Dbfetch

ID   CP000842; SV 1; circular; genomic DNA; STD; PRO; 177162 BP.
XX
AC   CP000842;
XX
PR   Project:PRJNA12997;
XX
DT   29-OCT-2007 (Rel. 93, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Acaryochloris marina MBIC11017 plasmid pREB5, complete sequence.
XX
KW   .
XX
OS   Acaryochloris marina MBIC11017
OC   Bacteria; Cyanobacteria; Synechococcales; Acaryochloridaceae;
OC   Acaryochloris.
OG   Plasmid pREB5
XX
RN   [1]
RP   1-177162
RX   DOI; 10.1073/pnas.0709772105.
RX   PUBMED; 18252824.
RA   Swingley W.D., Chen M., Cheung P.C., Conrad A.L., Dejesa L.C., Hao J.,
RA   Honchak B.M., Karbach L.E., Kurdoglu A., Lahiri S., Mastrian S.D.,
RA   Miyashita H., Page L., Ramakrishna P., Satoh S., Sattley W.M., Shimada Y.,
RA   Taylor H.L., Tomo T., Tsuchiya T., Wang Z.T., Raymond J., Mimuro M.,
RA   Blankenship R.E., Touchman J.W.;
RT   "Niche adaptation and genome expansion in the chlorophyll d-producing
RT   cyanobacterium Acaryochloris marina";
RL   Proc. Natl. Acad. Sci. U.S.A. 105(6):2005-2010(2008).
XX
RN   [2]
RP   1-177162
RA   Touchman J.;
RT   ;
RL   Submitted (25-SEP-2007) to the INSDC.
RL   Translational Genomics Research Institute, 13208 E Shea Blvd, Scottsdale,
RL   AZ 85004, USA
XX
DR   MD5; 5217cb4e8684817ba925ebe125caf54a.
DR   BioSample; SAMN02604308.
DR   EuropePMC; PMC2538872; 18252824.
DR   StrainInfo; 373281; 0.
DR   PubMed; 18252824.
XX
CC   Source bacteria from Marine Biotechnology Institute Culture
CC   Collection, Marine Biotechnology Institute, 3-75-1 Heita, Kamaishi,
CC   Iwate 026-0001, Japan.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..177162
FT                   /organism="Acaryochloris marina MBIC11017"
FT                   /plasmid="pREB5"
FT                   /strain="MBIC11017"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Acaryochloris marina"
FT                   /db_xref="taxon:329726"
FT   gene            join(174250..177162,1..843)
FT                   /locus_tag="AM1_E0001"
FT   CDS             join(174250..177162,1..843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32771"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP35"
FT                   /protein_id="ABW32771.1"
FT                   /translation="MTSTTSLNLNTPHLGFGTSTRTPSKLTPFRGANHCPICDSHDGRC
FT                   RGGGEIVLCMSETQDIGVVNGYKFRKLTKNYLWGIWAPHASEDFNAIDWETRKALREKQ
FT                   AEEKRQQRIARELPPQLRDQQYRQLLSDLSLCSMDQGDLVRRGMSQAEIDGFPAFSVGQ
FT                   FQRVQDLSPDLPGVLPGGILNSQGGYLWPLYNVHGQITALQLRKRNVDKDNRYIWLSSS
FT                   TKRNPNGNGPHVNGEIPLAIYKSFGPYSRIALVEGTGVKPYLLSQRLNLPTIGAAGGLW
FT                   ASSPETLQETLTVLSKDAEQSPIITLYPDAGAVRNLNVFRQYQRVIRLLEEWGYSVEVA
FT                   WWGQTYKENSCDIDELTSLELAQIGFKPTWFFNSLGLEYELGQLFLKLNGLSDQATTII
FT                   NKQYIELSDLGTIDPGSVVAIASMCGTGKTEMLKSLVGQVKGQVIMPGYRNNLLFNTED
FT                   RFIEQDANGNTLYKLIHLFRLNKEYQGNISMGFRSERSILLCFDSLLKIELDDIEPDSC
FT                   IILDEADAALFHVLSGQTLGDRQNQILEHFHAIANRVLETRGNIILLEDSLSQIPIDYI
FT                   KGITGGKYNTKIVVNEYKPDDNFPTKVFSGQTSQFLERILNAVAANERFIVVATSQEFL
FT                   EKLERMIAEMNPEFAKGILRHDRKTSERTENKIFQANPTEFVEDYQPTALFLSPTAESG
FT                   VSIDEPRLIPYFSRVFCYASSNHARSVYQQLWRYRAKVTREIYVTRKAHIPDIPSIKSV
FT                   EQVIMLQSKYGQDVAASIDLEQQLIHDQSPETAQQLAALKAYQQNPNNCHNVSFARYQT
FT                   RSIASLLALRESLMLLLEDHGHPIEMEELRDRNADIVESFSKVRKQMERETAVMMGTAD
FT                   GERFTVEQAIRVMGSSSATYKDTLDAKKVLLQDELPGVDLTDEFIHQVCVEHRGRLKSA
FT                   TKLHWMSYHPEIAEELDRRNFMKQLNSQFVLTHRLTNNRIQVQLLRDLGVFDLVDTYNV
FT                   TSADYEAYDKALEKGRQVQRQRQSLRLEAKGLSGQIREIIQEQKVIQAKLTALGRKAHP
FT                   RKAALKGELEQLEQQKQALKDQKLGLVERIEQQSQAFTQARYEQVEARMRMEIMVMTEG
FT                   DQRLEDIKVKALEYRYQIYRHFRNVISEGQSAVAIVNKLIKRVAHELVKVGSEESVSLY
FT                   VIRYSGNEAYKDQMLKAFQAKWNQRLEKNRPSCEICKKDGDLITEMEKRSEIDGFGHGS
FT                   DQEIGPLEGGDDGIEGGSEVNLGGDG"
FT   gene            1189..3489
FT                   /locus_tag="AM1_E0002"
FT   CDS             1189..3489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32772"
FT                   /db_xref="GOA:A8ZP36"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP36"
FT                   /protein_id="ABW32772.1"
FT                   /translation="MRYARYFVLVGLALIALFFYVKATSRNKGWPWDKKTDVTRNERCI
FT                   SKLWFYIVSLRVPIISILVILSLPIISATVAKRFLGNLYSLEYSWQISVVIFASGMMSL
FT                   IAITTLETIAENIELRLELPLGERHNFFTKGRFSRGAFTLILASPTVAILFYKSLDIGV
FT                   YQVVTGIIFGGLASIVFLYSIHSFHNWAKTRHRKLFEGFFKFILTGNINSCNNHKSLNG
FT                   YFHSNSPASRTILNEHIWNLLLFVSGLFFYSITAFIFYPGNNILGLDDPPALWFAYLII
FT                   WMLTGILGGITFLADRFRIPVLLALFIFTGLSYLAFDVDHFYSLEPITKNSVMYTADNS
FT                   RQTDDFISIINNKFSKSSLDKEKRTLVIVGASGGGIQASGWTVEALEGLNQDLGKEFTN
FT                   SIGLISSTSGGSVGTMYFLDGLKDGSLPETSSSNLIFEKATSNSLDAIGWGLSYPDFLR
FT                   IISLPPLAGDDLKDRGYAVEDDWKNLMQNPDTKLSDWKRSIDKGEIPIPVFNATLIEDG
FT                   RRFLISPVSLIDGNLQDLVCNQNSNQLDRKALDFRTLFPNKDLFVTTAARLSATFPYVS
FT                   PIPRNQEAQHLECPGSSTESHDFVYHVADGGFFDNSGLFTAIEWVDNLLKNPVSELEVE
FT                   RILLLEITAFPGEKLKGQKGNSGWLNEWVGPLLTLNSVRDSTQKARDQKEIEGFADLWR
FT                   SKGIKVEHFSIPYNSNNQPLSWKLSLNEKDNIRDEWNSYKRSSEYRCLNKYWTETDKWD
FT                   SKENCLANEEKLT"
FT   gene            3531..3656
FT                   /locus_tag="AM1_E0003"
FT   CDS             3531..3656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32773"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP37"
FT                   /protein_id="ABW32773.1"
FT                   /translation="MIRALKNVKLNFSNKTPSADLKNYSAPAVAKYICMLPQLVS"
FT   gene            3757..4242
FT                   /locus_tag="AM1_E0004"
FT   CDS             3757..4242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32774"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP38"
FT                   /protein_id="ABW32774.1"
FT                   /translation="MKRKSASEGGDDNYTEPTPGYNRREPTDTRRTQRGYSARQTPGRV
FT                   RPPRVFESKFHALERSQKNLVQQTKLEGQLEYLTVSQSGSGQYWIAVEGIGKPFIRFPC
FT                   ETPEFCFVAALELEETFDILQVIELRPGETIERIEEMVDVYLGYERVAKCLFYSVPV"
FT   gene            4909..7311
FT                   /locus_tag="AM1_E0005"
FT   CDS             4909..7311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32775"
FT                   /db_xref="GOA:A8ZP39"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP39"
FT                   /protein_id="ABW32775.1"
FT                   /translation="MTRKPNSSDDRPSNNSIREILAFLLDALRILRGNLTAKVIFLLIS
FT                   SGVALLTTQWWVPFIQTLICDVWEQDCNRIDASDRLVFWSGCVLTTIGILLLLYYYPRQ
FT                   SYKLREDHIRLYETTERTKSEKILINAVEAEVTSRLNQSLHNQVLINLGKTEKFTQVKR
FT                   PWDYLIKVRTRVEEILPSDVTIQQVFDRSDIQGRLLVLGQPGSGKTTVMLDLAKDLLER
FT                   VKDPKECIPVLLNLSSWASKRQSIPEWIVEELKSKYGVPASIGKKWLAEQKLLVLFDGL
FT                   DEVRSDRQHACVEALNQWISGDDSNRIPKQFVVCSRIEEYEQLEAKLQMNGAICLSELS
FT                   NQQIEDYLVSIKQQHLYSFFSQNPAILNLVHTPLFLSMIISAEQSAPGELQALTGKDKI
FT                   QTRVLDIYVSQMLGRAKNYTRKQMRTWLVQIASQLERDQQTEFLVERIQPRWLQNEKLK
FT                   SSYQLRVSLLFGIFYSLFSGVFRSLIRAAIKSSSSLPTLFIDVLLEGLIIGLIYRRIKG
FT                   PKSGLIEGMITGLIVQLTIKSTGIFILTGSLPEALFFGLRDGLFDGLVIGVMLGLGKDL
FT                   INGSNLITPVEGISWSWEKVRRGLFYGSIVGLIFGVISGLVDAIVVGLSVGISSGLISG
FT                   LSAYEVEQKVSINQGIWKSLHSGLMQFMIIGLGGALMVVLLGIFNLEQQPITFLSDWVN
FT                   WLWWGLDYVLLRNIEVRRGTGLIGGLYTWIRLGLLGGLAGGLGVCLKHLSLRQILFTNG
FT                   LAPWNYARFLNECSDCLLLQRIGGRFLFIHKSVQEHFSAMSFENSQT"
FT   gene            complement(7389..9044)
FT                   /locus_tag="AM1_E0006"
FT   CDS             complement(7389..9044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0006"
FT                   /product="transposase, IS4 family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32776"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP40"
FT                   /protein_id="ABW32776.1"
FT                   /translation="MRPTDLLDIPSETLEVARAAFPNGNLYMQLRDELGIIYHDHDFAD
FT                   LFPKKGQPALSPWQLVLVCIMQFLENLSDRQAADAVRARIDWKYALSLPLKDSGFNYSI
FT                   LSEFRKRLIEGGKEQRLFDIFLEHLQSKGFLKEHHQQRTDATHILAAIRTLNRLELFGE
FT                   TFRAALNSLVVADPQWLSEHMQEDWFDRYGRRIENYRLPKPDSERKALGSTIGQDGLAL
FT                   LDAIYHPSSPPWLKHLPAVETLRQVWLQRFYPPNADGTVEWRKVKDMPPSDVSIHSPYD
FT                   IEARYSNKRSMDWVGYKVHFTEVCDHDNPRLITHVHTTRATVPDDQVVEPIHLALAEKR
FT                   LLPKEHLLDGGYLSAEHLVNSEAEYDMDLVGPVRQNHSWQAKAGNGFDASVFQINWDQQ
FT                   KVVCPQGHSSTKWLPGQDIHGKDVIRARFLGTTCRSCPVRSQCTKSKTQPRELTFRPRE
FT                   LHQALNERRQVQRTTEFKEKYSLRAGVESTHSQGIRRFGMRQSRYIGLAKSHLQNVFCA
FT                   IALNFVRLDAWFNDVPLAKTRVSLFKRILQPLPA"
FT   gene            9300..9695
FT                   /locus_tag="AM1_E0007"
FT   CDS             9300..9695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32777"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP41"
FT                   /protein_id="ABW32777.1"
FT                   /translation="MLQEKDTSRLEYTAEDLISHKLQQSRILVAKPKFDREGTDLLAFL
FT                   EMGDGVKFCRIQCKGRSLANSESSQVNLPKSYITEGFVLFLYVEESANVSGLYCFFQTD
FT                   FQNLQYWHENIKGEYSLNISRSNGFVA"
FT   gene            complement(9736..10665)
FT                   /locus_tag="AM1_E0008"
FT   CDS             complement(9736..10665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0008"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32778"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP42"
FT                   /protein_id="ABW32778.1"
FT                   /translation="MSYQIRNWSEYNAGLKQRGSVTFWLEQSAIVHWLETTPRQKRGAS
FT                   LTYSDTAISTFETVKCIYGLAGRQTEGFLNSLFELMGIELPVCDHSTVSRRKGQLSISL
FT                   PVIPKQGAIHVVIDSTGVKVYGEGEWKTRQHGVSKRRTWRKLHLSVDESTGEILTGVVT
FT                   TNDVQDGEVFEDLLEGIDDEIEQVSADGAYDQSHCYDALMERNATAAIPPRKNAKIWQH
FT                   GNCNAPPHPRDQNLRAIRKQGRKRWKKQAHYHRRSLAETTMFRFKTIFGGQVRSRNFDN
FT                   QATELLLQCAALNRMIQIAKPETVWVEA"
FT   gene            10761..10934
FT                   /locus_tag="AM1_E0009"
FT   CDS             10761..10934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32779"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP43"
FT                   /protein_id="ABW32779.1"
FT                   /translation="MESFKFDDTKIELLRTLIKTAESSGEFRKLIYGNLTAQAGPATAS
FT                   VELTVEDPNAGV"
FT   gene            complement(11191..11613)
FT                   /locus_tag="AM1_E0010"
FT   CDS             complement(11191..11613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32780"
FT                   /db_xref="GOA:A8ZP44"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP44"
FT                   /protein_id="ABW32780.1"
FT                   /translation="MTESATKKERAEQLLSVVSGIYSTMLEMQLKNSALLVIVIGWLAS
FT                   SETLQKFIKSAPIIPPATTVAMLLLPIIYIKWMRDAGIESTAAYKQLNHLNYFPRVDYQ
FT                   AYRHLQLLVFTMRYANHSLCNGHTSCLNYFLELTRQ"
FT   gene            complement(11753..12043)
FT                   /locus_tag="AM1_E0011"
FT   CDS             complement(11753..12043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32781"
FT                   /db_xref="GOA:A8ZP45"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP45"
FT                   /protein_id="ABW32781.1"
FT                   /translation="MANKRNIPAVDVAALGQLAEELPSAQSEATKKAKGTIKPIESEDS
FT                   PLTVKIPDYVHRDLKIQAATTGKTQRQILLEALKMWGVDVEEDDIIDRRKA"
FT   gene            complement(11998..12111)
FT                   /locus_tag="AM1_E0012"
FT   CDS             complement(11998..12111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32782"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP46"
FT                   /protein_id="ABW32782.1"
FT                   /translation="MVIQLAVYMVNIISVQLASEDGQWQISETYLQLMSQH"
FT   gene            complement(12120..12761)
FT                   /locus_tag="AM1_E0013"
FT   CDS             complement(12120..12761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0013"
FT                   /product="ParA protein, putative"
FT                   /note="a conserved protein domain (COG1192)"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32783"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP47"
FT                   /protein_id="ABW32783.1"
FT                   /translation="MALIITFATSKGGTGKTTLAASLATHWHKKSFKVGVVDADPNSNL
FT                   ARWFSKGEIEDIPLVAEPDENGIIDAIDGLAGDNQIVLVDIAGFGNQSMVYAIGVSSMV
FT                   LIPSRPSEDDVLEAVKTKRLVENASRLTKRSIPYFAVITQGRENTRVITHTRNQFEAFS
FT                   VPVLKTEVMLRTPFQTARFHGSTPIIMEPNGKAAKEIADLANEIESNTTI"
FT   gene            13391..14008
FT                   /locus_tag="AM1_E0014"
FT   CDS             13391..14008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0014"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32784"
FT                   /db_xref="GOA:A8ZP48"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP48"
FT                   /protein_id="ABW32784.1"
FT                   /translation="MFCYQFGVSGILKVKMVICRQRNEHYRSREYLTLAEVNRLIMAAE
FT                   LRGRHPIRDKALLLLMFRHGLRVSEAISLRWDAVMLELKAIGITRLKGSVSGTHPLQAD
FT                   EVESLRDLRAEGYPDPYLFVGERGGHLKRHAVTSLINRCAELAQLGIKCHPHMLRHSCG
FT                   YHLANQGLDTRLIQDWLGHRNIQHTVTYTMLNPKRFGEIQWG"
FT   gene            14360..14476
FT                   /locus_tag="AM1_E0015"
FT   CDS             14360..14476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32785"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP49"
FT                   /protein_id="ABW32785.1"
FT                   /translation="MNFQSFESIGYSISIYTYIYDLYGERISALSTKTGPLI"
FT   gene            14888..15013
FT                   /locus_tag="AM1_E0016"
FT   CDS             14888..15013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32786"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP50"
FT                   /protein_id="ABW32786.1"
FT                   /translation="MDFKVNINRELKCLLDRRYRNLDPLKTPVPLMLIKVSSYLE"
FT   gene            15576..15851
FT                   /locus_tag="AM1_E0017"
FT   CDS             15576..15851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32787"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP51"
FT                   /protein_id="ABW32787.1"
FT                   /translation="MYLRKFNHFIYVMLAVSLLASCKGLKQAEEFGKLHEKLETNFASL
FT                   SNDIYLSCLRKASYPDEGYFPAIISFRSDEDKKCKEKFLPVYKKSK"
FT   gene            15859..16107
FT                   /locus_tag="AM1_E0018"
FT   CDS             15859..16107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32788"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP52"
FT                   /protein_id="ABW32788.1"
FT                   /translation="MTLINYVKGIGTLATNKPGLFRPNIDKLKTSLGTLNTSLPTIGVS
FT                   SLDSSTIDSGFNLVNLLADIFTFNFRKKNSKDYGYLL"
FT   gene            16136..16618
FT                   /locus_tag="AM1_E0019"
FT   CDS             16136..16618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32789"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP53"
FT                   /protein_id="ABW32789.1"
FT                   /translation="MKKIVNVGYIPLLESEKRIVNLYFENHTPDSGVTNTLSDFIASHQ
FT                   LTESYNTALNKTIMRKIAAESYIKILDETADSHQKLTNIFLKKKSINDPKIEKKCKKFF
FT                   EEGKELRKDKEKKTKQVSDELEIESLSKEEVEQVQQVLSQYYRKIKPLAKNINNAF"
FT   gene            16706..17104
FT                   /locus_tag="AM1_E0020"
FT   CDS             16706..17104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32790"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP54"
FT                   /protein_id="ABW32790.1"
FT                   /translation="MTNLNTEDLIKCRDHLNEIIENYMVKRRNIFPGSITRDQFLLFGS
FT                   KIRILIGISDEMTLMIVEGLLVSANENQQRIDDAVLVINNRIERLNQINQAIEDFANVI
FT                   NLFSGILGGIVSGSIPDLQKLLEPFFDG"
FT   gene            17407..17733
FT                   /locus_tag="AM1_E0021"
FT   CDS             17407..17733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32791"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP55"
FT                   /protein_id="ABW32791.1"
FT                   /translation="MPILSVTTDQNGFFMKTEEYDPPGPFPLNVNLSAKLLSPDQTKVS
FT                   SSLDIDAVGGETNQKRDFQINTGEEISLGEWRIDGGNNIIIVNGKTTPVRANTEIEIEL
FT                   NVSL"
FT   gene            18027..18764
FT                   /locus_tag="AM1_E0022"
FT   CDS             18027..18764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0022"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32792"
FT                   /db_xref="GOA:A8ZP56"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP56"
FT                   /protein_id="ABW32792.1"
FT                   /translation="MTNNKLSRYLVSQIAKKIPKAVFLKETNRKIISLTIDDIPAQNED
FT                   DKQSARKILEAIEAHNESFSTTVSATFFITTDHVKYESDKSKLDLDILKEISDKGHEIG
FT                   NHGKIDRRHASLSKIEFETEFLEAHQFLSQHISQPVCWFRPGQGFFNKSMFDTLITVGQ
FT                   SLGYQEKFALASMIPFDTLKFLDDPDFTLKNIGRFTFPGSILLLHGGFSHQAINTVDVL
FT                   NKLLPRLHEHNYQVVSLSKLMLS"
FT   gene            18781..19665
FT                   /locus_tag="AM1_E0023"
FT   CDS             18781..19665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32793"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP57"
FT                   /protein_id="ABW32793.1"
FT                   /translation="MASARENLESAIESIRNSSNEFAFQFRIIRFPNALIGIAEGDSWF
FT                   DYPPSWIEDPEKGDLINQLNTFKLGDERKFNILRIAEAGDTLENMVFGNDLDKLGEPRK
FT                   NQFLRTLALVRRYKPKFVLFSGGGNDVVGDGLEAFINHNMLKGKYGLLRDSYVDYILEE
FT                   VFREIFETFISEILDIDDNIQILLHGYGYAIPDGKPVVGDENFGFIGPWMAPTFARKRI
FT                   DFEDGQKIIIKLIDKFNILLKTIAHNNKNNVHYLDLREVIQQDDWANELHLTVTGYEKV
FT                   VKVYTDKLLEIFP"
FT   gene            complement(19880..19996)
FT                   /locus_tag="AM1_E0024"
FT   CDS             complement(19880..19996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32794"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP58"
FT                   /protein_id="ABW32794.1"
FT                   /translation="MIAEATTLRSKHRQIDALKHIEAALMLEELIHGVYDVV"
FT   gene            20261..20410
FT                   /locus_tag="AM1_E0025"
FT   CDS             20261..20410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32795"
FT                   /db_xref="GOA:A8ZP59"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP59"
FT                   /protein_id="ABW32795.1"
FT                   /translation="MLRHSCGYHLANQGLDTRLIQDWLGHRNIQHTVTYTMLNPKRFGE
FT                   IQWG"
FT   gene            complement(20932..23652)
FT                   /locus_tag="AM1_E0026"
FT   CDS             complement(20932..23652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32796"
FT                   /db_xref="GOA:A8ZP60"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP60"
FT                   /protein_id="ABW32796.1"
FT                   /translation="MESTKNNKTLSSISFLLLSLLVIYLLTINIACWIIVISIIFIYLR
FT                   KISFHLWVPTIIGILSLIIFGYIDQSLEIYRSYIYDQEHLKVIISTFFVLLLSILVCMS
FT                   GRLLSEKYVFNKIKNTNGESLTYSKWFEKEETVEPEQKLHLNKLHAQYSALKYIPRIIG
FT                   LLPTYGLLTGIYKVNRYKLYIDIGELSDSDLFALIWLAMTGVILFCLNQIIFYRRDIIN
FT                   IIKENLLLNKNEVKKKSLEKYENQILFNPVTEFLVITPALICFIFFTMPTIANTSGSYS
FT                   FQSLFVFITCLIFNIFLYLFNKNKIKCISSEVDKKKKLIEVNLLLISRIVITLLVFLLL
FT                   VPKYSSVKFIVFIGPISITALCLGSFSVIFSNIYYWGYSTPKEDFRYINILPGEKIPTI
FT                   TLIIILALISSQFNWNDNHQIRHIYGIKEQNKTENSKKKDIVLSIPDAFDSWIEKRNDK
FT                   NKYIEKNIAYPVYIVSAQGGGIYAAYHAASTLAKLHDTSDGKFSSHVFAISSVSGGSLG
FT                   SAVYSALVKEFAQQQNKNINSPTTINVHKKISPYVEKILGNDFLSPLFSLALFPDLLQR
FT                   FIPIPISTWDRVRGLELALEEYWDNTFNASTEMKNYENYFSNSYKEFWNLCEENPALVL
FT                   NTTNVETGERVVFSPFKFSTNGLNSFFDFDLVYPNIPLSTATFISARFPIFTPAGWFKH
FT                   YVKDETSATKRISKSRLVDGGYFDNSGVATARDIIDEILEDTQIYNPKTVKKSKEKVLR
FT                   ISLINIALVDSPDTRKFSDASHQGLNEILSPLRTVVNVRNSRANSIIEQAEDDLNTHPL
FT                   AVSNIKKNKNESNMKIIYNTRFIPIYLDNYIGERATLPLGWLLSKNTRMSIDTQIPEPD
FT                   NDLDSDSLCKSDESDSFVIEKYNFCISEEIKNQLQ"
FT   gene            complement(24758..25030)
FT                   /locus_tag="AM1_E0027"
FT   CDS             complement(24758..25030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32797"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP61"
FT                   /protein_id="ABW32797.1"
FT                   /translation="MTQIPSLTQQQLELLRLAKKDTVAELRLSYEFPVLDDSVPSGGHS
FT                   TFIQELIDHHFIQVQAKETSIRASEFQQENWSEFCDEIDYPRQAD"
FT   gene            complement(25027..25320)
FT                   /locus_tag="AM1_E0028"
FT   CDS             complement(25027..25320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32798"
FT                   /db_xref="GOA:A8ZP62"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP62"
FT                   /protein_id="ABW32798.1"
FT                   /translation="MTSDNQDTTPTRFSSLVDLSKDLLPILAVIGFLIGGLFFLINTSV
FT                   AAIVPTSESRLLDKIADNRIEIELLRKDMNTQFEGVNQRLDRIEQLLQNGQP"
FT   gene            complement(25381..25641)
FT                   /locus_tag="AM1_E0029"
FT   CDS             complement(25381..25641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32799"
FT                   /db_xref="GOA:A8ZP63"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP63"
FT                   /protein_id="ABW32799.1"
FT                   /translation="MDSCLLLSRSVDIDFSEWFLLKRKRAELSQTQLANELGVKPQSIG
FT                   NWENGRSIPTLNPCQVKKLCEMLNVTLEELCNAVHWEGPSQ"
FT   gene            25831..26142
FT                   /locus_tag="AM1_E0030"
FT   CDS             25831..26142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32800"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP64"
FT                   /protein_id="ABW32800.1"
FT                   /translation="MNTVLETPTTVNELEKWIDAQVTDPLHPEMVMVELQIEQYPGVRE
FT                   GGDLFEVFAPVICKPGLLRPRLEAWVKATYGNDHWLANWRTVPSTRQIDAENDYEDEF"
FT   gene            26211..26537
FT                   /locus_tag="AM1_E0031"
FT   CDS             26211..26537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32801"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP65"
FT                   /protein_id="ABW32801.1"
FT                   /translation="MKPTPRNKLVPIVQFTTQVELDCQQVAALNRLVLGSTDLSDDQAL
FT                   NLWQALNPWVMEFQHSTPRDVFASLRFIALAKPATEPEPLYPTDLLNSVGSNIETDSPS
FT                   CLCA"
FT   gene            26601..26978
FT                   /locus_tag="AM1_E0032"
FT   CDS             26601..26978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32802"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP66"
FT                   /protein_id="ABW32802.1"
FT                   /translation="MKDHPCLPEFPLDPPIVNAAYSPMAIVTIATAKSLMQSQELMLSG
FT                   AQKLFNPAVWPLLEPEIQRIPFDRQKAQCFRDCVAYLMAEATTLRSERRQNDALKHIEA
FT                   ALMLEALIHGGYDDLPFMSEQ"
FT   gene            26996..27391
FT                   /locus_tag="AM1_E0033"
FT   CDS             26996..27391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32803"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP67"
FT                   /protein_id="ABW32803.1"
FT                   /translation="MLNQAMPADAFIEEPFNEVIQMNPTTLPKPVPDNIELPSYELHTR
FT                   PTADNYRKFNVFYGSRLIGYVYINFVQGQSNFVGTTLDHRSFGPYSRRMKAAEAVLEAF
FT                   TAGLTGQQRMMVALANELVENMIVIAG"
FT   gene            27436..28284
FT                   /locus_tag="AM1_E0034"
FT   CDS             27436..28284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0034"
FT                   /product="KilA-N domain family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32804"
FT                   /db_xref="GOA:A8ZP68"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR017880"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP68"
FT                   /protein_id="ABW32804.1"
FT                   /translation="MNISEDIMETNILAHQIHGVSVGMQKADGYVNATKACEAYKVATG
FT                   KTKRTENWTRSARAKAYIAYVASVTRKSVTELVLVRKGGTPEEQGTWIHPDLAIAFGTW
FT                   LSVEFEYQLTQWVKEWESSQRPPINIDPDQPSPHEIESVLQATFGEVVEPARLAIVKSS
FT                   AIVGVHPEWSAIMSEGLDALPSLPPEEQTYTPTELGQLLEPKLSAIRVNKLLEAAGYQE
FT                   SYRTARNVLKWKPIDKAGDLAVITLEEKSNGKPIESLRWKHSVVDVLLSLVADSEQAKV
FT                   G"
FT   gene            28445..28693
FT                   /locus_tag="AM1_E0035"
FT   CDS             28445..28693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32805"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP69"
FT                   /protein_id="ABW32805.1"
FT                   /translation="MLELNQKPRDAALKLSKQCKILVSGRWKPPTRAAVVSEIREIVRQ
FT                   GSVVIGTHRAPDPGHGLATYLRWKYPDADQLELTHAR"
FT   gene            28683..29138
FT                   /locus_tag="AM1_E0036"
FT   CDS             28683..29138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32806"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP70"
FT                   /protein_id="ABW32806.1"
FT                   /translation="MQDRKILSLSRSTTQAVTPSQSQTNTPRAFRRPLEEILEDLRRPI
FT                   PGRFIKTKSKKGVALRFVSWYDIVRILEARAPGFEYDCSPHFGDGKTVVKATITIHGED
FT                   GSLSRSALGIADSDIESWGDATSNASSMALRRAAAEFGLGLHLYWEK"
FT   gene            29318..30124
FT                   /locus_tag="AM1_E0037"
FT   CDS             29318..30124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0037"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32807"
FT                   /db_xref="GOA:A8ZP71"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP71"
FT                   /protein_id="ABW32807.1"
FT                   /translation="MAIQNDSVQAYLKEMGRYPLLSHEEEIRLARQVKAGDLKAKQRMI
FT                   ECNLRLVVSIAKKHQHLGLPLMDLIQEGSIGLNTAVDKFDLAQGCKFSTYAYWWISEAI
FT                   KRALKSQSRTIYIPIHQWERAHRIKKAVRQLTQEKGRTPTLKELSAATGIKSSLIRNTL
FT                   QSFQAVSSLDQPVGPEQKDALIDLIQTEDAALSIMDGLEIEDALTRCMAYLTERERFIV
FT                   DQRYGLTDGQPKSMGVIGKQIGVSRERVRQILNIAMKKMTRQVRSA"
FT   gene            complement(30166..32028)
FT                   /locus_tag="AM1_E0038"
FT   CDS             complement(30166..32028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0038"
FT                   /product="haemagglutination activity domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32808"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP72"
FT                   /protein_id="ABW32808.1"
FT                   /translation="MNQSILLTSALAIWSVLLTPGLAQVSADRTLGNENSVIEQQRNRI
FT                   LIKGGASRNKSLFHSLKDLSIGTGQEVYFSNPNNINLILTRVTGGNPSNINGTLGVLGD
FT                   ADLFLMNPSGIYFGPNSFLDLNGSFLATTGSRFIFKDGKSFSAINPQPVQNLKLSIPIG
FT                   IQFGNTAQDINIQSVYVVDPSITTCMNLCFSEYPNLRVKPRNTISILGGGINFLRGGIQ
FT                   VLNGNIEIGSVAPRSYVSLQPTNQGWLLGYEDVGSFKDINVKNSSKILIDSSDSSRNKY
FT                   LRINSRNLNVENNGLIDTYSYFNGTGGNIFINTRNALNIDNSGTISSNSYQSSSGGNIL
FT                   INSKNTTLENMGKISSNSNVFGKAGNITIASKEILLRDNAEIGLFSSNAPGGSLSITGN
FT                   NLTLEDNASISMIVENQRLGDLNIELDNILLLRNKSKIKYDANGLGIGGLIDFDVRLLV
FT                   GLEESLIEIDAPLTQFNIESLGFFDSNGQFIIDAAEKYKESLAQPKDVIKSCRPGQSLG
FT                   NSTFVNVGRGGVPLGPHHIQTPPSIWQDLREPQISPQNSPSSTITETSNLTKRETYNQS
FT                   LTPASNPTIVEAQRWIRDKQGRVVLTANTSKLMTYNSGQSVASC"
FT   gene            32245..33354
FT                   /locus_tag="AM1_E0039"
FT   CDS             32245..33354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32809"
FT                   /db_xref="GOA:A8ZM09"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM09"
FT                   /protein_id="ABW32809.1"
FT                   /translation="MVERFGTLGVSPHLSSTPMIKIDFTAEEIQQLNYERYHHPHPRVQ
FT                   RRMEVLYLKSQGLSHTQICQLCQISRPTLAKTLRQYQQGGIEGLKTLEYKGQPSLLNAH
FT                   SDSVRAYFEQHPPRTSAEAQAVIEQLTGIKRSPTQIKAFLKRIGCRYRKVGYVPGKSSL
FT                   PEKIEEQEQFRHTRLEPLLEEAQRQERLVFFVDAAHFVHRAYLGFVWCITRIFIPSPSG
FT                   RQRFNVLGALDAITKDLVSVTNHTYINSHSMCLLLAKLALLDPVIPISVILDNARYQKC
FT                   QLVTDFAEIVDIELVYLPSYSPHLNLIERLWRFVRKECLYSKYYADFPAFKGAIQQCID
FT                   QCNGEHKAKLTTLLSLKFQSFKKVNILAA"
FT   gene            complement(33498..33635)
FT                   /locus_tag="AM1_E0040"
FT   CDS             complement(33498..33635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32810"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP74"
FT                   /protein_id="ABW32810.1"
FT                   /translation="MNSTNALAFLFVPRNRTFFYTLFYFSTEEVARMTPPKDRMFKDTV
FT                   "
FT   gene            33623..33814
FT                   /locus_tag="AM1_E0041"
FT   CDS             33623..33814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32811"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP75"
FT                   /protein_id="ABW32811.1"
FT                   /translation="MYYSSPSFLSDEMIEAEIGYIPSEVIEEGDDLDSQNNIEASPTVL
FT                   DLIGEAVELWVLKRGGDD"
FT   gene            33807..33968
FT                   /locus_tag="AM1_E0042"
FT   CDS             33807..33968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32812"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP76"
FT                   /protein_id="ABW32812.1"
FT                   /translation="MTELREFSFLVLHTSGEETVQTVVSTSKDLAESALYRWITDIKSL
FT                   QLLASKNE"
FT   gene            34077..34535
FT                   /locus_tag="AM1_E0043"
FT   CDS             34077..34535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32813"
FT                   /db_xref="GOA:A8ZP77"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP77"
FT                   /protein_id="ABW32813.1"
FT                   /translation="MSDNRVDWFGFALNKGLHLLEEFTQGITLPSWLAPLSMVGVLAAL
FT                   IKLIPSIEKGSFLAGIGGYLLLGLLIVNVIALSIFVYLPGKLVTFKSRSVSRTRLTLMR
FT                   LLLMGVVVMLRDMIKVALHLAFDLVILLLTALTYPSRQNEQPLNLQGC"
FT   gene            34707..34955
FT                   /locus_tag="AM1_E0044"
FT   CDS             34707..34955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32814"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP78"
FT                   /protein_id="ABW32814.1"
FT                   /translation="MLSKQTIPNASLEDAIQEESVQTLDGQGSSALYKDVDIYQILVAD
FT                   LVIHHKEILQNIPLEIAIQTMKSAWKLSHSTDEGFKG"
FT   gene            35085..35276
FT                   /locus_tag="AM1_E0045"
FT   CDS             35085..35276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32815"
FT                   /db_xref="GOA:A8ZP79"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP79"
FT                   /protein_id="ABW32815.1"
FT                   /translation="MKLIRKIVGFGLLVIGVPQVANGIQQIIETGGDPRVVGRLTAHVL
FT                   YIVVGLWLLLSKNRLKST"
FT   gene            complement(35342..35644)
FT                   /locus_tag="AM1_E0046"
FT   CDS             complement(35342..35644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0046"
FT                   /product="helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32816"
FT                   /db_xref="GOA:A8ZP80"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP80"
FT                   /protein_id="ABW32816.1"
FT                   /translation="MNQEEFTVTKGSQNVFADLGFDAEESQNLKIRADLMLSLRSFIQS
FT                   QGWTQQKAAQFFGETQPRISDLMTGDIERFSIDKLVKMLSRAGLEVKVEVGAKAA"
FT   gene            complement(35651..35989)
FT                   /locus_tag="AM1_E0047"
FT   CDS             complement(35651..35989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0047"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacteriophage N15 gp49 gene 49"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32817"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP81"
FT                   /protein_id="ABW32817.1"
FT                   /translation="MTDKPINWIGTSLEDISDFPESARRKAGFQLRLVQGGEKPTDFKS
FT                   MSVVGAGVKEVRIRTEDAYRVFYVAKFAEAVYVLHAFQKKTQKTSKLDIEIGQRRYQQL
FT                   LQYRKSRE"
FT   gene            complement(36075..36299)
FT                   /locus_tag="AM1_E0048"
FT   CDS             complement(36075..36299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32818"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP82"
FT                   /protein_id="ABW32818.1"
FT                   /translation="MIDVYSERLSDLSIPALIARSKSRSSLRLFILTVSYWLENPYAET
FT                   PYQQVFWFPQIVIFSEWYQQESINTFLNT"
FT   gene            36360..36773
FT                   /locus_tag="AM1_E0049"
FT   CDS             36360..36773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32819"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP83"
FT                   /protein_id="ABW32819.1"
FT                   /translation="MADIPSLSLPQLELLRLAKKHSVEELRLVYEFPVLDDNELSSGHP
FT                   PFIQELIDHHFIQVQEKGTSLCASEFQQESWTEYCDEIDYPKQTDWERWRQGFIVQLSE
FT                   GFESLMTPGKSLGQFSKVWIREIGLRGVQPSSL"
FT   gene            36770..36883
FT                   /locus_tag="AM1_E0050"
FT   CDS             36770..36883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32820"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP84"
FT                   /protein_id="ABW32820.1"
FT                   /translation="MSEAWGWDIALSLYILVSLFFQIQAASICSSKKWQMA"
FT   gene            complement(36993..37220)
FT                   /locus_tag="AM1_E0051"
FT   CDS             complement(36993..37220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32821"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP85"
FT                   /protein_id="ABW32821.1"
FT                   /translation="MITVGEIVVGEIAVGEGEMDDGGMDDGEMDDGEMDNGEMGDGGMD
FT                   DGEIADIEMMIGAGVEATNEAIFEISLTAG"
FT   gene            37548..37694
FT                   /locus_tag="AM1_E0052"
FT   CDS             37548..37694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32822"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP86"
FT                   /protein_id="ABW32822.1"
FT                   /translation="MEKYGIKWNLEGHDLSSFGAACHGLEFSFYKDSEHLDDSLGLNSM
FT                   SWY"
FT   gene            complement(37738..37911)
FT                   /locus_tag="AM1_E0053"
FT   CDS             complement(37738..37911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32823"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP87"
FT                   /protein_id="ABW32823.1"
FT                   /translation="MRVKIFADGLSKWYFEWLNRYRCLGKDYEIYLETIEVMINICFIR
FT                   LLMCRLVTLVSV"
FT   gene            complement(38055..38270)
FT                   /locus_tag="AM1_E0054"
FT   CDS             complement(38055..38270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32824"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP88"
FT                   /protein_id="ABW32824.1"
FT                   /translation="MSGHKTKPLSPLFKAQCFKPEGDEPRTAQVTFRLDQRLKDAIVEH
FT                   VDNPSEWMRMVLAQAAKEQGWLRDWD"
FT   gene            38416..38535
FT                   /locus_tag="AM1_E0055"
FT   CDS             38416..38535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32825"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP89"
FT                   /protein_id="ABW32825.1"
FT                   /translation="MRGTSLQPSILCTNQVHSPSVGAINTHPPDDALGMHQEA"
FT   gene            38638..38799
FT                   /locus_tag="AM1_E0056"
FT   CDS             38638..38799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32826"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP90"
FT                   /protein_id="ABW32826.1"
FT                   /translation="MDNSQTILDLLSQMQATADDIKRTCQETRERLGQQRRSIHDQVQE
FT                   TLDRYPLL"
FT   gene            38756..39643
FT                   /locus_tag="AM1_E0057"
FT   CDS             38756..39643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32827"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP91"
FT                   /protein_id="ABW32827.1"
FT                   /translation="MIRSKRRLIGIPYFDRYDLAIAVRHTDASQSCTTDIRDSARGLGA
FT                   DHHCESPTVLSFREFRHSNSMVNIMSNKNFEACTRNALTIAARQALGLAEDAKLRKHLI
FT                   ITYLPENVRKRDGEDADTTSELCQFAQQLKDGSVNLRGTEHCIRLAEILDLDDTQMAKK
FT                   AVKPEKKAKGLTRMQKAVYGLLKQAAMGDAVGVAAAYETALVCNLKNIAGILTTGETLK
FT                   GKQDEVSALVDEVCGLAGVQYKDTEGVEKYLLGLYPSYASDIAGAFEWHTAKAWSTARY
FT                   NIDQYLQSSQHQAA"
