga aaccggggta acgctggatt acggtctgaa    164880
     tgccctcggt ggatgaatta aaagttcaaa aactattccc aagtcaaagc ggaagagaaa    164940
     cgggttgcaa tcgactctct tccgctggct tattacaaac caaggagatt ctaacaatga    165000
     aacaaggact tacgctcgtt gaaatggctc aagctgttca agaccaggct gaggccaagc    165060
     gcgattttgt tgctgataca cgcacccttg agatgaaccc tgatggttcg attacagtcg    165120
     agtctgaaga agtcgaagaa acatttacca ccactgaaca cacccacggc cagatatccc    165180
     aacgcctcag cattcccctc aaatactatc gacggatgca atcgtcagcc ccccaacttc    165240
     tggcagaaaa cgttaatcac tggtttaaca ctaaccctga gcggcgcatg atccgcaccc    165300
     ttgacggttc tgctcgtgct ttcctttctg accgctatcg cagagtggac aactttgaga    165360
     tagctgaaac ggtcttgccc gtcctggctg aatttggtcc gggcttgaaa attatgagcg    165420
     ttggtctaac cgattctcgt ctttatatca aggctgtaaa tgagcgagtt cagcttgatg    165480
     tcagaaaagg tgacgctgtt caagctgggg tggtcatctc caactctgag attggcctcg    165540
     gttctatccg aattgaaccc cttgtataca ggctcgtgtg tctcaatggg atgatttctc    165600
     aagactacag ttttaggggt aattgaaggg tcgacactgt tggcgaaata ttccgcaatg    165660
     atctaagtcg gctgaaaata gcttctaaca cttgatgcag taagcctttt gtggattgag    165720
     gtatggtact gctaaaactc aaactcaatc acgctcactc tggaggctca ttgttatgtc    165780
     tatgcgcccg acagacttgt tggacatccc cagtgaaacc attgaagtag ctagggctgc    165840
     ctttcctgat ggcaatctgt atatgcaact acgtgatgaa cttggcatta tctatcacga    165900
     tcacgatttt gctgatctgt ttccgaagaa aggacaacca gctctatccc cctggcagct    165960
     tgtgctagtt tgcatcatgc aatttcttga gaatctttca gaccgtcaag cggctgatgc    166020
     cgttcgagcc cggatagatt ggaaatatgc cctgagccta ccgctgagag actctggatt    166080
     taattattct gttttgagtg aatttcgcaa gcgtctgatc gcgggtgaca aggaacaaca    166140
     gctatttgat agcttccttg agcaccttca agcaaaaggg ttccttaaag aacaccatca    166200
     acaacgaacg gatgcgaccc atatcctagc gtcgatccga accctcaatc ggttggagtt    166260
     atttggtgaa acctttcggg ctgctctcaa tagtttggtt gtcgcagatc cacagtggtt    166320
     aagcgaacac atgcacgatg actggtttga tcgctatggt cgacgaatag agaattatcg    166380
     cttgcccaaa cccgatagcg aacgcaaagc tttgggcagt actatcggtc aagatggttt    166440
     gacactgctt gacgccatat atgcccctag ttcaccaccg tggttaaagc atctacctgc    166500
     agtggaaact ctgcgacaag tctggctcca gcgattctac ccgcccaatg cagacggcac    166560
     agtcgaatgg cgaaaagtga aggatatgcc cccttctgat tcatccattc attctcctta    166620
     cgatgtcgaa gcccgctata gcaataaaag aagtatggat tgggtgggct ataaagttca    166680
     tttaacagaa gtgtgtgatc ctgaaagtcc acgtctcatc actcatgtgc acaccaccag    166740
     tgcaacggtt ccagatgatc aagttgttga acccattcac ctggctctgg ctaaaaaaca    166800
     gttgttgcct aaagagcatt tgttagatgg gggttacctc tcggcagagc atttggtgaa    166860
     tagcaaagca gaatatgaca tggatgttat tggtccagtg cgtcaaaatc atagttggca    166920
     agcaaaggca ggaaacggat ttgattcgag cttcttcctc atcagttggg accaacagaa    166980
     ggttgtctgt cctcaaggcc acttcagtac gaaatggttg cctggaaagg atattcacgg    167040
     aaaggatgtc attcaagcaa ggttccaggg gaccacttgc cgaagttgtc cagtgcgatc    167100
     tcaatgtacg aaatcaaaga cccagccaag agagttgacg ttccgtcccc gtgagttaca    167160
     tcaagccctt aatgaacgac gtcaggtaca acgaactact gagttcaagg aaaaatatag    167220
     cctgcgggct ggtgttgaga gtacccattc acagggaata cggcgatttg gcatgcgcca    167280
     atcaaggtat atcgggttag cgaagagcca tctacagaat gttttctgtg ccattgctct    167340
     caattttgtc cgcttagacg cttggtttaa tgatgttcca ctagcaaaaa ctcgtgtatc    167400
     tcttttcaag aggatacttc agccattacc agcgtgactt cttggaattc gccaacagtg    167460