FT   gene            complement(39705..39821)
FT                   /locus_tag="AM1_E0058"
FT   CDS             complement(39705..39821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32828"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP92"
FT                   /protein_id="ABW32828.1"
FT                   /translation="MQEKPPLPLVIGPKKNLFIVDYQRNKVIPINSLALIQE"
FT   gene            39872..40012
FT                   /locus_tag="AM1_E0059"
FT   CDS             39872..40012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32829"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP93"
FT                   /protein_id="ABW32829.1"
FT                   /translation="MADIKVDEPFKLLLFNATEKYVQTYIKHHGHVQVIPLDAIYSGAR
FT                   S"
FT   gene            complement(40176..40316)
FT                   /locus_tag="AM1_E0060"
FT   CDS             complement(40176..40316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32830"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP94"
FT                   /protein_id="ABW32830.1"
FT                   /translation="MTTMTAMGIDAWKRNRTLVCADLISIFWQISAFFAGGQKVWVKAT
FT                   L"
FT   gene            complement(40288..40764)
FT                   /locus_tag="AM1_E0061"
FT   CDS             complement(40288..40764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32831"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP95"
FT                   /protein_id="ABW32831.1"
FT                   /translation="MKGPHGHKINIEKELDPNFEAPDHVLGYLAPSIGSFTLSQGNNPQ
FT                   KGHASFVWHHLESHEGSSHFDVDWHDDEMEYVGGLINNEYWCYKVVETPPEEDGPVYIA
FT                   FAREIMADSTSGKNDEGYRIIYIDHGFSHLWAWDAKTFDGHGDDHDDHDDGHGH"
FT   gene            complement(41163..41315)
FT                   /locus_tag="AM1_E0062"
FT   CDS             complement(41163..41315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32832"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP96"
FT                   /protein_id="ABW32832.1"
FT                   /translation="MVCCFAIGLIAGYFIGRNAGLGVVCDQAEFLCKLGRVDGKIQLDV
FT                   RVIEM"
FT   gene            complement(41536..41682)
FT                   /locus_tag="AM1_E0063"
FT   CDS             complement(41536..41682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32833"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP97"
FT                   /protein_id="ABW32833.1"
FT                   /translation="MSDFSDFKDLILISRKSQKSIPSDPSLGWRGISGNVTLLTAPRLQ
FT                   HAS"
FT   gene            complement(41713..43686)
FT                   /locus_tag="AM1_E0064"
FT   CDS             complement(41713..43686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0064"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32834"
FT                   /db_xref="GOA:A8ZP98"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP98"
FT                   /protein_id="ABW32834.1"
FT                   /translation="MNKQPNQGAEKSLNISDSVLKDVQIGGISGGDLELTQIQKVGVVN
FT                   VYGTVQVPQTPLSTTKPLRQDEYRWRQVLLSKVQQFWIDGVLSNSLHTRVLIELGLEER
FT                   SEYVHSPLAGVKEISSETINVLPNGTSAADVFENIGAGRTLLILGEPGAGKTVTLLKLA
FT                   ESLLARTSKDLSQPLPVVVNLSSWARQRKSIEDWLVQELYETYTVSKSLGKAWIEEEQL
FT                   ILLLDGLDEVDAQHRNTCVKALNQFIQTHGRTEMVVCSRIRDYEALTEELSLRSAIYVQ
FT                   PLTLQQIDDYLERSGDSLANLRSMLSQNSEIKAFASSPLILSIMSLSYQDSGWKDFSQP
FT                   IASDAFHQQLFDTYIQRMFKRRGTTLKYLQPQSRRWLIWLSQRMVQHSQVVFLIERLQP
FT                   NWLQTKPQRTRYQLASGLMVMLVFMLVFGLIGGLMLGSYLGLIFGSYLALFIGLLPSIV
FT                   IGFLRDIRTVESLRTSRKVAVNASLLGLIIGLIIGLTSGLYFGLSFGLIYWLLYWLLYW
FT                   LISGFRGPEVSFQKKFKANQGLWMTARNTLIFGLFFGLIGGIAFGLIGGFEFWLPIGLI
FT                   GFSIFGMIGGLYGGGAACLQHFTLRFMLYRMGYIPWNYSRFLDYAVERLFLQKVGGGYI
FT                   FIHRMLLEHFARMNLQSLQNNN"
FT   gene            complement(43700..44134)
FT                   /locus_tag="AM1_E0065"
FT   CDS             complement(43700..44134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32835"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP99"
FT                   /protein_id="ABW32835.1"
FT                   /translation="MSEENLPQSINISGGQNSNVQIGGIAGQDQTVNQTQQIGTDGMEA
FT                   QLTKADVVGLITQLEDLLQGAELPKSGASKALRHLETAKEEVQAKKPDKDYAAKSLKKA
FT                   TTVLKEAGETVAAGSSLWSKVKPIVEKITPWLGVATGFFL"
FT   gene            complement(44544..44696)
FT                   /locus_tag="AM1_E0066"
FT   CDS             complement(44544..44696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32836"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPA0"
FT                   /protein_id="ABW32836.1"
FT                   /translation="MVCCLVVGLVVGYFIGRNVGLGVVCDQAAPLCELGRVDGNVYRLR
FT                   PKRAE"
FT   gene            complement(44738..45370)
FT                   /locus_tag="AM1_E0067"
FT   CDS             complement(44738..45370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32837"
FT                   /db_xref="GOA:A8ZPA1"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPA1"
FT                   /protein_id="ABW32837.1"
FT                   /translation="MTTKSSNDAVSRTQLLEQFFNGIEDSEEELANTLKAMGLKPNGTK
FT                   FKQQTAYCIGIVRSWVDSGEITDYDALSQVWEERKESVNAAYEQESSALTSVQQGDMVA
FT                   GNDVGSHTGTDAGSHTGNNPAHNLSIPAQRSYDAGLQIAQGMEGRIQHNQELAAKVVDG
FT                   AFYRGLNDGLGKLGNDYQPEPLVTDQQVDDILDQVVENARHSREPNG"
FT   gene            complement(45351..45746)
FT                   /locus_tag="AM1_E0068"
FT   CDS             complement(45351..45746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32838"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPA2"
FT                   /protein_id="ABW32838.1"
FT                   /translation="MAKQKLKRSILTDVRQALQNVPPPKESEDISRRIAIEEMYEDIAS
FT                   LLDDGHTFGTIAQVLEKNGIDINDQTLSQYFRDITKARKKAENRAKLEARKRGHPGRTV
FT                   DSNGAIKATPSVQQISAEIIDDDDEIQ"
FT   gene            45756..46100
FT                   /locus_tag="AM1_E0069"
FT   CDS             45756..46100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32839"
FT                   /db_xref="GOA:A8ZPA3"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPA3"
FT                   /protein_id="ABW32839.1"
FT                   /translation="MISIAMRVYGTTCVDACVDACVDACVDACVDACVDACIHAWVRAC
FT                   GLAWKLYGGSLGNCLWLCLWSFSGDSMETVWGYACVGACGCTSVGIGVHSRKFRMLKCG
FT                   GYLKEALFIT"
FT   gene            complement(46182..46322)
FT                   /locus_tag="AM1_E0070"
FT   CDS             complement(46182..46322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32840"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPA4"
FT                   /protein_id="ABW32840.1"
FT                   /translation="MTQALQKPQSYSHRAVPEAAKKYSSYIPPTTAHALDEALNKAVTM
FT                   Q"
FT   gene            46762..48735
FT                   /locus_tag="AM1_E0071"
FT   CDS             46762..48735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0071"
FT                   /product="TrwC protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32841"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR024385"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPA5"
FT                   /protein_id="ABW32841.1"
FT                   /translation="MISNSKVSGRGLGHYHAREDGQEAPGHWIGQGAKELGLNGEVKRA
FT                   DLEAVAHGTAPNGMRLKAKRSQWRQGSYRNGHRAGTDATFSPPKSVSIIGLVGGDKRVI
FT                   EAHEHAVLDTLKEIEETCSIAKIRTGGIRRNEVTGKLIIAKFDHRTTRPNDQGIPMPQI
FT                   HTHSLIFNSTKCKDGKWRSLENWKFFRTDKKRLRRHYINGLGERLKEIGYRIKSERDGL
FT                   HFQVEGITRSQELAYSERTKEIERELGESANGVRYKKGRFAALKTRNPKVPFEHERVHK
FT                   QWKEMAYREGIAFDRVPGLVRTPKEIPLPTRVRLELKCLQISHRIKAQVSRVHEVWDKT
FT                   HGKVDISHYSDADLMKLLQPKHLSDKHWNELVVESSIEPAIASASFETVPGEDAVELVL
FT                   GKKLESLGGYAQQYVTKSVEGLLDSYKHLEDGGLWCPGSGEYGQLKPESPRKDEKGKTI
FT                   KYENPPGVPLGVMLPEGPGIDWDEIRRNVNVPVGITEGKKKAASASSRGLNTIALSGMN
FT                   GGLKNGDLRDDLKGFDWKGRKVYLVLDKDPSHKLKTLRDGARELYKLGAMLDYYGADVV
FT                   IGTIPGKLKEKVGLDDHFSKGRTLADLRWRSVDDFGLNSPYLTQKYRNHNKERMERGYS
FT                   AYDNPIVREDGTRNDLDFGLGR"
FT   gene            49116..49535
FT                   /locus_tag="AM1_E0072"
FT   CDS             49116..49535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32842"
FT                   /db_xref="GOA:A8ZPA6"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPA6"
FT                   /protein_id="ABW32842.1"
FT                   /translation="MTESEYLEKEAEYTRAAVLTLIDKIEELERYALITTGAIWSWAAA
FT                   NNQSSAIHYLLWSPFFINSLFAFRAYVKWRHLKLHMEYLANLESKLDLKISIGIGNTTL
FT                   KKWGKLAEKTGSSFWIILVLVNFFVSLFAPSLITS"
FT   gene            complement(49598..49936)
FT                   /locus_tag="AM1_E0073"
FT   CDS             complement(49598..49936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32843"
FT                   /db_xref="GOA:A8ZPA7"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPA7"
FT                   /protein_id="ABW32843.1"
FT                   /translation="MSYRRYEYFVISCNPIFGIYAQIVTYTLMLVIPIIVVTYSGEGIQ
FT                   AAFEYKLGMRTKKSCIKKTAKYAPLLSDWCLNTSEVQAKREAERKEREYRTWLLHGGWR
FT                   YAPKRTGK"
FT   gene            complement(49926..51593)
FT                   /locus_tag="AM1_E0074"
FT   CDS             complement(49926..51593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32844"
FT                   /db_xref="GOA:A8ZPA8"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPA8"
FT                   /protein_id="ABW32844.1"
FT                   /translation="MYTNANTTTQQPTFFESKWFRQNAPDFILLGFLVLVAVIAKNYQG
FT                   KKKKLAKGGIGDQAILDRARRQGIKELGTTLNKSVLWLGDPESKDTIWFRRVLPGILVE
FT                   GGPDSGKSFTFFNQFMLSVVFQGWGCVMVDFKYPKQTARIADYAKRCGYEVGVLAPTFP
FT                   ETGTLNPVDLLRSPIDTIRAEEIIKVAKLNMVQSKVQSEGDKFWDDASTQTLAAGLCLI
FT                   KTWKYADILTLRAMLSLDDLPQRLKDNRDQIPPSIFAMFGQVIAAQRNARQFTALLSTC
FT                   LQLLDKMTALEFLPSIIGKTTVPLDVGPKQMLIIGLNRAYKEVLSPSIGMFAHAVIELN
FT                   LTQPRETPLAFFCDELPALTLPKIKNWLSEGREDGFCGILGFQSVHQLIERYGKEGAEI
FT                   IYTGSPTKAFMNPNNINVAHQMAKWTGDIEVDYTLKSRGRNKGGSSSNVSDQVKVKLAL
FT                   EATEINRMPQGTALMVSPGFETKTEAFIPVKRRIRVPEKNQRIIQLSEQRWKTHMRPEL
FT                   ISASRSKPYTQEDIRLRTKYAAEMLPLAKKEVSEDDEL"
FT   gene            complement(51597..52049)
FT                   /locus_tag="AM1_E0075"
FT   CDS             complement(51597..52049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32845"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPA9"
FT                   /protein_id="ABW32845.1"
FT                   /translation="MPNSDEYTGVRKYEATELAREMNQIVFGLLANAFPLQKDNKGRDN
FT                   KAKDDKGKGKDKFSRKPRELGRKLHEINKQNGKRLTDGRYVFRGKNFIIESKNARNVRL
FT                   IRNGQDKPALELRKGFVQANDITRSEAASIHRNHEKTLERTGRDGR"
FT   gene            complement(52115..52447)
FT                   /locus_tag="AM1_E0076"
FT   CDS             complement(52115..52447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32846"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPB0"
FT                   /protein_id="ABW32846.1"
FT                   /translation="MDEAQATLCSSEKFIRKRGQDWTNWMLSYGGKMYRVRFYAGEKLL
FT                   YSVANNPTEQQTREYFMRYLPIDLALDATAIHLKRCESRNLNPLDHLPDPSKLEGIKAA
FT                   ATANVP"
FT   gene            52647..54383
FT                   /locus_tag="AM1_E0077"
FT   CDS             52647..54383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0077"
FT                   /product="transposase, putative"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32847"
FT                   /db_xref="GOA:A8ZPB1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPB1"
FT                   /protein_id="ABW32847.1"
FT                   /translation="MPNKRIDSYHTRVYMNGRDLGLKQAEAAYIAEISTRTGQRIEAGT
FT                   HQPNRGRLQDQRTVPDPLADVWEDELEPMLRRDPRLKPMTLYEYLQDKYPGQYPQVLRT
FT                   LQRRVRTWKALHGPSPEVMFELRHEPGVQGFSDFTELKGITITIAGKPFEHLIYHYRLG
FT                   YSGWRYAQIIQGGESFVALSEGLQNAFAACGGVPTQHRTDSLSAAYRNMCGRRSKNLTR
FT                   LYDELCDHYRLEPTRNNKGVAHENGSIESPHGHLKNRIKQAIYLRGSADFTSVGEYQAL
FT                   IDAQVAKLNQQCQAKYEQEKEHLQPLPKYRTPDYEVLTAKVSKRSTIDVRCILYTVPSR
FT                   LIGRQLELHLYHDRIVGYLERHPVVELPRKRVSGKGKRRDRCINYRHVIGSMRLKPRAF
FT                   IYCTWQSDLLPNPEYRQIWEQLKAQFDLEQAAKIIVEALYIAAVQDKEQAVAVYLQQQL
FT                   RSSSLTLNRLKKQFEPPQMKQVPDLSIEQHSLELYDKLLPSCSVPAEPLPAPEPLFKKA
FT                   QALPHVDPLGIYRIPSHAGKLVLCGILTSLVRNGGPKKRTSSPKTCSHRSQAPKRKKFY
FT                   QL"
FT   gene            54124..54825
FT                   /locus_tag="AM1_E0078"
FT   CDS             54124..54825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0078"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32848"
FT                   /db_xref="GOA:A8ZPB2"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPB2"
FT                   /protein_id="ABW32848.1"
FT                   /translation="MTNSSPPAQSPLSPYQHLSLYLKKLRLSHMLTHWESIESQAMQEN
FT                   WSYAEFLLALCETEAQRREQARLKRALTEARLPNAKSFTNFDFSHCPQLNPAPLMQLAA
FT                   DPGWLERAENCLILGPSGVGKTHLATGVSKKMLEFGKRVKFFAANALVQQLQQAKLQLQ
FT                   LHPMLKKLDRYDLLILDDLGYCKKSEAETSVLFELIAHRYERKSLALWELACSSPTFSV
FT                   FPFSSLWNDLR"
FT   gene            54846..56090
FT                   /locus_tag="AM1_E0079"
FT   CDS             54846..56090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0079"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32849"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKW2"
FT                   /protein_id="ABW32849.1"
FT                   /translation="MDNSIRIPLNLPDIRVLELSKTERGDWLIKIESTLQGTTCHQCGR
FT                   EITDLHCHDQPFRIRHLPLFEVPVYLEIRPKRYRCKYCDDHPTTTQHLEWHEPRSPNTK
FT                   AYERWLLRILINSTVSDVARKLGVSEDIVSGIIDRWIAAQVDWSEYADLKVMGMDEISL
FT                   KRGHRDFVVLITIPTTDGVDILAVLADRKQQTVANFLQSIPIDLRQTIERVCTDMYQGF
FT                   VSAVREQLPQAKIVIDRFHVTKAYRNCADTVRKREVKRLRRELSKQEYDSIKGAMWPFR
FT                   KRPENLKESEQQLLERLFAYSPQLKQAYNLREKLTQIFEGRYTKHGAKCAIRAWCKQVL
FT                   KSDIKEFDCFLTTINNWMDEMTNYFLEGWTSGFVEGFNNRVKVLKRRCYGIFDIERLFQ
FT                   RISLDLNGYQTFAVT"
FT   gene            56138..56335
FT                   /locus_tag="AM1_E0080"
FT   CDS             56138..56335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0080"
FT                   /product="transposition helper protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32850"
FT                   /db_xref="GOA:A8ZPB4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPB4"
FT                   /protein_id="ABW32850.1"
FT                   /translation="MLITANQPFSQWDDIFTDSMMAVAAIDRLIHHGLIIEIQADSYRR
FT                   KSATQRTAQTQSQPQKSQSK"
FT   gene            complement(56414..56731)
FT                   /locus_tag="AM1_E0081"
FT   CDS             complement(56414..56731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0081"
FT                   /product="transposase, orfB, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32851"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPB5"
FT                   /protein_id="ABW32851.1"
FT                   /translation="MERRYPNAQVEVWSFDEHRLGLKPIIRKIWAPVGQRPIAEVDHRY
FT                   EWTYLYGFVHPATGDTEWLILPRVNGECIGCQPHRRCRDNHKADQPPNLNRIIWRTLPL
FT                   R"
FT   gene            complement(56745..57146)
FT                   /locus_tag="AM1_E0082"
FT                   /note="fragment; similar to N-terminus of transposase"
FT   gene            57242..57652
FT                   /locus_tag="AM1_E0083"
FT   CDS             57242..57652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0083"
FT                   /product="glycosyl transferase, group 2 family protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32852"
FT                   /db_xref="GOA:A8ZPB6"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPB6"
FT                   /protein_id="ABW32852.1"
FT                   /translation="MAFSNDALYRGDINRIWYKNYYLGNGRNLFSTLYSAIVVLVVYTF
FT                   PWIGLGLAIVLESDERSAAGVVPVILGIGAISMQYYFRLQTAQRFHQPLRYAWLSWLSG
FT                   ILVSSIAVGSIIKTETGWGWTWRGRPLKVQAQ"
FT   gene            57656..58531
FT                   /locus_tag="AM1_E0084"
FT   CDS             57656..58531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0084"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32853"
FT                   /db_xref="GOA:A8ZPB7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPB7"
FT                   /protein_id="ABW32853.1"
FT                   /translation="MRKNTLSLSTYTAAFTDQGQGAPLIFLHGFLGSSDCWHRIIPELQ
FT                   IAYRCLALDLLGFGGSSKPRLRYNIWHQVEFLQQFIQTLDLQNFHLVGHSYGGWTAAAY
FT                   SLASTGLGWTSQGWSSFTPISTSIPPPTSLNLIAPAGIRDDSFAGRYTYMKPLLWETPL
FT                   VDWGLKLIAPMARVVNQQSAFQKVFQARQELLRQPVAKSFLVDRWRPEDAIDTVDQYLQ
FT                   QLQIPTQVIAGQQDTTIPLWHCQTYAEKIATSTINVIPNAAHDLIQTHSFEIVRIINRF
FT                   LEQFQNRVAG"
FT   gene            complement(58549..58674)
FT                   /locus_tag="AM1_E0085"
FT   CDS             complement(58549..58674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32854"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPB8"
FT                   /protein_id="ABW32854.1"
FT                   /translation="MNDGDFMRMAIEESKKGDSLYGAVLVKDGVDRKKIVIVKLS"
FT   gene            58895..59812
FT                   /locus_tag="AM1_E0086"
FT   CDS             58895..59812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0086"
FT                   /product="methyltransferase, FkbM family"
FT                   /note="identified by homology with TIGR01444:
FT                   methyltransferase, FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32855"
FT                   /db_xref="GOA:A8ZPB9"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPB9"
FT                   /protein_id="ABW32855.1"
FT                   /translation="MELNKEYVRKIIKWLKLAYPELPFTMYDIGVRYGIHYLYIDLLSL
FT                   NHFKVIGFEVDKKEAENLTKNSKSGISEVWPYAVAKSKGRRKIYITKHPGCSSFYPPNQ
FT                   ELLSQYSSFDFFKISETKFVETISIDDFIEGHETTAPDYLKIDVQGAEYEILEGSELAL
FT                   NNITGIFLETQLREIYLGAPLFPEIHMFLNNLGFRLIFCEYNADLGGELIEFDVAYVRD
FT                   YKSVTSKKDLLKLVLFCCIHKNIDYAVNAVRNSSLTDSEKQEILNLFSRPLQPEKMLVK
FT                   SDSPYISSNIELRKIHEDWWINKP"
FT   gene            complement(59904..60320)
FT                   /locus_tag="AM1_E0087"
FT   CDS             complement(59904..60320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0087"
FT                   /product="PIN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32856"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPC0"
FT                   /protein_id="ABW32856.1"
FT                   /translation="MFLLDTNVISELRKVASRKANKQVEIWATSTPGEQTYISAISVFE
FT                   IERGVLLTERRDKKQGQVLRLWLTDHVLNNYAERIIPISTSIAIRTAQLHVPDPMPAYD
FT                   ALIAATALEHGLTLVTRNTNDFQGTGVKLLNPWI"
FT   gene            complement(60320..60571)
FT                   /locus_tag="AM1_E0088"
FT   CDS             complement(60320..60571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0088"
FT                   /product="prevent-host-death family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32857"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPC1"
FT                   /protein_id="ABW32857.1"
FT                   /translation="MQSISSREFNQDVGKAKRAAEKEPVFITDRGTPAHVLLTVDQYYK
FT                   LIHSSKSVADLLAMPDCAEIEFESVRDADSTLREVDLS"
FT   gene            60701..62881
FT                   /locus_tag="AM1_E0089"
FT   CDS             60701..62881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="ankyrin repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32858"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPC2"
FT                   /protein_id="ABW32858.1"
FT                   /translation="MSANQPVPLLYSGQVGDYFGTEYEGLPANVHPSINDVGVQLIHRD
FT                   LIYLGVLTCSEFSQVQIYAFATPDRQTVVSVMAGVSELCGIDCVCKFEDGSFLTTTTTQ
FT                   IAHNAYDEQRLFRISFPELNAVELLEQHQSFAQEFEDRCGGVQAIFIDLLSLAQMVDEY
FT                   TLRQRSNPGHGILQFTTSVAQAGFTQMMMDDNNEDDLDEGDDDNVDQIEYDEESIAPLI
FT                   QAILQDDLDQIETLLAQGAELDPKDWQEEVPLVAAVYRQNPKVIQRLIAAGANLDRLDL
FT                   AVDCSPVGMAIKQNSPNLVTLLLHAGASPDSGDLSWTGLTLAINQDNLPILKILLEAGA
FT                   DPNADMEDYDRAIMHAASQGNLEMVQLLVTHGADVSAWSQGDTAIMSAAHNEHKAVYEY
FT                   LYPLVDDETRRYADKHGQAVMAKAAKRKARLSNKGAEKLGDAALYGKLAQVKQLLAEGI
FT                   NPNVITECGKSPLMMAAMYGHKVVMAALLDAGADPNLGSDEEYAEGTTALMYIANSFFA
FT                   TNRVEVIQFLVEHGADVNAKNHKGQTTLMVAGENVDVVKALIEAGADVDLRDNEGNTAM
FT                   MLGSWAVQQLLKQAGASEEGLNDIALVKAARKGDLSIIEVLLQEGANVNYGDGSALVAA
FT                   TGSGHLAVVDRLIKAGADVNLGWRSGFTPIADAAYSGNLEIVERLLSAGADPFQKTHDE
FT                   EFHDALGYAELGQAEGHHRDKDYGAIIERLKR"
FT   gene            complement(63032..63187)
FT                   /locus_tag="AM1_E0090"
FT   CDS             complement(63032..63187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32859"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPC3"
FT                   /protein_id="ABW32859.1"
FT                   /translation="MKQFIYAYLAANCTPAIVKASCNALDLIYELGQHILEGCVFKDGL
FT                   YPKVTI"
FT   gene            63269..63907
FT                   /locus_tag="AM1_E0091"
FT   CDS             63269..63907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0091"
FT                   /product="Conserved CobQ/CobB/MinD/ParA domain"
FT                   /note="CobQ/CobB/MinD/ParA nucleotide binding domain
FT                   (PF01656 and COG1192)"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32860"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPC4"
FT                   /protein_id="ABW32860.1"
FT                   /translation="MIITLASLKGGSGKTSLAVHLSHAISLEKKKVLLVDADPQASAQN
FT                   WAAARETKPPFTVVGMARNTLHRDLPDLLDNFDHAVIDTPPRVSALARTSILAADLVII
FT                   PVQPSSYDVWAAAETVALLDEAKGFKPELKAVFVVNRVLTRTLISKDVVEALAEYDVPT
FT                   LSNKITQRVAFAEASSGYTVLESEPKKSAAKEIKALSKEILKFLELKRW"
FT   gene            63904..64671
FT                   /locus_tag="AM1_E0092"
FT   CDS             63904..64671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0092"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32861"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPC5"
FT                   /protein_id="ABW32861.1"
FT                   /translation="MKKSRIASKPNIPKSADEWVSAGGLDPDSKSTANENVASWDFSLI
FT                   QDRDNDTREINQSHVESLADSIAVLGLIEPLVIDRDGKLLAGGHRKVAISLLAELNPSA
FT                   YKTHFPDNLVPVRVINISSDENPDHAIEIEISENELRKDYSKAEILAIAERLRKAGYKD
FT                   NPGRPKKGEKRLKPALSTIFGKSIRTVERYLAEETPSNGEVLKLSTNVHLKKALTHLDT
FT                   WHKTRGRTKKEQALAKKLLELKPLMEEILDAKS"
FT   gene            complement(64765..65571)
FT                   /locus_tag="AM1_E0093"
FT   CDS             complement(64765..65571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0093"
FT                   /product="esterase/lipase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32862"
FT                   /db_xref="GOA:A8ZPC6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPC6"
FT                   /protein_id="ABW32862.1"
FT                   /translation="MHQPSYFSGFDLLSSDIEKLLMPDAKPQFCKAKPNGDAVVICVHG
FT                   FTGNPYDVSPAISTLSNMGLSVVAPLLPGHGYRERHKQEQAFSNITPEGMLSAARQEIA
FT                   RAREHYSKVGMFGFSMGGAISLTMASEGLIDACAVAAPALRLSRKAEILIPLLSWASFS
FT                   IEAPPQEPFYLPVYEFYHSKALRTLWQLSGYARRRLSHIQCPVFAVHSHKDLMVPPIVL
FT                   GMMQENIPFEIETAWFDESGHSMLLDVSGPRVSSAIASFFQRQFLH"
FT   gene            complement(65690..66502)
FT                   /locus_tag="AM1_E0094"
FT   CDS             complement(65690..66502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0094"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32863"
FT                   /db_xref="InterPro:IPR021246"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPC7"
FT                   /protein_id="ABW32863.1"
FT                   /translation="MQGTLRKMKTKLNEVVGYTLPVGDQSLQLNPLLNQNLELEFLGQI
FT                   YCQNCGRKTSKSFSQGYCYPCMKSLAACDICILKPEQCHFHMGTCREPEWGQHNCMVDH
FT                   VVYLANTSALKVGITRQSQIPTRWIDQGATEALPIYQVKSRHISGLVEVKLAQLMSDKT
FT                   NWRAMLKGNNDPIPLDEKAHEVRPQIQETIFALLKKYGENAIHQLDATVTKINYPVKRF
FT                   PKKISSFNFDKTPLVSGILMGIKGQYLIFDSGVINIRKFTGYEIEVRA"
FT   gene            complement(66620..68491)
FT                   /locus_tag="AM1_E0095"
FT   CDS             complement(66620..68491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0095"
FT                   /product="exoribonuclease II"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32864"
FT                   /db_xref="GOA:A8ZPC8"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPC8"
FT                   /protein_id="ABW32864.1"
FT                   /translation="MPRKPFSKSVIEEAETIALHTSINQRPQVPGITIDGAHSRDLDDA
FT                   IWIEEKEHLTTLSVHIADVAELVQPGSLVDQEARSRIQTLYFRHNNTPMLPRCLSEDKL
FT                   SLLEHQLRPTITLEITLNQSAEIQNVEVYESRLSSHKRFTYEQADEALMDISRPDSNFI
FT                   YRCWQWAEQLYQRRIQSKNFDGLTLPEGYYLDENGNLLSTDFARYQSYLIIQEFMILAN
FT                   TAMAQWLDQHNIPAIYRNHMHRAIGPEQTHQFAALVNAQSEEDTRRVLMSWLNPAEYGP
FT                   EPHGHFALNLSAYCHFTSPIRRYPDLINHRMVKAHLKGQSYPYSIEDIQALSQHIEATI
FT                   QAQEETHKTYCKAQQRQLYEAQLQSPEIIAQLPQGEFSLLLRFALEDQQGENLKAEAET
FT                   RLQSGNVTVEDLFVLLLLGDELQLQEQVLEYLGDHLYDAASIVSIALNQIEAWHSSAYV
FT                   EVSQEPPFMTWLEILIGEQLWTTAKPGISMNKTGAKHQACLAWLKAKFEGTLVHPEHRE
FT                   APPIPQPSAPKPPPVIHKLRQYQEGHNCLSLLMELCQGLQWPQAEFEIVEHEQGFHCEC
FT                   RLKVDDEVIIGSGIASSKKTAKHRAARPVVEQLQKTLAQDESLVAAC"
FT   gene            complement(68549..70009)
FT                   /locus_tag="AM1_E0096"
FT   CDS             complement(68549..70009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0096"
FT                   /product="cytochrome P450 family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32865"
FT                   /db_xref="GOA:A8ZPC9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPC9"
FT                   /protein_id="ABW32865.1"
FT                   /translation="MAWTVPGPKSTPIVGTTGNTFRFTQDPIGYSNQLFQDYGPMVSLC
FT                   EQGGTNLFTPFEKCPGTVIVHGPDLIRQARTPHSQWNLTPLSMTLYPMEAVSNRKQPLK
FT                   HFLVGLWGVNGDEHRLQRRLMMPAFHTRHIQSYWQDMVNITQSSLSHLRPGTTVNLVEE
FT                   TRLLAMRIVTKTLFGEDSGKAGQGVGHLLEQALAVLSQPLTTLMPYDIGGLPYRRFLNL
FT                   IACFDREMRGIISAKRARQSKDNDVLSMLIQARDEETGISLSETELLGHVGSLFAAGHE
FT                   TTSLALGWTVLLLSQHPDIAADLMDELGAVLQGDPPRLDQLDQLPLLERVIKESLRLIP
FT                   PAPFTWRYNNQIVDLGGYSLPVGTEVYCSIYATHHMPDLYENPNCFDPSRWERINPDMW
FT                   EYMPFSAGSRLCMGAAFAMMELKIVLSIMLQTFRMEFVPSVSVDRYGIITIAPKNGLPM
FT                   HLHHPDRNFTAGVGGVKGNIREMVQLPA"
FT   gene            complement(70416..71192)
FT                   /locus_tag="AM1_E0097"
FT   CDS             complement(70416..71192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32866"
FT                   /db_xref="GOA:A8ZPD0"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPD0"
FT                   /protein_id="ABW32866.1"
FT                   /translation="MGAMNSRKKSSPNYSFSLEFNPEILRIIAYVSLITLLVIGYVLTN
FT                   TVVDVDPETIVIYKIFGFNHACNVIDHEPSRTVSAMLLPFWEVPFLLYVIFNFLRIQDA
FT                   YRENRAPRYTFLIALYFLPLEILLTVWFRIVFVWSPEVNFLNHYLPYVGFQILLFLVAF
FT                   ENFLYFYAMKALPFKNNRSIALGYLSLLLVVTFLYVIIGLSLGLGYPLLEPTTNPTHRA
FT                   FIQALANLYTFLVLPVPLCLSFFEMKRSPKHTLTVS"
FT   gene            complement(71400..71531)
FT                   /locus_tag="AM1_E0098"
FT   CDS             complement(71400..71531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32867"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPD1"
FT                   /protein_id="ABW32867.1"
FT                   /translation="MVNENSSRFNLGLISRLIAYDSLISDEMVTLVIKNLDLYPYYS"
FT   gene            complement(71629..72093)
FT                   /locus_tag="AM1_E0099"
FT   CDS             complement(71629..72093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32868"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPD2"
FT                   /protein_id="ABW32868.1"
FT                   /translation="MQVNSQIDESVQQLCVWYGDGHDDLSPKADQWRLILERPANQPIT
FT                   LINFFKFRSIAEYPQDNHQISENISGQDAFNQYASISISTMERVGGRFLLVGPYEGVFL
FT                   GQDEDWDLVAIGSYPNLESFMGLHTDLDYRNAYCHRKAACEHQKVILCSS"
FT   gene            complement(72148..72933)
FT                   /locus_tag="AM1_E0100"
FT   CDS             complement(72148..72933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0100"
FT                   /product="short-chain dehydrogenase/reductase SDR,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32869"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPD3"
FT                   /protein_id="ABW32869.1"
FT                   /translation="MNNNLLANKTAVIFGAGGHLGQQVTRAYAEQGANVFASSLNGVSG
FT                   SGQSDIKEVTQVDALNEDEVQTYLDAVVAETGTLDIVTNLTGSNPADFNHGKPAVDVSL
FT                   EQFLIPQKTATATQFVTAKAAYKHMAHQHKGVIIFITSTLSKVGSPWSPALTASHAATE
FT                   GLLKSLANEWGPDGIRVVGVRSEAMPESPTINYTFTEMGKNLKLTRAQMQAFIEQNKTA
FT                   LKRLPSAQETAGVMVLAASDLAAYMTGTVLNCSGGHVLE"
FT   gene            complement(72943..73086)
FT                   /locus_tag="AM1_E0101"
FT   CDS             complement(72943..73086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32870"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPD4"
FT                   /protein_id="ABW32870.1"
FT                   /translation="MTLTVHTISGSPCGWRALVGLTLQGVDHKTHYLQGAKREHGAPEF
FT                   LK"
FT   gene            73213..73569
FT                   /locus_tag="AM1_E0103"
FT   CDS             73213..73569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0103"
FT                   /product="transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32872"
FT                   /db_xref="GOA:A8ZPD5"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPD5"
FT                   /protein_id="ABW32872.1"
FT                   /translation="MVSQNKASEKVLEPPIPIIEGVCPMPDIAQLIGGKWKLIILQILI
FT                   FQGTKRFGELRKLIDGITQTMLTNQLRALERDGLVKRKVYPEVPPRVEYSATKRALDLE
FT                   EMFHAMHAWWERNC"
FT   gene            complement(73538..73663)
FT                   /locus_tag="AM1_E0102"
FT   CDS             complement(73538..73663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32871"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPD6"
FT                   /protein_id="ABW32871.1"
FT                   /translation="MGRGYGWDVYERHIPEEHMKWPYQKRQRTIGLNSFFPTMHA"
FT   gene            complement(73632..74279)
FT                   /locus_tag="AM1_E0104"
FT   CDS             complement(73632..74279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32873"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPD7"
FT                   /protein_id="ABW32873.1"
FT                   /translation="MYTQLELDFVSALASALDEPEQADISLMCASLDQHLQGRSPQEQL
FT                   RVAGDAIKDMAEVCLQRAELMIQGWEERYNSEGPVLDEDFLAGMVQQTMFLDVSDLCRQ
FT                   PKSRKRRQGFTGKSVESVVGEVSKDSVLEFVDELESGEEVALKISHVEDVGAWVGAIRE
FT                   FLEGKEDAVLFGDLVRGLGLAPVAVLIGVLLGGFRVEQRGGFYGQGIWVGCL"
FT   gene            complement(74263..74793)
FT                   /locus_tag="AM1_E0105"
FT   CDS             complement(74263..74793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32874"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPD8"
FT                   /protein_id="ABW32874.1"
FT                   /translation="MARPINKKCLDCSQRSQQEAIRLHGPGTETACWNPKTCPRKRSHY
FT                   RNRKANNDKQRGLYRDLKVAHQQIETVETIVVPVQAPPVAQLYLYKEKPKDAHLHALAV
FT                   SVWQGSEKLADIEPIHCMGMTNTQVNRYLREVLRVLRERFGITEFEPPIRLEPTECEIT
FT                   ECPLKDKRHVHSA"
FT   gene            complement(74874..75095)
FT                   /locus_tag="AM1_E0106"
FT   CDS             complement(74874..75095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0106"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32875"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPD9"
FT                   /protein_id="ABW32875.1"
FT                   /translation="MDNRKFQMLIQWSDEDSCYVVSLPDFPEINQPCTDGATYSEAAQH
FT                   GQEMIDSLCLWYEQEGKELPQPQTLQVA"
FT   gene            75203..75322
FT                   /locus_tag="AM1_E0107"
FT   CDS             75203..75322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32876"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPE0"
FT                   /protein_id="ABW32876.1"
FT                   /translation="MLPLTVTSLSGLSRKACLEQHGLDVTDFFGHGSSTNCPI"
FT   gene            complement(75714..81293)
FT                   /locus_tag="AM1_E0108"
FT   CDS             complement(75714..81293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32877"
FT                   /db_xref="GOA:A8ZPE1"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPE1"
FT                   /protein_id="ABW32877.1"
FT                   /translation="MKSNYQAMGTELSAVVMSETFKRLQSFALDDNFLDKLQLAFGSTF
FT                   SNDAAADLQQAWADGDYSELPNIEIRVAAEINGANGAFSTDTNTIYLSQELISFNAANP
FT                   ETIVQVLLEEIGHFIDSQLNSVDSPGDEGAIFSALVLGQELSPSALQQLKAEDDTAIIN
FT                   LDGQLIQIEQAEIIGGPGDEVLNGSNGDDTILGGGGDDTINGGAGNDSIDGGTGIDSID
FT                   GGSGNDTIVGGGSGFGFGDSINNPIPTDSVNGDEGTDLLIADYSQGVRAIFLTNLLGVP
FT                   TEVLVEFGVNVTTSGSSALIQDDPPGSFQEFINTEFYSSSEFENFDITGTNLNDSLIGG
FT                   TNADTLIGGGGDDTIVGSDGNNTIDGGDGNDTIESGAGDDTIDAGDGNDTIESGAGDDT
FT                   IDAGDGNNTIDGGDGNNNIESGAGDDIISSGAGDDIITSSGGNDTIDAGEGNDTVNAGL
FT                   ASGIADGGEGTDLLVVDFSELNVGITMSSSFITAGSSNFNFVHVNFENFDITGTNQADS
FT                   INGDASADTLNGGDGDDTLDGFGGNDVIDGGAGDDLLIEADFSSTTDALNIDDTSSKTI
FT                   NTGGLSIANIETIENLLTGSGDDTINYVNFRDYSIDTGAGDDVINTGAGDDVIRAGEGN
FT                   DTVNAGLGSGTADGGEGTDLLIADFSELNVGITMSSSFITGGNTTFVHANFENFDITGT
FT                   NQADSINGDASADTLNGGDGDDTLDGFGGNDVIDGGAGDDLLIEADFSSTTDALNIDDT
FT                   SSKTINTGGLSIANIETIENLLTGSGDDTINYVNFRDYSIDTGAGDDVINTGAGDDVIR
FT                   AGEGNDTVNAGLGSNTADGGEGTDLLVADFSDLISSGITMSSSFITGGNTTSVNANFEN
FT                   FDITGTNQADSLKGDANADTLNGGDGDDTLDGFGGNDVIDGGAGDDLINLGADTDTDTV
FT                   TYNLGDGTDTINQFVRGVGGDILSFNGFQGVDVVSFNDRTQFHAQDGASFGEGTLLITL
FT                   VNTIDFTSDDLGINLTSSDGTQFRFENSNDPPVAVDDAFTIAEDTTTAVLDLLGNDTDL
FT                   DGDTLSIESIVGIALTPGTAQSIAVTNGTVNVSATGDITFTPDANYNGSVSFDYVVTDG
FT                   TATDTGTVNITVNPVNDAPIAADDTVTTDEDVAVVIDAALLLGNDTDIDGDTLSIGSVT
FT                   DPSNGTLVDNNDGTYTYTPDANYTGPDAFTYTISDGNGGTDTATVNITVRSTNDPPVAV
FT                   DDAVTTDEDVAITGNVLDGSSGGLDTDLDGDTLSVIDNTDPSNGTVSISANGDFTYTPN
FT                   PDFFGTDSFGYTISDGNGGTSVATVNITVNPVNDAPIAADDTVTTDEDVAVVIDAALLL
FT                   GNDTDIDGDTLSIDSVTTPSNGTLVDNNDGTYTYTPDANYTGSDAFTYTISDGNGGTDT
FT                   ATVNITVGSTNDIATVTDDSGSVTEDDDPNTLTTSGQVIVTDSDPGEAFATAETLIGTY
FT                   GTFTVDADGFWNYTADNTQAAIQELGLGESLTETFSVTSLDGTGAGTVTITINGLNELL
FT                   EGTSQADFLLGTGLADTINGRGGNDTLIGRGDNDILNGDGGRDTLEGRNGDDILNGGSG
FT                   ADSLNGGNGLDTLNGGNGRDTLDGGNNSDILDGGNGADTYLWDAGDDRDIYQDTGTTGT
FT                   DRITSLVENFNGLTATFDATSGIEVINREGDLAFNIRGAGTVGETWDFTDINLTNATIQ
FT                   GRGGDDNITGSNRADIIEGNRGNDTLNGGSGNDSLLGGGNDDVLTGGDGRDTLVGGSGA
FT                   DSLNGGAGNDLLQGNGGDDTFIFAGDFGRDTVVDFNGNADQIDLSSFAIGISDIDTNGD
FT                   GVIDSNDANARLVGGNLRLNLASLGGGRITFDSITSIDEANFTL"
FT   gene            82255..85848
FT                   /locus_tag="AM1_E0109"
FT   CDS             82255..85848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0109"
FT                   /product="WD-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32878"
FT                   /db_xref="GOA:A8ZPE2"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPE2"
FT                   /protein_id="ABW32878.1"
FT                   /translation="MPFTPEEAVISLNRILSAKNIDFRLSDVQSLIFSGCWENKSYAQI
FT                   AMDSGYEANYIKKVGSNLWQQLSTVFATKVTKNNIRVILTTHLQDTHNLSLPAVTPDHH
FT                   APHLDWGDANPLSTFWGRQQELMTLEQWVTQDRCNLITIQGIGGIGKSALAVKLAHQLQ
FT                   DQFNVVIWRSLKNLPPLTELMADLLLGVSHQQLTEIPNTPSELISLFVNYLQQQPCLIV
FT                   LDNAESLLQTGEQFGTYQPGYEDYGKFLRQIGEAVHQSCLLLTTRELPEEIAILAGELL
FT                   PIRVLKLAGLGTASAHQLLEAKGLMGTPEGTTALINFYRGNPLALKIVATSIQDIFAGN
FT                   IAEFLDQGNIAFKGIQRLLHQQFQRLSDLEVKVMNWLAIHREPMTPKQLLDDLTESFSP
FT                   GLLYQTLEALSRRSLIEQGIPIQHETEAPSLGFTLQPMVMEYIIDQLVAEFSQDIVNHQ
FT                   FSSLNQYALVQVIAHEYVRETQIRLMVEPILQRLEKTFKDSTRLVQHLKQFLAQMQTSS
FT                   LTIHYAAGNVLNLLRRCEADISDLNLSQLTIQQADLRSLKLHRVNFAQADLKTTLFSET
FT                   LGSIFDLAFSPEGDVLAIATNEEVKLYHYPQLREFASLVGHRILVWSLAFSEDGLLLAS
FT                   SGIDHTIKIWNVSTGLCLHTLEGHQAGVFSVAFEPQGSKGSEDYILASASHDGSVKLWN
FT                   VSQQICLQTLQVENKLPRKVSFDSIGEKFVVGYVDGSIRVSNSALSEECWLPSDIGSPE
FT                   SPLSFNPSNQTLAMGYGNGLIKLWNVSLQQCENVLEGHTSPILSLEYCANGQILASGSA
FT                   DNTVRLWDAQTGQCLKCLLGHFSRVSAIAWHPSTRSLVSGSEDSTVKVWNKQSGQLMKH
FT                   IYGHNDCVWTIAFSPNQPIIAVGSNDRGLRIWDTQTGQCLHDLAGHTGRVKTVAYSADG
FT                   QLLVSVTYGYEIKVWDPEEGRCLQTLQTSGKWCWDTALSHDGRTLAMSGGDNEIQLKNL
FT                   GTGQQLAPLVGHQDYSLGIAFSPDSQRIASTSWDQTVKLWDLSTGECLQTIPDDDWAWT
FT                   LAYHPFEPLVVTGCNGGTVKLWDITNGQCLNVLKGHQGLVMTVCFSPDGQTIVSGSADR
FT                   TIKLWDRHTGQCLQTLVGHADGIFTVAFSSFNQTLASGSVDESVRIWDFKSGECLQTLR
FT                   FPRLYEDMNIREARGLTSTQINRLKKLGATV"
FT   gene            complement(85907..86047)
FT                   /locus_tag="AM1_E0110"
FT   CDS             complement(85907..86047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32879"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPE3"
FT                   /protein_id="ABW32879.1"
FT                   /translation="MPSMEIVLQITEQLFRVNIRYGPNILCWRELFEAQWHPQTTILKI
FT                   K"
FT   gene            86087..87142
FT                   /locus_tag="AM1_E0111"
FT   CDS             86087..87142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0111"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32880"
FT                   /db_xref="GOA:A8ZPE4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPE4"
FT                   /protein_id="ABW32880.1"
FT                   /translation="MTVPEVKLIVLADQAATPIDAARSRTQPPKSTPADLRRTRVEEFM
FT                   RSREISSNTRKAYERDLKQFMDWTDKGWHEISARDLDRYKNHLKVEPNQRGQLRKNATI
FT                   NRNLAALQSFFKWLTVRDYITKDPTLLLEKLKADPVLPQEFSQDEVDNLYQAICDRGFH
FT                   TFRDRALLHLIDHGLRASEIHRLNVGDYDGQRIIIRVAKADSVGTVPLLKKARKAIDQY
FT                   KQWREQQGDVLGNDSPLFVSHSNNSKGQRLQYWGIYKIFKAIADIAEVENAHPHRGRHT
FT                   LATRLVMKDMDSVLARRITRHTSEQSFVRYSDRGIELKAEQEFYEVHGEVPGDGVAADK
FT                   PESIQIEAIGE"
FT   gene            complement(87391..87513)
FT                   /locus_tag="AM1_E0112"
FT   CDS             complement(87391..87513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32881"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPE5"
FT                   /protein_id="ABW32881.1"
FT                   /translation="MGFKVHGETRPKFLFNNGFGIQDPLRISMLNADLNLLIDR"
FT   gene            87904..88698
FT                   /locus_tag="AM1_E0113"
FT   CDS             87904..88698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32882"
FT                   /db_xref="InterPro:IPR009291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPE6"
FT                   /protein_id="ABW32882.1"
FT                   /translation="MHAPIIKLHPEEQFFPMDPLLFIQTSRFRHHRGFNVIDAGIDEGF
FT                   NTETQTWDKNNSKDPKYFNVPVDFINSLTLHSDGRNRRPRDSNAGDDLNVFLQPEGKPT
FT                   GHSTPTNNVPVFLFESAGGSHRFLQFWIFFGFNGSLLSHQGDWEDITIKVNGDDQVEGA
FT                   FLSAHGDRPFFPQSELMIENDRVVVFCSRETHAFYPAPGTHGPIGQDKTAAGGFSWDTA
FT                   GKVEDLSVQPWRDYAGAWGEVGELVHTTGPLGPWFKRFDVEI"
FT   gene            complement(88767..89828)
FT                   /locus_tag="AM1_E0114"
FT   CDS             complement(88767..89828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32883"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPE7"
FT                   /protein_id="ABW32883.1"
FT                   /translation="MILHYIFPQKLNLYRSIKVLEICQYFNINPKIMSIKDAFDKLLSD
FT                   EDNAGNFELFITTTNRDGSPYHPLPNGSISNFSFFSDRHQGGIQKLPQGGYVVSGSANS
FT                   QSYLYFTDESLHVQKVVLTSSTFNHGGGLQIVDNILVVGLEIIGERTGGSEVKFYRIFD
FT                   NPSDPTSLNPISIDPLTIHRSGANDTAGACGLCDFEGGSLLVVANWDAERLDFYTAGVS
FT                   VQNLSAQTSSVFTPINSVPNESGAYQNINLFTDPVSSGTAWLIAMSSDTRLGNHDRADL
FT                   YKVETTGSGISLTQIIPNKHFHRNISGPRFLHGSGCFYDSALEQFKVFSIEKQFSSGNP
FT                   RKSRCCLWEKYDM"
FT   gene            complement(89906..91849)
FT                   /locus_tag="AM1_E0115"
FT   CDS             complement(89906..91849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0115"
FT                   /product="neutral ceramidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32884"
FT                   /db_xref="InterPro:IPR006823"
FT                   /db_xref="InterPro:IPR031329"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPE8"
FT                   /protein_id="ABW32884.1"
FT                   /translation="MAMGSVLLNQLSGHSYQPEVASQPISNYLIGVGKSDITDPAIGLG
FT                   MQGMADKNQRTTGVESRLFAKVFIVAEPVSFKRVAIVSTDLWSGTHIVKQEVVERLQKI
FT                   YGPELYQLDNLLISGTHTHSGPGGYTHYYLYNHTLGGPNKTGGFDRHNFESIVAGIVSA
FT                   IEQAHNQLAPGKIYVNRGHIEDCGRQRSPEAYFRNPESELYQYGSDTDNEMLLLKFVHL
FT                   TDTNEKPLGLLNWYAIHPTDRGQYNTLVTGDNKGYAAELFEEKAYEPIVAAFANANCGD
FT                   VSGNVAFGSIPTGADDIERMKKHGGQQYQLAQTLFDQATEELHGSIDYRHTFIDMSHIE
FT                   IKDRPGKRTWPAALGISFAAGSSEDSKPPIPIREGITIRSITEDEASILAFSGLIAAIE
FT                   VPGAELPGQFDSKLTPDFIDGHAPKPIAFAPGLANPETDFFPITPKELPIQILKIGNLV
FT                   LTGIPGEITTMAGRRLKAAVQAELNADYLALAAYSNAFSQYITTFEEYQGQHYEGASTL
FT                   FGPYTLMAYQQEFRKLAAAMKQGQLVSPGIGPQSITPKTTLPRITFRNLTTSPVTLTFD
FT                   QHQAAPTVNLEALTVPPKADLAWMMPKEYLDSGVKVKFDRTNSTYISVNDLVTIHSNLN
FT                   IEVSSYRPSPLT"
FT   gene            complement(92770..93366)
FT                   /locus_tag="AM1_E0116"
FT   CDS             complement(92770..93366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32885"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPE9"
FT                   /protein_id="ABW32885.1"
FT                   /translation="MQQVLDGPKFKKSIPTDTIRFVAVTSEDSQASTMIFDNLSIETGV
FT                   GNPSVPDVETRTFTYVREIESTEDSLVEQDFRGFVAREGNASAAMIVHSGSQTAVVDLV
FT                   KAIEDAKNCAVSKDFPTRKQAEQAAAEDGLKDSERVGEFDDFIVHISTLVPAGQSLQTT
FT                   IILLVDRVGETDESTAFLAIDSIDSEVKASPDTNN"
FT   gene            complement(93350..93475)
FT                   /locus_tag="AM1_E0117"
FT   CDS             complement(93350..93475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32886"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPF0"
FT                   /protein_id="ABW32886.1"
FT                   /translation="MSVLAYLIMAFWLENSNRQNVFYRWFYKSRSLGDYQHATGT"
FT   gene            complement(93852..93977)
FT                   /locus_tag="AM1_E0118"
FT   CDS             complement(93852..93977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32887"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPF1"
FT                   /protein_id="ABW32887.1"
FT                   /translation="MRAKAARARIAVRKKAERDIRQKAAIKKIPLEHCYVVGQAS"
FT   gene            complement(94081..94335)
FT                   /locus_tag="AM1_E0119"
FT   CDS             complement(94081..94335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0119"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32888"
FT                   /db_xref="GOA:A8ZPF2"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPF2"
FT                   /protein_id="ABW32888.1"
FT                   /translation="MGLEPDAVRTFTKDFALTLSFYDFDESIHSLIRTSNALERLFREF
FT                   RTKADEIGAFPNEESCLAIFFLVSRRDHAKHDRLNNHGE"
FT   gene            94584..94718
FT                   /locus_tag="AM1_E0120"
FT   CDS             94584..94718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32889"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPF3"
FT                   /protein_id="ABW32889.1"
FT                   /translation="MSMFLAFKKIGTGAIHRLLHLFPEMTFASFYVRGHKGSLEHGYQ"
FT   gene            complement(94723..95328)
FT                   /locus_tag="AM1_E0121"
FT   CDS             complement(94723..95328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32890"
FT                   /db_xref="GOA:A8ZPF4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPF4"
FT                   /protein_id="ABW32890.1"
FT                   /translation="MSWRRLRRVVAGQPDPVEYETKRHQLEVLKRQEEKGELDLRYLDE
FT                   SGFCLVPYVPYAWQEKGETLGLPSQRSSRFNVLGLMNRHNDLTSYVFDKSITSAVVVAC
FT                   IDDFSRTCDQHTVVVMDQASVHKNAEIEEKIEDWKAKNVEIFWLPTYSPHLNLIEIFWR
FT                   FMKYEWIEFAAYKCLGSLSLYIDKILKGFGKDYVIDFG"
FT   gene            95806..95988
FT                   /locus_tag="AM1_E0122"
FT   CDS             95806..95988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0122"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32891"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPF5"
FT                   /protein_id="ABW32891.1"
FT                   /translation="MADVDALFTEFKAKGARIRQAPTNFSWGMREMNIEDPDGHRLRMG
FT                   AATNEPSDGVPLCED"
FT   gene            complement(96074..97273)
FT                   /locus_tag="AM1_E0123"
FT   CDS             complement(96074..97273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0123"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32892"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPF6"
FT                   /protein_id="ABW32892.1"
FT                   /translation="MKESLSIQQARKLVLLSQRLPPRKQSGRAIEATLSAIEHLGYIQI
FT                   DTISVVQRAHHHTLWNRNPRYKASQLDQLLSDKQVFEYWSHAAAYLPFRDYRFSLPRKY
FT                   ALASGELSHWYKRDEQMLKWVLKRIATEGPLMAKDFEHTGTRIGAWKTKPAKRALQYLF
FT                   MQGDLMIPYRVNFQKVYDLTERVLPEGTDITLPAPEEYARFLITRYLRANGLGQSAEIA
FT                   YLLKGTKPLIDMTLKDMVSSGELLQIHVGDRLYYALPNSLELLSKPLARSKLKILSPFD
FT                   NLVIQRKRLKALFDFDYLIECYVPEAKRQYGYFCLPILWDGKLVARMDCSTERSKSLLH
FT                   IHHLVLEPIVLKVEELFLALRKELESFLQFNRCKKLRLHRTSPTKFKPDLQILINDLTI
FT                   "
FT   gene            complement(97697..98770)
FT                   /gene="recA"
FT                   /locus_tag="AM1_E0124"
FT   CDS             complement(97697..98770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="AM1_E0124"
FT                   /product="protein RecA"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32893"
FT                   /db_xref="GOA:A8ZPF7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPF7"
FT                   /protein_id="ABW32893.1"
FT                   /translation="MSAKNEMNEKQKALDLVMKNVEKTFGKGAIMRLGDATRMQVETIS
FT                   SGALTLDLALGGGLPRGRVIEIYGPESSGKTTVALHAISQIQKTGGVAAFVDAEHALDP
FT                   VYAAALGVDVSELLVSQPDSGEMALEIVDQLVRSSAVDLVVVDSVAALTPRAEIEGDMG
FT                   DSHMGLQARLMSQALRKITSNIAKSGSTVIFLNQLRQKIGVTYGNPEVTTGGNALKFYA
FT                   SVRLDIRRIQTLKKGTDMYGIRAKVKVAKNKVAPPFRIAEFDILFGQGISTMGCLVDMA
FT                   EEKDIIVRKGAWYSYDGSNIGQGRENTIQYFLDNPEFAQDVEQQVRQKLDLGGEADVNA
FT                   NNAIEIEETHLEEADAT"
FT   gene            complement(98767..98895)
FT                   /locus_tag="AM1_E0125"
FT   CDS             complement(98767..98895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32894"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPF8"
FT                   /protein_id="ABW32894.1"
FT                   /translation="MPLQPHHVEVKHEQKYLIDTILVQNYYIGLASPQFTPLEIHS"
FT   gene            98889..99092
FT                   /locus_tag="AM1_E0126"
FT   CDS             98889..99092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32895"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPF9"
FT                   /protein_id="ABW32895.1"
FT                   /translation="MATDTLAELVGFPGGWLVGVSLDLEWGYQCWVITPERQVHTDGEF
FT                   YENNVIALSAGRFLVEHSLEVE"
FT   gene            complement(99102..100973)
FT                   /locus_tag="AM1_E0127"
FT   CDS             complement(99102..100973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0127"
FT                   /product="exoribonuclease II"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32896"
FT                   /db_xref="GOA:A8ZPG0"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPG0"
FT                   /protein_id="ABW32896.1"
FT                   /translation="MPRQFFSKPVIEEAETISLPTSINQRPQVPGITIDGAHSRDLDDA
FT                   IWIEEKDHLTTLSVHIADVAELVQPGSLVDQEAKSRIQTLYFRHNNTPMLPRCLSEDKL
FT                   SLLEHQLRPTITLEITLNQSAEIQHVDVYESRLSSHKRFTYEQADEALMDISRPDSNFI
FT                   YRCWQWAEQLYQRRIQSENFDGLTLPEGYYLDENGNLLSTDFTRYQSYLIIQEFMILAN
FT                   TAMAQWLAQNNIPAIYRNHTHRAIGPEQTHQFAALVNAQSEEDIRRVLMSWLNPAEYGP
FT                   EPHGHFALNLSAYCHFTSPIRRYPDLINHRMVKAHLKGQSYPYSIEDIQALSQHVEATI
FT                   QAQEEAHKTFYKAQQRQLYEAQLQSPEIIAQLPPREFSLLLRFALEDQQGENLKAETET
FT                   RLQSGNVTVEDLFVLLLLGDELQLQEQVLEYLEDHLYDAASIVSIALNQTEAWHSSAYV
FT                   EVSHEPPFVTWIEILIGEQLWTTAKPGISMNKTGAKHQACLAWLKAKFESSLVPPEHRE
FT                   APPIPQPSAPKPPPVIHKLRQYQEGHNCLSLLMEICQGFQWPQAEFEIVEHEQGYHCEC
FT                   RLKVDNEVITGSGIASSKKTAKHRAARPVVEQLQVTLIQDESLVAAC"
FT   gene            complement(101031..101612)
FT                   /locus_tag="AM1_E0128"
FT   CDS             complement(101031..101612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32897"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPG1"
FT                   /protein_id="ABW32897.1"
FT                   /translation="MAEQSSLFNDLELRDIRFSSSSPPILQMSDTALKEWKARIFRYQT
FT                   QVNESAPTQQGSLFDLAQPSTDPASIDPFSLKQQNTEFWRDTFDEGIAALYFVIDQELP
FT                   LLLYVGETSKSNQRWKGVHDCKDYLHNYVAAHRIHKLPVRVTISFWREAPADYHPRQQL
FT                   EQALIQKWKPPFNRESRKHWGAPFRDAKPD"
FT   gene            101701..102042
FT                   /locus_tag="AM1_E0129"
FT   CDS             101701..102042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="contains a tandem repeat of the PF07411: Domain of
FT                   unknown function (DUF1508)"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32898"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPG2"
FT                   /protein_id="ABW32898.1"
FT                   /translation="MGKKFELKVAANNQFHFNLKAGNGQVILTSEMYTTKAAALKGINS
FT                   VQTNAPHDNLYDRRESKRQEPYFVLKATNGQIIGNSEMYSSTSAMENGISSVKTNAPGA
FT                   PVEDLTVDN"
FT   gene            102049..102384
FT                   /locus_tag="AM1_E0130"
FT   CDS             102049..102384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32899"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPG3"
FT                   /protein_id="ABW32899.1"
FT                   /translation="MSNRCQQCDRFSGYLGSQYLVCAIHPSGPNQTPCPDFTEVIEDWQ
FT                   PLGAFYEGDQLIIDWAGYLTSSERLEVLVSHPYFSGICPKCGARFGDSRPIHYDCRECG
FT                   WIDDSIN"
FT   gene            102436..102729
FT                   /locus_tag="AM1_E0131"
FT   CDS             102436..102729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPG4"
FT                   /protein_id="ABW32900.1"
FT                   /translation="MNWIILLICVIVFIVYWSKRRQSRGNLGKVIDYSKGNQGVRREQW
FT                   QNYSSSEAKLIQRIGHEATERLIVSVLLDNPTKSRAWCMDKALRDLERDQGL"
FT   gene            102782..103261
FT                   /locus_tag="AM1_E0132"
FT   CDS             102782..103261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0132"
FT                   /product="nuclease, SNase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32901"
FT                   /db_xref="GOA:A8ZPG5"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPG5"
FT                   /protein_id="ABW32901.1"
FT                   /translation="MGCSPPPSNTTHEITSANTAPVKVLSTSDGDTLKVQFQNGKSSKV
FT                   RIGCIDAPEYSQEYGLEAGLRLKALIPTGATIKLRKITTDQYDRTVAEIYSEEKSVGLQ
FT                   LVREGYAVVYHRYLDGCSDTANQYVDAENDARSRKLNFWSQSDPVMPWDYRRNRR"
FT   gene            103328..104116
FT                   /locus_tag="AM1_E0133"
FT   CDS             103328..104116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0133"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32902"
FT                   /db_xref="GOA:A8ZPG6"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPG6"
FT                   /protein_id="ABW32902.1"
FT                   /translation="MSYSLSATKLKTYGQCPKSYQFRYEHKLPSPTIFGSTKLGNALHA
FT                   ALANVYKDWNYAYPLPSLDWFAVCWQHHTSELTPTQIHEGWAALQLYYERYIAPLPQIR
FT                   KPLGIETKVRATLQVRNIEFTLSGRYDRLDYIDDGLELIDYKTSKSVNPPPSVDIQLGF
FT                   YYLILEQIYKKALKRLSLIYLRSNEKLIYEVTPDHHQQAQSLIEDMAMKLRCDQEWKPV
FT                   AGQHCDRCGYQKYCPAKNTRPEPLPQDAKEVTQVQLALGF"
FT   gene            complement(104127..104501)
FT                   /locus_tag="AM1_E0134"
FT   CDS             complement(104127..104501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32903"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPG7"
FT                   /protein_id="ABW32903.1"
FT                   /translation="MTIDELRQLLNPLDASPTECDGMTRLCHTQLFRHNIPHQVYRGSC
FT                   RVDTQLIPLHFWIDLMEGLEGWRVDYRLGMWIRDNKLDVPHGVFNLASFSQIHYQGEAI
FT                   EMPPLPESLFQVLMLAPNSP"
FT   gene            complement(104533..104808)
FT                   /locus_tag="AM1_E0135"
FT   CDS             complement(104533..104808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32904"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL98"
FT                   /protein_id="ABW32904.1"
FT                   /translation="MRSHFLEPNPAQCKSCIFRSPEDGGLVLGDDRTTEITEYLCSGKQ
FT                   HICHTNPELACRGGRDIQLRVFAALGMIDQPTDEALWLANQEFLRS"
FT   gene            complement(105296..105415)
FT                   /locus_tag="AM1_E0136"
FT   CDS             complement(105296..105415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32905"
FT                   /db_xref="GOA:A8ZPG9"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPG9"
FT                   /protein_id="ABW32905.1"
FT                   /translation="MTKKIRKLNLTVKEAQTNHRVRNIFGNICMIFVGLITFG"
FT   gene            complement(105464..106045)
FT                   /locus_tag="AM1_E0137"
FT   CDS             complement(105464..106045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32906"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPH0"
FT                   /protein_id="ABW32906.1"
FT                   /translation="MNTNTNTNKVTPSTQPKAVLQPLSQQYQFQSQDPSHERALGFGDS
FT                   PSALAIFCNRSKTSTWYILDKDSEPVELQQPALTGYLISIEFVPKEYRGKTSYKLRFKM
FT                   LAHRPCTLEAGYDSTFAKGFLIAISSMTPDQLKQRITIEAVPADDDKVLFCAVWLGNQR
FT                   IFQRWDDRTDWRLIARKAMDNVAELQRQEN"
FT   gene            106105..106251
FT                   /locus_tag="AM1_E0138"
FT   CDS             106105..106251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32907"
FT                   /db_xref="GOA:A8ZPH1"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPH1"
FT                   /protein_id="ABW32907.1"
FT                   /translation="MIANFRVVIISTFTPGLKIATALTLVVLPRFTSRAKGRAVITQAP
FT                   QWL"
FT   gene            complement(106295..106678)
FT                   /locus_tag="AM1_E0139"
FT   CDS             complement(106295..106678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0139"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32908"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPH2"
FT                   /protein_id="ABW32908.1"
FT                   /translation="MPMIRARYPDNWDEIALQVKEDANWRCTECGKPCRKPGVEWLHFA
FT                   FWLMITHPEWFPITSEGEEQKPQRFTLTVAHLDQDPQNNHPDNLKALCAPCHLKFDAPF
FT                   RKANAYTKQEWFGQMKLEDLTNG"
FT   gene            complement(106678..107076)
FT                   /locus_tag="AM1_E0140"
FT   CDS             complement(106678..107076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32909"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPH3"
FT                   /protein_id="ABW32909.1"
FT                   /translation="MNITITQSTRTNQSQPGFRIAQSPLVSPFHPFHPEKDAEPCYNAY
FT                   REWLHEVVLCEKEPVRAAKRIAKQCGVLISTRYKGFSRDEILACLEELGSKTDLTIFVT
FT                   SDHDPGRCIKSYLEWKYPAPEQQTLEVL"
FT   gene            complement(107109..107441)
FT                   /locus_tag="AM1_E0141"
FT   CDS             complement(107109..107441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32910"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPH4"
FT                   /protein_id="ABW32910.1"
FT                   /translation="MNHTTLPQQVIDGIDLPSYELHTRPTADNDRKLNVFYGSRLIGYV
FT                   YINFVERQSNYVGTTLRHQFFGPYSRRMEAAEAVLEAFNAGLTDEQRLRVALAHEMAEN
FT                   MTVIAC"
FT   gene            complement(107515..107895)
FT                   /locus_tag="AM1_E0142"
FT   CDS             complement(107515..107895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32911"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPH5"
FT                   /protein_id="ABW32911.1"
FT                   /translation="MQAHHLNLAEFLLNPPTVNLAYSPVAVMTVATAKNLMQSQELLLS
FT                   GAQKLFNPAVWPQLEPEIERIPFDRQKAQCFRDCVAYLMAEATTLRSERRHIDALKHME
FT                   AALMLEALTHGGYDEVPFVSEQ"
FT   gene            complement(107996..108721)
FT                   /locus_tag="AM1_E0143"
FT   CDS             complement(107996..108721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32912"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPH6"
FT                   /protein_id="ABW32912.1"
FT                   /translation="MIRTSFAAEDQSAYVSYNHSNLIHFLEKIMTATLDNNATRNALTK
FT                   AIKEHIDPAKPEKVNIKKYIVKQYKPDDPTGQDKLAKFAWELHHGNRNLRNRDHVLELF
FT                   GLLTLEATGLEQRKTNKAKCSPLKEAVFKVLKQVAGQDILMIVALNELMDQLTVTRINS
FT                   WETFFKQLAIKRTELESLADTVYELSGVSPGAVEDLDAVIVPLYNEAKGQDIKAINWER
FT                   RSWWDWAHNHLLEQVSKAA"
FT   gene            complement(108696..109028)
FT                   /locus_tag="AM1_E0144"
FT   CDS             complement(108696..109028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32913"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPH7"
FT                   /protein_id="ABW32913.1"
FT                   /translation="MKPKTRYKLIPQVQFTTTIELHDQQTAILNRLVLGSKDLTDDQAL
FT                   DLWLSLNPYVHTFQHSTPRDIFFSLRYTALAALPTQPEPKPSYPVELLNSVRSDVEADD
FT                   QDFICC"
FT   gene            109013..109165
FT                   /locus_tag="AM1_E0145"
FT   CDS             109013..109165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32914"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPH8"
FT                   /protein_id="ABW32914.1"
FT                   /translation="MFWVSLVFPRSEWNEEGQEHGEVDGLPEQKPNEGVTVHRCPLSFQ
FT                   NLYGI"
FT   gene            complement(109205..109582)
FT                   /locus_tag="AM1_E0146"
FT   CDS             complement(109205..109582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32915"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPH9"
FT                   /protein_id="ABW32915.1"
FT                   /translation="MITASELQAELAHCHCSESHYQHWLGIRYTEGVKTLAEKGECFWL
FT                   LDEIASYQRVRLIKCNPNLQEFQLWLLTVNDDHSAVLACYEDSPSTCSPVITQDIPFTD
FT                   FVLPEIKLYAEYGVVLLPSEH"
FT   gene            complement(109652..109954)
FT                   /locus_tag="AM1_E0147"
FT   CDS             complement(109652..109954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32916"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPI0"
FT                   /protein_id="ABW32916.1"
FT                   /translation="MTTLTEAPTTVTELLQLVDSQVTDPLHPEVIAVEMQIEKYPGVRE
FT                   GGDLFEVYAPVKSKPGLIQPRLESWVKTFFGDDHWLADWRTIPTTRQIEAENEEF"
FT   gene            110188..110343
FT                   /locus_tag="AM1_E0148"
FT   CDS             110188..110343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32917"
FT                   /db_xref="GOA:A8ZPI1"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR012869"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPI1"
FT                   /protein_id="ABW32917.1"
FT                   /translation="MTRINITVPEDLLEEFKEYCDSQVRSVSSQIQFFMKQAVESNQKQ
FT                   KGNESS"
FT   gene            110392..110637
FT                   /locus_tag="AM1_E0149"
FT   CDS             110392..110637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32918"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPI2"
FT                   /protein_id="ABW32918.1"
FT                   /translation="MTNSNPQRWTDDRLDALAASTQSLLEATQANTKAIGENSELMQKV
FT                   IEGQLAMQTLHGQLAEQTLQLKRAVDYLLSKDGGQS"
FT   gene            110641..110865
FT                   /locus_tag="AM1_E0151"
FT   CDS             110641..110865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32920"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPI3"
FT                   /protein_id="ABW32920.1"
FT                   /translation="MESEEIIIRYYRNPIPVMVDPGQNHPRHEHDLLLGWICQGKDRSP
FT                   VLKNFPNAEIVAKAKSESEAKPYLTLVKQ"
FT   gene            complement(110834..111256)
FT                   /locus_tag="AM1_E0150"
FT   CDS             complement(110834..111256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32919"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPI4"
FT                   /protein_id="ABW32919.1"
FT                   /translation="MDLRDFQDKSLADLEEIFLEPTETGSDALLSSGLALKVIQDNKLY
FT                   LPDSKGFKVYVEENLGVTYIHAFRCIQAAELVLFLQEHFSVLPQSESAARPLVKLSRAN
FT                   QLKAWGEVLRITAGDKWAPGKDRIKKTIALLGLDKA"
FT   gene            111366..112694
FT                   /locus_tag="AM1_E0152"
FT   CDS             111366..112694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32921"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPI5"
FT                   /protein_id="ABW32921.1"
FT                   /translation="MTKLISKLVSAKTSDPKGDSSAKAKIDTAPQLSVEDIWDTLADRD
FT                   LYRLSIEIDSGLRLSARLDAEDLGLDPHVVDELAGGYRKAFSEAFTKARNQLSGLQKKF
FT                   NKKFTIYVKPFRFIDGSIINDAVDFAQEIKNEAASLRQGLVDTYTDQLETFLVELEQKL
FT                   NETIPGKKKQIEKALIYYAGEFPSIDDFSGSLQVIIDGPVQLTSLKNKLKADADLQAEL
FT                   AKKKRLTAKQKKEAQEIQERIKTSQLMLNGIAQAVQQSRVACLDEGWELLADLIDRFGA
FT                   SPDGKLTTKDQSAINSTFSRLELLEKHNPEISKHLAEARKLHEVMQGTPTPEQTKDAYD
FT                   KFSAFLAKQSKSASGEGAEKLQKSLQFANDYKALVSRLEKLIETPDAETLAELEAGQLA
FT                   NIETTLTRRVTNLKRLTKKAQESAKYANEQAAAQGGVDPVAGF"
FT   gene            112779..113936
FT                   /locus_tag="AM1_E0153"
FT   CDS             112779..113936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0153"
FT                   /product="ATPase of unknown function AAA-5"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32922"
FT                   /db_xref="GOA:A8ZPI6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPI6"
FT                   /protein_id="ABW32922.1"
FT                   /translation="MKPLQLKLQTLRKELNAAHLERKSVIDGLLATLLANQNALLYGPP
FT                   GTGKSLILREICSAIADANFFQRLLHKAMSPDEVLGQISLKALEQDIMKRNTNGRLQEA
FT                   HLAFLDEVFRGNGVLLNSLLELMNERTYDNPDKQKSPLRSIVGATNSIDSGSDLEAFAD
FT                   RFIYRPWIFDLKTPSSTKKLLSWTINGNRPQVSQGLITLAELDQMCAEAQRVKITSGMV
FT                   DAFTEMIHNLIRDGFVISARRRVKLLQLVQCYAYVQGDEQVYLEHVHELLPQCCWKSKI
FT                   EEIREIKKLIETTAPIAKKKLADIVKAAQGEVSRLEEKLNDPRLGHTDHVYAADFARTQ
FT                   LSNLSNSLNKVQADLCRNGASQRTKAEADLKAKAQRVSELVEGLY"
FT   gene            113938..115386
FT                   /locus_tag="AM1_E0154"
FT   CDS             113938..115386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32923"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPI7"
FT                   /protein_id="ABW32923.1"
FT                   /translation="MFTQLKAELTPITTEVSETSKLFWQDYLNSNPTMVEVTQDTNIKT
FT                   LNRFALEVFHRLYYSPIPEWLPEKPEHQWARVLHNQLSESEEFQNLTLTCTGDPLGSAI
FT                   AAQSMITNLYRQLEEASDDLEIDELDTLRAKARRAKMEGDEELFKELQAQGQAMSQAAQ
FT                   TFAQNLEGMEGEGIGESVEDAEGNVQEKKDELEALGMSWGNEPGDRNPTPTGEKLKLAA
FT                   LIEQRPQLKKILALAGNALETANRKRRQHQSETGYGELVGITTGNDVAQVLPQELARLS
FT                   DSRQKLSFYRDFLEGQLFQNDLQAPEEKGKGPMVICLDCSGSMVKGNRFLWSKALIVAL
FT                   VKLAHEQDRVVSLVLFESVCYDPIYFHPREDIDQLIRLLVTSPTDGGTEFQRPLETARD
FT                   IIEQDNNYSEADIVFITDGIAPLSSTFVQEYSNSLQNLKTDFFLLEIEPKQGWSSELRT
FT                   LASQSWAIDADGNFEELGAVFTAC"
FT   gene            complement(115504..115833)
FT                   /locus_tag="AM1_E0155"
FT   CDS             complement(115504..115833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32924"
FT                   /db_xref="GOA:A8ZPI8"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPI8"
FT                   /protein_id="ABW32924.1"
FT                   /translation="MPRYSLGSNEVAFALGALAFLSFAFMLYAQVQRKVVIRLRKATIV
FT                   RHLIRWITWLSWTASVVGWGYVLTAIVIRPAVLINPWVVAICATLVSSPLSAMYRVISI
FT                   QEKAE"
FT   gene            complement(115847..115966)
FT                   /locus_tag="AM1_E0156"
FT   CDS             complement(115847..115966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32925"
FT                   /db_xref="GOA:A8ZPI9"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPI9"
FT                   /protein_id="ABW32925.1"
FT                   /translation="MSKLNKTISRVVLFKLAVILFAILVRVANNSYQKSALFV"
FT   gene            116038..116421
FT                   /locus_tag="AM1_E0157"
FT   CDS             116038..116421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32926"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPJ0"
FT                   /protein_id="ABW32926.1"
FT                   /translation="MVFDHHTLPHPIILMDADFDLDSLYQQLQDEDVIELTILDGDLAP
FT                   GQTAEITVASKWLTRYHLYLFFEHHSQSFDLAGVKEGASKTKVNLIIDHMDAISSEKAY
FT                   IFTYGSETSWSIQLVQWKKLTRA"
FT   gene            116494..116907
FT                   /locus_tag="AM1_E0158"
FT   CDS             116494..116907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32927"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPJ1"
FT                   /protein_id="ABW32927.1"
FT                   /translation="MTQIPSLTHQQLELLRIAKKNTVGELRLSYEYPVLDDNEPQIGHP
FT                   PFIQELIDHHFIHVQVKETSLRASEFQQENWIEHCDGIDYPHQADWDRWRQGFITQLSE
FT                   EIESLMIPGKNLGQFTQVWIREISVRAVQPSSL"
FT   gene            complement(117139..117402)
FT                   /locus_tag="AM1_E0159"
FT   CDS             complement(117139..117402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32928"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPJ2"
FT                   /protein_id="ABW32928.1"
FT                   /translation="MADINRNPLLKDKFKEKHKLRNQLVISLKHHHHETLGQVPLDVAV
FT                   NGMYKAWQACHSETSEQLPHGVPTEINPKMHQLGAIVRHLHR"
FT   gene            complement(117562..117732)
FT                   /locus_tag="AM1_E0160"
FT   CDS             complement(117562..117732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32929"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPJ3"
FT                   /protein_id="ABW32929.1"
FT                   /translation="MLAGFSVKAMPLIDSVLLGIVISSQLLRHLYNQVFHTVDLNIANV
FT                   NQQPMDRSSQV"
FT   gene            117753..117905
FT                   /locus_tag="AM1_E0161"
FT   CDS             117753..117905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32930"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPJ4"
FT                   /protein_id="ABW32930.1"
FT                   /translation="MRSLPNIEPPKGGTNFLARGKTLVHLSNLIFISKIPQTVQIDAQV
FT                   LRLEN"
FT   gene            118091..118483
FT                   /locus_tag="AM1_E0162"
FT   CDS             118091..118483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0162"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32931"
FT                   /db_xref="GOA:A8ZPJ5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPJ5"
FT                   /protein_id="ABW32931.1"
FT                   /translation="MPRKRKQSKPITGKDLVAKVKQLGDLTREEKAKACGYYSTDKDGS
FT                   ERIKLMAFLNALLDAEGINLDSHSSSGNGNGRGGRKASYRVSVQSNGNLLLGSAYTKEL
FT                   DVKPGDEFEISLGRKHIHLNKVAEPS"
FT   gene            118725..119531
FT                   /gene="rpoD"
FT                   /locus_tag="AM1_E0163"
FT   CDS             118725..119531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="AM1_E0163"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32932"
FT                   /db_xref="GOA:A8ZPJ6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPJ6"
FT                   /protein_id="ABW32932.1"
FT                   /translation="MATQNDSVQAYLKEMGRYPLLSHEEEIRLARQVKAGDLKAKQRMI
FT                   ECNLRLVVSIAKKHQHLGLPLMDLIQEGSIGLNTAVDKFDLAQGCKFSTYAYWWISEAI
FT                   KRALKSQSRTIYIPIHQWERAHRIKKAVRQLTQEKGRTPTLKELSAATGIKSSLIRNTL
FT                   QSFQAISSLDQPVGPEQKDALIDLIQTEDAALSIMDGLEIEDALTRCMAYLTERERFIV
FT                   DQRYGLTDGQPKSMGAIGKPIGISRERVRQILNIAMKKMTRQVRSA"
FT   gene            119722..120075
FT                   /locus_tag="AM1_E0164"
FT   CDS             119722..120075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32933"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPJ7"
FT                   /protein_id="ABW32933.1"
FT                   /translation="MIADNITDYYLEHSQPTLTASNTVSLNVPIIESWRCYDISNNVII
FT                   RGQIFNHSKYPAGKSLKSSPIQGCLTKAGRVYVTTKNSMYELGIPHPDFAGDAQLWMDG
FT                   TDHQQWAKLTFCG"
FT   gene            complement(120174..120761)
FT                   /locus_tag="AM1_E0165"
FT   CDS             complement(120174..120761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32934"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPJ8"
FT                   /protein_id="ABW32934.1"
FT                   /translation="MSIIQSVDLEAKGLLHDQSSSLTIQGKWFKPGPSFRKSLRQAAIE
FT                   FCKDARTQGRQYILVEFPTYFMAWRRFIPKDAAPSHKVYAKDSSPPDEKLSPTSAKPSE
FT                   QGIKSKDSKYSEKLEADQASPTLIDSEFIEQCKAELAVHIGPMAEILIEDALTQIEQNK
FT                   PEKLIEALASYIHDPKASNAFTLKLAQVIFTR"
FT   gene            120754..120912
FT                   /locus_tag="AM1_E0166"
FT   CDS             120754..120912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32935"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPJ9"
FT                   /protein_id="ABW32935.1"
FT                   /translation="MDTLFPLTYIFSYSRSKTCSTLVFPSFEANQSFGILLALSLIGIS
FT                   ELLICDD"
FT   gene            121178..121333
FT                   /locus_tag="AM1_E0167"
FT   CDS             121178..121333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32936"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPK0"
FT                   /protein_id="ABW32936.1"
FT                   /translation="MIEAEIGYIPSEVIEEGDDLDPRNNIESSPTVLDLIGEAVELWVL
FT                   KRGGDD"
FT   gene            121326..121496
FT                   /locus_tag="AM1_E0168"
FT   CDS             121326..121496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32937"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPK1"
FT                   /protein_id="ABW32937.1"
FT                   /translation="MTELREFSFLVLHTSGEETVQTVVSTSKDLAESALHRWITDIKSL
FT                   QPMTSGDEEQH"
FT   gene            121527..121664
FT                   /locus_tag="AM1_E0169"
FT   CDS             121527..121664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32938"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPK2"
FT                   /protein_id="ABW32938.1"
FT                   /translation="MKYWYIPIAQIIQSTARSIETMRTQFKETKRLADRVFQRMDSLTQ
FT                   "
FT   gene            121829..122242
FT                   /locus_tag="AM1_E0170"
FT   CDS             121829..122242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32939"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPK3"
FT                   /protein_id="ABW32939.1"
FT                   /translation="MADIPSLSLPQLELLRLAKKHSVEELRLIYEFPVLDDNELSSGHP
FT                   PFIQELIDHHFIQVQEKGTSLCASEFQQESWTEYCDEIDYPKQTDWDRWRQGFIVQLSE
FT                   GFESLMTPGKSLGQFSKVWIREIGLRGVQPSSL"
FT   gene            complement(122486..122665)
FT                   /locus_tag="AM1_E0171"