     tcagggttgc tgacaccagc tgcaatcaag gctgaatccc ttacctagta aagcttatag    167520
     ccattaagaa ctgtaaactc cattgacttc catcaccctt aattcataat ctacgcttat    167580
     agtacaaaaa cttgccttac gctctaatga attcactttc ataggagcgt aattgcatga    167640
     aacggaaatg gcatccagaa gagctgcttg agcattggtc tatccaacct gacgaggagc    167700
     atctattggc cagacgtcaa ggagcaaacc gcttaggatt tgtcctgctg cttaaatttt    167760
     tccaatatga aggacgcttc cctgaacaga agtatgagat tcctcgtatg gcactgacct    167820
     tcgtcgcaga acagttagaa ctactgcccg agctgttcca gagctatgac tggcatggga    167880
     ggaatagcta ttatcacaga gcccagattc gccaattttc cggatttcga caagccactg    167940
     tggcagacca aaaccaactt cgcacttggt tagtcgatac cttcctcagt caagagcagg    168000
     actatcatca tctgaaatta aaagtctatg ctcaactgcg ttcacttcag attgaaccac    168060
     ctgcccctgc taggattgag cgtttaatcc ggtccgctca acgcctgttt gaacgcaagt    168120
     ttttttcctc aactcttcag cacctgtcca agcaaactca gactgagctc gatgaattga    168180
     tccaagaacc caaggtgacc ccaggtaaag agatcccaga tcctccccta agtgcgttga    168240
     aaaaagaccc aggaccagtc ggtctcaata gcctgctttc agaagtcatc aaactccaac    168300
     gactccgcca agtggctttg cctgataccc tgttttctca tctaagccca cgagttctgg    168360
     agtgttatcg gctccgagtg gagacagaaa ccttatcaga gttgaggcat caccccaaaa    168420
     ccatccgact caccttactc gcgagtttct gctggcagcg gtgccaagag atcatcgaca    168480
     acatcatgga tttattgatt cagatcgttc atcgcattga tacacgcagc aagaataaag    168540
     tgacgtcaga ggtgatcgct aaagtcaaaa aaaccgactc tcatacccaa ctgttttatc    168600
     aggtggccac cgcagcccta gccacaccag atggcttggt cagagacgtt atctaccccg    168660
     ttgccagtga gcaaaccctg gaaacatttg ttgattccta taatgatggc ggtcagactt    168720
     accgacaact tctacactcg aggatccgtt cttcctacgg tcatcattat cggcaaatgc    168780
     ttcctgcggt actggaagtg attgactttc ggtgcaataa caagcaatac cagcccatcc    168840
     tgcaggctgt ggatttactc aaagcctatg tggacacccc ccgaaaacct tatgcctcag    168900
     aagatgacgt ccccattgaa ggggtcgtca gtgcagactg gcaagagacg gtgttaggtc    168960
     aggatgagga ccagccagac aaagtagatc gcatcgccta tgagatgtgt gtcctcaggg    169020
     ccttgcgaga gaaactacgg tgtaaggaaa tttgggtcgc cggtgccaat cgctatcgca    169080
     atcccgatct ggatttaccc caagactttg acgagcggcg agaggaatat taccaggatc    169140
     tacaacagcc cctagaggtg gaaaccttca tcgctcaaat ccaggctgat atggaaaatg    169200
     ctttgaccct tttgaatcag gggatgcctc acaattctaa agttgagatc ttgagtaagc    169260
     gagggggacg cgttaaggta tctcctctgg aggcacaacc tgaacccatg aacatccaga    169320
     agctcaagga agagatcaac aaccggtggt ctctaacgca tttgttggat gtgctcaaag    169380
     aagcggactt tcggattgat ttcacccaac atttcaagag tgcggccagt cgtgaaatat    169440
     tgaaacctca gtccctgcgc aagcgcttac tgttgtgcat ttacggactg ggcactaatt    169500
     tagggattaa gcgcatcgct cattcagaag ccgatgcagg atactttgaa ttgcattatg    169560
     tccgacgcaa atttttaagc aaaatggccc tcagctgtgc cattacggat gtggccaatg    169620
     cgattttcca gattcgcctt tctcatgtct ggggggaagc caccactgcc tgtgcgtctg    169680
     attctcggca ctttgaatct tgggaccaga atttgatgac ggaatggcat gttcgttatg    169740
     gcggccgggg ggtgatgatc tactgggtgc gattcgttgg ctagaaacta gacctgaata    169800
     gggtttgagg ggattagccg caagcgtaaa gaaggggaaa atatcccaac tgtaccttga    169860
     caacttaata gccatatagg tgagagtcag tatcctagac cgctctagtc ctatcccgca    169920
     ggtgcagcgg tgacagcatt tcccccaggt tcgcgactag ccatcaacgc ctgaagcggg    169980
     gaaaaaagga ggtaacaggg agcctagctc tgaacccctt cgagcaagaa cttatgagta    170040
     gcgaaagcga agatgtggtt aacccaccgt aatcattaac cagcgaaatt aggttgataa    170100