FT   CDS             complement(122486..122665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32940"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZMQ4"
FT                   /protein_id="ABW32940.1"
FT                   /translation="MFSSRISPEAATSLFGLTLTDIRQAIYNGELPAQWNHGSPLLSYT
FT                   DLLNYQLRKVSKSA"
FT   gene            complement(122969..123088)
FT                   /locus_tag="AM1_E0172"
FT   CDS             complement(122969..123088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32941"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZMQ5"
FT                   /protein_id="ABW32941.1"
FT                   /translation="MGTISLIEAFIVIQEKTPLLGKNVVFFLLRRKLHEPFFD"
FT   gene            123221..123349
FT                   /locus_tag="AM1_E0173"
FT   CDS             123221..123349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32942"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPK6"
FT                   /protein_id="ABW32942.1"
FT                   /translation="MFGVKPIIRPSTNVTSSLQILFYQSDKRGLSRSEDAKPSLLN"
FT   gene            complement(123377..123775)
FT                   /locus_tag="AM1_E0174"
FT   CDS             complement(123377..123775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0174"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32943"
FT                   /db_xref="GOA:A8ZPK7"
FT                   /db_xref="InterPro:IPR012427"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPK7"
FT                   /protein_id="ABW32943.1"
FT                   /translation="MEVVHHLQGNLEIIVSFLEVVLEAVAAFCIVLGLLVSIKLSVNLR
FT                   RRRSTIQFPLGRLRLTFGRWLALALEFQLGADVLATTVAPTFEALGKLGAIAIIRTFLN
FT                   YFLNKELIEVFEMQKRFDEDETDLSNSN"
FT   gene            complement(124395..125144)
FT                   /locus_tag="AM1_E0175"
FT   CDS             complement(124395..125144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0175"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32944"
FT                   /db_xref="GOA:A8ZNG5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNG5"
FT                   /protein_id="ABW32944.1"
FT                   /translation="MTTLKQLRLRHFLDEWQSIEHQATQENWSYAQFLLALAQGEASRR
FT                   EQNRISRALTEAQLPYGKSWTNFEFAHVPTLNPAALMEFAQTTHWLESGSNILIFGPSG
FT                   TGKTHVSSALGASIIELGKRVKFVTATTLVQQLQLAKLQLELQSLLSKLDRYDLLIIDD
FT                   LGYVQKSDVETSVLFELIAHRYERKSLLITANQPFSQWDSIFPNSMMTVAAIDRLIHHA
FT                   TIFEMQAESFRKQEAAKHTAKSQKTDS"
FT   gene            complement(124939..126669)
FT                   /locus_tag="AM1_E0176"
FT   CDS             complement(124939..126669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0176"
FT                   /product="transposase, putative"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32945"
FT                   /db_xref="GOA:A8ZMH7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZMH7"
FT                   /protein_id="ABW32945.1"
FT                   /translation="MPAPIKPQQVHLYMQTKQSGSSQETAAAKAGISTRTAHRIDSGTH
FT                   RPQRGRPHDWKTREDPLDGLWELELEPMLEREPRLEATTLFETLQENHPGQYDDKIRTV
FT                   QRRTAKWKAAHGKPKEVMFKIQHHPGEMGQSDFAQLKGFSVTVQGEAFHHILYHYRLSY
FT                   SGWQYVQVIQGGESFIGLSQGLQNALTACGGVPKIHRTDSLSAAYRNTGGRNPQLTQLY
FT                   STLCDHYRMQPTRNNLGVSHENGGIEGSHGYFKRRLCQALYRRGSFDFDSVAEYQQFIE
FT                   QVIAKLNAKCQKKFALELPTLQPLPRYRTPDYEVRSAKVSCNSTIAVRCVLYTVPSRLI
FT                   GHRLKLHLYHDRLVGFLGTTPVVELARVHVHGSEKKRRARSIDYKHVAESLRRKPNAFL
FT                   YCQWQSELLPNLQWHQLWESLKANFEQDQAARLITEALYIAATQDQESQVADYLQTQLE
FT                   QSTLTLSRLKQAFEFKLSTEQYPDVTSQQHDLSDYDQLLHSRPGQPIPVADDNPKTVAV
FT                   EAFPRRVAEHRASSDSGELVLRPVSVGFSSRRSQPSGAESDFTRSNRSAAALRKVLDQF
FT                   "
FT   gene            complement(126945..127511)
FT                   /locus_tag="AM1_E0177"
FT   CDS             complement(126945..127511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32946"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPL0"
FT                   /protein_id="ABW32946.1"
FT                   /translation="MSRTISLIRHGKPTITPQGWIGGHELPQVINRIQSAKIASDSFPT
FT                   GDVQVLVQSAKLVFTSDIPRSMHSAQILEPTIPPVSDPIFREVDFWLECPINIRLPFHI
FT                   WLFLDRLLLSLGCSSHAQSQAHIKKRVKKAAELLEQQSYEASSVVLVGHGITNLFIARE
FT                   LKKRGWCGPRIPKMEHWGCTSYSLG"
FT   gene            complement(128003..128764)
FT                   /locus_tag="AM1_E0178"
FT   CDS             complement(128003..128764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32947"
FT                   /db_xref="GOA:A8ZPL1"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPL1"
FT                   /protein_id="ABW32947.1"
FT                   /translation="MKFHCTYCGYKIETSNGQSGQLMTCPSCSADILVPPPPISELSAK
FT                   SKANLKKSDSLPTQGFVYRRLFLISLIGCLIFGALTAIYSLITSSFDTSQATILLTTVS
FT                   LGTYSMTGLCCSTLIGHPQHHRFGQIGIAVSVFSGFWAFVNNLAILANQEINNWGELLQ
FT                   VRFSFLVVAVAFAHCSLLLRIHTTNQTVQNVRYVTLGIIAMFSMVLLGNIMAPDNFSTS
FT                   WKLISILSVLNVLGTIATPLYHAATKESKAN"
FT   gene            complement(128971..129090)
FT                   /locus_tag="AM1_E0179"
FT   CDS             complement(128971..129090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32948"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPL2"
FT                   /protein_id="ABW32948.1"
FT                   /translation="MFELAYYSNTSGKDFTVVLNESHFSEQPRVMRFLIQKGI"
FT   gene            complement(129157..129300)
FT                   /locus_tag="AM1_E0180"
FT   CDS             complement(129157..129300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32949"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPL3"
FT                   /protein_id="ABW32949.1"
FT                   /translation="MLGIRSEAMRTLEQYQHSDITPIHFTQTFKLLESLRILYYSVIVD
FT                   ES"
FT   gene            complement(129381..130142)
FT                   /locus_tag="AM1_E0181"
FT   CDS             complement(129381..130142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0181"
FT                   /product="pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32950"
FT                   /db_xref="GOA:A8ZPL4"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPL4"
FT                   /protein_id="ABW32950.1"
FT                   /translation="MTFNKVWNFLLQEDNREAAKVLISLLGLVGSTAIAFGLFLNYQDS
FT                   VFDRSIATKQLAVSEQRSVSDRFAEAIKLFGNPDPLVRIGGIYSLEKIAQDSPSDHWTI
FT                   MEFLVSYIAKESPLDRDKAQSEPISEDIQAAIKVIIARQVSQDPVDQFIGLQDVSLVNA
FT                   QLYKAHLEDADLRGANLAEADLLEANLSKANLSEANLSKASLGRANFESANLTNAILTN
FT                   VSEWTDQQLGKALLCRTKLPKGSKHNPDRDC"
FT   gene            complement(130210..130437)
FT                   /locus_tag="AM1_E0182"
FT   CDS             complement(130210..130437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32951"
FT                   /db_xref="GOA:A8ZPL5"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPL5"
FT                   /protein_id="ABW32951.1"
FT                   /translation="MIKVKSVPLIYRILAIVSIQIIALAASSYQSNQPYIPKRGYFRFG
FT                   EIVRLVWLVLIKIGSKCLKRLLQPFSAKTD"
FT   gene            complement(131098..131598)
FT                   /locus_tag="AM1_E0183"
FT   CDS             complement(131098..131598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0183"
FT                   /product="acetyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32952"
FT                   /db_xref="GOA:A8ZPL6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPL6"
FT                   /protein_id="ABW32952.1"
FT                   /translation="MGSKPNVVIRSANSTDLPYLENIRKAAFAPVFASFRKILGDEIYN
FT                   LAQAHEDEAQGELLASLLAPDSDWEVYTAVIDSSVVGFISFQLNLDRKVGEIGLNAVNP
FT                   NHAGRGIGTIMYDFVISKMKEAGMQVATVATGGDPSHAPARRAYEKSGFTVQIPSVWLC
FT                   QKL"
FT   gene            131678..132802
FT                   /locus_tag="AM1_E0184"
FT   CDS             131678..132802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0184"
FT                   /product="strictosidine synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32953"
FT                   /db_xref="GOA:A8ZPL7"
FT                   /db_xref="InterPro:IPR004141"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR018119"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPL7"
FT                   /protein_id="ABW32953.1"
FT                   /translation="MSRISVTTKRGKFNKSLWLLLIIALVALYLIAWPVPIEPVAWEAP
FT                   SNPGYSGAFESNQRLKDIQKLPLRDNHGPEDIALDSQGRIYASTHEGRIVRLLPDGSSS
FT                   QNWVETGGRPLGIDFDKSGHLIIADAFRGLLSIAEDKTITVLATEADGVPISYANDVDI
FT                   ADDGKIYFSDASTKFGAKEWGGTYEASLLDLMEHGGHGRLLVFNPTDGSVQTLLDDLNF
FT                   ANGVALSHDQTYVLVNETGNYRVIRYWLNGPQKGQSETFLKDLPAFPDNISTGLGNRFW
FT                   VALVSPRSAVLDQLSNKPFMRKVIQRLPAFLRPKAQPYGHIIAVDGSGNVVQNLQDPQG
FT                   TYPLNTAITETEEYLYIGSLVAPNIGRLSKPDDF"
FT   gene            complement(132984..133256)
FT                   /locus_tag="AM1_E0185"
FT   CDS             complement(132984..133256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32954"
FT                   /db_xref="GOA:A8ZPL8"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPL8"
FT                   /protein_id="ABW32954.1"
FT                   /translation="MRAIALDEVSIIQARELKLLGHERTINQINRCLSLMANSSAILIL
FT                   LVVFLAGSGLIVGVNLPKYAICSDPLNPCWWLRFGGSERKVLTNQ"
FT   gene            complement(133253..133801)
FT                   /locus_tag="AM1_E0186"
FT   CDS             complement(133253..133801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32955"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPL9"
FT                   /protein_id="ABW32955.1"
FT                   /translation="MSNQSFSKTLKTLQISKEDLIELRGICGLGETEEFSESDIEMLKE
FT                   VVQHKQSGAITYTEAWQQIQAEVVPVEAEPVAEKSDGTDHILERAEKIADEDGERVLQT
FT                   LDGYGDDLQKAVLGAYMSRLNHVFANARVQKAVVEDPDELAKKPGPFTSRLRERLAAQA
FT                   KQTALPASTNSSTETLPTE"
FT   gene            complement(133805..134173)
FT                   /locus_tag="AM1_E0187"
FT   CDS             complement(133805..134173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32956"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPM0"
FT                   /protein_id="ABW32956.1"
FT                   /translation="MPKPNRTNIIIRCQPISGSKQELIIKSARSFYGSKFKKTVELALV
FT                   DLFEPIHIAIEGGSAADIQNAIESSAHEIRDLHREALNQCQKNGYVSASQVVQATTSAD
FT                   MSPQNCEPDEDEPELEFD"
FT   gene            complement(134157..135290)
FT                   /locus_tag="AM1_E0188"
FT   CDS             complement(134157..135290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32957"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPM1"
FT                   /protein_id="ABW32957.1"
FT                   /translation="MNFSQGAILHLNIDTGSSSTRGFFLADFDGGTHEGFINQPPNVGF
FT                   LMQSNYENDKRRSTTKTSRVTFRQGSDWVFRIVGEIPGHAGTKTDPNMSKADLLVPKVL
FT                   AFVGLALDRVPELSPDRVKLVINFMLPISEWTEYADLESDLLSCLLGGFGYNGRHIDFA
FT                   AVDAKGYMEGAGMATIPPPDITAYVGVCGHKDANFIAVEDGRPLAYPKSKTFEGLGMSS
FT                   IVNSVMHFTDDVQGAKAVFRFLALMDKPNKQDQARKELAALIKPHRLEQKLTQTREGFN
FT                   KNWGEIKQRIDSDRGIKQAQAFYLVGGNAPIYKSRFKALFGSAFKPLNGAIKQLSDEFE
FT                   EINTQWAYRAIDVWMLHLHVTGRTWTPKGVKEYAQAK"
FT   gene            135684..135965
FT                   /locus_tag="AM1_E0189"
FT   CDS             135684..135965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32958"
FT                   /db_xref="GOA:A8ZPM2"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPM2"
FT                   /protein_id="ABW32958.1"
FT                   /translation="MSQTRYKTKVIYQTCKYDHQGQKYCINPKVVEDKTQPIKGVEVPI
FT                   LGEIIPPPPFGLESYSDLFWLLIASVFFLKIFPNPIAIMMVFFSPSRR"
FT   gene            135965..139999
FT                   /locus_tag="AM1_E0190"
FT   CDS             135965..139999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="Shows homology to DNA helicase but no HMM support"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32959"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR024385"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPM3"
FT                   /protein_id="ABW32959.1"
FT                   /translation="MFRPTLINKGNAAIEEYYTEDEALKNSEDEYYAPGKDPVITPCKW
FT                   YGNGADSLNLKGVINQKVFKKLFYGHHPESGKRLRKKPTNGQERLGIDLTFGPGKEASI
FT                   LALVGGDRRIIDLHEQALQKVFDIFQARYTQTRVRYGNGQRSLVNTNSLIGAFINHATA
FT                   RPVTIDGKTYSDPALHTHIVVMNATQINGKWQSLSNEAIFKSLSLGSIYRHFIDKGLAE
FT                   LGYTVRPDGSIEGLSPETVWHFKKRTQEVERYLKKYGLEDTQENRQNAVLRTRNKKEDN
FT                   TNIPEKMKGWVEELVINRFRLPKPAKKSTWVHRPELARKYVDSAIAHLQERNAEFCHEL
FT                   IEQWVFDQRPPFTYEELQTEIANHPQLIRTKNDTYTTQYALDREEKTRQLWAAGQHKFT
FT                   PITTGKIEFNKMLNADQRIAVRSTLASSNRLIIWHGLSGVGKTTTLSELQKHIEAINPD
FT                   IQIKGYSPTTKAAGVLAEELGIETTTVSGLITRRLDTTPNQWWIIDEAGMKSAEQGLEV
FT                   LKRAEAVNARVLLVGDINQNSSVNAGSPQRSLMKAGAETYHIKTILRQKRIVQRRAVEL
FT                   VSIGKPLEALKLLNEYGHVTEVADRRDRAAQVAQKYLSLKPKERKQTLVVTGTHRERKA
FT                   ITTLIREGLRAEGVIKGEDQALRQLVDKRLTTEQTHHLRYYKTDDYVIPNDNFSSRLQK
FT                   GKLYKVVGVDEASGVVRVVSQGGQYSSFDPAKLENKTVFTAQKINVSVGDQLRWTRNNL
FT                   HGNNGDQFKVTAVEGHRIQINHKKWIDTSKPLELDYSITSTTHAAQGQTTYRVIFSGTI
FT                   DPTSSREPFYVAISRQKHELYIFTENYEGLCQQIQRSAAQLNPRELLGLDGELELPEFT
FT                   RSAFWTPQTAMAEPPKSGIAPHHWEELIEGSGIHPDFIELNCHSLKGDSVYEYLLEDKI
FT                   AGLGAGQVWVADQQKARARIEHCWDGGFWIGAGVEAQSLDDPILSTWGSFKPDHPRYDS
FT                   SRERFQKYEHPQGRSRGIFLTEVPDWFKEYICKKYDITSALGDHFWKIIRDNPQIPIKI
FT                   TEGGKKTLSITSQGHVVIGLPGVNAGYRSKDDEGIKLPERRLNPDLAIFAVPGREIKFM
FT                   YDQDTKPSTVANVRRDMVRTGMLLEDKGCTVKFSKWSSLYKGADDLIVGASPEMLELAI
FT                   DAAQPLAVATAKHYEHEYQKLYEFVVRRDGELPHKVMNLEIFIEAYTRGTTKDAYKTIE
FT                   AIKPELNREELMKAALQHQDKKRNAATTVVPILEELAKTKGTKYRHTYQYRVDKWLIAS
FT                   GKRGLTVRDTATGRILLQTKMGRLTRVSARPGVIKLFKSTVKQAKVKPIQQVQKGRKYS
FT                   A"
FT   gene            140118..140231
FT                   /locus_tag="AM1_E0191"
FT   CDS             140118..140231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32960"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPM4"
FT                   /protein_id="ABW32960.1"
FT                   /translation="MQSHFFAASSGESTLTRLKRSFPRYNCEYLMEKTFGL"
FT   gene            140575..141966
FT                   /locus_tag="AM1_E0192"
FT   CDS             140575..141966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0192"
FT                   /product="pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32961"
FT                   /db_xref="GOA:A8ZPM5"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPM5"
FT                   /protein_id="ABW32961.1"
FT                   /translation="MQNQDKPTLKLPIKSIFYIFLLIGGIQLISQLDRLIRCNFISIRN
FT                   VNQCTLYGQTTWEWLKLLIGPLIAITGGFILNGYFKNRDERRLDKAKETELDQLRHETL
FT                   ITYFNEISNLLLNKNWPKYGRNTNIEENPNLTIVALAKARTSSVLNEINGKRKGSLLLF
FT                   LLESKVWQIITDIDGNSSWANLSFCDLNKANLTRINLSGANLSEANLNLCNLSEAELSN
FT                   TIMINTKLTSVDLKKSNLSGAKLIKANLRRANLSDAVLENANFKEAKLTGGILLSEGKV
FT                   KFFLFYFSLRFYSLLVRTYPFRISKYATYKSDKIRVYINYLFGANLKGANLKEAYLRHV
FT                   SLLGANLDRADLESANLSQANLSFANLRGASLIEADLKGASLIGADLKGADLKGADLKG
FT                   ADLKGADLKGANLCDKNIIKPIKITTGQIKKTFNWETALYKEDFRKKLGLPPTPSSNPP
FT                   KEESE"
FT   gene            complement(142070..143707)
FT                   /locus_tag="AM1_E0193"
FT   CDS             complement(142070..143707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32962"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPM6"
FT                   /protein_id="ABW32962.1"
FT                   /translation="MADILENGGNEQEVERANEAILLTPLELLQQLGQAAWQLVKKGDE
FT                   WGRAAFKDLEVGNKKLLPETTTPDDLEAVETAVQDPENAKVEVNAIATTEQGEVVRQPV
FT                   ADPWDMEPDQVVDQAMSQLESLEPEAIEVDAVVVEPDQLPSPNQSIRPVVNEFIEQAGQ
FT                   RAKQNASNFVAQANAYLRENIQVDYQPIPQQDGSLALAVDTPSLLTQMQLAGGEYAQAA
FT                   QEKMRNLAPQQFDRVSQTVKNTQDRMKSALDSATEAVQARLNQPSMKDRVAALETSTDQ
FT                   IRAAIKAEFATEIKDLQQTVSGLESNVAHLEQQQAKAQEMIAALQAPKPQLSNPRLNQW
FT                   QSNLVSAMKDRFEKIKQNLGEKIDQAKAKVSELFETFKQKVRERLQPVIDRLQPVYDQA
FT                   QALKQQAGDQINQVKATVGENVDKAKQFVGEKAMDWQAQALTATATYVLAQQGKQTPQG
FT                   TTIYEGENFDFHRSKGNSLLIVDKTTQQPVYKNGEFNQKAPQAVKDKLISAAKTTQQGL
FT                   EKQQAHKQAKVKAQAHKPKPKVAAAARR"
FT   gene            complement(143750..144172)
FT                   /locus_tag="AM1_E0194"
FT   CDS             complement(143750..144172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32963"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPM7"
FT                   /protein_id="ABW32963.1"
FT                   /translation="MSEQTESQITFTETQLQALTRLGISTPELYAQYPNSHHNAIETLE
FT                   QRGCDALPKNTVIDEMQIYYGDVAYSPAIQYRGGKLIGFDPNAYAQPADSECVSFRING
FT                   LWAYIQVAGRILVDLTGELELPPMPTEKDVLALVAA"
FT   gene            complement(144215..146008)
FT                   /locus_tag="AM1_E0195"
FT   CDS             complement(144215..146008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32964"
FT                   /db_xref="GOA:A8ZPM8"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPM8"
FT                   /protein_id="ABW32964.1"
FT                   /translation="MPQHTEQPPQPPQQFGPQIDFQVYLMGGLFLILIILLIFKDGFSK
FT                   KQKLGDARKATPKEVKKAKTYGFDMMEERKRNKVALWVGEPKGVVVDKEAREIFIPRDY
FT                   VNSWILSHLEEHLVALGSTGSGKSYSLLNPLQRCMIKLGYPLAVFDAKGHEESETSTCP
FT                   SSEIAGYARLHGYKVKIIAPGYDDSDVFNIYQMIRSRFGREAYEDKDGAGVVAEVLSEN
FT                   LAKTAADNGDEFFPLAAKQLLQSVFLLALYLDPNANFVLAFYLLERIVEIGAAGIRSLD
FT                   LPPYLRSSFSQYLASEKSAETGASIAGTTLLQFNRMFTPANVSTFCGDSTVDLEIKGKT
FT                   LVIFRLNPELKASVGPMIATTIQCFMLANAYRARTQPLGFFLDECQMIKLCGVQEMQTV
FT                   TRSNGVFFVFASQGFSFLKGTYGEKAAMGLIEGCKTQVIGQLNANEPAEYYSKQFGQKE
FT                   IKSQSKSKSKGKHSSSSESNQPHLKDLVPLQELLGLPQGQFYYLNRAFRNKKMARIPVL
FT                   YETVIPQWEQQEIKQGISEWYRYRRVARANSKALAKTDEELVRYQTRAREALPEPEPEQ
FT                   QQSSSPQDDGSEILAIGISAL"
FT   gene            complement(146077..146445)
FT                   /locus_tag="AM1_E0196"
FT   CDS             complement(146077..146445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32965"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPM9"
FT                   /protein_id="ABW32965.1"
FT                   /translation="MIGKILSAVVLMFVLSSPVAIAQVQSNDQVEEVIATASSALSPSA
FT                   VINKVAIVGNFALVSWTDGHAGSSATLRNSDQGWVVVTDSMRGWPPVDVYARENGMTVE
FT                   EAEALFDAFNPKWRQWQR"
FT   gene            complement(146442..149048)
FT                   /locus_tag="AM1_E0197"
FT   CDS             complement(146442..149048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32966"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPN0"
FT                   /protein_id="ABW32966.1"
FT                   /translation="MPRYPQRIFSLLPAAVLTLQSFPAVAQIINQQSIKAANQNTQTQE
FT                   EGTIPGLYYDPSGVVAPTFANSPASETAGSIRLPAGSQAPSYLNGAWPANASSDQVLKI
FT                   GHLKNHPQFKQFTELNINEVLKASGKDPATVTLSEVPIASTMTVGEYLQINPGAAEQSL
FT                   EEAPAVVQSAFGYYEDEPLLHEPIDQTDIVFIEQKASNPEISDIPAEDLIEGDWGDVFT
FT                   EEERSKLAKTLSKVNNRLRKLPLKQLIPLTQGIINGDWDTVKKQAKDLAIKEGSKVLIK
FT                   ELMKNPKIAKAIKDLPLGTLPLDKLGLADAPGVGETAIKDIPGSEDKTLNQVPGLKDVP
FT                   LDQIDLALALSFTRLDLLGRIDTTDAAAVVDNIDYVISGGTKDQIPKPAPCKIDGKDTK
FT                   NCRHFELDNVDGGGEPTKLSGQAWIQGPDQMVPGGQGWLRIIANGKEVTGIKPWVAGNV
FT                   KLYLEDMREGSGDEVGSARLSTAWQFGYSDPITGSHYTPHFIRIPTPWRIKEGGIMLLL
FT                   ARSGGIPDAIRNLQPSQQQFCREPTLVASAQTNNTTDSNQTTGGADGSSPPNSEQHHIN
FT                   QYLARIAYGESTGGTDIGPHPDTGAYGEYQFIEKSRNTLFTRTGIDAWSESKEERDRAA
FT                   LAWIDIYGQEVGHDIIGYIRSGNFEAADYLLGRNQFTSLPGGAEDVKWNDPVALEVYGP
FT                   NGNAPVTPTGATASFGVPFCQPTNGSATFAQGPAPEAGEINNAIFESAKQMRGFDTSGG
FT                   PEGGNQACAWSVDHVLARAGIQPMQTDWVPTWADKFAAGRGKQVNPSEAQPGDIALSKG
FT                   YQHIGVCMNVGCSQILSNSSGRASFSWVSDRNFDGTYDNSRYLSDNPQTQIWRVTR"
FT   gene            complement(149271..151634)
FT                   /locus_tag="AM1_E0198"
FT   CDS             complement(149271..151634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0198"
FT                   /product="TPR repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32967"
FT                   /db_xref="GOA:A8ZPN1"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPN1"
FT                   /protein_id="ABW32967.1"
FT                   /translation="MGGIGKTELALQYAIAQLEQEQYPGGFCWLRARDQEIATQIVSFA
FT                   QTKLGITLPDGLDEKGQVDYSWGHWREGDVLVVLDDVTEFDAVEPYLPPSDPKFKVLLT
FT                   TRLNLGSSVQSLSIEELDDESALALLETLVGPDRIYSQLEAAKTLCGWVGNLPLGLELL
FT                   GRFLARKLDWSFEKLVERLESKKLTAKALIAKESGMTAQLGVASALELSWVELSEVEQE
FT                   LACLLGMFAIAPIPWHLVEECLFDQDNDDLEDLRDEGLRDRNLLKRVEESTYQLHQIVK
FT                   EFFRIKLHERTDKGESLKTAYCRGIVGIEQGIDERPTIDVITEIKGCIPHLEELIRKWI
FT                   DHLSDDDLILPFQGIGRYYEGQGNYGLALPWRQKCLVQAKKRFGTEHPDVATSLNNLAL
FT                   LHYNQGRYSEAKPLYDQALEMRQKLLGSEHPDVAQSLNNLALLFDRQGRYSEAEPLYVQ
FT                   ALEMCQKLLGGEHPDVATSLNNLASLFDRQGRYSEAEPLYDQALEMCQKLLGNEHPDVA
FT                   MCLNNLATLYYKQGRYSEAEPLYDRALEMRQKLLGGEHPDVATSLINLATVYESQGRYS
FT                   EAEPLYDQALEMRQKLLGNEHPDVAVCLNSLAGLYESQGRYSEAEPLYVQTLEMCQKLL
FT                   GNEHPDVAQSLNNLAFLYYTLERYSEAEPLYDQALEMRQKLLGNEHPDVAQSLNNLAKL
FT                   YYIQGRYSKAKPLYVQSLEMLQKLLGNEHPNVARSLNNLAELYDIQGRYSKAKSLYEQS
FT                   LNILQNLLGDEHPYTFKVQSNFDDCCKKIKELDT"
FT   gene            151723..151839
FT                   /locus_tag="AM1_E0200"
FT   CDS             151723..151839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32969"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPN2"
FT                   /protein_id="ABW32969.1"
FT                   /translation="MTPLRGRLEGMPVGGFNFAQSRSGDSSQTVLLMVMFSP"
FT   gene            complement(151803..152231)
FT                   /locus_tag="AM1_E0199"
FT   CDS             complement(151803..152231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32968"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPN3"
FT                   /protein_id="ABW32968.1"
FT                   /translation="MTEPVTLTAAVIANLAFQEFLKSSAGEAAQQFTADALTLMGKLRQ
FT                   KIWDRLRGKHDAAGQALTQAEQGNQKAIETVATLLGVEMLDEAFAGELRQIAQEINFHI
FT                   SKDTNTQVQNNYGGTNFQNSISGGEVFQGENITINKTV"
FT   gene            complement(152781..153596)
FT                   /locus_tag="AM1_E0201"
FT   CDS             complement(152781..153596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32970"
FT                   /db_xref="GOA:A8ZPN4"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPN4"
FT                   /protein_id="ABW32970.1"
FT                   /translation="MANSTENQNESNNHDLYFRYYEDQWTHVRHHESLRSSLTFQILVA
FT                   ATAIVAAYISVWELEKNTIARQYLLYFLGAIMILLGGVGYCAVKRIEKAARKHILRARK
FT                   ARKEIVLLEKIIEEEEIDSIKEDIKLIEKEIKSIKAKHISKLRKKIVNKFYSLSKPRNP
FT                   FRYRFWSSLCSGIREIFSNFPKYFSNGKINILINEVLYQIRRVRLQMRKVRLQMRKKRL
FT                   QAKKILSLDYGVDSAKRESTFPKIEPIYLSFNQIVVVLGIILVLTAFNS"
FT   gene            complement(153950..154348)
FT                   /locus_tag="AM1_E0202"
FT   CDS             complement(153950..154348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32971"
FT                   /db_xref="GOA:A8ZPN5"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPN5"
FT                   /protein_id="ABW32971.1"
FT                   /translation="MKKFLGIPAFFALFFLTPFAIVIIGFFYISSQHVGLPTIDELRAK
FT                   YPTCEQRSEFVSNYVKERQAEPIDLSMRYSPMEFIDRPATSLEDSWNRYRAGVEDILER
FT                   QARRIFVDTLYDLGRGCWHDLTSLLILI"
FT   gene            complement(154507..154929)
FT                   /locus_tag="AM1_E0203"
FT   CDS             complement(154507..154929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32972"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPN6"
FT                   /protein_id="ABW32972.1"
FT                   /translation="MKGLLVPLLFLLSWSTVASAQQVRELNLKGTTNMRPIAVDPSGVI
FT                   VHLNNGDKIQGLSLQPPNQIELYPLDGQLCTGVQQCQGQAPSMLQLTRVRPKNIKGKLS
FT                   NSDGSSMLVIVTNSGAKHVLFVVPTSRAKYQVVNIQ"
FT   gene            complement(154926..156362)
FT                   /locus_tag="AM1_E0204"
FT   CDS             complement(154926..156362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32973"
FT                   /db_xref="GOA:A8ZPN7"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPN7"
FT                   /protein_id="ABW32973.1"
FT                   /translation="MAAVLDKWKDTVNDGLEDESLIDTTVEIDDGDQDYTVRTQYNFAE
FT                   NPKTKIILVGACVSIVLILGGGLLLIMNSSSAITAQQQQQFNPSQAIAQSALSPEDKQL
FT                   LQEVLKRETFNRQDQQGRRLANKNKGVTAPSTLGQPSRSRVSVTPQRTVTPPRVIYRPR
FT                   PVAPPPQQPQRQFSVQRPVAVAAQAEVDDPNAGYFTAPLAATRKSPVSGQRKLLKLTKS
FT                   EGFKTTQKPVKLFNPPTQIASASKSIPQPQPRQLGNLSGNLKNPYMNQIVATASQAVIP
FT                   VDTAVSAQVVNRVSWIPENPKLAKGKVVRLKLQDDLKDGAGDVVASRGTIALGFVTQAT
FT                   EQGLISVNLTKIGSKFVQSGAVEIHQDGDPTMIAKLETKGGNSNWLKTALDIGIGGVQT
FT                   WASNRNNPTSQTSFTNGNQTFLSTNNSDLNSTAAFVEGATGRIGERLRQSVNGLTQTKI
FT                   GVFRFGGKRVQLYFVREVRL"
FT   gene            complement(156365..157087)
FT                   /locus_tag="AM1_E0205"
FT   CDS             complement(156365..157087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32974"
FT                   /db_xref="GOA:A8ZPN8"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPN8"
FT                   /protein_id="ABW32974.1"
FT                   /translation="MLKTSIFEQVARDTPSGLTPFLLKALIATTGGLVVLSPLFWQLAS
FT                   INGRLTAIEAGPPVVQVGQDAKLISAERLNPDANAKEFIKEALPALFAWSQRVSPDVHP
FT                   TGIDPGRNTRYGPLPTLIDVYSNALASPYREAFRQGISDYKPKKFNQGEARLLNITRIA
FT                   PPQKTEKGWEVLVFAELIDLDKNDDAYASTPFNNVIHLVEVEAPKKRAAFTPIEQIYAE
FT                   VRRRGLMIIRIEAFNERS"
FT   gene            complement(157090..158139)
FT                   /locus_tag="AM1_E0206"
FT   CDS             complement(157090..158139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32975"
FT                   /db_xref="GOA:A8ZPN9"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPN9"
FT                   /protein_id="ABW32975.1"
FT                   /translation="MITLAAITDNPQDIIDNANELTNRVEAAVQVLWDVLNTPLFIEIA
FT                   NLGAIIAFLFAAFWFFRLVRHWLDPEMNQAPDSIRLFLIAILLLILLGTPTNRGKLLGN
FT                   VVVNADRLGNALTQMVLDKLETGPNSSLNELQVQRAVQARMQEDFQRCSELPSGEEREQ
FT                   CIIEGQQRVTSATAPFGNVEWAQKLRKDSIALFGEITDDYVAYSDKVIGQTVEKEIKLF
FT                   IADTARKLIASILFLITAAFMILLRVAKPIVALIMPLYVGLTFVPSDNPPIVFGMGLFM
FT                   DLFLIELVFKIFLVLIARVMLLLPGEDPLLLPIFLVIVMIPAVVYLARRPPGGGLGFGL
FT                   SALGLLRRR"
FT   gene            complement(158136..159143)
FT                   /locus_tag="AM1_E0207"
FT   CDS             complement(158136..159143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32976"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPP0"
FT                   /protein_id="ABW32976.1"
FT                   /translation="MCNRYLKLLPISLLVIATPVAAQNVAEGENDYWRTTDVDYSVFKK
FT                   DQPINNKGLFEVDKKTGEETQISKDFKKGVEIYQQAKPVIDLVGGLFGIGKHFSFLKHI
FT                   DNNLAYGEWLFGKVPRQQQENGVTVDGAPIGDVYGVDGQIDPAKVREQIASVVLASVPD
FT                   PTGPLGLSGYAYQTLVGDLAVTRAQRKNLEVLFGEDGQTFAKEARDFVANVIRTSGEMV
FT                   DQAHDANSTQDVEKIRAQIEANGQLLGQFQFSEQQQTRFSVNRVHDTTLANLEINQKKD
FT                   WKDEIERTAQNLSLANAQNLVFSVAQSGQQTDPVNPNLQTAQTQQAPPFVANNR"
FT   gene            complement(159136..162237)
FT                   /locus_tag="AM1_E0208"
FT   CDS             complement(159136..162237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32977"
FT                   /db_xref="GOA:A8ZPP1"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPP1"
FT                   /protein_id="ABW32977.1"
FT                   /translation="MTEEVKSIQYTPALDERPHILMIPREVFVFGVVVLVLIVLLQSII
FT                   ATLHLSLPWIPVLGLWLGLTVSYWMLLGSQPWKVMGALHPDKLRVNANLKTEKDIGSGL
FT                   KKRIGKTKTIGPKTAQRKVSPAEDDIDIAAVIDFQLDPDPRCGALLLQREGKLQAVWMK
FT                   DSDGIPSTSTREQARVTAEKIQEGFRDLRIGDPLTMHMGAFANCEDRIREINRQGEQCP
FT                   SEPISFLLYWIRRRVRALQKRGKYQPKFLHFYIHHDLGAMGRHQDPFTSTVQSIVDWWD
FT                   ERRKGQQLDQRLHELLISAYDESFIHYRNFFNKCGLSARPMTPEQVWAAVYRRFNSGEV
FT                   PPIPQVIVVTRESITAHRNGRRAISSVLLQNTPDYGKSVVWLPGRQMYAGGLVLNQRPN
FT                   REYHPHTGRLDQLLDASSPILGDRHSVKPDALSNLEIIATFEAEPQKAVLKTSQRNTGQ
FT                   SNQSLVMTENRKRLDGGAIYNTRKSLEAEMKLREGGHTLKVGWMAIVYRKDKRSLDRAI
FT                   QRLSSIPIFAGEKAKRETGYFDSLFLEAQPVTTSVLLKGSLAKLTEKFNRQMRETTAAA
FT                   IGMMPLVMDGRPDQRGIEFISKAGSPLKVDPFGRKPHNHMILMGTTRTGKSFIVQAIST
FT                   YVLSQPDTQVVIIDAGREDNTGSFDAYTQFVDASHFDAGSDFFNIFQKPDPRIMRPEQR
FT                   DIAEGLFKKFLVGALKNLTTTRDDTATLIKFYTDILTNLVTAYLSEPPVQTAYANAYAE
FT                   GYGTQAWRQMPCLRKFVDYIALARLPAELQSDEAEQAILRIKMSLVALMQRQSGKAISE
FT                   PSSFQVDKPLVVYGLGSVQDDADMVPALLAAQASMLNQTFTRKRTWVVAEESTNLWRFE
FT                   SYRGIVAEWFTGKAKSGVWACWVGQSLNILLQHKDEASSILDNVGTYLVGAIKDTAVKD
FT                   LTEIGFNPEIARYCTDSDFNPDRDNPPLEFASQWLIRTGGRYHFGYHYPDFASFGLTMN
FT                   NLDEVELRDRIFAESNATDKYEQASALALYLQQQSEDQKVIDHV"
FT   gene            complement(162248..162706)
FT                   /locus_tag="AM1_E0209"
FT   CDS             complement(162248..162706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32978"
FT                   /db_xref="GOA:A8ZPP2"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPP2"
FT                   /protein_id="ABW32978.1"
FT                   /translation="MSRLNPIQRRQLYRFLNKYKWVILAAIGLAFAFCEPTFAQCVGWL
FT                   CGPKDVLRGNAVLSQDTKAVAMIDFFFIVVQILVMAILVALAVPLVHKLRREEDYMAPF
FT                   VAILAALLLIIGINYLGGYLLGNGTTGTASNTTTGGTPIGGVVNPGTN"
FT   gene            complement(162749..163027)
FT                   /locus_tag="AM1_E0210"
FT   CDS             complement(162749..163027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32979"
FT                   /db_xref="GOA:A8ZPP3"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPP3"
FT                   /protein_id="ABW32979.1"
FT                   /translation="MKKIAKADVFIQWLAALPLIKQMVYQTEAHPWRVLLLFCPGLLLI
FT                   TVGISHIGSWAFTAGNGTLSGICASLAVFILITTALTAGVVWWKAYR"
FT   gene            complement(163058..163789)
FT                   /locus_tag="AM1_E0211"
FT   CDS             complement(163058..163789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0211"
FT                   /product="peptidase M23 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32980"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPP4"
FT                   /protein_id="ABW32980.1"
FT                   /translation="METATVPPVPIDIPVPEPLADDSAVLAPPLEQPKPALEETNQPYG
FT                   EIPSTPLEPPYQAPLPTPAPQPQTSVPPQPRQQIQPSSGVAYRQPVPTTIVETIGYPLT
FT                   SIFAVTSAFGWREHPVQGNTSFHAGIDLGAPHGTPTLTMLSGRVIHADWEGGYGKSVVI
FT                   EHPGTGLKTRYAHLSKIHVQPGQWVEQGWHIGDSGATGLVTGPHAHIEMIMNGQPVDPW
FT                   PYLAQASRQAVLINRFHPWAG"
FT   gene            complement(163957..164919)
FT                   /locus_tag="AM1_E0212"
FT   CDS             complement(163957..164919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32981"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPP5"
FT                   /protein_id="ABW32981.1"
FT                   /translation="MYKSISLALLMAAVPAMVRAQTTPVVEISEGHGHTFTLEGSQARI
FT                   VKAWPGQFEAFDFGEHPQIPNAKFIFVKLKPGAKLDSTTLTLIIDDGLGKETTKSYVLK
FT                   RVKGIPSQTTTLIGNQPVYAAQPQPTQSVTNIFSPPPRPVKQIHKEKKGKKPKKLKVSK
FT                   EFSSAFSSGFVASKPVDEPQPAKRAKEPAPEETEESDVPDSVEPTTEEKAETAQSEPLP
FT                   LIRAPKTLQAKATIETPTQKQLIARSGLDNYGIARYLLRGLYQAERLNQINTHTPQFGQ
FT                   AQDTAIWLRRGRSIEEALELSGLPPVTFNNLLGHGGVGK"
FT   gene            complement(165048..166478)
FT                   /locus_tag="AM1_E0213"
FT   CDS             complement(165048..166478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0213"
FT                   /product="RNA polymerase sigma factor domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32982"
FT                   /db_xref="GOA:A8ZPP6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPP6"
FT                   /protein_id="ABW32982.1"
FT                   /translation="MIKGTGLRPSPDIIATIARHPNLSPEQEAELILKAQDGDNDARQT
FT                   VIYSNLAWICSMGGSLSRKGIEDGELISEGYFGLNKAIDQWSSEKGANIRTFSRDKIYK
FT                   FQSEAVHQKNHIRLPKSTYEQLSKLKKATAVLGEDATVAQLAEGTEIKEKRIRTLQEIS
FT                   QPVSLNSVTGTRENLELLDQQADDCQGSLDPALSSELLDLVDKLHPRQREILHLYHWEE
FT                   LSFQKISDYLGLPAKKVRKLYKQALDLLRKFLQGEINEFPPLPLLEWRNFVFAKFFLAT
FT                   GLSQIFNVVVAQLKRLKRLHQNNHTAPVQSQLTVSQSSTEVLPESDPEIAIQAPVEPST
FT                   QYSVWYQRLWQFVNRDKPTHSRVNTHQIDSGGLRDGPKFLLDSFWHVLNCIAQFLGYWP
FT                   GSPRGSDQYRCRSGDRWRCRGKTQGRYSKKKVKLRIRLKIPLVHHCQFSRKKTKPKIEY
FT                   FNSIRPFLRLSINQLQIS"
FT   gene            complement(166702..166872)
FT                   /locus_tag="AM1_E0214"
FT   CDS             complement(166702..166872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32983"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPP7"
FT                   /protein_id="ABW32983.1"
FT                   /translation="MLKTTFLPLGLLAIKSTSAFTNPATVPIDRSVGEIQKLTISQEES
FT                   HYLDFSDTEHN"
FT   gene            167274..167567
FT                   /locus_tag="AM1_E0215"
FT   CDS             167274..167567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0215"
FT                   /product="addiction module antitoxin, Axe family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32984"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPP8"
FT                   /protein_id="ABW32984.1"
FT                   /translation="MLSKDISYTQARANLTDTLNDVEDNRSIVVIRRRGRPGVALIAED
FT                   ELTSLMETVHLLKSPTNAKRLFEALDEVQSGDFEVADSIHELAEELGLEQEA"
FT   gene            167551..167844
FT                   /locus_tag="AM1_E0216"
FT   CDS             167551..167844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0216"
FT                   /product="addiction module toxin, Txe/YoeB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32985"
FT                   /db_xref="GOA:A8ZPP9"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035095"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPP9"
FT                   /protein_id="ABW32985.1"
FT                   /translation="MSKKRSLSASKDSTEIAFSRKFREDLQYWVKTDRKTALRLLDIVD
FT                   AIERDPFKGIGKPEPLKFAGSDLWSRRLTQEHRIVYLVEHEKVYFLAARFHY"
FT   gene            complement(168013..168471)
FT                   /locus_tag="AM1_E0217"
FT   CDS             complement(168013..168471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32986"
FT                   /db_xref="GOA:A8ZPQ0"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPQ0"
FT                   /protein_id="ABW32986.1"
FT                   /translation="MSDCQIDWFGFALNKGLHLLKDFTQGINLPSWLAPLSMVGVLAAL
FT                   IKLIPSIEKGSFLAGIGGYLLLGLLIVNVIALSIFVCLPGKLITFKSRSVSRTRLTLMR
FT                   LLLMGVLVMLRDVIKVALHLVFDVVFLLFTALTYPSRQDEQPLNLQGC"
FT   gene            168784..168900
FT                   /locus_tag="AM1_E0218"
FT   CDS             168784..168900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32987"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPQ1"
FT                   /protein_id="ABW32987.1"
FT                   /translation="MEWKNDPLKIPILNIGDADDLYLVSWISIAAQEQICLL"
FT   gene            complement(169198..170106)
FT                   /locus_tag="AM1_E0219"
FT   CDS             complement(169198..170106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0219"
FT                   /product="carboxylesterase NP, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32988"
FT                   /db_xref="GOA:A8ZPQ2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPQ2"
FT                   /protein_id="ABW32988.1"
FT                   /translation="MKISDYHPFRSAEAKETYLAHYDARAKKWPIPSTEHYIDTSYGQT
FT                   FVRVSGPDEGSPLVLLHGHSENGLNWLPNIQELSQQYRTYVVDIISDPGRSTYTKVMKG
FT                   IDDYNYWLEELFDGLGLKQGINLAGLSYGGWLVSRYALRYPQRLHKICLIAPAGISPFP
FT                   VKFIAFALFLSLFQFRSKLLFKQLTRWMFEDFIKTQSQGEEKFEDWFEFIYLGIQSHQA
FT                   QPIVFAKVFKDAELQALKIPALFITGENEIIYSVPKTLNRLQKVAPDIQVTVVKNAGHD
FT                   LPLAQPQQVNEAILDFLQVGT"
FT   gene            complement(170131..171177)
FT                   /locus_tag="AM1_E0220"
FT   CDS             complement(170131..171177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32989"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPQ3"
FT                   /protein_id="ABW32989.1"
FT                   /translation="MAGSLSSFEGYDIFLNDVKTRIRAAQVKAKLAVNQELVLLYWQIG
FT                   REILTRQQQQGWGAKVIDQLSKDLRQEFPEMKGFSARNLKYMRAFAEAYDDQQIVQQAA
FT                   AQIPWFHNCVLLDKVKDPQIRQWYSQKTIENGWSRSVLVHQIESDLHKRQGSAITNFDR
FT                   ALPQPQSDLAQALLKDPYHLEFLGIAEEVQERDLENALLHHMRDFLLELGVGFAFLGNQ
FT                   YPLTIGGEDFYLDLLFYHVRLHCYVVIELKMTGFKPEYSGKMNFYVAAVDDLLRSPGDQ
FT                   PTIGLILCKSKNQTIIEYSLRDMNQAIGVSTYHLGDQLPLPVQDKLPPIEVLQEQLEQI
FT                   PNDKEPIN"
FT   gene            complement(171367..171657)
FT                   /locus_tag="AM1_E0221"
FT   CDS             complement(171367..171657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0221"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32990"
FT                   /db_xref="GOA:A8ZPQ4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPQ4"
FT                   /protein_id="ABW32990.1"
FT                   /translation="MSENGSLITWKLKQTMDKHGITTSALAESMGVSSNSISNMRKSEM
FT                   PRLNGERLNQLIMCINQMRKPGTRLIELEDLIVLSYTTAEMKTSTHQQSRK"
FT   gene            172464..173747
FT                   /locus_tag="AM1_E0222"
FT   CDS             172464..173747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32991"
FT                   /db_xref="GOA:A8ZPQ5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPQ5"
FT                   /protein_id="ABW32991.1"
FT                   /translation="MVATLVSDRQSNLSEFNDRQSQYTLIIQAQAGDLRARDRFIRQNE
FT                   GLVFQQAHKFRGLADWDDLVNAGNLGLAIAIQKFDVAKGYKFSSYAVKVIRTEIRRLIH
FT                   EFKGISIEISLHLKEIEQASQAIRMDLDREPTITELSDETGYSQQVIFNAWNKANVVET
FT                   ASLNIPLNDDQGCEQLDVIGVDDRTWEFTETLDQKNYIAQLPDREAFIVRAKRDGFSNK
FT                   EIGTMLSLSGERVRQLLKQARAFLKHLMTYGACFVQFPKPVPISPVKSNKQVLKRVDAT
FT                   RLGGRIGKVITQVFNPFKEWLIEENGGLNHAQEHFLDFRRCSNHGAVDVARHQLTPVNQ
FT                   RCHQLERPQVNWLGYLGFNPVILNILLLPLALVSKSIRGFQNNDRPNIRRPMMSFVITG
FT                   VFGDVGIGYWKEHPRPPNDCPETNESLH"
FT   gene            173713..173853
FT                   /locus_tag="AM1_E0223"
FT   CDS             173713..173853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_E0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_E0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32992"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZPQ6"
FT                   /protein_id="ABW32992.1"
FT                   /translation="MIAQRLTKVCTNQAANLFILIRGINRCFSSSDHIASDPETLDDLL
FT                   F"
XX
SQ   Sequence 177162 BP; 49049 A; 39103 C; 40045 G; 48965 T; 0 other;
     gtacagttgc ttcgtgacct gggggtattt gatttagtgg atacctacaa cgtcaccagc        60
     gctgattatg aagcctacga taaagcgttg gagaagggac gccaagtgca acgacaacgg       120
     cagtctttga gattggaggc caagggtcta tctgggcaga tcagggaaat cattcaggag       180
     cagaaggtca ttcaagctaa gttgacggct ttgggcagaa aggcccaccc caggaaggca       240
     gcgctgaagg gggagctgga gcagttagag cagcagaaac aggccctcaa ggaccagaag       300
     ctgggattgg tggagcgaat tgagcagcag tctcaggcgt ttacccaggc ccgatatgag       360
     caggttgagg cccggatgcg gatggaaatc atggtaatga cggaggggga tcagcggttg       420
     gaagacatca aagtgaaggc gttggaatat cgctatcaga tctaccgcca tttccgtaat       480
     gtcatcagtg agggtcagag tgctgttgca attgtcaata agctcattaa aagggtggcc       540
     catgagttgg tgaaggtggg cagtgaggaa tccgtgagtc tgtatgtgat tcgctattcg       600
     ggcaatgaag cttacaaaga ccagatgctg aaggcatttc aggcgaaatg gaatcagaga       660
     ttggagaaaa atagaccaag ttgtgaaatc tgtaagaaag acggtgatct aattacagaa       720
     atggaaaagc gatctgaaat agatggattt ggtcatggat ctgatcagga aatcgggcct       780
     ttggaagggg gtgatgatgg gatcgagggg ggatctgagg tgaatttggg gggtgatgga       840
     taaataacgg ctcttcacta gtacctgtca ttctcaagaa aatggtcatt ctgttaaaca       900
     tgtgtttgca acaaaatatg aagcgttgca taaatgtcgt gaaggctaca gatatcaaaa       960
     aaagttggaa atcattctat gaaattgtaa gttttttagg atgagctcac aaatgagaat      1020
     acgtgcatat tagaagtctt ttatattcaa cacttataaa agcatttttt cacaagatat      1080
     tcttacttag taagcattag tctgaacagt tttctcggtt ttttgtgctt tatcttaggg      1140
     cttttaggtc aactcagtta gttaacaata tctctaagga gaaagacaat gagatatgct      1200
     agatattttg ttctagtggg tcttgcacta atcgctctat ttttctatgt caaagctact      1260
     tctaggaata aaggttggcc ttgggataag aaaactgatg tcacacgcaa tgaaagatgc      1320
     atctcaaaac tatggtttta tatagtttct ttaagagttc caattatctc aatattggta      1380
     atcttatctc ttccaataat ctcggctaca gtagcaaaaa gattcttggg aaacctctat      1440
     tctctagaat atagttggca gatttcagtg gtaattttcg catcaggaat gatgtcatta      1500
     attgctataa ctacacttga aactatcgct gaaaatattg aactaagatt agagttgcct      1560
     ttaggagagc gacataactt tttcactaaa ggtagatttt cgaggggggc atttacatta      1620
     attcttgctt caccaactgt tgcaatacta ttctataaat cattagatat aggagtatat      1680
     caagtagtaa caggaataat tttcggtggg ctggcctcga tagtattctt gtattcaata      1740
     cattcttttc ataactgggc aaagacaaga catagaaagc tctttgaagg cttttttaaa      1800
     tttatactta caggcaatat aaattcttgc aacaatcata agtcattaaa tggatatttt      1860
     cattcaaata gtcctgcatc aagaactatt ttgaatgagc atatttggaa tcttttactg      1920
     tttgtaagtg ggttattttt ctattcaatt acagctttta tattctatcc aggaaataat      1980
     attcttggcc tagatgatcc accagcgctc tggtttgcat atttaattat ttggatgctc      2040
     acggggatat taggtggaat tactttttta gccgaccgat ttagaattcc ggttcttctt      2100
     gcattattta tatttactgg tctgtcttat ttagcttttg atgttgatca tttttattcg      2160
     cttgaaccaa taactaagaa ctcagttatg tatacagctg ataatagtag acagactgat      2220
     gattttatct caatcataaa taataaattt agcaagtcat cattagataa ggagaaacgt      2280
     acgctggtta ttgtcggagc tagtggcggt ggaatacaag catctggttg gactgttgaa      2340
     gctcttgaag gactaaatca agatttaggc aaggagttta caaactctat cggattaatt      2400
     agttctacct ctgggggctc agtaggtact atgtactttc ttgatggctt gaaggatgga      2460
     agcttaccag aaactagttc atccaatttg atttttgaaa aagcaactag caattcatta      2520
     gatgcgatag gctggggatt atcttatcct gattttcttc ggataatctc attacctccc      2580
     ttagcagggg atgatctaaa agatcgtgga tatgctgttg aagatgattg gaaaaatctg      2640
     atgcagaatc ctgatacaaa attatctgac tggaaaagaa gtattgataa aggagaaatt      2700
     cctattccag tttttaatgc aactctcata gaagatggac gtagattttt aatatcgcct      2760
     gtctctctaa ttgatggaaa tcttcaggat ttagtttgta atcagaattc taatcaatta      2820
     gatcgtaaag cattagattt cagaactctc tttccaaata aagatttatt tgttactaca      2880
     gcagctagac tatcagcaac ttttccatat gtttcaccta tcccaaggaa tcaagaagct      2940
     caacatttag agtgtcctgg ttcatcaacg gagtctcatg attttgttta tcatgttgct      3000
     gatggtggtt tcttcgataa ttctggatta tttactgcaa ttgaatgggt agataatctc      3060
     cttaaaaacc ctgttagtga attagaggtg gaaagaatat tattacttga aataacagct      3120
     ttccctggag aaaaactaaa aggacaaaaa ggtaactctg gttggttaaa tgaatgggtt      3180
     ggcccactgt taactttaaa tagtgttaga gattctacac aaaaggcgag agatcaaaaa      3240
     gaaattgaag gttttgcaga tctttggaga agtaaaggaa ttaaagttga gcatttttca      3300
     attccatata attccaataa tcagcctttg tcttggaaat tatcactcaa tgagaaagat      3360
     aatataagag atgaatggaa cagctataag cgctcaagtg agtatcgatg tctaaataag      3420
     tattggactg aaactgataa gtgggattct aaagaaaatt gcttagctaa tgaagagaaa      3480
     ttaacttagt aaaataacat tagatcctaa tgaaaacgac tttgtgaata ttgattaggg      3540
     cattaaaaaa tgtcaaatta aacttttcca acaaaacccc cagtgcagat ctcaaaaact      3600
     actctgcacc tgcagtagca aagtatatct gtatgcttcc ccaactcgtc tcttaattcc      3660
     aaacctacgc aaaaacaccc agtaggccca gaagtagctg ctacttacct tgattagaca      3720
     tcgtttccaa ctattgtaag gaaagatgag ccactagtga agcgtaagtc agcttcagag      3780
     ggaggggacg acaactacac tgaacccacc cctggataca accgcagaga acccaccgat      3840
     actcggagaa ctcagcgagg atattcagct cggcaaacac caggaagagt ccgacccccc      3900
     agagtttttg agtccaaatt tcacgccctt gagcgcagtc aaaagaattt ggtacagcag      3960
     actaaattag agggtcagct tgaatatcta acggtttccc aaagcggttc agggcagtac      4020
     tggatagcag tggagggaat cggaaagcca ttcatcagat ttccctgtga aactccagag      4080
     ttctgctttg tggccgcatt agaactagag gaaacgttcg atatcttgca agtgattgaa      4140
     ttgcgtcctg gtgagaccat tgagcggatt gaagagatgg ttgacgtgta tctggggtat      4200
     gagcgggtgg caaagtgttt gttttattca gtacctgttt gagaattgtt tgaaacccct      4260
     tattaaatct ggctttcagc gattttgagt attttggcta taatctatgt cagataaggc      4320
     ttctggagaa ctcttcaagc aggttcttag ggggggtaca cgagtgcttt tctttgtagt      4380
     cttaagaggt atgaagtttt aaaataaaat ctttgttatc aatccatatt aaaacagctt      4440
     tcttccaaga caacttaatg catttataaa aaatttcttt ttagactgct ttcttaaaat      4500
     gaacacatga aactatagta atatacgata tttatgctta attcgacttt aacgcacttt      4560
     agtttttaaa cttaactaat tataagtcat tttttaatgg tgatgaatat ggtaatctaa      4620
     tattattcgt aagatttaaa taacctgaaa gccttctcag tgcttactaa gattaaactg      4680
     cattatcgta acttattttt gatgctatag attgttagat attgctttat tggcattgct      4740
     ttaaggctaa cattacgtta gcaattttag gtagatttgg tgtaaaaaga tcaactaagt      4800
     ttcattttat gaattaatct agaaatcttt tcctgtatag ggtttgatcg aatttacatt      4860
     tcaaactcta caaaagtttt tcaagcctta tctacttagt gtaatattat gactcgcaag      4920
     ccaaattctt ctgacgatcg cccttctaac aactctatca gagaaatcct tgcttttctt      4980
     cttgatgcac taagaatttt gcgtggtaat ctgacagcaa aagtcatatt tcttttgatc      5040
     agtagtgggg ttgccctact cacaactcaa tggtgggtgc catttattca gactttgatt      5100
     tgtgacgttt gggaacaaga ctgtaatcga attgatgcta gtgatcggtt agtattctgg      5160
     agtggttgtg ttttgaccac aatcggtatt ctattgcttt tatattatta cccacggcaa      5220
     agttataagc taagagaaga tcatattagg ctttatgaaa caactgagcg gacaaaatca      5280
     gagaagatat taatcaatgc cgttgaagca gaagttacta gccgtcttaa tcagtctttg      5340
     cataatcaag tactaattaa tttaggtaag acagaaaaat ttacgcaggt aaaacgaccc      5400
     tgggattatc taattaaagt aaggacaaga gttgaagaga tacttccatc agatgtaact      5460
     atccagcaag tattcgatcg ttctgacatt caaggtcgtc ttcttgtatt gggacaacct      5520
     ggctctggca aaacaacggt aatgcttgat ttagccaaag atttattaga aagagttaag      5580
     gatcctaaag agtgtattcc tgtattactt aatctctcct cctgggctag caaacgacaa      5640
     tcaattccag agtggattgt tgaagaactc aagagtaaat atggtgttcc agctagcatt      5700
     ggcaaaaaat ggttggctga gcaaaaacta ttagtacttt ttgatggtct tgatgaagtg      5760
     agaagtgatc gccagcatgc atgtgtggaa gcattgaacc aatggatttc tggtgatgat      5820
     agcaatagaa ttccaaagca atttgtggtg tgcagtcgca ttgaagagta tgagcaacta      5880
     gaagctaaac ttcaaatgaa tggtgcaatt tgcctgagtg aactctcaaa ccaacaaatt      5940
     gaagactatt tagtgtctat caagcaacaa catctatatt ctttttttag tcaaaatccg      6000
     gctattctaa atttagtgca taccccatta ttcttgagta tgatcatcag tgctgagcag      6060
     tcagcaccag gggagttaca agctttaact gggaaggata aaatacaaac gcgtgtactt      6120
     gatatctatg ttagccagat gttggggagg gctaaaaatt atacacgtaa gcaaatgcgt      6180
     acttggttag ttcagattgc tagtcaacta gaaagagatc agcaaactga gtttttggtc      6240
     gagcggatac agccaagatg gctgcagaat gaaaaattaa agtcttcata tcaattgagg      6300
     gtgagtttgc tttttgggat attctacagc ttgtttagtg gagtgtttcg tagtttgatc      6360
     cgtgctgcca tcaagagttc atccagtctg cctacacttt tcatagatgt actactagaa      6420
     gggctaatta ttgggttaat ctacagacga ataaaagggc caaagtctgg attgatagaa      6480
     ggaatgatta ctggcttgat agttcaactt acgattaaat caactggaat ttttatatta      6540
     actggatcac tacctgaagc cctgtttttt ggacttcggg atggattgtt tgatggacta      6600
     gtcataggcg ttatgcttgg attgggtaaa gatttgatta atggatcaaa ccttattact      6660
     ccagttgaag gtatctcctg gtcatgggaa aaagttagac gtggtttgtt ttatggctcc      6720
     attgttggtc ttatctttgg agtcattagt ggtttagttg atgcaatagt tgttgggctg      6780
     agtgttggaa taagtagcgg attgattagt ggtttgagtg cgtatgaagt ggaacaaaaa      6840
     gtttctatca accaaggaat ttggaagtct ttacactctg gcttaatgca gttcatgatt      6900
     attggactag gtggtgctct gatggttgtt ctgcttggta tattcaatct tgaacaacag      6960
     ccaattacct ttttaagtga ctgggttaac tggttatggt gggggctgga ctatgtactg      7020
     ctgagaaata tagaagtccg cagaggtacc gggttgattg gtggtttgta tacctggatt      7080
     agattaggac tacttggtgg attagctggt gggttaggtg tttgtcttaa acacttgagt      7140
     ttgagacaaa tactcttcac aaatgggcta gctccctgga actatgccag atttctcaat      7200
     gaatgctcag actgtctttt attacagcgt atcggtggtc gatttctgtt tattcataaa      7260
     tccgtccaag aacatttctc tgcaatgtct tttgagaatt cacaaactta gctaaagaaa      7320
     aaataggctg atagaaactc atattagggg taattgaagg gttgacactg ttggcgaatt      7380
     ccaagaagtc acgctggtaa tggctgaagt atcctcttga aaagagatac acgggttttt      7440
     gctagtggaa catcattaaa ccaagcgtct aagcggacaa aattgagagc aatggcacag      7500
     aaaacattct gtagatggct cttcgctaac ccgatatacc ttgactggcg catgccaaat      7560
     cgccgtattc cctgtgaatg ggtactctca acaccagccc gcaggctata tttttccttg      7620
     aactcagtcg ttcgttgcac ctgacgccgt tcgttaaggg cctgatgcaa ttcacgggga      7680
     cgaaaggtta gctctctagg ctgggtcttt gatttcgtac attgagatcg tacgggacaa      7740
     cttcgacaag ttgtccctag gaaccgtgct cgaatgacat cctttccatg aatatcctgt      7800
     ccaggcaacc actttgtact ggagtgacct tgaggacaga caaccttctg ttggtcccag      7860
     ttaatttgga agacgctggc atcaaaccca ttccctgcct ttgcctgcca gctgtggttt      7920
     tgacgcacgg ggccaacaag gtccatgtca tattctgctt cactattcac taaatgctca      7980
     gcagaaagat agcctccatc tagcaaatgc tctttaggca acaatcgttt ctccgctaag      8040
     gcaaggtgaa tgggttcaac aacttgatca tctgggacgg ttgcacgggt agtatgcaca      8100
     tgagtaatga ggcggggatt atcgtgatca cacacttcag tgaaatgaac tttatagccc      8160
     acccaatcca tacttctttt attgctgtag cgggcttcta tgtcgtaagg agaatgaatg      8220
     gatacatccg aagggggcat atccttcact tttcgccatt cgactgtgcc gtctgcattg      8280
     ggcgggtaga atcgctggag ccagacttgc cgcaaagttt ctacagctgg tagatgcttt      8340
     aaccagggtg gtgagcttgg gtggtatatc gcatcaagca gtgccaaacc atcttgaccg      8400
     atagtactgc ccagggcttt gcgttcgcta tcgggtttag gcaagcgata attctctatt      8460
     cgtcgaccat agcgatcaaa ccagtcttct tgcatgtgtt cgcttaacca ctgtggatct      8520
     gcaacgacta aactgttgag agcagcccga aaggtttcac caaataactc caaccgattg      8580
     agggttcgga tcgccgctaa gatatgagtc gcatccgttc gttgttgatg gtgttctttg      8640
     agaaaccctt tggattgaag gtgctcaaga aagatatcaa atagccgttg ttccttgcct      8700
     ccctcgatta gacgcttgcg gaattcactc aaaatagaat aattaaatcc agagtctttc      8760
     agcggtaggc tcagggcata cttccaatct atccgggctc gaacggcatc agccgcttga      8820
     cggtctgaaa gattctcaag aaattgcatg atgcaaacta acacaagctg ccagggggat      8880
     aaagctggct gtcctttctt tggaaacaga tcagcaaaat cgtgatcgtg atagataatg      8940
     ccaagttcat cacgtagttg catatacagg ttgccattag gaaaggcagc cctagctact      9000
     tcaagggttt cactagggat gtccaacaag tctgtcgggc gcatagatat aacaatgagc      9060
     ctccagagtg agcgtgattg attttaagtt ttagcagtaa catacctcaa tccacgaaag      9120
     gctcgctgca tcaatggtta gaaacttttt acagccgtct tagatcattg cggaatattt      9180
     cgccaacagt gtcgaccctt caattacccc aagttaagct ttcccctgaa actccctaga      9240
     gcatatcccc agacgctaca ctgactttgc cttagtagag aagatctgct ttataaatta      9300
     tgcttcaaga gaaggatact tcccgtcttg aatatacagc ggaagactta atctcccata      9360
     aattgcagca gtctagaata ctggtagcca agcctaaatt tgaccgtgaa ggaacagatt      9420
     tactcgcttt tttggagatg ggtgatggtg ttaaattttg ccgaattcaa tgtaaagggc      9480
     gttcgcttgc aaattccgaa tcctcccaag tgaatctccc aaagtcctat atcacagaag      9540
     gatttgtctt atttctctat gttgaagaat cggccaatgt ctctggtctg tactgtttct      9600
     ttcagaccga ttttcagaat ttgcagtatt ggcatgagaa tataaaaggc gagtattctc      9660
     taaatatttc gaggagtaac ggctttgttg catgaatcgc gtaaaggcta gatgaattgc      9720
     ctctcctcgt tattcttaag cttcaaccca aacagtctcg ggtttggcga tctgaatcat      9780
     tcgattgagt gccgcacact gcaggagtaa ctctgtggct tgattatcaa agttacggga      9840
     acgtacctga cccccaaaga tagttttgaa gcgaaacatc gtcgtttcag ctagagaccg      9900
     ccgatgatag tgggcttgtt ttttccacct ctttcgtccc tgttttcgga tggctctgag      9960
     attttgatct cgtggatggg gtggagcatt gcagtttcca tgttgccaaa ttttggcatt     10020
     cttccttggg ggaattgcag ctgtggcatt gcgctccatg agggcatcat agcaatgact     10080
     ttggtcatag gctccgtcag cagagacctg ttcaatctca tcgtcgatgc cttcaaggag     10140
     atcttcaaac acttcaccat cctgaacgtc attggttgtc acgacacccg tgagaatttc     10200
     tccagtggac tcatcaacac tcaagtgaag tttacgccac gtccgacgtt tgctcacacc     10260
     atgttgcctg gttttccact ctccttcacc atagactttg acccctgtgc tatcgataac     10320
     gacgtgaatg gcaccttgct taggtataac gggcaatgaa atcgatagct gacctttccg     10380
     ccgagagacg gtgctgtggt cacaaacggg aagctcaatt cccatcaact caaacaatga     10440
     atttagaaat ccttcggttt gacgccctgc taaaccatag atacatttga cggtctcgaa     10500
     ggtggagatt gctgtatcgc tataggtcag agaggctccc cgcttttgtc tcggtgtggt     10560
     ttctagccaa tgaacgatag ctgattgttc gagccagaag gtcacacttc cccgctgttt     10620
     gagaccagcg ttatactcgg accagttgcg gatttggtaa ctcatgggct agcggttttt     10680
     ggtggtacat aaactctagc ccgcgcctaa tccgcagcac ctattcatgc aacaacgcca     10740
     ggagtaacta caaagctaaa ttggagagct ttaaattcga tgatactaag atcgaacttt     10800
     tacgcacctt gatcaagaca gctgagtctt ctggagaatt tagaaagcta atctacggaa     10860
     acttaacggc acaagctggt cccgcgacag caagtgtaga attaactgtt gaagatccca     10920
     atgctggcgt ctaatgccca tctgacaatg acttgaggag atagtggtag tgtacctgga     10980
     gcgggagcgt gtagctcgga tctgggggtg agggatgtcg tgtaatctgc ttgtatgtaa     11040
     ttcataacaa agcttgggtc ttggcctctt ttggtgaacc gaaatgggaa gtaggggaaa     11100
     tagcgtctta catcagctac aaatttggag tgaggctgac ggcgtaacgg aaaatttgtc     11160
     ggttgcatgt aaggcattat gtctcattgc tcattggcgg gttagctcaa gaaaatagtt     11220
     caaacaagaa gtatgaccat tgcatagaga atgatttgcg tagcgcatag tgaaaacaag     11280
     aagctgcagg tgacggtatg cttgataatc gactctggga aagtaattta gatgattgag     11340
     ttgcttgtat gcagcagtag attctattcc cgcatcgcgc atccatttta tgtagattat     11400
     tggaagtaaa agcatagcta ccgttgttgc aggagggata ataggagcag atttgataaa     11460
     tttctgcaaa gtctccgaag acgcgagcca accgattaca atcactagca atgcgctatt     11520
     ttttagctgc atttctagca ttgtcgaata gatacctgag acaacagaaa ggagttgttc     11580
     ggcgcgctcc tttttcgtag ctgattcagt catatttgtg tcgtcaactg gggcataacg     11640
     tctaagcaag tattgttgac aatacaatta tacagttagc agtatttcag tatatccaca     11700
     taagctgtta tacagataac tgtatataag ggtttaggct ctgataatct aatcaagctt     11760
     tgcgacgatc aataatatcg tcctcttcaa catcaacacc ccacatcttc agagcttcaa     11820
     gtaagatttg gcgttgagtc tttccagttg tagcggcttg gatctttaaa tctctgtgga     11880
     cataatcagg aattttgaca gtcaatggac tgtcctcaga ctcaattggc ttgattgtac     11940
     ctttcgcttt tttagttgct tctgactgag cactaggaag ttcttctgca agctgtccta     12000
     atgctgcgac atcaactgca ggtatgtttc gcttatttgc cattgtccat cctcactcgc     12060
     aagttgtact gagatgatat taaccatata tacagctaac tgtataacca tatatacagc     12120
     tatatagtag tattactttc aatttcattt gctaaatcag caatttcctt cgcagccttt     12180
     ccatttggtt ccatgatgat gggggttgaa ccatgaaagc gggctgtttg aaatggcgtt     12240
     cgtagcataa cttcagtctt taacacgggt acagaaaagg cttcaaactg attgcgagta     12300
     tgggtgatta cgcgagtgtt ctccctccct tgagttatca ccgcaaagta aggaattgac     12360
     ctctttgtca aacgtgaagc attttctact agccttttgg tcttaaccgc ttccaacacg     12420
     tcatcctctg atggtctgga agggatcaga accatagacg ataccccgat tgcgtacacc     12480
     atcgattggt ttccaaaccc tgctatgtca actaggacaa tttgattatc tccagctaga     12540
     ccatcgatgg catcgataat tccgttttca tcgggttcag ccactaaagg aatatcctca     12600
     atttctcctt tggaaaacca acgagccaaa ttgctgttgg gatcagcatc taccactcct     12660
     actttgaatg actttttgtg ccagtgtgtg gcgaggctgg ccgctaatgt cgttttccct     12720
     gttccacctt tggatgtagc aaaggtgatg attaatgcca tattgatatc ctgctatcag     12780
     taaatacagc tatacagttt taaatctttc aagctaaccg caaatcaata tagcaacatt     12840
     cttgcttgca gtaacctttt tcttaaagtt agcaatcaaa ctatacagat atctgtacct     12900
     atatctatct gtaaatactg ttaactgtat aacagcaaag ctttatcata cttagcccaa     12960
     gcctatagtc gtaatgcact agctactatg aaaagctgta gatacagcta tattgtttta     13020
     tggatatctg ttaattcata aatcattaaa tactgttaac tgtataaaaa taaatcctca     13080
     ttacacttag tccaacctaa aaatttgtac ttgtatcatt actttagtag ctgcatatac     13140
     agttatactg ttttaatgct ctacagcttt ttgatataag aagttactaa gaaactcatg     13200
     atgtatgtcg aacatcccaa aaagagtaaa tttgataaaa catcagcaga acttatcatt     13260
     tacagatttt caacgagttt ccagtacttc cagccctgaa ccaatcataa gttcaactta     13320
     atcgaagggt ctttaatgac ctctacctcc aaaaccccct aaaatcgttc tacaactgac     13380
     tacaaaataa ttgttttgtt atcagtttgg tgtgagtgga atcctcaagg tgaaaatggt     13440
     catttgccgc caacgaaacg aacactatcg cagtcgggag tatctgaccc tggcggaagt     13500
     gaatcggctg atcatggccg ccgagttgag gggtcgtcac ccgatccgag ataaggcgtt     13560
     gttactgctg atgtttcgtc atgggttgcg agtcagtgaa gcaatatccc tgagatggga     13620
     tgcggtgatg ctggagttga aggccattgg gattactcga ctcaaggggt ccgtcagtgg     13680
     gacgcatcca ttgcaggctg acgaggtgga gtcattgagg gacttacgcg ctgaaggtta     13740
     cccagatccg tatctgtttg tcggggagcg gggtggacat ctcaagcgcc atgcggtgac     13800
     gagtctcatc aatcgctgtg cggagttggc gcaattaggg attaagtgcc atccccatat     13860
     gctgcgccat agctgtgggt atcacctggc gaatcagggg ttggatacga ggttgatcca     13920
     agactggctg ggacatcgga atatccagca tacggtaacg tatacgatgc tgaatccgaa     13980
     gcggtttggg gagattcagt gggggtgagt gattagtatg ggaagtgggg gacagtgtag     14040
     ctgtttagca gataatggta gatgaagttc agcttatatt ccgtcatgca gatctggaaa     14100
     cggcgatgtg aattgacgat aatcgcagaa atctccagag taagggtcat ggtgttactg     14160
     tcggggtaat tggctttttc ttatcaatgg accgaaaatg gtcgctaaag tgttcagaat     14220
     actaaacggt gattaagttt tggctgtccc ccaactgacc atatctggga cacaagaatt     14280
     ctacatctat tgatctatat agctttcaga aactttccta aaactgtcca agcatagaaa     14340
     gtgggacagt gctgttttca tgaattttca aagttttgaa tctattgggt attctataag     14400
     tatttatact tatatctatg atctatatgg ggaaaggatt tcagccttat caaccaaaac     14460
     gggtccattg atatgaaatg gcctaattgg gtgaaggtga tttggtttga tcgcaagatc     14520
     tattttcttt tgtttgagga gttatagatg caatgtgaca aaaaggaaca ttatgtgatt     14580
     attagtaatt aataaaatca ggtaatataa acagtttatt gcttttttca ggataatttg     14640
     ggaatgcaat gtgataaaaa ggaacattat atgattatta gtaataaata aaattaggga     14700
     aattaactgt tttatacttg ccaggaattg tttagattaa ggatgaaatc taattaatgt     14760
     taagaaatag tatttattta ttgtgcgtta aatatggtta atgtatcctt taagaataca     14820
     ggtgatgttt tattgatgcg gcactggtct cttagcagga tctatacgtt cacaaccctt     14880
     ttggactatg gacttcaaag taaatataaa tagagaactc aaatgcttat tagataggcg     14940
     ttatagaaat ctagatcctc ttaagacacc agtgccattg atgctgatta aagtttcatc     15000
     gtacttagaa tagaaaggaa ttgatatata aatctatcta tatctatcct tattactaca     15060
     atcccaataa ctctaaatct agttaatttt gttttcaact agtatttttg attctcaaaa     15120
     taaattgaat caggtatttt tggtgatgtg aatgaagttg agaaagaata aattcaatta     15180
     tctcattcat cttaagcata gattacccta atctatgctt aagttcctta tcatctctct     15240
     cctcaattaa gaactgctca cacttgataa aggtgccatt gaatagcttt atttagtcaa     15300
     aaagctattc aaagctcgaa tgctagattt attaaagact gcttgaatat taatacaaaa     15360
     cttgtgtttt tatctaagat tatttgttga gtaataaata tttcagataa aaatatgttt     15420
     attaaggtgt aagtcttata atctgaaaaa agcttataaa agatagctat cttgtgtttt     15480
     aaatattcta tgagattttc atggtagatg ttctcaattc attgatttag aggaactagt     15540
     ttttttagtt gttgaaaatg aagtataggt ctcttatgta cttacgaaag tttaatcatt     15600
     ttatctatgt tatgctcgca gtatctttac tagcgagttg taaaggccta aaacaagctg     15660
     aagaatttgg aaagctccat gaaaaacttg aaactaattt cgcatcttta agcaatgata     15720
     tatatttatc ctgcttaaga aaagcgagct accctgatga aggatatttt ccagcaataa     15780
     taagttttag atctgatgaa gataaaaagt gcaaggaaaa atttctccct gtatacaaaa     15840
     aaagtaaatg atgcaaattt gacattaatt aattacgtaa aaggcatagg aacgctagct     15900
     acaaataagc caggtttgtt tcgacctaat attgataagc ttaagacatc attgggaact     15960
     ctaaatacga gtttacctac tataggtgtc tcctctcttg attcaagtac tattgattcg     16020
     ggctttaatc ttgtcaatct gttagcagat atatttacgt ttaactttcg taagaaaaat     16080
     agtaaagact acggttattt gctctaacaa agatattcag gcttttgtac cagcattgaa     16140
     aaaaattgtt aatgttggtt atataccgct gcttgaatct gagaaaagaa tagttaattt     16200
     atactttgag aatcatacac cagattcagg tgtaactaat accttatctg attttatagc     16260
     ttctcatcaa ctcactgaaa gctataatac tgctctcaat aaaaccataa tgcgtaagat     16320
     tgcagctgag tcatatatta aaatcctaga tgaaacagct gattctcacc aaaagttaac     16380
     gaatattttt cttaagaaaa aatcaattaa tgatcctaaa attgaaaaaa aatgcaagaa     16440
     gttttttgaa gaaggaaaag aattaagaaa ggataaagaa aaaaagacta aacaggttag     16500
     tgatgaacta gaaattgagt ctttatctaa ggaagaagtc gaacaagtac aacaagtact     16560
     ctctcagtac tatagaaaaa taaagccact tgctaagaat atcaataatg ccttctaact     16620
     tgactgtatc aattctgatt atcttctctt acttaagaaa gctggctgta attactgaga     16680
     aatttagatt gaaggactta atggcatgac aaacttgaat accgaagact taatcaaatg     16740
     ccgagatcat ttgaacgaaa ttatcgagaa ctatatggta aaaaggagaa atattttccc     16800
     tggctcaata acgagggatc aatttcttct attcggctca aaaataagaa tattgattgg     16860
     aatttcagat gaaatgaccc ttatgattgt agaagggcta cttgtaagtg caaacgaaaa     16920
     tcagcagcga attgatgatg ctgttctagt tatcaataac cgaattgaaa gattgaatca     16980
     aattaatcaa gctattgaag actttgcgaa tgtaattaat ttattttcgg ggattcttgg     17040
     aggtatagta agtggatcta tacctgattt acagaaactc cttgaaccat tttttgatgg     17100
     ataagtaact agagaatatc taacttcttt atataaatgc tctagtggta attttttaaa     17160
     ctgaaagagc atatgcaatt cttaaaatat aagtcaattc tcttactaaa ttagttggag     17220
     aaatcctgga atttctgttt cgagaagaaa gatctaaaat tttagaattc atgccttcaa     17280
     aaaaatagct gaaagaattt tcggtagtaa accaattaaa gaaggtgaat atcctgaatt     17340
     ttgtttggtt atacagaata ttctgcaagt actatattga gttttttccc agcaaggagc     17400
     tatattatgc cgatattatc agtcacaact gatcagaatg gtttcttcat gaaaactgaa     17460
     gaatatgatc cgccaggtcc atttccgtta aatgttaatc tttcagcaaa acttctctcc     17520
     ccagatcaaa ctaaagtatc tagtagtctt gatattgatg cggtaggagg agaaacaaat     17580
     cagaaacgtg attttcaaat taatacaggt gaagaaatat ctttaggaga gtggagaatt     17640
     gatggtggta ataatattat tattgtaaac gggaaaacaa ctccagtacg tgcaaacact     17700
     gaaatagaaa ttgagctaaa tgtttcacta taattttaag gattggtagt gatttaaagg     17760
     tagtgaaact cttcaagagt tatcagatat gcgttatggt caaggctgcc tcattctagt     17820
     ccagcatgga atagttttac ttgtaatcgc taacgagttc gattgctttt tgaaacatat     17880
     atcataaagt aggaaatacc ttcctacttt atgatagtgg tcaataaact gaggtctgca     17940
     gtgatataac tattgtcggt tacaatatct ctatcttttt ttagtttaat agacctattt     18000
     attctggcta gaagtgaacc aataaaatga ccaataataa acttagtaga tatttagtct     18060
     ctcaaatagc aaaaaaaatc cctaaagcag tatttctaaa agagacaaat agaaagatta     18120
     tttcactgac aattgatgat atacctgctc aaaatgaaga tgataaacaa tcggctcgga     18180
     agattttaga agccatagaa gcacataatg aatcgttttc aacaactgta agtgcaactt     18240
     tctttataac cactgatcat gtcaagtatg aaagtgataa gagtaaatta gatttagata     18300
     tacttaaaga aattagtgat aaaggtcatg aaatcggcaa tcatggaaaa attgatcgac     18360
     gtcatgcaag tctatccaaa atagaatttg aaactgaatt tcttgaagca catcaatttt     18420
     tgtcacagca tattagtcaa cccgtttgtt ggttccgacc tggacagggt ttctttaaca     18480
     aatctatgtt tgatacatta ataacagtag ggcagagctt aggttatcaa gaaaaatttg     18540
     ctttggcatc aatgattccg tttgatacac tgaaattttt agatgatcca gacttcacat     18600
     taaagaatat aggtcgcttt acttttcctg gctctattct acttttacac ggtggcttta     18660
     gtcatcaggc tattaatact gtagatgtct tgaataagct gttaccacga ctgcatgaac     18720
     acaattatca agttgtttcc ttgtccaaac taatgctttc ataaattgga agttgtgatt     18780
     atggcctcag cacgagaaaa tctagaatca gcgatcgaaa gtattagaaa ttcttccaat     18840
     gaatttgcat tccaatttcg cattattaga ttccccaatg cattaatagg tatagcagaa     18900
     ggcgattcat ggtttgatta tccaccatct tggatcgaag atcctgaaaa aggtgatcta     18960
     attaatcaat taaatacttt taagcttggg gacgagagaa aatttaatat cttacggata     19020
     gctgaagctg gtgatacatt ggagaacatg gtattcggca acgatctaga taagctaggt     19080
     gaacccagga aaaatcagtt cctaagaact ttagcattag tcaggagata taaacctaag     19140
     tttgtcttgt tttctggagg aggtaatgat gttgtcgggg atggattaga agctttcatc     19200
     aatcacaata tgctaaaagg taaatatgga ctgctgcgag atagttatgt agactatatt     19260
     ttagaagaag tatttcgaga aatttttgaa acgtttatta gtgaaatact tgatattgat     19320
     gacaacatac aaatactctt gcatgggtat ggttatgcaa tacctgatgg aaaacctgtg     19380
     gtcggtgatg aaaactttgg ttttattggc ccatggatgg ctcccacctt tgcaaggaag     19440
     cgaattgact ttgaggatgg tcagaaaatc attataaagt tgatcgataa atttaatata     19500
     ttactcaaaa caattgcgca taataataaa aataacgtgc attatctaga cttgagagaa     19560
     gtcattcaac aagatgactg ggctaatgag cttcatctca ccgtgactgg ctatgaaaaa     19620
     gtggttaaag tttatacgga caagctccta gaaatcttcc cctaatgagc catgattttg     19680
     ttagcgttca ttagatctgt aataagttaa tcagcggtaa tttaagcgca ctgccctcca     19740
     tgtcgcagtc atgctatgaa aaatctgtga acataaaaat cttggtttca gattactttt     19800
     ttgggaattt aaaatagccc tgcacagacc ttaaataccc tcggtaaact tagcgatgcc     19860
     ttttcctttg agtcattgac tacaccacgt cataaacacc gtgaatcagt tcctcaagca     19920
     tcagtgccgc ctcaatatgc ttaagggcat cgatctgccg atgtttggac cttagcgtcg     19980
     tcgcctcagc aatcaaatag gcgacacaat cacggaaaca ttgggccttt tgccagtcaa     20040
     agagaatccg ttcaatctct ggttctaact gtggccagac cagtggattg aaaagtttct     20100
     aggcaccact aagggttaaa ttctgggatt gcatcagggt tcatgccgtg gctactgtca     20160
     tgattgctac ggaggaatag acgacattga tgatgctgtg acgagtctca tcaatcgtta     20220
     tgctgagttg gcgcaactgg gaataaagtg tcatccccat atgctgcgcc atagctgtgg     20280
     gtatcacctg gcgaatcagg ggttggatac gaggttgatt caagattggt tgggacatcg     20340
     caatatccag catacggtga cctatacgat gctgaatccg aagcggtttg gggagattca     20400
     gtgggggtaa cggatgagta ggtgaagggg gcgattggta agttgttgtg ggagcgtaat     20460
     atatccctag tctgaaatca tttagtcaaa aaatcatagg aattttccag ataatggata     20520
     attatctaga gtagactagg tatatattac gctccctctg tgattggatt ctctctagtt     20580
     gtaagaagtc aatttaatag cgtacttaac cttattgaga aagatatctg tctctctctg     20640
     gaaactgaca cggtatcctt ccctgataat ttaaagtcat acccgaggtt agttttatgc     20700
     tgaagaaaag agacgcaggt tgagtggtag tgaggacaat ccatgtaaag cagacagagc     20760
     ttagcttcgg gtaagcatta agcctatcag atttgcggac gttaatcaat tttggctact     20820
     caagactgat agatttattt tttctgatcg gtcgctaact tgtaaatgct ggaaactcaa     20880
     accactataa tcttcaaacc taaaacattc taatgcacaa cgaattactt tttattgtaa     20940
     ttggttttta atttcttcag aaatacaaaa attatatttt tctataacga aactatcact     21000
     ttcgtcagat ttacataaag agtcagagtc aagatcatta tctggttctg gaatttgtgt     21060
     atctattgac attctagtat tttttgatag cagccaacct aacggtaaag ttgctctttc     21120
     tccaatataa ttatctaaat atattggtat aaatcgtgta ttatatatga ttttcatatt     21180
     tgattcattt ttattctttt ttatatttga aacagctaat ggatgagtgt taaggtcatc     21240
     ttctgcttgc tcaataatac tattagcacg tgaatttcga acattgacta ctgtgcgcaa     21300
     tggagaaagt atttcattca aaccctgatg actggcatca gaaaattttc ttgtatcagg     21360
     tgaatcaaca agtgcaatat ttataagact aattctcaga actttttctt tagatttttt     21420
     aactgttttt ggattataaa tctgagtatc ttcaaggatt tcatcaataa tatctcttgc     21480
     agtagctaca cctgaattat caaaataacc tccgtctaca agtcggcttt tactgatacg     21540
     ttttgtagct gaggtttcat ctttaacgta atgtttaaac catccagcag gagtgaatat     21600
     aggaaatctc gcactaatga atgtagcagt actaagagga atattaggat aaactaaatc     21660
     aaaatcaaaa aaagaattta acccatttgt tgaaaattta aaaggactaa aaactactcg     21720
     ttcacccgtt tcaacgtttg tagtatttaa aactaatgca ggattttcct cacataaatt     21780
     ccaaaattcc ttgtaagaat ttgaaaaata gttttcatag ttcttcattt cagtactggc     21840
     attaaaagta ttatcccaat attcttctaa tgcaagctct agaccacgta ctctatccca     21900
     tgtactaata ggtattggga taaatctttg tagtaaatca ggaaacagag ctaaagaaaa     21960
     taatggcgat agaaagtcat tacctaatat tttttctaca tatggagata tttttttgtg     22020
     aacatttata gttgttgggc tattaatatt tttattctgt tgctgtgcaa actctttaac     22080
     taatgctgaa tacaccgctg agcctaaact accacctgat acagaactaa ttgcaaagac     22140
     atggcttgaa aactttccat cacttgtatc atgtagcttt gctaacgtag atgctgcatg     22200
     gtatgcagca tatattccac caccctgtgc agaaacaata taaacaggat aagctatatt     22260
     tttttcgata tacttatttt tatcatttcg tttttctatc caactatcaa atgcatctgg     22320
     tatgcttaga acaatatctt tctttttaga attttcagtt ttattttgtt ctttaatgcc     22380
     atatatatgt cttatttgat gattatcatt ccagttaaac tgacttgata ttagagctag     22440
     tataattatg agtgttatag taggtatttt ttctccaggc aatatattta tatatctaaa     22500
     atcctctttt ggtgttgagt aaccccagta gtaaatatta gaaaaaataa ctgaaaaact     22560
     tcctagacaa agagctgtga tacttattgg accaatgaaa acgatgaatt ttactgaaga     22620
     gtatttagga acaagcaaaa gaaatactaa taaagttatt acaatacgtg atataagaag     22680
     cagattgacc tcaattaatt tctttttctt atcgacctca ctagaaatac atttaatctt     22740
     gtttttattg aacagatata ggaaaatatt aaaaattaag catgttataa atacaaataa     22800
     agattgaaaa gaataactgc cagatgtgtt agcaattgtg ggcatagtga aaaatatgaa     22860
     acagattaga gctggtgtga tcaccaaaaa ttctgtaact ggattaaata agatttgatt     22920
     ctcatacttt tctaaagatt tttttttaac ttcgttcttg ttaagcaaga gattttcttt     22980
     tatgatgtta ataatatcac gtctatagaa aattatctga ttaagacaaa aaagaataac     23040
     cccagtcatt gcaagccata tcaatgcaaa tagatcagaa tcacttagct ctccaatatc     23100
     tatatataac ttatatctat taactttata aatacccgtt aagagaccat atgttggtaa     23160
     tagaccaatt attcttggaa tatattttaa tgctgaatat tgagcatgta atttgtttaa     23220
     atgtagcttt tgttcaggtt ctacagtctc ctccttttca aaccattttg aataagttaa     23280
     tgactcacca ttagtattct tgattttatt aaaaacatat ttttcagaaa gtaaacgccc     23340
     tgacatacaa acaagaatag aaagtaacag cacaaaaaat gtgcttatta tgaccttaag     23400
     atgctcttga tcatatatat aagatctata aatttcaaga ctttggtcga tatagccaaa     23460
     aataattaaa cttaatattc ctataattgt aggaacccat aaatgaaatg atattttgcg     23520
     caaatatata aaaataatag aaataacaat tatccagcaa gcgatattaa tagtgaggag     23580
     ataaattact agtaaagata acaataggaa cgagattgaa gacaatgtct tattattttt     23640
     tgttgattcc atagaagtaa tataagtatt tttgtttgct caaaattgat ttagatagta     23700
     tttctattta gatatagaga ataaatatat cataaatgat acacttaaag tacttaaact     23760
     ttccatctag aataataata agatatttct agattattta ttatttttgc tgagcaatta     23820
     agtttttttt gtgatgctaa atactttata actaaactat gcatttttca gtttaagatt     23880
     ttgatactgt atatctttga gttcaaaaaa ttgaataact ttcaagaagt tagatgtaga     23940
     aatttgcacg agaatatgta tcttaaaata cttaaatctt catctagact ggcatactaa     24000
     atatctctat caggtcatca gtagtgaaga gtaaaaaacg atgctgagaa tttttcagac     24060
     tcatatgtga tgcagagaat atttgaaaat taaaatgact tgtgagtaaa gatcatgagc     24120
     atatacttcc cacgtcgaaa tcggtaagtg acattatcaa ggggtaaaaa caaaaagcaa     24180
     catgacttca acaggtgtta caggagtatg tgaaacgata ttgttggaaa aatttattgg     24240
     tcattggttg tgaagtctgg agcaagggtt ataaaagtga actaaggtgt aagaatattc     24300
     caatctttag aattaaatag atacgttgcc tagtcttagt tttggaggtc tacaatggtc     24360
     acttaccaca cagtttaagg cccttgagta gcaattgaac aggaacgtac gctatggctg     24420
     aaagctatat atatagtaga tttcagaggc tgtatttttt actttagaaa ctgtaccatt     24480