     cgctgggagt cccaaaaggg caaggatata cggagctggc gtgtccagta gcgaccagtt    170160
     agcacttcca ataaacccgg tggagcgcat cactctaaca gttcaatcaa tggctattag    170220
     gaacgaagta acccccgcct atctctcttg gaggtcgatt ggctaagagt aggtgctaac    170280
     cagaagttag gcggtgggaa ggattgggtc aaaagcaaaa gccccactgt aatggtgagg    170340
     ataagcagac agactcacgg tgacttggaa tgaataggaa caagtagcaa taaatatgtc    170400
     taaagcacgg gtcaaaccga tgatggaatg gagcgcaatc ccctggccaa aactagagcg    170460
     gaaagtgttt aagttgcaaa agcgcatatt cagagccaga caacgtggcg atgtcaaagt    170520
     agtacataga ctccagaaaa ctctgatgag gtcctggtca gccaaatgcc tttcagttag    170580
     acgggtcaca caagacaacc agggaaaaaa gacggcaggt gtggatggag ttaaatctct    170640
     gtccccagaa gctcgtctgc ccctagtggg tcaacttaaa ctcggctcaa aggcccctcc    170700
     caccagacgg gtgtggattc ctaaaccagg aaaagacgaa caacgtcctt tgggtatacc    170760
     gaccctgtat gaaagggcaa gaatgacact agtcaaacta gccctggaac ctgaatggga    170820
     agcggttttc gaaccaaact cctatggttc aagaccaggc cgttcatgtc atgacgcgat    170880
     agaacaaatt tttgcagcca ttaaacagaa agcaaaatat gtgttggacg ctgatatagc    170940
     ccaatgtttt gaccgaataa accacgaagc actgctcaaa aagctgaaga cctttcccac    171000
     tctacgccga caaataaaaa cttggctaaa agctggggta attgatggtc atcagttctt    171060
     acagacatct gaaggagcac ctcaaggggg gactatctct cctttgttgg caaatgtagc    171120
     cctccatggc ctagagtatc gaatcaagca agcctttcct atcagaaaga ttgccgacgg    171180
     gaataagcga aaaagaattg ctactcctga tgtcattcga tactgtgatg acttcgtgat    171240
     tcttcacgag gatttatccg tagttcaaag atgtcagagc ttagttcatg agtggctaaa    171300
     agacatgggg ttggaactaa aacctagcaa aacgcatata tcccatactc tcaaaaggta    171360
     tgaagctgaa aaccctggat ttgattttct aggattctca gttagacaat tcccggtcgg    171420
     tcaacatcaa tcggggagat tatgcgggac attgctggga tttaagacca tcattacccc    171480
     cagtcgaaag aagcaaaaag tacattacaa tcggctcgtt agtatcatca acgcccataa    171540
     ggcagcgccg caagcggcat taatccgcca cctcaatccc gtgattagag gatggacgag    171600
     atattattcg accatggcta gtaaagagac cttctcccgt ctagaccatt tactgtatca    171660
     aaagcttcaa acatgggcta accaccgcca tcctggcaaa tccaggaaat gggtggtgaa    171720
     taaatattgg caaactgtcg ggggagataa atgggtcttc gcgactagag taactaaatc    171780
     tagaaccgaa aaattactca aacatcgaca gactccaatt atccgccatg tcaaagtcaa    171840
     gggggatgca agtccctaca atggcaatct agtttactgg agttcaagga ctgggaagca    171900
     tccagaagct ccgaagagag tatctatgct cttgaagaag cagaagggga aatgcgctca    171960
     gtgcggcatg ttcttccgag aagaagattt acttgaagtg gatcacattc tccctacatc    172020
     aatgggagga ttggacgtat acaagaatct tcaactacta cacagacatt gtcattatgt    172080
     taaaacggcc aaggagaagt cctctcaggc caaatggtat gtatgacaag caccaagcca    172140
     ctgaggagcc gtgtaaatcg aaagatttac gcacggtttt gaagccaagt cggaggagtg    172200
     atcctccggc ttaggttaac catgtcgaga aaaaatccgt atgtatctac tcgcaactga    172260
     agaagtgttc ttcttcggag gtggccttta tggtgaaggg cgtacttcgc cactgcacgc    172320
     aaatgtcagt gaataaaagc tatgtggata cccatggcca aagcgaggtg gggtttgcct    172380
     tttgctattt attgaatttt cagctgatgc ctcgcttcaa gggcatcaac aagcagaagc    172440
     tctacctgcc gatgtccggg cagaagaaga agtatttcca tctcaaggcg attttaaagc    172500
     gccccattcg ttgggatctg gttcgggagc aatatgagcc aatgatccag ttcaccaccg    172560
     cgatgaagca aggcaccgcc gaacctgaag ccattctgag tcggttcact cgcaacaaca    172620
     tcaagcaccc cacctatctt gctttggctg aattagggcg agctatcaag accattttcc    172680
     tgtgccagta tttgcatgat gaagccttac ggcaagagat caatgaag                 172728
//