     tagaccttag gttaattggt acagaaaaac ggaacggaat atcaagggtt tcaggcccct     24540
     tctggttgag aggtttaatt tggtacagaa aatttggaag cttagcgtac gtttctgttc     24600
     cgatactgat actgttggcg aaagtattac aaatgcaact acacatgtat tacaggatca     24660
     taagtgcaac gaaattctgt aggttgtgcc gtgcgtagta tttgaatttc atatttgtag     24720
     cacattcgcc aacagtatcc gatactaccc atactcctca atcggcttgt ctgggatagt     24780
     caatctcgtc acagaactcg gaccaattct cttgctgaaa ctcagaggca cgtatagaag     24840
     tttctttggc ttgtacctga atgaaatggt gatcaattaa ttcttggata aacgttgaat     24900
     ggccgcctga aggtacactg tcatccagca ctggaaactc ataggaaagc cgtagttcag     24960
     ccacagtatc cttcttggct aatctcagca gttctagctg ttgttgagtt agggaaggaa     25020
     tctgagtcat ggttgaccgt tttgcaacag ttgctcaatc cgatccaagc gttggttgac     25080
     gccttcaaat tgagtattca tatctttacg caacagttca atctcaatcc tgttgtcagc     25140
     aatcttgtcc agtaatcggc tctcactagt ggggacgata gcagcaacac tggtattgat     25200
     caggaagaac agaccaccta tcagaaaacc aatgacagcc aatatgggca gcaagtcttt     25260
     ggatagatcc accaaagaag aaaaacgggt tggggtagtg tcttggttat ctgaggtcat     25320
     tgtgctgtct gtgtcctcaa acgcaaacaa tggaaatttg tttatatcgt attctgaggg     25380
     ctattgactt ggcccctccc aatgaacagc gttacatagt tcttctaagg tgacgttcag     25440
     catttcacaa agttttttta cctggcaggg gttaagagtg gggattgacc gcccattctc     25500
     ccaatttcca atcgactgtg gttttactcc tagctcatta gctaattgtg tctgacttag     25560
     ttcagccctc tttcgcttca aaagaaacca ttcagagaaa tcgatatcca cacttcgact     25620
     cagtagcaaa catgagtcca taatagtccc tgcttttgta tatcttggtt catttacatt     25680
     gtagaggcac tataaaagat tagcaataaa taacaaataa tttgattaat cccaatatat     25740
     ttggtattat tgtttcatac aacaaaaggc acccggtcgc ctggacagtt cccggatgcc     25800
     ctagttaaaa ccccgtaaag gaaattaact atgaatactg tactcgaaac gcccaccacc     25860
     gttaacgagc tggagaagtg gatcgacgct caggtcacag atcccctcca tcccgaaatg     25920
     gtgatggtgg aacttcagat tgaacaatac cccggtgttc gtgaaggggg cgacttgttt     25980
     gaagtcttcg cacccgtcat ctgtaaacct ggactactca gacctcgctt agaggcttgg     26040
     gtcaaagcca cctatgggaa tgaccactgg ctagccaact ggcgtaccgt tccctccact     26100
     cgccaaattg acgctgagaa cgattacgaa gacgaattct aggaatatcc tgggggcacc     26160
     ctgccccctt ccacgccaca tatacccagt cgctacatag ggttaaaaca atgaaaccga     26220
     ctcccagaaa caaactggtt ccaatcgttc aatttacgac tcaagttgag cttgactgtc     26280
     agcaagtcgc agccctcaac cgcttggtct taggcagcac agacctcagt gacgatcagg     26340
     cactcaacct ctggcaagcc ctcaatcctt gggtcatgga attccagcac tccaccccca     26400
     gagatgtgtt tgcctcattg cggtttatcg ctcttgccaa gccagcaacg gaaccagaac     26460
     ccctctaccc cactgatctt ttgaactccg taggctcaaa catcgaaacc gatagcccaa     26520
     gctgcctttg tgcatgaggg accgcctact ctccgtgtcg ttcccccatc aatcccaaca     26580
     atccatacct ggagatagcc atgaaagacc atccctgtct tcctgaattc cccttggatc     26640
     cacccatcgt caatgccgct tattcaccaa tggcaattgt gacgatagcc acggcgaaga     26700
     gtctgatgca gtctcaggaa ttaatgctca gtggtgctca gaaactgttc aatccagcgg     26760
     tctggcccct gcttgaacca gagattcaac ggattccctt tgaccgtcaa aaggcccagt     26820
     gcttccgtga ttgtgttgcc tatctcatgg ccgaggccac gaccctcaga tccgaacgtc     26880
     gtcagaacga tgcccttaag catattgaag ccgcactgat gctagaagcc ctgattcatg     26940
     gcggctacga cgatctgcca ttcatgtccg aacagtaaaa agcatcgcca atcttttgct     27000
     gaatcaagcg atgcctgctg atgccttcat tgaagaacca ttcaacgagg ttattcaaat     27060
     gaatcctaca acattgccaa aaccagtacc cgacaacatc gaactgccct cctacgaact     27120
     tcacacgagg cccactgctg acaactatcg caagttcaat gtgttctatg gctctcggct     27180
     gatcgggtac gtctacatca actttgtcca gggccaatcc aactttgtcg gcacgaccct     27240
     cgatcatcgg tccttcggtc cctactcccg caggatgaaa gcggctgaag cggtcttaga     27300
     agctttcaca gcaggactca ccgggcaaca gcgaatgatg gtggctcttg ccaatgagct     27360
     agtcgaaaac atgatcgtca ttgctgggtg atgccaaaac cttcaaatca cccaggccaa     27420
     caaatccaat caacattgaa tattagcgag gacattatgg aaacgaatat cctagcccat     27480
     caaattcacg gcgtttctgt agggatgcag aaagctgatg gatacgtgaa cgcaacgaaa     27540
     gcctgtgagg cgtataaagt tgcgacgggc aagacgaagc gaacagagaa ctggactcga     27600
     tccgcacgag ctaaagccta catcgcttac gtggcctccg ttacgcgaaa aagcgtaacg     27660
     gaactggtac ttgttcgtaa aggtggaacc cctgaagaac aaggcacctg gatacaccct     27720
     gacctagcca tcgcttttgg cacctggcta tccgtcgagt ttgaatatca gctcactcaa     27780
     tgggtgaaag agtgggagag cagtcaacgc cctcccatta acatagaccc cgatcagcct     27840
     agcccccatg agattgaatc tgtcctccaa gcgacctttg gtgaagtcgt tgaacccgcg     27900
     aggttagcca tcgtcaaatc aagtgccatt gtcggcgttc accctgaatg gtccgcgatt     27960
     atgagtgagg gtctggacgc tttaccttcc ctgcccccag aagaacaaac ctatacccca     28020
     actgagctgg gccaactgct agagcctaag ctgtcagcca tcagagttaa caaactcctt     28080
     gaagcagcgg gctatcaaga aagctatcga accgctcgaa atgtcctgaa gtggaagccc     28140
     atcgacaaag cgggtgattt ggcggtgata acgctggaag agaaatcgaa tggcaagccc     28200
     attgaatctt tgcggtggaa gcattcagtg gtggatgtgc tgttgtcgtt agtggcagac     28260
     agtgagcagg caaaggtggg atgagggatg gatcatgaac atcaaactca agaaactatc     28320
     tagaagcacg agccgcaaag ggttataact cctagagaat agcccactca agtgcccgtt     28380
     ccactcatac agtgatgctg agaacagtaa ctgtgccaag gcatacaaag cctacctcta     28440
     tgcagtgcta gagctgaacc agaaaccgag ggatgctgcc ctgaaattgt caaagcagtg     28500
     caaaatcttg gtctcaggcc gatggaagcc ccccacgaga gctgccgttg tgagtgaaat     28560
     cagggaaatc gtcaggcaag gctctgtggt gattggaacc catcgcgcac cggatccagg     28620
     gcatggactc gcaacctacc tcagatggaa gtatcccgat gccgatcagt tggagctaac     28680
     ccatgcaaga tagaaaaatc ctttccctca gccgctcgac cactcaagca gttacaccat     28740
     ctcaatctca gactaatacc cctagggcat ttcgacgacc gcttgaggaa atcttggagg     28800
     atctgagacg gcctattcct gggcgattta tcaagaccaa atcaaagaaa ggcgtggcct     28860
     tgaggtttgt cagttggtac gacatcgttc gcattctaga ggccagggca ccgggctttg     28920
     aatatgactg ctcaccacac tttggcgacg gaaaaaccgt agtgaaggca acgataacga     28980
     ttcatggcga ggacggtagc ctttcgcgat cagctctggg aattgccgac agcgacattg     29040
     aaagctgggg tgatgcgaca agtaatgcta gctcaatggc ccttcgcaga gctgccgctg     29100
     aatttgggct gggtctgcat ttgtattggg agaaataggc catgcaaacc gatacgaaat     29160
     cccattcctt tgggcagtgg acaggggttc attgccagac tcccatttcc tctattacct     29220
     gggatcagca cctctttttt taagaaatac gaataagcta ttccatttct ccggtaggtg     29280
     gggtattcct ctagcaacgg tgtttgggga tttaaatatg gcgattcaga acgacagcgt     29340
     tcaagcctat ttgaaggaga tgggccgtta cccactcctc tcccatgaag aagaaatcag     29400
     actggcccga caggttaaag ctggtgatct caaagccaaa caacggatga ttgagtgtaa     29460
     tctgcgcctg gtggtctcca ttgccaagaa gcatcagcat ctcggtttac ccctgatgga     29520
     cctaatccaa gagggcagca ttggtctcaa tactgctgtt gacaagtttg acttagctca     29580
     aggctgtaag ttcagcacct atgcctattg gtggatttca gaggcgatta agcgggcatt     29640
     gaaatcccag tcccgcacta tctatatccc tattcatcaa tgggaacgcg cccacaggat     29700
     caagaaggct gttcgccaat taacgcaaga gaaagggcgt actcccaccc tcaaagaact     29760
     ctcagcagcg actggcataa agtcttcact gattcgcaat accctgcaat catttcaagc     29820
     tgtttcttct ctcgatcagc ccgttggccc agaacagaag gatgctctta ttgatttaat     29880
     ccaaacagaa gacgctgctc tctcgatcat ggatgggcta gaaattgaag atgctctaac     29940
     ccgatgcatg gcctacttaa ctgagcggga gagattcatc gttgatcagc ggtatggctt     30000
     aacggatggt cagccaaaat caatgggagt cattggcaag caaattggtg tcagtcgaga     30060
     gcgggttcgg caaatcctca atatcgccat gaagaagatg acaagacagg ttcgctcagc     30120
     ttagtcattg cgagttgcaa cctgtgcagc tttacttcgg actaatcagc aacttgcaac     30180
     agattgacca gagttatagg tcataagctt tgaagtgttt gctgttaata ctactcggcc     30240
     ttgtttatcc cgaatccatc tttgtgcctc aacaatggta gggttggacg ctggggtcag     30300
     tgattgatta tatgtctctc gttttgtgag attggatgtt tctgtaattg ttgaagaagg     30360
     agagttttgg ggggatattt gtggctctct caagtcttgc caaatggagg gtggcgtttg     30420
     gatatgatgt gggccaagag gtactccacc tcttccaaca ttcacgaaag tgctatttcc     30480
     gagagattga ccaggacgac aactttttat aacgtctttt ggttgagcta gtgattcttt     30540
     gtatttttca gcagcatcaa ttataaattg accgtttgaa tcaaaaaaac ctaatgattc     30600
     aatattgaat tgagttagag gtgcatcaat ctcaataaga ctttcttcta gacctaccag     30660
     gagtctaaca tcgaaatcaa ttaaaccacc aataccaagt ccgtttgcat catattttat     30720
     cttgctctta tttctcaaca gcaaaatatt atcaagttca atatttaaat caccgagacg     30780
     ttgattttcc acaatcatag aaatagaagc attatcctcc agagttagat tattgcctgt     30840
     gatagagaga gagcctccag gtgcattgct tgaaaataat ccaatttctg cgttgtctct     30900
     aagaagtatt tctttcgaag ctattgtaat atttcctgct ttcccaaata cattagaatt     30960
     gctggatatt ttacccatat tttctaatgt agtattcttt gaattgatca gtatatttcc     31020
     accactggat gactgatatg aatttgaaga tatagtgcca ctattatcaa tattgagtgc     31080
     attccgtgta tttatgaaga tattcccacc agtcccatta aagtatgaat aagtatcaat     31140
     caatccattg ttttcaacat ttaaatttct tgaatttata cgtaaatatt tatttcttga     31200
     agaatcagag ctatcaatta atatcttgct ggaatttttt acatttatat ctttgaaaga     31260
     cccaacatct tcatacccca atagccagcc ctgattggta ggctgtaaac ttacgtagct     31320
     tcttggtgct acactaccaa tttcaatatt tccattgaga acttggatgc cacctcgtag     31380
     gaaatttata cctccgccta gaattgatat cgtatttcta ggcttaaccc tcaaatttgg     31440
     atattcagaa aagcacagat tcatgcatgt agtaatacta ggatctacaa cataaactga     31500
     ttggatattt atatcttgag ctgtgttacc aaattgaatg ccgattggaa tacttaactt     31560
     tagattttgt actggttgag gattgattgc actaaacgat tttccatctt taaatataaa     31620
     tctacttcct gtagttgcaa gaaatgatcc atttaaatct aaaaaagaat taggtccaaa     31680
     ataaatccca gatggattca tcaagaatag gtcagcatca cctagtacac ctagagtgcc     31740
     attaatattt gatggatttc cacccgttac acgggtcagg atcaagttga tgttattggg     31800
     atttgagaag taaacttcct gaccagtccc tatacttaag tccttaaggc tatggaatag     31860
     agatttattt cttgaagccc ctcccttgat cagaatccgg tttctctgtt gctcaattac     31920
     cgaattctca ttccctaacg tccgatcagc agatacttgg gctaatcctg gtgtgagcaa     31980
     aacgctccaa atggctagag cactggtcaa caagattgat tgattcatat cttatccact     32040
     tcatagtcag tggttgtatg aatagctata tctaaagaat tagagcagtc acctaaaaga     32100
     gttttcagga taaaaaagat attttgcttg agttcttaca aaaattcatc tgatttcgat     32160
     gggatttttg agtttataca gacaatgttc taattactgg ggcattaatc tagatatact     32220
     gcggacgact tgtgacttaa cattgtggta gagagatttg gcacactggg agtatccccg     32280
     cacctatcct ccactcccat gattaaaatt gatttcaccg cagaggaaat ccaacaactc     32340
     aattacgaac gctatcatca ccctcaccca cgggtgcagc gacggatgga agtgctctac     32400
     ttgaagagtc aaggtctttc ccatacccag atctgccagc tttgtcagat tagtcgcccc     32460
     actttagcca aaactcttcg tcagtatcaa caaggaggga ttgaagggct gaagaccctt     32520
     gaatataaag gtcaaccgag tctactcaac gctcatagcg atagtgtgag agcttacttt     32580
     gagcaacatc ctccccgcac cagtgcagaa gctcaagcgg tcattgagca attaacaggc     32640
     atcaaacgca gtcccaccca aatcaaagcc ttcctcaaac gcatcggttg tcgttatcga     32700
     aaagtggggt atgtgccggg aaagtcgagt ctgcccgaga aaattgagga gcaagagcag     32760
     tttcgacaca ctcgccttga acccttatta gaggaagctc aacgccaaga gcgtcttgtc     32820
     ttttttgtgg atgctgctca ctttgttcac cgtgcttatc tagggtttgt ctggtgcatc     32880
     actcggatct tcatcccttc tccttctggt cgccaacgtt tcaatgtcct gggcgcgctc     32940
     gacgctatca ccaaagacct agtcagcgtt accaaccaca cctatatcaa ttctcacagt     33000
     atgtgcctgt tactggccaa gctggcgcta cttgacccag tcatacccat cagcgtgatt     33060
     ttagacaatg cgcgatacca gaaatgtcag cttgtaacgg actttgccga gatcgtcgat     33120
     attgagctgg tctatctgcc ctcctattca ccccatttga atttgattga gcgactctgg     33180
     cgttttgtac gcaaggaatg tctctattca aagtattatg ctgattttcc cgccttcaaa     33240
     ggggccattc aacagtgcat cgaccagtgt aatggagagc ataaggcgaa actcaccacc     33300
     ttactatcac tcaagtttca gtcttttaag aaagttaata tcttagccgc ctagagtata     33360
     gtatttgggg gccaagacca agttgcgatc gcaaaaccag tcaaagccat tgtcaaagac     33420
     ttagaaagta ccacctcaac tgaatctggg ttgttgcctt tgccttaatc catagaccaa     33480
     acagcttaag cgttaagtca caccgtatcc ttaaacatcc ggtctttggg tggagtcatt     33540
     ctagccacct cctctgtcga gaaatagaaa agggtataga aaaatgtccg atttcgaggt     33600
     acaaagagaa aagctagagc atttgtacta ttcatcacca agctttctat ctgatgaaat     33660
     gattgaagct gaaatagggt acatcccctc agaagtcatt gaggagggtg atgacctcga     33720
     ttcacaaaac aacattgaag cgtctccaac ggtccttgac ctaatcggtg aggctgttga     33780
     attatgggtg ctgaaacgag gtggggatga ctgagcttcg cgagttttcc ttcctcgtct     33840
     tgcataccag cggcgaagag accgttcaga cggtcgtgag taccagtaag gatctggctg     33900
     aaagtgcttt gtatcgctgg attacagata tcaaatcact acaactcttg gcttccaaga     33960
     acgagtaaca acaatgattg cttgttgttc attactgatg gagtcatccc tcattgaatt     34020
     aattgacaaa gtaagaaccg tggctagaat atcggcaaag ttgctgggta ggtgatatgt     34080
     cagataaccg agttgattgg tttgggtttg ccctcaataa agggttacat cttctggagg     34140
     aattcaccca aggcatcacc ctacccagtt ggctggctcc tttgagtatg gttggtgtgt     34200
     tagcagcctt aattaagctg ataccctcca tagaaaaagg ctcctttcta gctggcattg     34260
     ggggttatct gcttttaggt ttattgatcg tcaacgtgat cgccctatca attttcgtct     34320
     acctacctgg caaactagtt accttcaagt cccgttcagt ctcccggaca agattaacgc     34380
     taatgagact tctgttgatg ggtgttgtag tgatgctcag ggatatgatt aaggtggcct     34440
     tgcatcttgc ctttgatctt gtaattcttc tcttaacagc attgacctac ccttcacgac     34500
     aaaatgaaca accgttgaat ctacaaggct gttaagaata tctgccccct gaaaacgttg     34560
     caatagtgcc ttgctaggag acttggatca ctgctccaag gtattcacag tcatcaacag     34620
     gtgatgatac tgctcacggt aacgactctc ccgtcatggg accatacctg tgatgcttct     34680
     agaacgaggg tttggagatg actgcaatgt tgagcaagca aactattcca aatgcaagtc     34740
     ttgaagatgc tatccaggaa gagtctgttc aaaccctgga tggacaaggc agctcagccc     34800
     tctacaagga cgtagatatt tatcaaattc tcgtcgctga tttagtcatt caccacaaag     34860
     agattcttca gaacattcca ctagaaatag ccattcaaac gatgaaatca gcatggaaat     34920
     tgtctcatag tactgatgaa ggcttcaaag gctaaacaga acgctctcaa ccgttgtaca     34980
     ttcgttggct gtgttatccc aaggaagccg ccatacctgt ttggcggtat gaagaccgta     35040
     ttaatagtcg ctacaactgc tgataaattc ttgagggtac gtttatgaag ctcatcagaa     35100
     aaatagttgg ttttggccta ctcgtcatag gcgttccaca agtcgccaat ggtattcagc     35160
     agatcatcga aactggaggt gatccccgag tggttgggag attgaccgct catgttttat     35220
     atattgtcgt cggtctctgg ctactattgt ccaaaaatag gcttaaaagc acttgaccta     35280
     tccaggtcaa aggcacggat gatacaccct tagtattctg ccggattgat gagaaagggg     35340
     atcaagcagc tttagccccc acttcaactt tcacctccag acctgcacgg gatagcatct     35400
     tgactaattt atcaatgcta aatctctcaa tatctcccgt catcaggtca ctaatgcgag     35460
     gttgagtctc cccgaaaaat tgagctgcct tttgttgggt ccatccttga gattggataa     35520
     aactccgcaa gctcaacatc agatcagccc taatcttaag gttctgggac tcctctgcat     35580
     caaaccccag atccgcaaat acattttgac tgcctttcgt cactgtaaat tcttcttgat     35640
     tcatcactgt ctactccctt gactttcggt attgaagtaa ttgctgataa cgtctctgtc     35700
     caatctcgat atctaacttt gaggtcttct gagtcttttt ctggaacgca tgaaggacat     35760
     acacagcctc tgcaaatttg gcgacataga agacccggta tgcgtcttca gtgcggattc     35820
     ggacttcctt aaccccagct ccaacaacag acatggactt gaaatccgtc ggcttctcac     35880
     ctccttggac aagccgaagc tgaaaccctg ctttgcgtcg tgcgctttct ggaaaatctg     35940
     aaatatcttc taatgaagtt cctatccagt tgatgggctt gtccgtcata tccgaattat     36000
     acctgatttg gcataattag aatttagtta gcaatgctaa ccactcttgg ccgggagaga     36060
     gtattgctgt atcgctaggt gtttagaaaa gtatttatac tttcttgttg ataccattct     36120
     gaaaagataa ctatttgagg aaaccaaaag acttgctgat agggtgtttc agcgtatgga     36180
     ttctctaacc agtagctaac ggtcagtatg aacagtcgca acgaggatcg tgatttactc     36240
     cgagcaatca aggctggtat cgataagtcg ctgagacgtt ctgagtaaac atctatcaat     36300
     tcacagatat atatttaacg ctggttcaat atacatgaac tgggcgatgg agataactta     36360
     tggccgatat cccatctctt tctctcccac aactagaact cctcagactt gctaaaaaac     36420
     attctgtgga agaacttcgg cttgtctatg agttcccagt gctggatgat aatgaacttt     36480
     caagcggcca tccaccgttt atccaagaat tgattgatca ccatttcatt caggtgcaag     36540
     agaaaggaac ttctttatgt gcttccgagt ttcaacaaga aagctggact gagtactgtg     36600
     acgagattga ctatcccaag caaactgatt gggagcgatg gaggcaggga ttcattgtcc     36660
     aactcagtga gggctttgaa agcctgatga ctccaggaaa aagcttgggg caattctcta     36720
     aggtatggat ccgagagatt ggccttcgag gggttcagcc aagtagcctg tgagtgaggc     36780
     ttggggctgg gatatagcac taagcctcta catcctcgtc agcttatttt tccaaattca     36840
     agcggcctca atatgttcct ctaaaaaatg gcaaatggct tagtgccttc tagaaaggta     36900
     taccttccca gcccactaag ccatttagag gtgactctaa atatatgtca atttccaatt     36960
     tgacagtatc taatcatcat agactctgcg atttaaccag cggtcaagct tatctcgaaa     37020
     atcgcctcgt ttgtcgcctc tacgccagcg ccaatcatca tttcgatgtc tgcgatctcg     37080
     ccatcgtcca tcccgccatc gcccatctcg ccattgtcca tctcgccatc gtccatctcg     37140
     ccatcgtcca tcccgccatc gtccatctcg ccttcgccaa cggcgatctc tccaacgacg     37200
     atctctccaa cggttatcaa accgatctct acgaccttta caccgaacac gaccataccg     37260
     acgccaacag tatcgattac ctcgacctct gccagccacc agtgtttgag tctcttcaaa     37320
     tttttctagc ggagtttctg agctgaatgt tgcagcttga gcaggggaaa gaacagatgt     37380
     agccccaacc attagtgcag cagcccacat catataagat ttggccattg cttttctctc     37440
     acttatccaa ctatttgtaa gtgttacctt agttacaaaa gcccagcatg tcagtctaaa     37500
     agcaataaaa ataaacttct acttaaagag aaaaaagtta agtttaagtg gaaaaatatg     37560
     gaattaagtg gaatttagaa gggcatgatt tgtctagttt tggggctgcc tgtcatgggt     37620
     tagagttcag tttctataag gattctgaac atctggatga ttctttaggt ttgaattcaa     37680
     tgagttggta ttgaagttgc tatcgtatca cccagcgtct tcactcagag ctaatttcta     37740
     aacagaaact aaagtcacta atcgacacat gagcagtcga ataaaacaga tattaatcat     37800
     gacttcaatc gtttctaaat agatttcgta atccttcccc aaacaacgat agcgattcaa     37860
     ccactcaaaa taccacttcg ataaaccatc tgcaaagatt ttaaccctca tagtactcag     37920
     agggtctttt gctgtatatg ccaaagttta tccctgtaac ttcagcggat gactacccat     37980
     cgacaagatt cacccatgcc tttataagca ggaatcacag gtccgatcgc aaccatcacc     38040
     accccaaaaa caccctaatc ccaatcccgt aaccacccct gttccttcgc tgcctgggca     38100
     aggaccattc gcatccactc agacggatta tccacgtgct ccacaatggc atccttgagc     38160
     cgctgatcca gcctgaacgt cacctgtgcc gttcggggtt catccccctc aggtttaaaa     38220
     cactgagcct taaataaagg ggacaggggt ttggttttat gtccactcat tgtctttatc     38280
     catacgctga aatgcatggg atttgagcca atgctatcac actagaattt gcttataact     38340
     ccctccagac aaataactta tattgattaa atttcccttg cactgcatag gaaaatagat     38400
     atattgttga catggatgag agggacttct ctacaaccct caatcctctg cactaatcag     38460
     gtccatagcc catcggtggg ggcaatcaat acccaccctc cagacgatgc actcggaatg     38520
     catcaggaag cctaaacccc ttccaacccg ctaacggggc tgttcctcag cgagagagga     38580
     cagagaacgc tgagcgggtc agtccaatgt ttctagtcgc tacaccagga gaaatacatg     38640
     gataattcac agaccattct ggatttgctt tcacagatgc aagccacggc agacgacatc     38700
     aaacgaacct gtcaagagac gagggaacgg ctgggccagc aacgacggtc catccatgat     38760
     caggtccaag agacgcttga tcggtatccc ttactttgac cgatacgacc ttgcgatcgc     38820
     agtacgccac acggacgctt cacaaagctg cacaaccgat attcgagatt cggcgcgagg     38880
     attgggcgca gaccaccact gcgagagtcc caccgtactc tcattcagag agtttcgtca     38940
     ctcaaattca atggtgaaca tcatgtctaa caaaaacttt gaagcctgca cacgcaacgc     39000
     cctcaccatc gcggctcgtc aggctctagg actggcggaa gatgccaagc tacggaagca     39060
     tctcatcatt acctacctgc ccgagaacgt gcggaagcgg gacggtgaag atgcggatac     39120
     cacttctgag ctgtgccaat tcgcccagca gttaaaggat ggctcggtca acctccgggg     39180
     aacggaacat tgcatccgac tcgctgaaat cctagaccta gatgatacgc agatggcgaa     39240
     aaaggcagtc aaacccgaga agaaggccaa gggcttaact cggatgcaga aggcggtcta     39300
     cggactgctg aagcaagctg caatgggtga tgccgtgggg gtcgccgcag cctatgagac     39360
     ggctttagtc tgcaacctta agaatatcgc tgggattctc acaactggcg agactctgaa     39420
     gggaaaacag gatgaagtca gtgccctcgt ggatgaggtc tgcggtttgg cgggggttca     39480
     gtacaaggat actgaggggg ttgagaaata cctccttggt ttgtatccga gctatgcctc     39540
     cgatattgcg ggtgcctttg aatggcacac ggcaaaagcc tggagtacgg ctcggtacaa     39600
     catcgaccag tacctccagt ccagccaaca tcaggctgct taacgttgct ccgagaatcc     39660
     cctccgatcc ttcactgggt tggagggggt tctttttttt gtggttattc ctgaattaat     39720
     gccaaggaat tgatgggaat gactttattc cgttgataat caacaatgaa taggtttttc     39780
     ttggggccga tcaccagtgg aagcgggggc ttttcttgca acagaagcca taaaaggatt     39840
     cgttggcctt gcggtcagag tcttcggtga aatggctgac atcaaagttg atgagccctt     39900
     caaactactc ctattcaatg ccaccgaaaa atacgtccaa acttacataa agcaccacgg     39960
     ccatgtccag gtcatcccct tagatgccat atattccggt gctaggagtt agcggctata     40020
     aggtctgggc tagaagttaa ttcttttaga caattaatga tggtttgtta atctcaaaaa     40080
     aacataatcc tttcattatc aagagcaaac gcactgatac ttagttgttc tagccgttag     40140
     atttatccga tagaacatat ctaaagaatc aatatctata aagttgcttt aacccagacc     40200
     ttttggccgc cagcaaaaaa tgcagaaatt tgccagaaaa tagatattaa atcagcacag     40260
     actagggttc tgtttcgctt ccatgcatca atgcccatgg ccgtcatcgt ggtcatcatg     40320
     gtcgtcacca tgtccgtcaa acgtcttcgc atcccaagcc caaagatggg aaaagccatg     40380
     atctatgtag atgatccgat acccttcatc gttcttgccg gacgtgctgt cggccatgat     40440
     ctcacgagca aaagcgatgt aaacagggcc atcctcctcc ggtggagttt caaccacctt     40500
     gtagcaccaa tactcattgt ttatgagtcc acccacatat tccatctcat catcgtgcca     40560
     gtccacatca aagtggctgc tgccttcatg agattctaaa tggtgccaca caaaagaagc     40620
     gtgacccttt tgggggttat tgccttgaga tagggtgaag gaaccgattg agggggcgag     40680
     atacccaagc acgtggtctg gtgcttcgaa gttcggatcc agctctttct caatgttgat     40740
     tttatgtccg tgggggcctt tcataaattc tcctgtagga aaagatcaaa ttggtaattc     40800
     ttctagggtt atgacagagt cattgtcata accgaatggt aaacataaag ttttatacat     40860
     tcttattagc tattcagctt gaaatctaat gattacgaaa tctgaaatat atctttgaac     40920
     ttggcgttcg cgtaacaaat tagtgaaaca aataatcgcc taaatacacc taaaaccctt     40980
     actggtaaat gcatagaaca atagccctgt tggtgaaagg ccatttcttt tctctaaata     41040
     ttgcgtcaaa ttgcttggtt tatgagtcta ttcagacaaa gaataatttt tcagaaagat     41100
     agatctatag gctgtaacgt ttacatagaa agtattgcaa gtattttgaa caagaaatct     41160
     ttttacattt ctataacgcg aacgtcaagt tgaattttgc catcaaccct ccccagctta     41220
     cataggaact cagcttggtc acagacaaca cccaagcccg catttctacc aatgaaatag     41280
     cctgcaatca gaccgatagc aaaacagcaa accatcaggg tcaccccttg ccatcggtcc     41340
     tggttcagct tgactttgag ccgttctgtt cgtgtgagcc tcgtgcagtt tccacgacct     41400
     gattgagtat ggtgtctacc cgccgatccg tgacgagcgg ttcgggctga tcgtcattcc     41460
     ttaactacct ccacactatc cctcacgggt ttgatcggcc cacagaaaaa gcatggcgag     41520
     atgcagccca taacttcaag aagcatgttg aagccttgga gcagtaagca gcgtaacatt     41580
     acccgaaatc cccctccaac ccaatgaagg atcggagggg atgctttttt ggctttttct     41640
     ggaaataagg attaggtctt tgaaatctga aaaatcactc aaaagaataa tctaaatgtt     41700
     tttacattga atttagttgt tgttctgaag tgactggaga ttcatccggg caaaatgttc     41760
     aagcaacatc cgatggataa agatataacc accaccaact ttttgtagaa aaagacgctc     41820
     aacagcataa tctaggaagc gggaatagtt ccagggaata taacccatac ggtaaagcat     41880
     aaagcgaaga gtaaaatgtt gaagacaagc agcaccacca ccatacagtc cgccgatcat     41940
     tccaaaaatt gagaaaccga tcaacccaat gggtagccaa aattcaaatc caccgatcag     42000
     tccaaaagct atcccgccga ttagcccaaa gaatagccca aaaatgagtg tattgcgagc     42060
     agtcatccac agtccctgat ttgctttaaa tttcttttga aatgatactt ctggacctct     42120
     gaatccacta ataagccagt aaagcaacca atagagtaac caataaatta gtccaaaact     42180
     cagcccaaaa tatagtccac tagtcagtcc aataatcagt ccaataatca gccctaacag     42240
     tgaagcattc actgctactt tccgagaagt cctcaacgac tcaactgttc gtatatctct     42300
     taaaaatcca ataactatgc taggcaacaa ccctataaat agtgcaagat acgacccaaa     42360
     aatcaacccc agatacgagc ccaacattag gccacctatc agcccaaaaa ccagcataaa     42420
     aaccagcata accatcagtc cactagccaa ctgatatcta gttctttgag gttttgtttg     42480
     gagccaattt ggctgcaatc gctcaatcaa aaagactact tgagaatgct gaaccattcg     42540
     ttgagataac caaattaacc accgccttga ttgtggttgg agatacttca gtgtagttcc     42600
     ccgtcgtttg aacatgcgtt gaatataggt atcaaacagt tgctgatgaa aagcgtctga     42660
     agcaattggc tgagaaaagt ccttccatcc tgagtcttga taggagagac tcataatgct     42720
     caatatcaaa ggcgaggagg caaacgcttt aatttcagag ttctgactga gcattgatct     42780
     caaattcgcc aatgaatctc cagaccgttc tagataatca tcaatttgct ggagagttaa     42840
     tggctgaacg taaatggcac ttcgcaaact taactcctca gtaagagctt cgtagtcgcg     42900
     aatacggcta caaacaacca tctcagttcg gccatgagtt tggatgaatt gatttagagc     42960
     ctttacacag gtattccgat gttgagcatc aacttcatcg agtccatcca gcaacaagat     43020
     taattgctct tcttcgatcc aggcttttcc caatgactta gaaacggtat aggtctcata     43080
     gagttcctgt actaaccagt cctcgatgga ctttcgctgt ctagcccaag acgacagatt     43140
     tactaccact ggtaacggct ggctcagatc ctttgatgtt cgagcaagaa ggctttctgc     43200
     tagcttcagt aaggttactg tcttccctgc accaggctct cctagtatca gtaaggtgcg     43260
     tcctgctccg atgttttcaa atacatctgc ggctgatgtg ccattaggca aaacatttat     43320
     agtctcggaa gagatttcct tgactcctgc tagaggacta tgaacatatt cacttcgttc     43380
     ttctaatcca agttcaatta agactcgggt atgtagtgag tttgataaga ccccatcaat     43440
     ccagaactgt tggaccttac ttagcagaac ctgacgccat ctatactcat cttgtctaag     43500
     aggctttgtt gtgctcagag gagtttgagg aacctgaaca gtaccatata cattgacaac     43560
     cccgaccttt tgaatctgag ttaattccag atctcctcct gaaatgcctc caatctggac     43620
     atcttttaga acactatccg aaatatttaa actcttctca gccccctggt taggttgttt     43680
     attcatcact agttaggttt tatagaaaga aaccagtagc aacccctagc cagggagtga     43740
     ttttttcaac aatcggtttg actttgctcc aaaggctgga acctgctgct accgtttcac     43800
     ctgcttcttt aagtaccgta gtggcctttt taaggctttt tgcagcatag tctttgtctg     43860
     gtttttttgc ttgaacttct tccttagcag tttctaggtg tcgaagtgct ttactagcgc     43920
     cgctttttgg tagctctgca ccttgcaata agtcttccaa ttgagtaatg aggcccacga     43980
     catcagcctt tgtcagttga gcttccatcc catccgtccc aatttgctga gtttggttca     44040
     cagtctgatc ctgcccagct attccaccta tctggacatt agagttttga ccaccactga     44100
     tattgataga ttgaggaaga ttttcttctg acatatctgt agttggaatt ttaattatgt     44160
     accctttaaa ttgtcagtcc tttcactaga tgttatagtt ctcttcatta aaatttgaga     44220
     ttgagagaca tgattcaaag acaatgagca agtgaaaaac gcattcatta ctctagagtc     44280
     agctaatcct agttaagctg ctctagcagc tctcttggaa tactattggt gtcgttcaat     44340
     catcgatgag ataagtgcac aatcaccgtc tgatttaata atttacttaa cctcaataat     44400
     cagcaccgag gcaatttcta gccaaggaga atgggctaga aattgcctcg gattaatcat     44460
     ctaaaactaa attagaatta ctccattttc catctcacct ccacctccca agccctagcc     44520
     cctcataggc ttttcttcgc tcatcactct gcccttttcg gcctcagtcg ataaacattg     44580
     ccatcaaccc tccccagctc acacaatggt gcagcttggt cacagaccac ccccaagccc     44640
     acattcctgc cgatgaaata gcccaccact agcccaacga caaggcagca aaccatcagg     44700
     gtcacccctt gccatcggtc ccgattcagt ctgaccttta gccgttcggt tcgcgtgaat     44760
     gtcgtgcgtt ctccacaacc tgatcgagga tgtcgtctac ctgctgatcc gtgacgagag     44820
     gttcgggctg atagtcgttt cccagcttcc ccaggccatc gtttagtccc cggtagaatg     44880
     ccccatctac aaccttggcc gctagttcct ggttatgttg aattctgcct tccatccctt     44940
     gggcaatttg caagcccgca tcataggacc gttgtgctgg aattgatagg ttgtgtgctg     45000
     gattgttacc cgtatgactg cctgcatcag tgcctgtatg gctacccaca tcgttacctg     45060
     caaccatatc gccttgctgc acggaagtta atgcggaact ctcttgctca taggctgcat     45120
     tcacactctc tttgcgctcc tcccaaactt ggctcaatgc atcatagtct gtgatttccc     45180
     cactatcgac ccagctacga acaatgccga tgcagtatgc ggtctgttgc ttgaattttg     45240
     ttccattggg ttttagcccc attgccttga gggtgtttgc tagctcctct tctgaatctt     45300
     caatgccgtt gaaaaactgc tccaagagtt gtgtccggga tactgcatcg ttactggatt     45360
     tcgtcgtcat cgtctataat ctccgcacta atttgttgca ctgatggtgt ggccttgatt     45420
     gccccgtttg agtctacggt tctacctgga tggcctcttt ttctagcctc cagctttgcc     45480
     cggttctctg ccttcttcct tgccttagtg atgtctcgaa agtactggct cagtgtctgg     45540
     tcgttaatat cgatgccatt tttttccaac acctgggcta tcgtgccaaa tgtatgaccg     45600
     tcatctagaa gtgatgcaat atcctcgtac atttcctcga tggcaatcct acggctgatg     45660
     tcctcggatt ctttcggtgg gggtacattc tgcaatgcct gcctgacatc ggtgaggatg     45720
     cttcgtttta acttttgttt tgccatgact cctccatgat ttctatcgct atgagagtct     45780
     acggaactac ctgtgttgat gcctgtgttg atgcctgtgt tgatgcctgt gttgatgcct     45840
     gtgttgatgc ctgtgttgat gcctgtattc atgcctgggt ccgtgcctgt ggtcttgctt     45900
     ggaagttata cggagggagt cttgggaact gcctgtggct atgcctgtgg tcattctctg     45960
     gagattctat ggaaactgtc tggggttatg cctgtgttgg tgcctgtggt tgtaccagtg     46020
     ttggtatcgg ggttcattct cggaagttcc gtatgctcaa gtgtggggga tacctgaagg     46080
     aagctttatt tattacatga caggaatcat gatgagaact ttttcactgc ctggtgctgt     46140
     gctggggtgg gaacatgacg ggtgcttttt cgcagatggt ttcattgcat ggtcactgcc     46200
     ttgttcaatg cctcatccaa tgcatgggct gttgtggggg gaatatacga tgaatacttt     46260
     tttgcagctt ctgggactgc acgatgggaa tatgactggg gcttttgcaa tgcttgggtc     46320
     actgcctggg ctgtggtgta cgggaagtct gtcgggatgt atgggcgagg acttgttcgg     46380
     tgcttttttc gtgatgggac ggggactttt tcgttgatgt gttcactgca tggtgctgtt     46440
     gtgtcggtgg agtatggcga ggaattatgg cgagtgctgg ggcggcgctt ttttcacggt     46500
     gggttgggtg ctttttacac tgcatgatgc ttatgcctct gggtaacgat gcgaattaca     46560
     aaccgataac caaacgaatt tcaaagtgga tagacaacag gtagcaaaac aagtttcaaa     46620
     ccgatagaca aacagataac aagacggaca gcaatcaggt aactgaaccg atagcgatgt     46680
     ggattacaaa gtggatagca atgaagtgac tatgtggaca acaacgaggt aactgagcgg     46740
     acagcaatct aggtaaccac catgatttcc aactcaaaag tttcagggcg aggattaggg     46800
     cattaccacg cacgtgagga cgggcaggaa gcaccaggcc attggatagg tcagggggca     46860
     aaggaacttg gcttgaatgg agaagtcaaa cgagcagact tagaggcagt ggcccatgga     46920
     actgcaccga atggcatgag gctaaaggcc aaacgctctc aatggagaca aggcagttat     46980
     cgtaatggtc atcgtgcagg tacggatgcc accttcagtc caccaaagtc cgtatctatc     47040
     atcgggttag tgggcgggga caaaagagtg atcgaagccc atgaacatgc agtactagac     47100
     acattgaagg agatagaaga aacctgttca attgccaaga tacgaacggg tggcattcgt     47160
     agaaacgaag tgacgggcaa actgattatc gccaagtttg atcacaggac gactcgaccg     47220
     aacgatcagg gtatccccat gccacagatc catacacaca gcctgatatt caactcgaca     47280
     aagtgcaagg atggcaagtg gcgtagcttg gagaactgga agttcttcag gacggataaa     47340
     aagcgattgc gaaggcacta tatcaacggg ttaggagaaa gactcaaaga gataggctat     47400
     cgaattaaat ccgagcgtga tggacttcac ttccaggtag agggcataac gagaagccag     47460
     gaactggcct actctgaacg gaccaaagaa atagaacgag aactgggtga aagtgccaat     47520
     ggggtcagat acaagaaagg cagattcgcg gcattgaaga cgagaaaccc aaaagtaccc     47580
     tttgagcatg aacgggtgca taaacaatgg aaggagatgg catatcggga aggcattgcc     47640
     tttgatagag tccctggttt agtccgtaca cctaaggaga tacccttacc gacacgagtc     47700
     agacttgaac tcaagtgtct acaaatctct caccgcatca aagctcaagt aagcagagtg     47760
     catgaggtct gggataaaac acatggcaag gtcgatatca gtcattacag tgatgctgac     47820
     ttgatgaagt tacttcaacc gaaacatctc agtgataaac actggaatga attggtggtt     47880
     gagagcagca tcgaacctgc aatcgccagt gcatcctttg agacagttcc aggtgaagat     47940
     gccgttgaat tggtcttggg taagaaactg gagtctctgg ggggctatgc ccagcaatac     48000
     gtcaccaaat cagtcgaagg tttgttggat agctacaagc atctagagga tggcggctta     48060
     tggtgtccag gcagtggaga gtatgggcag ctcaaaccag aatcccccag gaaggacgag     48120
     aagggcaaga cgattaaata tgagaatcct ccaggggttc ccttgggggt gatgctgcct     48180
     gaaggaccgg ggattgattg ggatgagatt cggcgcaacg tcaatgttcc cgtggggatt     48240
     acggagggga agaagaaggc ggcgagtgca tcatcaaggg ggctgaatac gattgctctg     48300
     tctgggatga atggagggct aaagaatggg gacttgaggg acgacttgaa gggatttgac     48360
     tggaagggcc gcaaggtcta cctcgtgttg gataaggatc cgagtcataa gctgaagaca     48420
     ctccgggatg gggcaaggga gctgtataag ctgggagcga tgctggatta ctatggggcg     48480
     gatgtggtga tcgggacgat tcccggcaag ctcaaggaga aggtggggct ggatgaccac     48540
     ttctccaagg gaaggacatt ggccgatctg aggtggcggt cggtggatga ttttgggctg     48600
     aactctccgt atctgactca gaagtaccgt aaccataaca aggaacggat ggagcggggg     48660
     tatagcgcct atgacaatcc catcgtgaga gaggatggga cgaggaatga tctggatttt     48720
     gggttagggc ggtgagggat aatgcttgaa aatgaattca ctaaaagcac gttgtaattt     48780
     taaattcaaa aaaatttgga gagggagaat ttaaactgat ctgaaaaaat acccagttaa     48840
     atttggcaag atatttaaca gtttactgat ataaactcta aaaagtatat ttaggaaaaa     48900
     tgtatatatg attgctcgga aattagaaaa tctataaatg ataattaata aaccaatatg     48960
     gttgagactt caagattcat caatctctta atattatact aaacataaat caatgaattt     49020
     ttccaaacct gcttgtatat aattccttag caatttaaaa tcgatcataa acgtttattg     49080
     acctataaag tacagccatc taaattcttt tattcatgac agaatctgaa tatctagaga     49140
     aagaagcaga atatacaaga gcagctgttt tgaccttaat cgataagatt gaagagttag     49200
     aacgttatgc tttgatcact acaggggcaa tttggagttg ggcagccgct aacaaccaaa     49260
     gctctgctat tcattatctt ctctggtcgc cattttttat taattcactt tttgcttttc     49320
     gtgcttatgt aaagtggaga catttaaaac tacacatgga gtatctcgct aatctcgaaa     49380
     gtaaactaga cctaaagata tcaattggaa tcggcaacac aacattaaaa aaatggggaa     49440
     aacttgctga gaagactggc tcttctttct ggatcatact ggttttagtc aatttttttg     49500
     tatccctatt tgcaccgtct ctcatcactt cttaaagttc gtttatatca ttgatcatgc     49560
     tgcatatagc tttcatgctc agactgtaga attccctcta cttccccgtc cgcttcggag     49620
     catatcgcca gcccccatgc agcagccaag tgcgatattc tcgctccttt ctttcagcct     49680
     ccctcttagc ctgcacctcc gacgtattca aacaccaatc actcaacagt ggggcatact     49740
     tcgctgtctt cttgatgcag cttttcttcg tccgcatccc gagcttgtac tcaaaggctg     49800
     cttgaatgcc ctcaccgcta tatgtcacga caattatggg gatgaccagc atcaaggtat     49860
     aggtcacgat ttgggcgtag ataccaaaaa ttggattgca ggagattaca aagtattcat     49920
     atcttctata gctcatcgtc ttcagacacc tctttctttg cgaggggtaa catttcagcg     49980
     gcgtatttcg ttctcaaccg aatgtcttct tgagtgtacg gtttagatcg actcgccgag     50040
     atcagctctg gccgcatatg ggttttccat cgttgctccg atagctgaat gattctctgg     50100
     ttcttctcag ggactcggat ccgacgcttg acggggataa atgcctccgt cttcgtctca     50160
     aatccaggtg acaccatcaa tgctgtccct tggggcatcc gattgatctc cgtggcctct     50220
     aacgccaatt tcaccttgac ctgatccgag acattactag agctaccacc cttgtttctc     50280
     cctctagact tcagggtgta atccacctca atatcccccg tccacttcgc catctgatga     50340
     gcaacgttga tgttgttggg gttcataaag gctttagtcg gtgaacccgt atagataatc     50400
     tctgcccctt ctttgccata tctttcaatc aactggtgaa ccgactgaaa gcctaagatg     50460
     ccacagaacc catcctctct cccttcactc agccagttct tgattttggg cagggtcagg     50520
     gctggcaact catcacagaa aaaggccagg ggtgtttccc tcggttgggt gagattaagc     50580
     tcaatgacag catgagcgaa catgccgatg gaaggcgaca gcacctcttt gtaggctcgg     50640
     ttgagaccaa taatcagcat ttgctttggc cccacatcga gggggaccgt tgttttcccg     50700
     ataattgagg gcagaaactc tagtgccgtc atcttgtcta gaagctggag acaggtggac     50760
     aggagagccg taaactgtct agcgttgcgt tgggccgcaa tcacttgccc aaacatggca     50820
     aagatggagg ggggaatctg gtctcggttg tctttcagtc gttggggcag atcatcgaga     50880
     gacagcatgg ctctcaaggt gaggatatcg gcatacttcc aggtcttaat caggcacagt     50940
     cccgccgcta aagtctgggt actggcatcg tcccagaact tatccccttc actttgaacc     51000
     ttggactgca ccatattgag cttggcgacc ttgatgattt cttccgctcg gatggtatcg     51060
     atgggggacc gtagtaaatc aacgggatta agggtgcccg tctctgggaa ggtgggagct     51120
     aagactccga cctcataccc acaccgtttg gcatagtcgg caatcctggc cgtctgtttg     51180
     gggtatttga aatcgaccat cacacagccc catccctgaa agaccacaga gagcatgaac     51240
     tgattgaaga aggtgaagga tttaccgctg tccggtccac cctcgaccaa gattcccggt     51300
     aatacccgtc gaaaccagat ggtgtctttg gattctgggt cacccagcca gagaacggac     51360
     ttgtttaaag tggtgccgag ttctttgatg ccttgtctcc tagctcggtc caaaatggct     51420
     tggtctccga tacctccctt cgctagtttc ttcttcttgc cctggtagtt tttggcaatg     51480
     acggcaacaa ggactagaaa gccaagcagg ataaagtccg gggcattctg tctaaaccat     51540
     ttcgattcaa agaaggtggg ttgttgggtc gtggtattgg cattggtata catatactat     51600
     ctcccatccc tacctgtgcg ttctagggtc ttctcatggt tgcgatggat gctagcggcc     51660
     tcagatcgag tgatgtcatt ggcttgaacg aatcctttcc tgagttctag ggctggtttg     51720
     tcctggccgt tgcgaatgag cctgacgttg cgggcattct tgctctcaat gatgaagttc     51780
     tttcctcgga acacatagcg gccatccgtg agtcgtttgc cgttctgctt attgatttca     51840
     tggagcttgc ggcctagctc tctgggtttg cgactgaatt tgtccttacc ttttccctta     51900
     tcatccttgg ctttgttgtc tcgtcccttg ttgtccttct ggagaggaaa agcattggct     51960
     agaagaccga atacgatttg attcatttct ctagccagtt cagtggcctc atactttctg     52020
     acgccagtgt attcatctga gttgggcatg atggatcctc atagagtgct gtttgaggat     52080
     acggattcat tgaaatcgtc ctttcaaatg atgcctatgg gacgtttgcc gttgccgccg     52140
     ctttgattcc ctctagcttg ctgggatccg ggagatgatc cagaggattg agattgcggc     52200
     tctcacagcg cttgagatga atcgccgtgg catccaaggc caaatcaatg gggagatagc     52260
     gcataaagta ctcacgggtc tgctgttccg tggggttgtt agccacagag taaagcagtt     52320
     tctctcccgc atagaatcgg actcgataca tcttgccccc atagctcagc atccagttcg     52380
     tccaatcctg ccctcgttta cggatgaatt tctctgagct gcacaaggtc gcttgggctt     52440
     cgtccatctt ctattagacg acaatcgagc tgacggatta atgacgatgt cacgtcggct     52500
     atagctatga agaaaccaag catcccctga gaaggataaa actagatctc aattccctag     52560
     aaatgatgtg tgagatcgcg tttctagaat tcaatctcaa gaaaaaagac actttttaca     52620
     tccctaatca atagagggct gtacaagtgc ctaacaaaag aattgattcc tatcatactc     52680
     gtgtttatat gaacggaaga gacctcggct tgaaacaagc tgaagcagct tacattgccg     52740
     aaatatctac aagaaccgga caacgaattg aggccggcac ccatcaacct aatcgcggcc     52800
     gccttcagga ccaacgcacc gttcccgacc ccttagctga tgtgtgggaa gacgagctag     52860
     aaccaatgct gcgtcgagac ccacgcctca aacccatgac cctgtatgag tacctgcagg     52920
     ataagtatcc aggccagtat ccccaagtcc tgcggaccct acaacgtcgg gtgagaacgt     52980
     ggaaagcctt acatggacca agccctgaag tgatgtttga attgcgtcat gaacccgggg     53040
     tacaagggtt ctccgatttt acagaactca aaggcatcac gattaccatt gccggcaaac     53100
     cctttgagca cctgatatac cattaccgtc tgggatatag cggctggcga tatgcccaga     53160
     tcatccaagg aggcgaaagc tttgttgccc tctcagaagg attgcaaaat gcctttgcag     53220
     cctgtggagg tgttcctaca cagcatcgta ctgatagttt gagtgcagcc tatcgcaaca     53280
     tgtgcggccg ccggtccaaa aacctcacgc gtttgtacga cgaactgtgt gaccactatc     53340
     ggctagaacc cactcgtaac aacaaaggtg tagcccatga gaatggctcc attgaatctc     53400
     cccatggcca tctcaaaaac cgaattaagc aggcgatcta tctgcgcggc agtgcagatt     53460
     ttacgagtgt tggtgagtat caagctttga ttgatgccca ggttgccaag ttgaatcaac     53520
     agtgccaggc caagtatgag caagaaaaag agcatctgca acccttgccc aaatatcgaa     53580
     cccctgacta tgaagtgctt accgctaaag tcagtaaacg cagcaccatt gatgttcgtt     53640
     gcattctata caccgttcct tctcggctaa ttggccgtca attggaactg catctatacc     53700
     acgaccggat tgtcggctat ctagagcgac acccagtcgt ggaattgccg aggaagcgtg     53760
     tcagtggcaa aggcaaacgt cgcgaccgtt gcatcaacta tcgccatgtt attggttcaa     53820
     tgcgattgaa gcctcgtgct tttatctatt gcacctggca atcagaccta cttcccaatc     53880
     ctgaataccg ccaaatctgg gaacagctca aagcccaatt tgacctggag caggctgcca     53940
     agatcatcgt ggaagccctg tatattgctg cggttcaaga taaagaacag gccgtagcag     54000
     tgtacttaca gcagcagctt cgctcatcca gccttaccct caatcgcctg aaaaaacagt     54060
     ttgagccgcc tcagatgaag caggttcctg acctcagcat tgaacaacat tcacttgaac     54120
     tttatgacaa actcctcccc tcctgctcag tccccgctga gcccctacca gcacctgagc     54180
     ctctatttaa aaaagctcag gctctcccac atgttgaccc attgggaatc tatcgaatcc     54240
     caagccatgc aggaaaactg gtcctatgcg gaattcttac tagccttgtg cgaaacggag     54300
     gcccaaagaa gagaacaagc tcgcctaaaa cgtgctctca ccgaagccag gctcccaaac     54360
     gcaaaaagtt ttaccaactt tgactttagc cattgtcccc agctcaatcc tgctcccttg     54420
     atgcaattag ccgcagatcc gggttggttg gagcgcgccg agaactgcct tattttggga     54480
     ccctcgggcg ttggaaaaac acatctggcc actggagtgt ccaaaaagat gctggaattc     54540
     ggtaagcggg tgaagttctt tgcagccaac gcattggttc aacaattgca acaggcgaag     54600
     ctccaactgc agctgcatcc aatgctcaaa aaactggacc gctatgatct gttgatcttg     54660
     gatgacttgg gctattgcaa aaagtcggaa gcggaaacgt ccgttctgtt tgaattaatt     54720
     gcgcatcgct atgaacgaaa aagtttggct ctctgggaat tagcgtgtag cagtcctaca     54780
     tttagtgtgt ttcctttttc atccctatgg aatgatctga ggtagtactt cagagcaatg     54840
     gcgtaatgga taactcaatt cgcatcccgc tcaaccttcc tgatattcga gttctagagc     54900
     tatcgaagac tgagagaggg gattggctca tcaagattga gagtacgctt caaggaacaa     54960
     cctgtcatca atgcggacgt gagattactg acctccattg tcatgatcag ccttttcgga     55020
     ttcgtcacct gccattattt gaagtccccg tttacttaga aattcggccc aagcgttatc     55080
     gatgcaagta ttgcgatgac catcccacaa caactcaaca tttagaatgg cacgaacctc     55140
     gcagtcccaa tacaaaagca tatgagcgtt ggcttctgcg aatcttgatc aattcaacgg     55200
     tctcagatgt tgccagaaaa ctaggcgtta gtgaggatat cgtcagtgga atcattgatc     55260
     gttggattgc cgctcaagtt gactggagcg aatatgcaga cctcaaagtt atggggatgg     55320
     atgagatttc tctcaaacga ggccatcgtg attttgtggt tttgatcacg attcctacga     55380
     cggatggggt ggatatattg gcagttctag ccgaccgtaa acagcagaca gtggcaaatt     55440
     tccttcaatc gattcccatt gatttacgcc aaaccattga gcgcgtctgt acggacatgt     55500
     accaaggatt tgtcagtgca gtccgagaac aattgccgca agccaaaatt gtcattgacc     55560
     gctttcatgt gaccaaagcc tatcgtaatt gtgctgatac ggttcgtaaa cgtgaggtca     55620
     aacgtctacg acgagagctc tctaagcaag agtatgacag catcaaaggc gcgatgtggc     55680
     cttttagaaa acgaccagag aatctgaaag agtcagagca acaactcctt gagcgattgt     55740
     ttgcttattc tccacaactg aaacaggcgt acaacctccg agagaaactc acgcagatat     55800
     ttgagggcag gtacaccaag cacggagcta aatgtgccat ccgtgcttgg tgtaaacaag     55860
     tactcaagag tgacatcaag gaattcgatt gttttctgac cactatcaat aattggatgg     55920
     acgagatgac caactatttc ctggaggggt ggaccagtgg ttttgtggaa ggatttaata     55980
     accgagtcaa agtcttaaaa agacgatgct acggtatttt cgatattgaa agactcttcc     56040
     aaaggatttc tcttgacctc aatgggtatc agacattcgc tgtgacctaa acactatatc     56100
     tagcggctac cacgctaatt cccggagagc caaaagtttg ttgattacag cgaatcaacc     56160
     cttcagccaa tgggatgaca ttttcactga ttcgatgatg gcggtggctg ccattgatcg     56220
     cttaattcat catggcttga ttatcgaaat tcaagccgat agttatcggc gcaaatcagc     56280
     gactcagaga acggctcaaa ctcagtctca acctcaaaaa tcccagtcca aataatcgag     56340
     cgatcactgg ttgtcatttc gatcacgggt tgtcgttttg ttctgaaggt atcgtatgag     56400
     gtctgaaaaa gagctaacgc aaagggagtg tacgccaaat aatacggttc aaatttgggg     56460
     gttgatccgc cttgtggttg tcgcgacatc gcctatgggg ttgacatcca atacattctc     56520
     cattcacccg aggcagaata agccattcgg tgtcgccggt tgcggggtga acaaatccat     56580
     acagataggt ccattcgtaa cgatggtcca cctcagcaat tggacgctga cccacaggcg     56640
     cccaaatctt tcgaataatg ggtttaaggc ctagacgatg ttcatcaaag gaccaaactt     56700
     cgacctgagc attagggtag cgtcgctcca attctgcttt gtactcaggc agttttttta     56760
     aaagcggctt gggcctctgg ttcaccttta cggtggtgag ggcgtgggca ttgcagggac     56820
     tgctctaatc gtttgagata gtcccaaccg cgttggggcc acaccttctc gactcctgtc     56880
     atctgagcga tgacctgggc tactttgggg ccgttccata gaccaccgtc ggcgggtggt     56940
     gtttgtagac gagtcaacaa ttgtgcacat tggtcttgag tcaggagact gcgagattga     57000
     tgaggtcgct tatctttgcg tcggttgcgt aatccattag ctccatggcg gttatactcc     57060
     ctgacgattt ctcgagcgta atcgtaattg agacctacca cttgggctgc ttgagttagc     57120
     gttgtttgct cactgacgag ccacaacaga tgccagcggc gcgattctac tgggtctttg     57180
     ctggctcgat aatgagactt cagttcgtcg ggcgaaaaat gaggttcgag atatagtttt     57240
     cttggcattc tctaatgatg cattataccg gggtgatata aatcggattt ggtataagaa     57300
     ttactatctg gggaacgggc gcaatctttt ttcgacactc tattcggcca tagtagtgct     57360
     agtggtgtat acctttccct ggattggatt aggattggct attgttctgg agagtgatga     57420
     acggtcagca gcgggtgttg tgcctgtgat actagggata ggtgctatct caatgcaata     57480
     ctactttcgc cttcaaactg cccaaaggtt tcaccagccc ttgcgctatg cctggctcag     57540
     ctggctcagt ggcatactgg tatcgtctat tgctgttggt tcaataataa aaactgaaac     57600
     tggctggggc tggacttggc gtggtcgtcc tttaaaagtt caggctcaat aacccatgcg     57660
     gaaaaatacc ctgtctctat caacctatac tgctgccttt accgatcaag ggcaaggagc     57720
     accattgatc ttcttgcatg gtttcctagg tagtagcgac tgctggcatc gcatcatccc     57780
     tgagttacag atagcttacc gctgcctggc acttgatctt ttaggcttcg gtggctcttc     57840
     taaaccgcga ctacgctata acatctggca tcaagtcgag tttttgcaac aatttattca     57900
     aaccttagat ctgcaaaatt tccatttggt tggtcattcc tacggtggtt ggacagcggc     57960
     agcttattcc cttgcctcaa cagggcttgg ttggacatca cagggttggt cctcctttac     58020
     accaatttca acctcgattc cacctccgac ttccctaaat ttgattgcac cagcaggaat     58080
     tcgagacgat agctttgctg gtcgctacac ttacatgaag cctttattat gggagacccc     58140
     gttggttgat tggggattaa aattgattgc tcccatggcc agagttgtca accagcaatc     58200
     ggcatttcaa aaagtttttc aggctcgtca agaacttttg aggcagccag tcgccaagtc     58260
     ttttctggta gatcgctggc ggcctgaaga tgccatagat actgttgacc aatatttaca     58320
     gcagttacag attcctactc aggtcattgc gggtcagcaa gacaccacta ttccgctctg     58380
     gcactgtcaa acctatgccg agaaaatagc gacatcgacc attaatgtta tccccaatgc     58440
     agctcatgat ctaatccaaa ctcatagttt tgaaattgtc cgaattatta accgtttttt     58500
     ggaacagttt cagaaccggg tagcgggtta gcagtcataa tgcctgagtt aagacaactt     58560
     aacaattact atctttttcc tatctactcc atctttgact agaacggctc cgtagagtga     58620
     gtctcccttt ttcgactctt caattgccat acgcatgaaa tcgccatcgt tcatagttgt     58680
     cttcagaaat gctatgaagc aatatgtcta gacagaccat aaattggtaa acgtatttac     58740
     aaagcatgct cttaaactat tcaagcaata tttgaattga aatattcact ttattaatga     58800
     gactttgcat ttatctgaag taaacattca aaagagtttc agagtgaaat aattgcatgt     58860
     aagtaataat taaagtatat atcttgataa gaatatggaa ctcaacaagg agtatgttcg     58920
     aaaaattatt aaatggttga aacttgctta ccctgaacta ccattcacta tgtatgacat     58980
     tggtgtcaga tatggaatcc attacttata tatcgacctg ctgagcttaa accattttaa     59040
     agtaattggt tttgaagtag acaagaagga ggcagaaaat cttacaaaaa atagcaaatc     59100
     aggtatttca gaagtatggc catatgctgt tgctaaatca aaaggaagga ggaaaatata     59160
     tattacgaag catccaggct gttcttcatt ttatccccca aatcaagaac tcttaagtca     59220
     atattcgtca tttgatttct tcaaaatatc tgaaacgaaa ttcgtagaga ccatctcaat     59280
     tgatgatttc atagaaggac atgaaacaac tgcaccagat tatttaaaga tagatgtaca     59340
     aggtgctgaa tatgaaatcc ttgaaggtag tgaattagcc ttaaacaata tcactggaat     59400
     atttttagaa actcaattga gggaaatata tttaggtgcc ccgcttttcc cagaaattca     59460
     tatgtttctc aacaatttag gatttaggct aatcttctgt gagtataatg ctgatcttgg     59520
     cggagaactg atagagtttg acgtagctta tgtgagagat tataaatcgg ttacatcgaa     59580
     aaaagatcta ctcaagttgg tcttattctg ttgtattcat aaaaatattg attatgcagt     59640
     taatgcagta agaaattcat ctcttacaga ttctgaaaag caagaaatac tgaatttatt     59700
     ttcacgacct ttgcaaccag agaaaatgct tgtcaaatca gacagtccat atattagcag     59760
     taatattgaa cttaggaaaa ttcatgaaga ctggtggatt aataagccct agagtatctg     59820
     ttgggtagca aattaaggat ggcaattgag ataatcagag ggtactagga agtatgtgga     59880
     catcccgaat ctgtgacaca ggactaaatc caaggattga gcagtttgac tccagttcct     59940
     tgaaagtcat tcgtatttct ggtgacgaga gtaaggccat gttctaaagc agttgctgct     60000
     attaacgcat cgtaagcagg cattggatct ggtacgtgaa gctgagcagt cctgatggcg     60060
     atactcgtac tgatgggaat gatgcgttca gcatagttat ttagtacatg atccgttaac     60120
     caaagacgta gcacttggcc ctgcttttta tcacggcgtt cagtaaggag tacccctcgc     60180
     tcaatttcaa atacagagat tgcagaaatg taggtttgtt ctccaggtgt gctggttgcc     60240
     catatttcaa cctgcttgtt ggcttttcta gaagcaactt tacggagttc agagataaca     60300
     ttagtatcca gtaagaacat caagacaaat ctacctctct caaggttgaa tccgcatccc     60360
     gtactgattc aaactcaatc tcagcacaat caggcatcgc taacaaatca gctacgcttt     60420
     tagacgaatg gattaactta tagtattgat ccaccgttag caacacatgg gcaggtgttc     60480
     cccgatctgt gatgaagaca ggctcttttt cagcagcccg tttagctttg cccacatctt     60540
     gattaaattc tcgactagaa atgctttgca tatgcccctc tgcaatgtag atatgtaact     60600
     acattataaa tccttaccag atgtatagag agacaccaga gtgtcaggca gggcatccta     60660
     aaggaagaat aatattcaga taagatttca atcattaaca atgagtgcca atcaacccgt     60720
     ccctttgctt tacagtggtc aagtcggaga ctattttgga acggagtatg aagggctgcc     60780
     agccaatgtg catcccagta ttaatgacgt tggggtgcaa cttatccacc gcgatttaat     60840
     ctatcttggt gttctcactt gttcagagtt ttcccaagtt caaatttacg cattcgctac     60900
     tccagatcga cagacagtcg tctcggtgat ggcaggtgta tctgaattat gtggaattga     60960
     ttgtgtttgt aagtttgaag acggtagttt tctgaccaca acgacaactc aaatcgctca     61020
     taacgcctac gatgagcaga gactattccg tatttctttc ccagagctta atgcagtaga     61080
     acttttggaa caacatcaga gttttgctca agaatttgag gatcgatgtg gtggtgttca     61140
     ggcgatcttc attgatctac tatcactcgc tcaaatggtc gatgaatata cgctcaggca     61200
     aagatctaat cctggtcatg gaattcttca gttcacgaca agcgttgctc aagctgggtt     61260
     tacccagatg atgatggacg ataacaatga agatgatttg gatgaaggcg acgatgataa     61320
     tgtagatcaa attgaatacg atgaagaaag tattgctcct ttaattcagg caatacttca     61380
     ggatgattta gaccaaatag aaacgctttt agcccaaggt gcagaattag atcccaaaga     61440
     ttggcaagaa gaagtgccac ttgtagcggc ggtctatcga caaaatccca aggtgatcca     61500
     acgacttatt gccgcaggag caaatctgga taggcttgac ctagctgtgg attgtagtcc     61560
     ggttggtatg gccattaaac aaaatagccc taatttggtt acactcctat tacatgcagg     61620
     agcttcacca gattctgggg atctatcttg gaccggatta actctggcca ttaaccaaga     61680
     caacttaccg attttaaaaa tacttcttga ggcaggggct gatcccaatg ctgacatgga     61740
     agattatgat cgcgccatta tgcatgcagc atctcagggc aacttagaga tggtgcagct     61800
     acttgtaact cacggcgcag acgtcagtgc ttggagtcaa ggcgataccg ccattatgag     61860
     tgcagctcat aatgaacata aagctgtgta tgagtatctg tatccattgg ttgatgatga     61920
     aacccgtcgc tatgctgata aacatggaca ggcagtaatg gctaaagcag ctaagcgtaa     61980
     agcccgctta tccaataaag gagctgaaaa gcttggagat gcggccttgt atgggaaatt     62040
     agctcaagtt aagcaactct tggcggaagg tatcaatccc aatgtcatta ctgaatgtgg     62100
     caaaagccct cttatgatgg ctgctatgta tggccacaaa gttgtgatgg ccgctctgtt     62160
     agatgcaggt gctgatccta atctaggtag tgatgaagaa tatgcagaag gcacgacggc     62220
     actgatgtat attgccaaca gcttctttgc gaccaatcga gtagaggtaa ttcagtttct     62280
     tgtcgagcat ggtgcggatg taaatgcaaa aaatcacaaa ggccaaacga cactgatggt     62340
     cgctggcgaa aatgtggatg tagtgaaagc attaattgaa gcaggagcag atgttgatct     62400
     ccgagacaat gaaggtaata cagcgatgat gcttgggagt tgggcagtac agcaattact     62460
     taaacaagct ggtgcgtcag aagagggctt gaatgatata gccctagtta aagctgcccg     62520
     taaaggtgat ctatctatca tcgaagtcct tttacaagaa ggagccaatg taaattatgg     62580
     cgatggtagt gcattagtcg ctgctactgg ttctgggcac ttagccgtcg ttgatcgcct     62640
     catcaaagca ggagctgatg taaatttagg ctggagaagt ggatttacac ctattgctga     62700
     cgctgcttac tctggtaact tggaaatagt agagcgacta ctcagtgctg gggccgatcc     62760
     ttttcagaaa acccatgatg aggaattcca tgatgcgttg ggttacgctg aacttggaca     62820
     ggctgaagga caccatcgag acaaagatta tggagccatc attgaacgat taaaacgcta     62880
     acaactttaa tgttgacaga tgtgaaaact atcgtcccag cagtgtggca gtatccagta     62940
     tccctcgcct aaacccttca ttgatcttaa ccatgatcga tatcaggggc ttttactatt     63000
     ccaacacctc atcattttct tagggatgtt cttagatcgt cactttagga tatagaccat     63060
     ctttaaacac acagccttca agaatgtgct ggcccagctc atagattaaa tccaacgcat     63120
     tacaagatgc cttcacaatt gccggggtgc agttggccgc aaggtaagca taaataaatt     63180
     gcttcacttt atttagaccc tgagctttat cagagagcta tcctatcaag gagtatactt     63240
     tctgggaaat aaacgaatcg cacaaaaaat gatcattact ttggcatcac ttaaaggtgg     63300
     gagtggaaaa actagcttag ccgttcattt gagtcacgct atatctttag aaaagaaaaa     63360
     agtattatta gtagatgcag atccccaagc tagcgcgcag aattgggccg ctgcaaggga     63420
     gactaaacct cctttcactg tagtgggtat ggccagaaac actctccatc gtgacctacc     63480
     tgatttgtta gataattttg atcatgctgt aattgatacc ccaccaaggg tgtctgccct     63540
     cgctagaaca tcaattctgg ctgctgactt agtaattata cctgttcaac cttctagtta     63600
     tgatgtctgg gctgcggctg aaactgttgc tttgcttgat gaagctaaag gattcaagcc     63660
     agaattgaaa gcagtttttg tagtgaatag agtactaact cgtactttaa tatctaaaga     63720
     tgtagttgaa gcactagctg aatatgacgt tccgacatta tcgaataaga ttactcagag     63780
     agtcgccttt gctgaagcat cttcaggtta tacagttctt gaatctgagc ccaaaaaatc     63840
     tgctgccaaa gagatcaaag cattaagcaa ggaaatactg aaatttcttg agttaaagag     63900
     atggtgaaga agagtaggat tgcgagtaaa ccaaatattc ctaagagtgc tgatgagtgg     63960
     gtgagtgctg gaggtcttga tccagactct aaatcaactg ctaatgagaa tgtggcaagt     64020
     tgggacttta gtttaattca agatagagac aatgatacta gggaaataaa tcagtctcat     64080
     gttgaatctt tagcagattc aatagcagtt cttggtttaa ttgagcctct cgtaattgat     64140
     agagatggga agctacttgc tgggggacat agaaaggtcg ctatttcact actagcagaa     64200
     ctaaatccat ctgcttacaa gacacacttc ccagacaatc ttgttcctgt tcgtgtaatt     64260
     aatatttctt ctgacgaaaa ccctgatcat gctattgaaa tcgagatatc tgaaaacgaa     64320
     ctaaggaaag attattctaa agcagagata ttggctattg ctgaaagact tcgaaaggct     64380
     ggatataagg ataatcctgg aagacctaaa aaaggggaaa agcgacttaa acctgctttg     64440
     tctactatat ttggaaaatc tattcgaact gttgaacgat atcttgccga agaaaccccg     64500
     tcaaatggcg aggttttgaa attaagcacc aatgttcact taaagaaagc cctaactcat     64560
     ttagatacat ggcataaaac aagaggcagg acaaagaaag aacaggctct agcaaaaaaa     64620
     ctacttgaac ttaagccact gatggaagaa attttggatg ctaaatctta gagtagggtc     64680
     tcgtagaata tatcacccat agacatcacc taaaactgtc ttatcagcaa caggtttaat     64740
     caataccaag cactgtcagg cttattagtg caagaactga cgttgaaaaa aactagcaat     64800
     agctgaagat actcttggtc cactcacatc tagtagcatc gagtgcccag actcatcaaa     64860
     ccaagcagtt tcaatctcaa atggaatgtt ttcttgcatc attcctagca caataggcgg     64920
     caccattaaa tctttatggg aatggactgc aaatacagga cattgaatat gggataacct     64980
     acgacgagca tagccactta gttgccagag tgttctcaaa gctttggagt gataaaactc     65040
     atagacgggt aaataaaatg gttcttgagg tggagcttct atggaaaagc ttgcccagct     65100
     taaaagcgga atcaaaatct cggcttttcg agataatcgt aaggctggtg cagctacggc     65160
     acaggcatct atcaatcctt cggaagccat agttagcgag atcgcaccgc ccattgaaaa     65220
     tccgaacata ccgaccttag aataatgctc ccttgcccga gcaatttctt gtcgagctgc     65280
     ggagagcatc ccttccggtg tgatgttaga gaatgcttgc tcttgtttat gtcgctctcg     65340
     atagccatgc cctggtaata agggggctac tacggataaa cccatgtttg agagtgtaga     65400
     gattgctgga gacacatcat aaggatttcc ggtaaagcca tgcacgcata taaccactgc     65460
     atcaccatta ggcttggcct tgcagaactg aggctttgcg tcaggcatca acagtttttc     65520
     aatatctgat gagagaaggt caaatcctga gaaatatgat ggctggtgca taatctcaac     65580
     atctcattga gttaaagcaa ggtttgttgg gtagttaaaa tgattttagt tggtgcgggt     65640
     gttactccaa attttagaaa taaaacctgt cctcatgact caatacccat taagcacgga     65700
     cttcgatttc atatccggta aacttccgaa tattgatgac acccgaatca aatattaaat     65760
     actgtccctt aatacccatc aaaattccac tcactagtgg tgttttgtca aaattaaacg     65820
     aggatatttt tttcggaaat cttttgactg ggtagtttat cttcgtgact gtggcatcta     65880
     actgatgtat cgcattttca ccgtatttct ttaaaagcgc aaagatggtt tcttgaatct     65940
     gcggtctaac ctcatgagct ttctcatcca atggaatcgg atcgttatta ccctttagca     66000
     tggctcgcca gtttgtttta tctgacatga gttgagctaa cttaacttca actaaaccag     66060
     aaatatgtcg cgactttact tggtagatgg gtaatgcttc cgtagcacct tgatcaatcc     66120
     aacgagtggg aatctgtgat tgtcgcgtga tacccacctt caatgctgaa gtgttggcaa     66180
     ggtagacgac atgatcaacc atacagttgt gttgacccca ttctggttct ctacaagttc     66240
     ccatatgaaa gtgacattgc tcaggtttca agatgcatat atcacaagca gcaaggcttt     66300
     tcatacatgg ataacagtac ccttgcgaaa aacttttact tgtttttcgc ccacaatttt     66360
     ggcaatagat ttgacctaaa aactctaatt caagattttg attgagcagt ggattgagtt     66420
     gtagcgattg atcgcccact ggtaaggtat atccaacaac ctcattgagt ttcgttttca     66480
     ttttgcgcaa ggtaccttgc ataatcaatg tttccactct gtttcaaaag tcgggctatc     66540
     cttcccgacg ttatatcaaa gattgtgatt tgggttgcca ccactagcat atattgcatt     66600
     gcacttataa agacattgat cagcaagctg caaccaagga ttcgtcttgg gctaaagttt     66660
     tctgaagttg ctctaccact ggccttgcag ctctatgctt tgccgtcttt ttactagagg     66720
     caatgccact accgataata acttcgtcat caaccttgag ccgacattca cagtgaaagc     66780
     cttgctcatg ctccacaatc tcaaactctg cctgtggcca ctgaaggccc tggcataact     66840
     ccatgagcag actcagacaa ttgtgccctt cctggtactg ccttaattta tggatcacgg     66900
     gtggaggctt aggtgcagac ggttggggaa tcggaggtgc ttctctatgc tctggatgaa     66960
     ctaaagtacc ttcaaactta gccttgagcc aagctaaaca agcctgatgt tttgcacccg     67020
     ttttattcat agagatcccc ggtttagccg tcgtccatag ctgttcgcca atgagaatct     67080
     ctaaccatgt cataaaaggt ggttcctgac tgacttcaac ataagcagaa ctgtgccaag     67140
     cttctatttg attgagagca atactgacaa tgctggcagc atcatagaga tggtctccca     67200
     agtactccaa gacctgctct tgtaactgca gctcatcccc caacaagagc aagacaaata     67260
     aatcttccac ggtgacattg ccagactgta atcgagtttc agcctcagct ttaaggtttt     67320
     ctccttgttg atcttctagg gcaaatcgga gcagaagcga gaactctcct tggggcagct     67380
     gggcaatgat ctcgggtgat tgtagctgag cttcatagag ttgtcgctgc tgggctttgc     67440
     aataggtttt atgagtctcc tcctgggctt gaattgttgc ttcaatatgt tgggaaagcg     67500
     cttgtatgtc ttctatggaa tagggatagg attgcccctt caggtgagct ttgaccatac     67560
     gatggttgat taagtctgga tatcgacgaa tcggggaagt gaagtggcaa taggcagata     67620
     gatttagggc aaaatgccca tggggttcag ggccatactc agccggattt agccaactca     67680
     ttaggacgcg acgagtatcc tcctcagatt gagcattgac gagagctgca aactgatggg     67740
     tttgttcagg gccaatggct cgatgcatgt gattccgata aatggcaggg atattgtgct     67800
     ggtctaacca ttgagccatg gccgtattcg ccagaatcat aaactcttga ataatcagat     67860
     agctctgata ccgagcgaag tccgtggaga ggagattccc attttcatct aggtaatacc     67920
     cttctggcaa agtgagacca tcaaaattct tggattggat tcgtctttga taaagctgtt     67980
     ctgcccattg ccaacaccga tagataaagt tggagtccgg tcggctgata tccatgaggg     68040
     cttcatccgc ttgttcataa gtgaagcgtt tatggctact caaccgggat tcatagactt     68100
     caacgttctg aatctcagcg gattgattca gggtgatctc tagggtgatc gtgggtcgaa     68160
     gttgatgttc taggagactg agcttatctt cagataaaca ccgaggcagc atcggagtgt     68220
     tgttatggcg aaagtacaag gtttggatgc gtgaccttgc ttcttgatcg acgaggcttc     68280
     cgggttgcac gagttcggca acatcagcga tatggactga aagggttgtg agatgctctt     68340
     tttcttcaat ccagatggca tcatccaagt ctcgggagtg tgctccatca atagttatcc     68400
     ctggcacttg tggccgttga ttgatggagg tgtgaagggc aatggtctct gcttcttcaa     68460
     taacagactt agagaagggt tttcgaggca tcttggctaa aaggttggat tctcatacac     68520
     tttagcgaca aaaacggaat tgaaagcatc atgcgggtaa ttggaccatc tcccgaatat     68580
     ttccctttac accaccaaca cctgcagtga agttacgatc tgggtggtgt aagtgcattg     68640
     gtaaaccatt cttgggcgca attgtgatga ttccatatcg gtcaacagag acagatggta     68700
     caaactccat ccgaaaggtt tggagcataa tagacagtac gattttgagt tccatcattg     68760
     caaaagctgc tcccatacat aggcgtgaac ccgcactaaa cggcatgtac tcccacatat     68820
     cagggttgat tcgctcccat cggcttgggt caaagcaatt tggattctca tagaggtctg     68880
     gcatgtggtg ggtggcataa atactgcaat acacctctgt tccaactggt agggaatatc     68940
     cgcccaaatc cacgatctga ttgttatacc gccaggtgaa gggagctggt gggatcagcc     69000
     gtaagctctc cttgatcacg cgttcgagga gcggtaactg gtccaattgg tctaggcggg     69060
     gaggatctcc ttgcagaacg gcacctaatt catccatcag atcagccgca atgtcaggat     69120
     gctgagaaag taataacacc gtccaaccga gagcaagaga ggtcgtctca tgtcctgccg     69180
     caaacaacga acccacatgt cctaacaact cggtttcgct caagcttatt cctgtctctt     69240
     catcccgcgc ctggattaac atggagagga catcattatc cttagactgg cgtgctcgtt     69300
     tcgctgaaat aatgcccctc atttccctgt caaagcaggc aatcaaattt agaaaccttc     69360
     gataaggtaa acctccaatg tcgtaaggca tcaacgtcgt caaaggttgg gaaaggactg     69420
     ctaatgcttg ctccagcagg tgaccaaccc cttggcccgc tttaccgcta tcttcgccaa     69480
     agagcgtctt ggtgacaatc cgcatcgcaa gtaatcgtgt ctcttcaacg aggttgaccg     69540
     tggtgccagg gcgcagatgt gacaaggatg attgagtgat attaaccata tcttgccaat     69600
     agctttgaat gtggcgggtg tgaaaggcag gcatcatcag ccgacgttga aggcgatgtt     69660
     catcaccatt gacgccccag aggccaacca gaaaatgctt gagtggctgc ttccggtttg     69720
     agactgcttc catcggatag agcgtcatgg aaagaggcgt cagattccat tgagaatgag     69780
     gtgtgcgggc ttgacgaatt aaatcaggcc cgtggacgat aacagtacct ggacattttt     69840
     caaaaggcgt gaacagattg gtcccccctt gttcgcacag ggagaccatt gggccatagt     69900
     cttgaaatag ctggttggag taaccgatgg gatcttgggt aaatcgaaag gtattacctg     69960
     ttgtcccaac tataggtgta gattttggtc ccggaacggt ccaggccatc tctgtgttgg     70020
     tatctgtagg tggtttgata ttcgccatat ttccacttga acaatacggt tgaaccagag     70080
     tttatcgact tgatctaatg agtaggagca ttgaactttt ccaattctcc attgagtaag     70140
     ttagaaatcc atacttgtga ttgcaggacc ttaaactagg gtacttaaga agctatacgc     70200
     tgaaaactaa ggaatggatc tatggatttc cattgtttct aatttgccga ggcgggacag     70260
     ttccgcaagc tagtaacccg gaaagggatc cggtagctag atggcgtcaa cttaaatgat     70320
     aaaactgggg agatatccgc gatgcacagt actcaagagt ctttcagaat agttcctctg     70380
     aaagtcaaac cagaaggaaa atctgatttt tttaatcaag aaacagtcaa ggtatgcttt     70440
     ggggatcgtt tcatttcgaa aaatgaaaga caaagaggta ctggcaaaac taaaaatgta     70500
     tatagattag ctaaggcttg aatgaatgct ctatgtgtag gattagtagt tggttctaag     70560
     agtgggtatc caagaccaag agaaagtccg ataattacat ataaaaaagt cactacaagt     70620
     aagagagaaa gatatcctaa agcaattgaa cgattgttct taaaaggaag tgctttcatt     70680
     gcgtagaagt ataggaagtt ttcaaatgct actaagaata acaaaatctg aaaaccgaca     70740
     taagggaggt aatggtttag gaaatttact tcaggactcc agacaaagac aattctgaac     70800
     cagacagtta ataatatttc aagtggcaga aaatacaaag caattagaaa ggtataccga     70860
     ggtgctctat tttcgcgata ggcatcctga atccttaaga agttgaagat aacatagaga     70920
     agaaaaggaa cctcccaaaa tggtagaagc atagctgaaa cagttcgact aggctcatga     70980
     tcaatcacat tgcaggcatg gttgaaccca aatattttat aaatgactat agtttctgga     71040
     tcaacatcaa caactgtgtt tgttaaaaca tatccaatca caagtagtgt gattaaagag     71100
     acataagcaa taatcctgag aatttctgga ttaaattcca aactaaatga ataatttgga     71160
     gatgatttct tcctcgagtt catggcaccc ataatattcc ttgagacaat aaaataaata     71220
     aggcctaagg ctttctatag ttgtactgga tatattcata ctagccttta gaattaagat     71280
     ataattgtcc cattatttgt aatttagaaa ttcatattgt ctcctagaaa ataagttatg     71340
     tatcggcttg agtcgaggta gacaattttt tctcaagaga ttgataataa gatttatatt     71400
     taagaataat agggatacaa gtctaaattt tttatcacaa gcgtaaccat ttcatctgaa     71460
     atcaacgaat cataagctat aagcctggat attagcccaa gattaaatcg gctagaattc     71520
     tcattgacca ttttgatcga cgggatggca gaattaatgg tcttgaccaa agtttgtaga     71580
     cacttgaaaa aggtcaacaa gagaatattg gatagtactt gctgaattct aacttgagca     71640
     cagaataact ttttggtgtt cgcaggcagc ctttcggtgg cagtatgcat tgcggtagtc     71700
     caggtcggta tgaagtccca tgaatgactc aagattagga taggacccga tcgcaactaa     71760
     atcccagtct tcatcctgac ccaagaacac tccctcatag gggccaacca gaagaaaccg     71820
     gccacccacc ctctccatcg tcgagatgct gatcgatgcg tattgattga atgcgtcttg     71880
     acctgagatg ttttcgctga tctgatgatt atcttgaggg tattccgcaa tggatctgaa     71940
     cttgaagaag ttaatcagcg taatgggctg attcgctggt ctttcgagaa tcagccgcca     72000
     ctgatcggct ttagggctta agtcatcgtg tccatctcca taccaaacac atagttgttg     72060
     tacgctttca tcaatttgag aattgacctg cattgcaaaa gctccctgta cactttggtc     72120
     tatatcatga atcaattgat tgctacccta ttcgagaaca tggccacctg agcaattgag     72180
     aacggtgcca gtcatatagg ctgccaaatc agaggcggct aagaccatga cacctgctgt     72240
     ctcttgggct gatggtagtc tttttaacgc cgtcttgttt tgttcaataa aggcttgcat     72300
     ctgtgctcgg gtcaacttca gattcttacc catttctgtg aacgtatagt tgatggttgg     72360
     cgattctggc attgcctctg atcgcacacc aaccacccga ataccgtcag gcccccattc     72420
     gttagctagg gattttaaga gtccttccgt agcggcatgg gaggcagtaa gggctggact     72480
     ccagggtgat ccgacttttg ataaggtcga agtgataaaa ataatcacgc ccttatgttg     72540
     atgggccatg tgtttatatg cggcttttgc cgtcacaaac tgagttgcag ttgccgtttt     72600
     ttgagggatc aaaaattgtt ccagagaaac gtccacggct ggcttgccgt gattgaagtc     72660
     ggcaggattg gagccagtca ggtttgtgac aatatcaagg gtgccggtct cagcgacgac     72720
     tgcgtctaaa taggtttgta cctcatcttc gttcaaggca tcgacttgcg tcacctcctt     72780
     gatatcggat tgcccagagc cagaaacccc attcaggcta gaggcaaaaa catttgcacc     72840
     ttgttcggca tatgctctgg tgacttgctg accgagatgg cctccagcac caaagatgac     72900
     cgctgttttg ttggccaata agttgttgtt cattttttgt acctacttca aaaattcagg     72960
     tgctccatgc tcgcgtttgg ccccctgaag atagtgcgtt ttgtgatcta ctccctggag     73020
     cgtcagaccc accagtgccc gccacccgca tggagagcca ctgatggtgt gaactgttaa     73080
     cgtcattgac tgacctttgt ttcagtgagt gtcactagca agaatcatag ctgtttagtt     73140
     tttaaattca agtaggcagt tttatcgcat atactcatac aaatagtact tagtctaaaa     73200
     attagagtaa gcatggtttc tcaaaacaag gcaagcgaaa aagtcctaga accccctatc     73260
     cctattattg agggcgtttg tccgatgcca gatattgctc agcttattgg cggcaagtgg     73320
     aagctgatca tcttacaaat tctgattttt caaggaacca agcgctttgg cgaactgcga     73380
     aagctgatcg atggaatcac gcaaacaatg ctcaccaatc agctccgagc cttagaacgc     73440
     gatggtctcg tcaagcgcaa ggtctatcct gaagttccgc cccgcgtgga gtattcagca     73500
     acaaagcgcg cgcttgatct agaggaaatg tttcacgcta tgcatgcatg gtgggaaaga     73560
     aactgttgag accaattgtt ctctgtctct tctgataagg ccatttcata tgttcctcag     73620
     ggatatgtcg ttcatagaca tcccacccat atcccctgcc catagaaccc tcctcgctgt     73680
     tccacccgaa agccccctaa aagcaccccg atcaacacag ccacaggagc cagaccaagt     73740
     cctcgtacta agtcaccgaa caacacagca tcctctttac cctcaaggaa ctctcgaatc     73800
     gcacccaccc atgcccccac atcttcgaca tggctgatct tcagtgccac ttcctcccca     73860
     ctctccagct catccacaaa ctccagcacc gagtctttgc taacctcacc cacgaccgac     73920
     tcaacagact tccccgtgaa tccttggcgt cgcttccgtg acttcggctg acgacaaaga     73980
     tctgacacat ccaaaaacat ggtctgctga accatcccag ctaagaaatc ctcatccagc     74040
     actggacctt cagagttgta tcgttcctcc caaccctgga tcatcaactc tgcccgctga     74100
     agacaaacct cagccatatc cttgatcgca tccccagcta ccctgagctg ttcttgggga     74160
     gaacgacctt gcaaatgctg atccaacgat gcacacatca aggaaatatc agcctgctct     74220
     ggttcatcca aagcagaagc caaagcactg acaaaatcta gctcaagctg agtgtacatg     74280
     gcgcttatcc tttagcggac attccgtgat ctcacactca gttggctcca agcggatcgg     74340
     gggttcaaac tccgtgattc cgaatcgttc tcgtagtacc ctcagtactt cccgcaaata     74400
     tcgattgact tgagtattcg tcatgcccat acagtgtata ggctcaatat cggctaactt     74460
     ctcgctccct tgccagacac tcacggctag ggcatggaga tgagcatcct tgggcttctc     74520
     cttatacaga tagagttgtg ccacaggtgg ggcttggact ggaaccacga tagtttcaac     74580
     ggtttcaatc tgttgatggg ccactttaag atcccgataa agcccccgtt gtttatcgtt     74640
     attggctttg cgattccggt aatgagagcg cttgcgagga caagtcttag gattccagca     74700
     agccgtttca gttcccggac catgcagccg gatcgcctct tgctgagaac gttgtgaaca     74760
     gtccagacat tttttgttga ttggacgagc cacgagaaca acatttagaa cgacgacaat     74820
     tagaccaaac tagatgggaa gattcttggg ttcttctcca tctccatacg ccatcaagcc     74880
     acttgcaagg tttgaggctg aggtagctcc ttcccttcct gttcgtacca gagacagagg     74940
     gaatcaatca tctcttgccc gtgttgagct gcctctgagt aagtggcccc atccgtacag     75000
     ggctggttta tttctgggaa gtccggtagg gaaaccacat aacaggaatc ttcatcggac     75060
     cactgaatca acatttggaa cttgcggtta tccatcaggt ttctctttta aggttttcag     75120
     tgcagcgtca acttctttct ctatatcggg gtgcatcatc cccatccttg cgagcaatga     75180
     cgatataagt gtccagtgct ggatgcttcc acttactgtg acttcccttt ccgggttgag     75240
     cagaaaagcc tgccttgagc agcatggcct tgatgtcacg gatttttttg ggcatggcag     75300
     ctcaaccaac tgtcctatct agtttacagg ctagccaggg atagtgaccg ttttttatgt     75360
     aacttttaat gtaatccaga taagagcaat tatttggagt aggaatttcc gcaaaattac     75420
     ctctgctgtc agagcaaggg ttttgaaaag tcaattctat atttggacga cacttctgga     75480
     attagcatca tgaatcttat gtatctaaat tagtgatcac ttgagcatat tttgtagtgc     75540
     aatctatgtc gtgtattaga tgtcgtgtac aaccctaatc tctgacatcc cgccagccca     75600
     tctagttgag tttgatatgg agatatcagc gctgagcaag cctagaattc cccacttcca     75660
     aaacggtttg attagagaac ggttgaggag ctccacccca accgttctgg gatttagagg     75720
     gtaaagttgg cctcatcaat ggaggtgatg ctgtcaaaag tgattcgacc accgcccaag     75780
     gaagcaagat ttaaccgtaa gttacctccc actaatcgag cattggcatc gttagagtca     75840
     ataacaccat caccattggt atcaatatcc gagatgccga tggcaaagct actcaagtcg     75900
     atctggtcgg cattgccatt gaagtccacg acagtatctc ggccaaagtc tccggcaaag     75960
     ataaaggtat catccccacc attcccctga agcaggtcgt tgcctgcccc accgttgagg     76020
     ctatctgctc cactaccacc aacgagggta tcacgaccat cccctcctgt gaggacatca     76080
     tcattcccac ccccgagaag gctgtcatta cctgaaccac cattgagggt atcattccca     76140
     cggttgcctt caattatgtc agcacggtta gacccagtaa tgttgtcatc accaccgcga     76200
     ccttggatag tcgcattcgt cagattgata tcggtaaaat cccaggtttc tcccacagtt     76260
     ccagcccctc gaatgttaaa ggctagatcc ccttcacggt taatgacttc aatcccagaa     76320
     gttgcatcaa aggtggcggt gaggccatta aagttctcca ctagggaggt gattctatcg     76380
     gtgccagtgg tccctgtatc ttggtagata tcccggtcat caccagcatc ccagaggtaa     76440
     gtatctgccc cattgccgcc atctagaata tctgagttgt tacccccatc taaggtatct     76500
     ctgccattgc ccccattgag ggtatctaga ccattacctc catttaggct atcggcaccg     76560
     gacccaccat tgagaatgtc atcaccatta cgaccctcta gggtgtctct accaccatca     76620
     ccattaagga tgtcattatc tcctcttcca atgagggtgt catttccacc ccgaccgttg     76680
     atggtatccg ctagaccagt ccctaggagg aaatcggctt gggaggtgcc ctctaatagt     76740
     tcattgaggc cattgatggt aatggtgacg gtgcccgcgc ctgtaccatc aagggaagta     76800
     acgctgaagg tttcagtgag gctctctccc aagcctaatt cctgaatcgc tgcttgggta     76860
     ttgtctgccg tgtagttcca gaacccgtca gcatctacgg tgaaggtgcc gtaggtacct     76920
     atcaaggttt ctgcggttgc aaaggcttca cctggatctg aatctgtgac aattacttgg     76980
     ccggaggtag ttagggtatt ggggtcatca tcttcggtga cggagccaga gtcatctgtg     77040
     acggtggcga tgtcattggt gctccccaca gtaatattga ctgttgcagt atcagtgccc     77100
     ccattgccat cactgatggt gtaggtaaac gcatctgatc ctgtgtagtt ggcatcaggg     77160
     gtataggtat aggtgccatc gttgttatcc accagggtgc cattactcgg agtggtaacg     77220
     ctatcaatgg agagtgtatc tccatcaata tcggtgtcat tgcctaggag tagagcagca     77280
     tcaataacaa cggcaacatc ttcatcggtg gtgaccgtgt catcggcagc aatgggagca     77340
     tcgttgacgg gattcacggt aatgttgacg gtggccacgc tggtgccacc attgccatca     77400
     ctgatggtgt agccaaagct gtctgtgcca aagaagtcag gatttggggt gtaggtgaag     77460
     tctccattgg cggagataga gacggtgcca ttgcttggat ccgtgttgtc aataacggag     77520
     agagtatccc catcaaggtc tgtatccagt cctccgctgc tgccgtctaa gacattgccc     77580
     gtgatggcaa catcttcatc ggtggtcacg gcatcatcta ctgcaacggg tggatcattg     77640
     gtgcttctca cagtaatatt gactgttgcg gtatcagtgc ccccattgcc atcactgatg     77700
     gtgtaggtaa acgcatctgg tcctgtgtag ttggcatcag gggtgtaggt gtaggtgcca     77760
     tcgttgttat ccaccagggt gccattactc ggatccgtaa cgctaccaat ggagagtgta     77820
     tctccatcaa tatcggtgtc attgcccagg agtagggcgg catcaataac aacggcaaca     77880
     tcttcatcag tggtgactgt gtcatcggca gcaatgggtg catcattgac agggttgact     77940
     gtgatgttga cggtgcctgt atcagtggca gtgccatccg tgacgacgta gtcaaaggag     78000
     actgaaccgt tgtaattagc atctggggtg aaggtgatat ccccagtggc tgaaacattg     78060
     acggtaccgt tggtgacggc tatcgattga gcagttcctg gggttagtgc aatccctaca     78120
     atcgattcaa tactcagggt atcgccatcg aggtctgtgt cgttgcctag taagtcaagg     78180
     acggctgtgg ttgtatcttc ggcgatggtg aaggcatcat ctactgcgac gggcggatca     78240
     ttactattct caaatctgaa ttgggtacca tctgatgaag ttaagttaat tcctaaatca     78300
     tcagaagtaa aatcgatagt gttgactaaa gtaattaata aagttccctc accaaagcta     78360
     gcaccatcct gggcatgaaa ttgagtacga tcattgaatg aaacaacatc aacaccttga     78420
     aaaccattga agctcagaat atctccaccc acacctctaa caaattgatt aatggtatct     78480
     gtgccatccc caaggttgta agtaactgta tcggtatcgg tatcagcgcc tagattaatt     78540
     aagtcatccc cagccccccc atcaataaca tcattaccac caaacccatc taaggtgtca     78600
     tctccatctc caccattgag tgtgtcagca ttggcgtcgc cttttaagga atcagcttgg     78660
     ttggtacctg tgatatcaaa attctcaaag ttagcattga cggaagttgt gttgcctcca     78720
     gtaataaagg aggagctcat agtgatgcct gaggagatta aatccgaaaa gtctgcaact     78780
     aagagatctg taccctctcc tccatctgca gtgtttgatc ctaaaccggc attgacggtg     78840
     tcattccctt ctccagctct aatgacatca tcaccagcac ctgtgttgat gacatcatca     78900
     ccagcacctg tgtcgatgct atagtctcgg aagttgacat agttaatcgt atcgtcgcca     78960
     ctaccagtta acaggttttc aatcgtttcg atattggcaa tggataagcc acctgtattg     79020
     atggttttgc tactcgtatc atcaatattg agcgcgtcag tagtactcga gaaatctgcc     79080
     tcgatgagta agtcatcccc agccccccca tcaataacat cattaccacc aaacccatct     79140
     aaggtgtcat ctccatctcc accattgagt gtgtcagcac tggcgtcgcc atttatggaa     79200
     tcagcttggt tggtacctgt gatatcaaaa ttctcaaagt tagcatggac gaaagttgtg     79260
     ttgcctccag taataaagga ggagctcata gtgatgccta cgtttaattc cgaaaagtct     79320
     gcaattaaga gatctgtacc ctctcctcca tctgcagtgc ctgaacctaa accggcattg     79380
     acggtgtcat tcccttctcc agctctaatg acatcatcac cagcacctgt gttgatgaca     79440
     tcatcaccag cacctgtgtc gatgctatag tctcggaagt tgacatagtt aatcgtatcg     79500
     tcgccactac cagttaacag gttttcaatc gtttcgatat tggcaatgga taagccacct     79560
     gtattgatgg ttttgctact cgtatcatca atattgagcg cgtcagtagt actcgagaaa     79620
     tctgcctcga tgagtaagtc atccccagcc cccccatcaa taacatcatt accaccaaac     79680
     ccatctaagg tgtcatctcc atctccacca ttgagtgtgt cagcactggc gtcgccattt     79740
     atggaatcag cttggttggt acctgtgata tcaaaattct caaagttaac atggacgaaa     79800
     ttgaaatttg agctgcctgc agtaataaat gaggagctca tagtgatgcc tacgtttaat     79860
     tccgaaaagt ctacaactaa gagatctgta ccctctcctc catctgcaat gcctgaagct     79920
     aaaccggcat tgacggtgtc attcccttct ccagcatcaa tggtgtcatt cccaccacta     79980
     gaggtgatga tgtcatctcc ggcacctgag ctgatgatgt catctcctgc accagactcg     80040
     atattattgt taccatcacc accatcaata gtgttattac catcaccagc atcaatagtg     80100
     tcatctccgg caccagactc gatagtatcg ttaccatcac cagcatcaat agtgtcatct     80160
     ccggcaccag actcgatagt atcgttacca tcaccaccat caatagtgtt attaccatca     80220
     ctacctacga tagtgtcatc gccaccaccg ccgattagcg tatcagcatt agttccccct     80280
     atcaaagaat catttagatt agttccagta atatcaaaat tttcaaattc agagctgcta     80340
     taaaattcag tatttataaa ttcctggaat gaacctggtg ggtcatcttg aattagtgca     80400
     ctcgaaccac tggtagtgac gttaacacca aattcaacca aaacttcggt tggaacccct     80460
     agcaaatttg ttaaaaaaat tgcccttacc ccttgtgagt aatcagcaat cagcaggtca     80520
     gtaccttcat cgccattaac agaatcagtt ggaatagggt tattaatgga atcaccaaac     80580
     ccaaaaccac tgccaccccc aactatagtg tcatttccac tacccccatc aatgctgtca     80640
     atacctgtac ccccatcaat gctgtcgttt ccagcaccac cattaatcgt gtcatctccg     80700
     ccaccaccca aaatagtgtc atcgccgtta ctaccattaa ggacttcatc tccaggccca     80760
     ccaataattt cagcctgttc aatttgaatt aattgaccat ctaaattgat gattgcggta     80820
     tcatcctcgg ctttcaattg ctgtaatgca gatggactca gctcctgtcc caacaccaaa     80880
     gcagaaaaaa ttgccccttc atccccagga ctgtccacag aattcagttg agaatcaata     80940
     aaatgaccaa tctcttctag caagacttga acaatggttt cagggttcgc ggcattgaaa     81000
     gatataagtt cctgagataa ataaatcgtg ttggtatcgg tcgaaaaagc tccattcgca     81060
     ccgttaatct cagcagctac ccgaatttca atattaggta gttcactgta gtcaccatca     81120
     gcccatgctt gctgcaagtc tgccgccgca tcattgctga aagtactacc aaacgccaac     81180
     tgaagcttgt ctaggaagtt atcgtcaagg gcaaatgatt gaagacgttt gaatgtttct     81240
     gacatcacta ctgcagaaag ctcagtcccc attgcttgat aattactttt catgaattat     81300
     ttcctaaatt aatttagtgc taatgagaaa ttaaagatct tactttcggg ttagaactcc     81360
     ggattctgac aacgagttag ctttgaggca gcaaaaactc taactacagc aattcccatg     81420
     aatatttatt ccgcttcctt taaacttcca ttaaccgggt aaattgccga tatacattga     81480
     ttatgaactg gaggactcgg gtctcaacgg acatagtatt tattccagaa aatacatatt     81540
     agaaataaag acagcccaag attactcccg taaaaccagc aagataattt agtactgtta     81600
     atagcaacag cactaaaaaa attacgagga caaaaataat ttcaaaaacc tccgggttac     81660
     tgatatttca gcaccttcag cccttaaata agcctcgatt accaatccaa taaagagaga     81720
     gaacgacgct cctaaagtct gctctttgtc tctggcttgg gcgatggaga taacctatcc     81780
     ttaatgcctt aacaagcatt aaggataggt tatctatggg gttaagaatt cagaaaaact     81840
     ctgataaaat tcgcataaat agcatgacaa tgttcgattt actaacagca gataaaaaag     81900
     aaacacacat ttagtactct attttgcaaa tgggatgtaa taatcaccaa atcattccaa     81960
     agtatcaaga acccatcatt attgagtata tcgctcagaa aactctgaaa atcatatcga     82020
     attctaattg aacagttaaa cgaaagagat aattaatttt atttcattgc taattattta     82080
     attacggatt gtaggctatc ttacattgac ctaggaaata atcgagtaac taaaggtatc     82140
     caaaagtaac ctcttgagaa ccaggagatg ttaattaatg tttcttcgtt cttcaaaagt     82200
     cactagaata cttgtgaaga gattaacaat atatggatag actttgccta aattatgccc     82260
     tttacccctg aagaagctgt tatttcctta aatagaatcc tgtcagcgaa aaatatagat     82320
     tttaggctga gtgacgtcca atctcttatt ttctcggggt gctgggaaaa taaatcctat     82380
     gcccaaatag cgatggattc agggtatgag gcgaattaca tcaagaaagt tggatctaat     82440
     ctttggcaac aactctccac cgtctttgca acgaaagtca cgaagaacaa tatccgggtg     82500
     atcctaacaa cgcacctaca agatactcat aacctttccc ttcccgctgt cacccctgat     82560
     catcacgccc cccatctaga ctggggagat gccaatcccc tctccacatt ctggggccgt     82620
     cagcaagaat tgatgaccct tgagcaatgg gtaacgcagg atcgatgtaa tctcattacc     82680
     attcaaggca ttggcggtat tggcaaatca gcccttgcgg tgaagttggc ccaccagtta     82740
     caagatcagt ttaatgtcgt gatctggcgc agccttaaaa acttaccccc cttaacggag     82800
     ttgatggctg atctgcttct tggggtctct caccaacaat tgactgagat cccaaatacg     82860
     ccatcagagc tgatttcgct gtttgtgaac tatttgcagc aacagccctg cctgattgtt     82920
     ttggataatg cagaaagcct gctccagacg ggggaacagt ttggcaccta tcaacccggt     82980
     tatgaagact atggcaagtt cttacggcag ataggtgaag cagtccatca gagctgtctg     83040
     ctattgacca ctcgggaact cccagaagaa atcgccatcc tggccggaga gttgctcccg     83100
     attcgggttc tgaaattggc ggggctgggg acggcctctg cccaccagtt attagaagct     83160
     aagggattga tgggaacacc tgaagggaca accgctttga tcaattttta tcgaggtaat     83220
     cccttagcgc tgaaaatcgt agcaacgtcg attcaagata tttttgcggg gaatattgca     83280
     gagttcttag accagggcaa cattgctttt aaggggattc agcgactact ccaccagcaa     83340
     ttccagcgct tatctgacct ggaagtaaaa gtgatgaact ggttggccat ccatcgagaa     83400
     ccgatgacgc ccaagcagct attagatgat ttgactgaaa gcttttcccc agggctcctc     83460
     tatcaaactc tggaagcgtt gagtcggcga tcgctgattg agcagggtat cccgattcag     83520
     catgaaacgg aggcaccctc ccttgggttc acgcttcaac cgatggtgat ggagtatatc     83580
     attgaccagc tggttgctga atttagtcaa gatatcgtta accatcaatt cagctccctc     83640
     aaccaatatg ccttggtcca agttatagcc catgaatatg ttcgtgaaac tcaaattcgt     83700
     ttgatggttg aacctattct gcaacgcttg gagaaaacct ttaaagattc aacccgattg     83760
     gtgcagcacc tcaagcaatt cttggcccag atgcagacct cttctctcac aatccactat     83820
     gctgcgggga atgttctgaa tctcctgcgc cgttgtgagg cggatatatc tgatctgaat     83880
     ctatctcagt taaccattca gcaagctgat ttgcggtcct tgaaattgca ccgggtcaat     83940
     tttgctcagg ctgatctaaa aacgacgctg ttctctgaaa ctctgggcag tatttttgat     84000
     ctagctttta gccctgaggg tgatgtttta gccattgcga cgaatgaaga ggtaaagcta     84060
     taccattacc ctcagcttcg tgagtttgca tctctggttg gccatcggat attggtctgg     84120
     tccttggctt ttagtgaaga tggcttgctc ctggctagca gcgggatcga tcatacgatc     84180
     aaaatctgga atgtcagcac agggctctgc ctccatacgt tagaaggcca tcaggctggc     84240
     gtattttctg ttgcttttga accacagggg agcaaaggat ctgaagatta tatccttgcc     84300
     agtgcaagtc acgatggcag tgtgaaattg tggaatgtca gccaacaaat atgtctccaa     84360
     accctccaag tggagaacaa gctaccccgc aaggtttctt ttgacagcat tggcgagaaa     84420
     tttgtagtgg gttatgtgga tgggagtatt cgtgtttcga actcagcctt gagtgaagaa     84480
     tgttggctcc cctccgatat tggaagccca gagtctcctc tcagtttcaa cccttcaaat     84540
     cagacgcttg cgatggggta tgggaacggg ctcattaagc tctggaatgt gtcgctccag     84600
     caatgcgaga acgtcctcga aggccatacc agccccattt tgtcattgga atattgtgcg     84660
     aatggtcaaa ttttagccag tggttcggca gataatacgg tccgactatg ggacgcccaa     84720
     actgggcagt gtcttaaatg cttactgggt cacttttcta gagtatccgc tattgcctgg     84780
     caccctagta ctaggtctct ggtaagcggt agtgaagaca gcacggttaa ggtttggaac     84840
     aagcagtcag gacaattaat gaagcatatc tatggtcata acgattgtgt ctggaccatc     84900
     gccttcagtc caaaccaacc gatcatcgcg gttggaagta acgaccgagg gttgagaatt     84960
     tgggataccc aaacagggca atgtttgcac gatctagcgg gccatacagg gcgagttaaa     85020
     accgtggcgt atagtgctga tggccagttg ttagttagtg tcacgtatgg ctacgagatc     85080
     aaggtatggg atccagaaga agggaggtgt ttacagacgc ttcagacctc ggggaaatgg     85140
     tgttgggaca cggctttgag ccatgatggg aggacccttg ctatgtctgg gggagataat     85200
     gagatccaac tgaagaatct gggtacagga caacagttgg cccctctcgt tggccatcaa     85260
     gactattccc ttggaatcgc ctttagtcct gacagtcagc gaattgcttc aactagctgg     85320
     gaccaaacgg tcaagctatg ggacctatca actggcgaat gtctccaaac tattcctgac     85380
     gatgattggg catggacgtt ggcctatcac ccctttgagc cactggtagt gacagggtgc     85440
     aatgggggca ctgtgaaact atgggatatc acgaatggac agtgcctaaa tgttctaaaa     85500
     ggacatcaag ggcttgttat gaccgtctgt ttcagtcctg atggtcaaac tatcgtcagt     85560
     ggtagcgcag atcgcactat caaactttgg gatcggcata ctggacaatg tcttcaaact     85620
     cttgtaggtc atgctgatgg catttttacg gttgcttttt catcgttcaa tcagactttg     85680
     gcgagtggta gtgttgatga atcagttagg atatgggatt tcaagtcagg ggaatgtttg     85740
     cagaccttac gcttccccag attgtatgaa gatatgaata taagagaggc tcgggggttg     85800
     acttcaactc aaatcaaccg attgaagaag ttaggcgcaa ctgtgtaggg taaacatcag     85860
     tatgtttcaa cgaagaattt ggaaattgta ctaaaagctc tcgaaattat ttgattttta     85920
     atattgtggt ctgtgggtgc cattgcgcct caaacaattc gcgccaacat aaaatattgg     85980
     ggccatatct tatgttgacg cgaaacagct gctcagttat ttggagtaca atctccattg     86040
     atggcatccc aacccgttac agcgtcttgc tcctagactt tcccaaatga ccgtccccga     86100
     agtaaagctc atcgtattgg cagaccaggc cgccactccc attgatgctg ccaggtcccg     86160
     tacccaacct ccaaaaagta ccccagcaga tctacgacgg acgcgagtgg aagagttcat     86220
     gaggtctcgc gaaattagct ccaacacccg caaagcctat gagcgggact tgaagcagtt     86280
     catggactgg acggataagg gttggcatga aatttcagcc agggacttgg atcggtacaa     86340
     gaaccatctg aaggtggaac ccaatcaaag aggccaactc cgaaagaatg caaccattaa     86400
     ccgcaacttg gccgcattac agagcttctt taaatggcta accgttcggg actacatcac     86460
     taaagatcca actttgctcc tagaaaagct caaggccgat cccgtgctgc cccaggaatt     86520
     cagccaggat gaggtggata atctctatca ggctatttgc gatcgcggct tccatacgtt     86580
     ccgagatcgg gccttactgc acctgattga tcatgggctg agggcatcgg agattcacag     86640
     gttgaacgtt ggggactatg acgggcagcg catcatcatc cgagttgcta aagctgacag     86700
     tgtgggtacg gtgccactgc tgaagaaagc tcgaaaagcc attgatcagt acaagcagtg     86760
     gcgagagcag cagggggatg tactgggaaa tgattcaccg ttgtttgtct cccactccaa     86820
     caacagtaag gggcagcgat tgcagtattg gggcatttac aagatcttca aggccattgc     86880
     tgatattgcc gaggtggaga atgcccatcc acaccgggga cggcataccc tagcgactcg     86940
     gctggtgatg aaggacatgg attccgttct ggctcgacgg attacccggc atacttcgga     87000
     gcagtctttt gtccggtatt cggatcgggg gattgagctg aaggcagaac aggaattcta     87060
     tgaggtacat ggggaggtac caggggatgg agtggctgct gataaaccgg agagtatcca     87120
     aattgaggcc attggtgaat aatcaatgac gtggcccaag attagttttt atagggatac     87180
     cactgaataa gatatccatt ctttctcaac tggaagtcac cctagttatt caactctttc     87240
     ttgagagggt taccgtcctg gcgactatca gtaagaaaat cgggaattaa aagtggataa     87300
     aatgtgacgt aatggaacat ttttaattta aaaaaattaa aaaataaaga aataaccgaa     87360
     tagaatcgta aaatagaaat actctgaata tcacctatca atcaacaagt taagatcagc     87420
     gtttagcatt gatattctca gaggatcttg aataccgaag ccattattga ataagaattt     87480
     aggtcttgtt tctccatgaa ctttgaagcc cattaaatat aaaaactttg aacgtgtaga     87540
     tcctgctatt ggatcgtgcc tagcttataa acttcagata aatattattt gagaattata     87600
     aactaacagc caataaaatt gcaggtttaa aagtaagtct cacaatggat ttcagagtgt     87660
     aaacctaagg cttctaattt atatttacta gagtcttttt gacttcttta ttagtaaatt     87720
     atatagagtc tcccacttat tactgctttt cttgaaagtc taaatggccc taaaatatct     87780
     cacctaattt catctttctt tactcaaaag ctccgaatat ttttagagcc ttgttgttat     87840
     ctatcatctt tatgagatta gtcgactttg gttttagttg tagatattga gtaggttttg     87900
     tccatgcatg ctccaattat taagttgcac ccagaagagc agtttttccc catggatccg     87960
     ctcctcttta ttcagacttc tcgattccgt caccatagag gatttaatgt tatcgatgct     88020
     ggaatagatg aaggctttaa cactgaaacc cagacatggg ataagaacaa ctctaaagat     88080
     cccaagtatt tcaacgttcc agttgacttc ataaatagcc ttacacttca ttcagatgga     88140
     cgtaatcgcc gcccacgcga ctcgaacgct ggggacgact taaatgtctt tctccaaccc     88200
     gaaggaaagc cgacaggtca ttcgactccg accaataatg tacccgtgtt tctgttcgag     88260
     agtgctggcg gttcacatcg gttcttacag ttttggatct tctttggttt caatggttca     88320
     ttattgagtc accaagggga ttgggaagat ataactatca aagtcaatgg tgatgatcaa     88380
     gttgaaggag cctttctaag tgctcatggg gacagaccgt ttttcccaca gagcgagctg     88440
     atgatcgaaa atgatcgtgt agttgtattt tgctcacgcg aaacccatgc cttttatcct     88500
     gctcccggta cacatggtcc cataggccaa gataaaaccg cagcaggggg attttcttgg     88560
     gatactgctg gcaaagtcga agatttatct gtgcaaccct ggcgcgacta tgcaggtgct     88620
     tggggtgaag taggtgaatt ggtccatact acaggaccac taggcccttg gttcaagcga     88680
     tttgacgtgg aaatctgata cacctttttg ttaaaaagct agccttagac ttcaacagca     88740
     ggagttaagt acaaaaaact taaagactac atatcatatt tttcccataa acaacatctg     88800
     gattttcgag gattacctga tgaaaattgc ttttctatag aaaacacctt gaattgttct     88860
     aaagcagagt cataaaagca tccagagcca tgaaggaagc gagggccaga aatgttgcgg     88920
     tgaaaatgtt tattcggaat gatctgagtc aggctaatgc cacttccagt ggtttccacc     88980
     ttgtacaagt cagctctatc gtgatttccg agccttgtat cagatgacat cgcaataagc     89040
     caggctgtcc cactgcttac tggatcagtg aataaattta tattttggta agcaccagac     89100
     tcgttcggta cagaattgat aggtgtgaat acagaagaag tttgagcaga tagattttga     89160
     acggagacac cagcagtata aaaatctaac cgttccgcat cccaattcgc aaccacaagc     89220
     agagaaccac cctcaaagtc acaaagtccg caagctcctg ctgtgtcatt agctccagaa     89280
     cggtgaatgg tcaatggatc aatactgatg gggtttaaag aagtaggatc tgatggatta     89340
     tcaaaaattc tgtaaaactt gacttctgat ccgcccgttc tctcacctat tatctctaag     89400
     ccaaccacta gaatattgtc aacaatttgg agccccccac cgtgattaaa agtactagat     89460
     gttagaacca ctttctgaac atgaagggac tcatcggtaa agtacaaata cgattgactg     89520
     ttggcactgc ctgaaacaac ataccccccc tggggcagct tctgtattcc cccttgatgt     89580
     cgatctgaaa agaaggagaa atttgagatt gaaccattcg gtaacggatg ataaggagaa     89640
     ccatcacgat tagttgtcgt aataaaaagc tcaaaattcc ctgcattatc ctcatcggat     89700
     agtaatttat caaatgcgtc tttaatgctc ataatttttg ggttgatatt gaagtattga     89760
     caaatctcaa gtactttgat ggaacgatag agattcaatt tttgcggaaa aatataatga     89820
     agaatcacac ttctgaatac aaaatacgca agccatagtt ttgaattgat tgagatttga     89880
     gtgaaagcta ttgcagaaaa aaactttaag tcaggggaga aggacggtag gaagatactt     89940
     caatgttcag atttgagtga atcgtcacca agtcattaac agagatataa gtagagttag     90000
     tcctatcaaa tttcaccttc actccactat ctagatattc tttaggcatc atccaggcta     90060
     gatctgcttt tggaggtacc gtcaaagctt ccaaatttac agttggagca gcttgatgct     90120
     ggtcaaaggt cagggtaacg ggcgatgtcg tgaggttcct gaatgtaatt ctcggcaatg     90180
     tagttttggg cgttatagat tgaggtccta taccaggcga gaccagttgc ccttgcttca     90240
     tggcagcagc taattttcgg aattcttgct gatacgccat caaggtgtat gggccaaaca     90300
     aagtagatgc cccttcatag tgctgcccct ggtattcttc aaaggttgta atgtattgcg     90360
     agaaggcatt ggagtaggcg gccaaggcta aatagtccgc attcaattca gcctggaccg     90420
     ctgcctttaa acgacgtcca gccatggtgg tgatttcgcc aggaataccc gtcaagacca     90480
     aattaccaat tttaagaatt tgaatcggca attcttttgg agtaattggg aaaaaatccg     90540
     tttcagggtt ggctaaaccg ggagcgaagg caattggttt gggagcatgc ccatcaataa     90600
     aatctggagt cagcttgcta tcaaattgtc ctggcagttc agcaccgggc acttcaatcg     90660
     ctgcaattaa cccagaaaaa gctaggatac tggcttcgtc ttccgtgatt gaacggatgg     90720
     taatgccttc tctaatggga atgggtggct tactgtcttc gctactacct gcagcaaagg     90780
     agattcctaa agctgctggc caagttcgtt ttccaggccg atcttttatc tcaatatggg     90840
     acatatcgat aaaggtatgt cgatagtcaa tgctgccgtg tagttcttcc gttgcctgat     90900
     caaataaggt ttgagccagt tgatattgct gcccaccatg ttttttcatc cgctcgatat     90960
     catcagcacc cgtcggaata gaaccgaagg cgacattacc agatacatca ccacagttgg     91020
     cgttagcaaa agcggcaacg atgggttcat atgccttttc ttcaaatagc tctgcggcgt     91080
     atcctttgtt atcccccgtc actaaagtgt tgtattgtcc acgatctgta gggtgaatgg     91140
     cataccagtt cagtagacca aggggctttt cgtttgtatc agtcagatgc acaaatttca     91200
     gcagcaacat ctcattgtcc gtgtcgcttc catactgata aagttcagac tcagggtttc     91260
     gaaagtatgc ttcaggcgag cgttgccttc cacaatcttc gatatgcccc cgattaacgt     91320
     aaattttacc gggggcgagt tgattatgag cttgctcaat ggctgagaca atcccagcga     91380
     caatagattc aaaattatgt cgatcaaacc cacccgtttt attcggtcca cccagagtat     91440
     ggttgtacag ataatagtgg gtatatccgc caggaccact atgggtgtgg gtgccactaa     91500
     ttaggaggtt atctaactgg tagagttcag gaccgtatat tttttggagg cgttcaacaa     91560
     cctcttgttt gacgatatgc gtaccagacc agagatcagt ggatacaatt gcgactcgtt     91620
     tgaaggacac tggttcagcc acaataaaaa cctttgcaaa caaccgagat tcaactcccg     91680
     ttgtgcgctg gttcttatcc gccatgccct gcatacctaa accaatagca ggatctgtta     91740
     tgtcactttt accgactcca ataagatagt tagaaatagg ctggctagct acttcaggtt     91800
     gataactatg accactgagt tgatttagaa ggactgagcc catcgccata ctggcagtgc     91860
     tcagaaagtt gcgtctagag atgtttgttt tcaacgtcat tggttgcatc acttagattg     91920
     atgtaccaga taattccact agataggtat tgctcaactc aataaaagtg agacaaagtt     91980
     tagcaatact ttttggaatt aagtatcagt ttttagttca aataattgta attaactcat     92040
     agaaatttct aaagattgcc attattagct aaaaactatt attgccatca ttatttttgg     92100
     agttaaataa catagttcaa ttgccaatag agatcggcta gacttaactg aatcaccttg     92160
     agttctacct tcgttattac ttctgaaaga cggccattat ttattcatta cttaatattt     92220
     ctttattttt atgtagctaa gaatatattc gaatggcttt tatctagtag tttcagctac     92280
     aagagaattt taaaaaaatt gcatgccaat actaggttgg tgaatgacgg tcaactaagc     92340
     atttgcgtgc gtctttggac gggctattgc atcggtgaag actgtcagct gcgtactagt     92400
     gatgttgaca aggccccata ctctcggtgt tattttctgg caccaaacta agagcaagcg     92460
     agatacgcga gaagtgctga tacatttcca tttaggggtt tttggtataa cttctcagaa     92520
     aagtgtattc caacttcaaa cctttttatc tcattttcag aaattatttt tataggcttg     92580
     aaaagactct aacttaattt gatcaaagat ttattgaaca agagtttcaa tttctcagaa     92640
     cttctaggtt tctgcaccca aaagagagta ttttctgttg gcacaggaga tcaaaaatag     92700
     gtatgcatct gaaaaagctt gcaacaaaag aatatagccc tatcccaata ctactgctcg     92760
     atcaagacct caattattcg tgtctggact tgccttcacc tcactatcaa tcgaatcaat     92820
     tgcaaggaaa gcagttgatt cgtccgtttc tccgactcga tcaacaagca ggatgatggt     92880
     ggtctgtaat gattgccctg caggaaccag agttgaaata tgaacaatga agtcgtcgaa     92940
     ttcgcccact cgttcagagt cttttaatcc gtcttcagca gcagcctgct cagcttgctt     93000
     tcgagtagga aagtctttac tcacagcaca attttttgcg tcttcaattg ccttgactag     93060
     atcaacaact gctgtctgag aaccagagtg aacgatcatc gctgcactgg cattaccctc     93120
     tcttgcaaca aagcctcgaa aatcttgctc cacgaggcta tcttcggtac tctcaatttc     93180
     tcggacataa gtgaacgttc ttgtctctac atctggtact gatggattgc ccactccagt     93240
     ttcaatcgat aaattatcaa agatcatggt tgaagcttga ctatcctcgc ttgtgacagc     93300
     cacaaacctt attgtgtcag tcgggatact cttcttgaat tttgggccat caagtacctg     93360
     ttgcatgctg atagtctcct aaagaacgac ttttataaaa ccaacgataa aaaacatttt     93420
     gtctattgct attctccaac caaaaagcca tgattaaata ggcgagaaca ctcatcggca     93480
     gtggtccctt aaaaggctct agatttccgt agcccctatt ctataaacat ttgagacttc     93540
     caactccatt tattctgaag tttataacct agaaaggttt tgaactttta gatcctgcta     93600
     agagaccagc gccaacacct ccaaatataa ctagacccgt agtctggcgg ggagactagt     93660
     agcaatataa aagtaatgaa tcaggataaa aatgctattt tgtgttgtct taaattgttg     93720
     agtttagtga agaatgtgag caatgtactt cgacaggaat aagtgtcaag cacttttttc     93780
     aagtattcag atgagatgaa tttcgttgtg aacactctgc accaaggcac ttgggctgtc     93840
     cgactctgaa tttagctggc ttgaccgacc acatagcaat gctctagcgg aatcttctta     93900
     atcgccgctt tctgccgtat atctctttct gctttctttc gaacagcaat cctagcccta     93960
     gcagctttag cccgcattgc cttggcatcg ctgttgtagt tcttctgaat ttcttcagta     94020
     tttcgagagg ggggatggcg tattgatttt gatcggtcaa agggaagtta gtgtcccgat     94080
     ttattcgcca tggttattga gacgatcatg cttggcatga tctctgcgtg agacgaggaa     94140
     gaaaatcgct aaacagctct cctcattggg gaaagcacca atctcatcag ctttggttcg     94200
     gaattctcgg aacaaccgtt ctagcgcatt ggaagtacga atcagcgaat gaatggattc     94260
     atcaaaatca tagaaactca aggtcagggc aaaatctttg gtaaaggttc tgaccgcatc     94320
     gggttcaagg cccaattgaa gggttgctga caccagatac aacgaaggct agaggctata     94380
     cagagaaagg attctaaggc ttgatatttc tcaatattct ttagctttta gtaatgattt     94440
     agtttctggt cgaacgtatt tgcgtcgttt caggccccta aaagtgcttg attgcacctg     94500
     gtgtcagcaa cccttcaatt gggccttttc gggcctttcc cccatactca atgtcagtag     94560
     tatccctacg agtattgatt attatgtcaa tgttcttggc tttcaaaaag attgggactg     94620
     gggcgatcca ccgacttttg catctgtttc cagagatgac gtttgcatct ttttatgtca     94680
     gggggcacaa gggcagtctg gaacatggat atcaataagt acctatccaa aatcaattac     94740
     ataatctttt ccgaagccct taaggatttt gtcgatgtac agactcaggc tgcctaaaca     94800
     cttgtaggca gcaaattcaa tccactcata tttcataaaa cgccagaaaa tctcaatcaa     94860
     attcagatgc ggtgaatagg taggtagcca gaaaatttcg acattcttgg ctttccagtc     94920
     ctcaattttt tcttcaattt cagcgttttt atggacgctg gcttgatcca tcaccacaac     94980
     cgtgtgttga tcacaggtcc tactaaaatc atcgatacag gccaccacca cagcactggt     95040
     aatactcttg tcaaacacat aggaagtgag gtcattgtgc cgattcatca accccaacac     95100
     gttgaatcga ctgctgcgtt gactgggaag tcctagtgtt tcccctttct cctgccaagc     95160
     ataggggaca tacggcacta agcaaaaccc gctttcatcg agatatctca ggtccagctc     95220
     acctttttcc tcttggcgct tcaagacctc taactgatga cgtttggttt catactccac     95280
     tgggtctggc tggcctgcaa cgacccgcct gagacgacgc cagctcatgg aacatgattt     95340
     gaggatgcgc ttgagggtgg ttttgctcac cgctatgttc caggcttctt tgatcttggc     95400
     caacacagca ttgaggttat gcggagtcat ttttgcccac gctcggattt gctccttctg     95460
     cacgtcattc aacttaggtt tacggccccg gcctggctga tcatacagac ccactaagca     95520
     gtggttgtcc caatcatcta accaggtata aaccgttttt cgggtgacgg caaagatgct     95580
     cattaactct gtgacattga acccttcaaa actcaacaga atgcaatggg cacgttgacg     95640
     gacttggtgg tgataactat ggcgatgaat ccggctgagt aaatggatgg tctctgggct     95700
     caatccctga ataaaacgtt gtttcattgg gctacaagct attcgctatc aactgaactg     95760
     aaaccactta ttatgatgta aatatttctg gctatctact tattcgtggc tgatgttgat     95820
     gcgttgttca ctgagttcaa agcgaaagga gccaggattc ggcaagcacc tactaatttc     95880
     tcttggggaa tgcgagaaat gaatattgaa gatcctgatg ggcatcgatt gcggatggga     95940
     gctgcaacga atgagcccag tgatggagtg ccattatgtg aggattgata tggggggatt     96000
     gcgggaaatt caaagcaatc ttttccgtac agcctgtgcc gtggcaccgt attgctctgc     96060
     gatctcttga tagtcaaatc gtcaagtcat tgatcagaat ctgcaagtct ggtttaaatt     96120
     ttgtggggga ggttctgtgt aaccggagtt ttttacagcg attgaactgc agaaatgatt     96180
     ctaattcctt gcgtagagca aggaacaact cctcgacttt taagacaatc ggttccagta     96240
     cgagatgatg aatatgcagc agcgatttac ttctctcagt actgcagtcc attcgagcga     96300
     ccagttttcc atcccacaaa atggggaggc agaagtagcc gtattggcgt ttggcctcag     96360
     gcacatagca ctcaattaag taatcaaaat caaacagcgc tttgaggcgc ttacgctgaa     96420
     tgacaagatt gtcaaatggt gagagtattt tcagtttgct gcgggctaaa ggtttactga     96480
     gcaactccag tgaatttggc aaggcatagt agagacgatc accgacatga atctgcaata     96540
     gctcaccgga agaaaccatg tccttcaatg tcatatcaat aagcggcttg gtacccttca     96600
     gcaaataggc aatttcagca gactggccta acccgtttgc gcgcaaatat cgcgtaatca     96660
     aaaatcgagc gtattcctct ggagctggta gggtgatatc tgtcccttca ggcaataccc     96720
     gctcggtgag atcataaact ttttgaaaat tgacacggta aggaatcatg agatccccct     96780
     gcataaacag atattgcagg gcgcgcttgg caggcttggt tttccatgca ccgatccttg     96840
     taccagtatg ctcaaaatct ttagccatca aagggccttc agtggcaatg cgtttgagca     96900
     cccatttcaa catctgctca tcacgtttat accagtggct tagttcacca cttgccagcg     96960
     catacttgcg aggcagactg aagcggtagt cccgaaaggg caggtaggcg gctgcatgtg     97020
     accagtactc aaaaacctgt ttgtcagaaa gcagctgatc gagctgggaa gccttgtaac     97080
     gaggattgcg attccacagg gtatggtgat gggcacgttg aacaacggag atggtatcaa     97140
     tttggatata gccaaggtgc tcaatcgccg atagggtcgc ttcaatggca cgaccagatt     97200
     gctttctcgg aggtaatctt tgtgagagca ggaccagttt tctggcttgt tgaatggaca     97260
     gggattcttt catagcctag taatcaccag catccctcgc ctaagtcttc cataaatctc     97320
     atccatgttc gacctcagca gcttcagttt ccccacccct catctttctt tcacagatga     97380
     ctctgaatag tcgtctcagg gcaaagatcc actatcagga tgccagtctt ctaaaattct     97440
     cgacctggct aaagattcgc tccatagcat agtggactgc atccaaaaac tggtggtaat     97500
     agcgaacaca ctgttgcaga ttggtgaatt tacccctcat taaacggact cgagtggaca     97560
     cacacaagcg tcgcttctgg cacctgctcc tcagcctata gcttcaggct ctccctagcc     97620
     taattagggc ttgctggcgt ttatttatca atggacctgt tttggtcgct aaggtgttca     97680
     gattactgaa cggtacttag gtagcatctg cttcttccag gtgagtctct tcaatttcta     97740
     tggcattgtt agcattaacg tccgcttcac ctcctaggtc aagcttttga cgcacctgct     97800
     gttctacatc ttgagcaaac tctgggttat ccaaaaaata ttgaatcgta ttctcccgac     97860
     cctggcctat attgctaccg tcatagctat accaagcccc tttgcggaca atgatatctt     97920
     tctcttccgc catatcgacc aggcaaccca tggttgagat tccctggcca aaaaggatgt     97980
     caaactcggc tatccggaaa ggaggtgcaa ccttgttctt ggcaactttg accttcgctc     98040
     ggatgccata catatcggtc cctttcttca aggtctggat ccgacgaata tccagacgaa     98100
     ccgatgcata gaatttgagg gcgttacctc ccgtggtcac ctcagggtta ccataggtga     98160
     ccccaatctt ttggcgaagc tgattcagga aaataacggt gctgccagac ttagcaatat     98220
     tgctcgttat cttgcgtagg gcttgactca tcaaccgagc ctgcaaaccc atatgagaat     98280
     ctcccatgtc tccctcaatt tcagctctgg gagtgagagc agccacggaa tcaaccacca     98340
     ctagatccac cgcactggat cggactaact gatccacaat ttctaaagcc atttcaccag     98400
     agtcaggctg acttacgagt agctcagata catctacacc taatgctgct gcatacactg     98460
     gatcaagagc atgttcagca tccacaaagg cagcgacgcc cccagttttt tggatctggg     98520
     agatcgcatg gagggctaca gttgttttac cggaactctc agggccatag atttcaatca     98580
     cccgtcccct aggaagtcca cctcctaagg ctaggtccag ggtcaatgca ccactagaga     98640
     tggtctcgac ctgcatccga gtggcatccc ctagtcgcat gatggcccct ttcccaaacg     98700
     tcttctcaac gttcttcatc accaagtcga gggctttttg cttctcgttc atttcatttt     98760
     tggcactcat gagtgaatct ccaaaggggt gaattggggg gatgctagac caatatagta     98820
     attctgtact aaaatggtgt caataagata cttttgttca tgttttacct ccacatggtg     98880
     aggttgtaat ggcaacagat acacttgctg aattggttgg attccctggt gggtggctcg     98940
     taggcgtctc tcttgatttg gagtggggct atcaatgttg ggtgatcaca ccagaaagac     99000
     aggttcacac tgatggagaa ttctacgaga acaacgttat agcgttgtca gcaggccgct     99060
     tcctggtgga acattccttg gaagtggaat agggctattg atcagcaagc tgcaaccaag     99120
     gattcatctt ggatcagggt cacctgaagt tgctctacta ctggccttgc agctctgtgc     99180
     tttgccgtct ttttactaga ggcaatacca ctaccagtaa taacttcgtt atcaaccttg     99240
     agccgacatt cacagtgata gccttgttca tgctccacaa tctcaaactc tgcctgtggc     99300
     cactgaaagc cttggcatat ctccatgagc agactcagac aattgtgccc ttcctggtac     99360
     tgcctcaatt tatggatcac gggtggaggc ttaggtgcag acggttgagg aatcggaggt     99420
     gcttctctat gctctggagg aactaaagaa ctttcaaact tagccttaag ccaagctaaa     99480
     caagcctgat gttttgcacc cgttttattc atagagatcc ccggtttagc cgttgtccat     99540
     agctgttcgc caatgagaat ctctatccat gttacgaaag gcggttcgtg gctgacttca     99600
     acataagcag aactgtgcca agcttctgtt tgattgaggg caatactgac aatgctggca     99660
     gcatcataga gatggtcttc caggtactcc aagacctgct cttgtaactg cagctcatcc     99720
     cctaacaaaa gcaagacaaa taaatcttcc acggtgacat tgccggactg taatcgagtt     99780
     tcagtctcag ctttaaggtt ttctccttgt tgatcttcta gggcaaatct gagcaggagg     99840
     gagaactctc gtgggggcag ctgggcaatt atttccgggg attgcagctg agcttcgtag     99900
     agttgtcgct gctgggcttt gtaaaaggtt ttatgggcct cctcctgggc ttgaatcgtt     99960
     gcttcaacat gttgggaaag cgcttgtatg tcttctatgg aatagggata ggattgcccc    100020
     ttcaggtgag ctttgaccat gcgatggttg attaagtctg gatatcgacg aatcggggaa    100080
     gtgaagtggc aataggcaga tagatttagg gcaaaatgcc catggggttc agggccatac    100140
     tcagccggat ttagccaact catcaggacg cgacgaatat cctcttcaga ttgagcattg    100200
     acgagagctg caaactgatg ggtttgttca gggccaatgg ctcgatgggt gtgattgcga    100260
     taaatggcgg ggatgttgtt ctgggctaac cattgagcca tggctgtatt tgccagaatc    100320
     ataaactctt gaataatcag atagctctga tagcgtgtga agtccgtgga gaggagattc    100380
     ccgttttcat ccaggtaata cccttcaggt agagtgagtc catcaaaatt ctcggattgg    100440
     attcgtcttt gatagagctg ttctgcccat tgccaacacc gatagataaa gttggagtcc    100500
     ggtcggctga tatccatgag ggcttcatcc gcttgttcat aagtgaagcg tttatggcta    100560
     ctcaaccggg attcataaac gtcaacatgc tgaatctcag cggattgatt cagggtgatc    100620
     tctagggtaa tcgtgggtct aagttgatgt tctaggagac tgagcttatc ttcagacaaa    100680
     caccggggca gcattggagt gttgttatga cgaaaatata aggtttggat gcgcgacttt    100740
     gcttcttgat cgacgaggct tccgggttgc acgagttcgg caacatcagc aatatgaacg    100800
     gaaagggttg tgagatgatc tttctcttca atccagatgg catcatccag gtctcgggag    100860
     tgggctccat caatggtgat ccctgggact tggggtcgtt gattgatgga ggtgggtagg    100920
     gaaattgtct ctgcttcttc aataacgggt ttagagaaga attgtcgagg catcttggct    100980
     gagggatagg agcttcagta cacgattagg ggttgagaac gaaaagaaga ttagtctggc    101040
     tttgcatctc tgaagggtgc cccccaatgc ttccgtgatt ctctgttgaa agggggtttc    101100
     catttttgga tgagggcttg ctctagctgt tgccggggat gatagtctgc aggtgcttct    101160
     ctccaaaaac taatggtgac tcgcacgggt aatttgtgga ttcggtgggc tgccacgtaa    101220
     ttatgcaggt agtctttaca atcatgaacg cctttccatc gctggttgga ttttgaggtt    101280
     tcacctacgt ataacagcaa tggcaattct tgatcaatga caaagtatag ggctgcaatg    101340
     ccttcatcaa aggtgtctcg ccaaaattcg gtgttttgtt gcttgaggct aaagggatcg    101400
     atgctggctg gatctgttga gggttgggct aaatcaaaaa gtgacccttg ctgagttggg    101460
     gcagattcat tgacttgagt ttggtatctg aagatccgag ctttccattc tttgagggct    101520
     gtatcactca tttgtagaat gggggggctg gaactagaaa accggatatc tcggagttct    101580
     aggtcattga agagtgagga ttgctcagcc ataactggat tatttcaatt ttgtggatta    101640
     gcttagcgca actcagcaaa ctccagttga tttgactaag ttagggagag gatagagatt    101700
     atgggaaaaa agtttgagct gaaggtggcg gctaacaacc aatttcattt caatttgaaa    101760
     gcaggcaacg gccaagtcat tctcacaagt gagatgtata ccactaaagc ggcggccctc    101820
     aagggcatca actcagtcca gacaaatgcc cctcatgaca atctgtatga tcggcgggaa    101880
     tccaagaggc aagaacccta ttttgtcctc aaagccacca atggacagat tattggtaac    101940
     agtgagatgt actcttccac ttcagcaatg gaaaatggta tctcatctgt aaagaccaat    102000
     gcgcctgggg cacccgtcga ggatttgacg gtagataatt aggtttccat gtctaatcgt    102060
     tgccaacaat gcgatcgctt tagcggatac cttggctccc agtatttagt ctgcgccatc    102120
     catccaagtg gccccaatca aactccttgc ccagacttta cagaagtgat tgaggactgg    102180
     caaccgctgg gggcattcta tgagggtgat cagttaataa tagattgggc gggttatctc    102240
     acctcatcgg agcggctaga ggtactagtg tcgcacccgt acttctcagg tatctgtcca    102300
     aagtgcggtg caaggtttgg ggatagcaga cccatccact acgattgcag ggaatgtggt    102360
     tggattgatg attcgatcaa ctgagacaaa taactaaccc cagcttttac ctttgactat    102420
     tctaaacagt agctaatgaa ctggattatt ctgttaattt gcgtgattgt attcatcgtt    102480
     tactggagta aacggaggca aagccgaggc aacctcggca aggtcattga ctacagtaaa    102540
     ggaaatcagg gtgtgcgaag ggagcaatgg cagaactact cttcaagcga agcaaagctg    102600
     attcagagga ttggccatga agctacagag cgtctgatcg tcagcgtact tctggataat    102660
     ccaaccaaat cgagagcctg gtgtatggac aaagccttac gtgacctgga acgagatcaa    102720
     ggtctgtaag acaatggcaa ccccaagaca gctactctgt attctttttc ccatagcagt    102780
     gttgggatgc agccctcccc ccagcaacac gacccatgaa attacttcag cgaacaccgc    102840
     tcctgtcaaa gttctcagca cgagcgacgg ggatacttta aaggtgcaat ttcaaaacgg    102900
     taaatcgagt aaagtccgta ttggctgcat tgacgctcct gagtattcac aagaatatgg    102960
     cttagaagca ggcctacgac tcaaggcatt gattccaacc ggagcaacta tcaagcttcg    103020
     gaaaatcacc actgaccagt atgaccgcac agtggcagag atttactcgg aggagaaatc    103080
     agtggggtta cagctagtga gggaaggata tgcggtagtg tatcaccgct accttgatgg    103140
     ttgttccgat acagcaaatc agtatgttga cgcagagaat gatgcgcgat cacgaaagct    103200
     caatttctgg agccagagtg atccggttat gccgtgggat tatcgcagga atcggcgata    103260
     atattggacc gagggttaag gtttaataca tctgatctac tatggactta tgcgctaaca    103320
     cacgcccatg tcctattccc tgtcagccac caagctcaaa acctacggac agtgcccaaa    103380
     atcctatcaa tttaggtatg agcataaatt accttcacca accatattcg gctccaccaa    103440
     gcttggcaat gctctccatg cagcgttagc caatgtctac aaggattgga actacgctta    103500
     ccctcttcct tccctggact ggtttgctgt ttgttggcag caccatacca gtgaattgac    103560
     tccgacgcag atccatgagg ggtgggcagc attgcagctt tactacgagc ggtacattgc    103620
     cccacttcct caaatccgta aaccgctggg gatagagaca aaagtcaggg caaccctcca    103680
     agtccgcaac atcgaattta ccctgtctgg tcggtatgac cgcttggatt atattgatga    103740
     tggtctggaa ttgattgatt acaagaccag taaatccgtc aatcctcctc catccgtgga    103800
     tatccaattg ggtttttatt atctgatact ggaacagatc tacaagaaag cgctcaaacg    103860
     tctgagtcta atctacttgc gttctaatga gaaactgatc tatgaggtca cacctgacca    103920
     tcaccagcaa gcccaatctc tgattgaaga tatggcgatg aagctcagat gtgatcagga    103980
     atggaaaccc gtggcgggac agcattgcga tcgctgcggg tatcagaaat attgccccgc    104040
     gaaaaatact agaccagaac cgctaccgca agatgctaag gaagttacgc aagtgcagtt    104100
     ggctttgggg ttttgattga aactattcaa ggagaattag gagccagcat cagaacctga    104160
     aaaagcgact caggcaaggg tggcatctct atcgcctctc cttgatagtg gatctgagag    104220
     aacgaggcga gattgaatac accatgagga acatccagtt tgttgtctct aatccacatt    104280
     cctagccgat aatctacgcg ccatccctcc agaccttcca ttaagtcgat ccaaaagtgc    104340
     aagggaatca actgagtatc cacccggcaa gaccctcgat aaacttggtg gggaatgttg    104400
     tgccgaaaga gttgagtatg acatagacgg gtcataccat cacactcagt aggagaggca    104460
     tctaatgggt ttaatagttg gcgtagttcg tcaattgtca tatcaagaaa gctaaggtta    104520
     gtcagttgga gcttacgatc tcagaaattc ctgattcgct aaccacaaag cttcatctgt    104580
     cggctgatcg atcatcccta gtgccgcaaa gacgcgcagt tggatatccc gtccgcctcg    104640
     acaagctagt tccgggttgg tgtggcagat atgctgtttt ccgctacaca gatactcagt    104700
     gatttctgtc gttcgatcat cgccaaggac taagcctcca tcctctggag atcggaagat    104760
     gcagcttttg cactgagcgg ggttgggttc aaggaaatgg cttctcatga tttttcggat    104820
     agttcattta atgcttttat aaaatcatca agattgtatt tattctgctg ttagaaaaag    104880
     aaaatattgc tgatagggaa aaatgctcta tcttcattgt tacagcacaa cataaaccca    104940
     taattaagtt catcaattcc ataagataga gtaaagctat tcccattatc cttaaaagat    105000
     acactggcaa aatcaaaggg attaaacctt aaactaaaga atgttgcgtc gataatctcg    105060
     aaaaggctta caccgaaagt atcaataaat cttatgcata gtctttcttg agatggtgtc    105120
     agcggtttat gactaacttt aatctttcca ggtttattca tttacataat ggtgatagtg    105180
     ggccaaacca atattcaggt gtccctggct gcatagacct tgggctagta aacagtaatg    105240
     ggcagttact atcatcggct ttcgaactac ttgaacttga taggaccaaa gcagttcatc    105300
     caaaggtaat tagacccacg aaaatcatac aaatattgcc aaatatattc cttaccctat    105360
     gattcgtttg agcctctttg actgttaggt ttaattttcg gattttctta gtcatgatta    105420
     gtcattttta agatgattaa cagattcccg gtagaaactg aagttaattt tcctgtcgct    105480
     gaagctctgc cacattatcc atggcctttc gtgcgatcag cctccaatcc gtccgatcat    105540
     cccaccgctg aaaaattctc tgattcccca accagactgc acaaaaaaga actttgtcat    105600
     catcagcggg aacagcctca atggtgatcc gctgtttgag ttggtctgga gtcatacttg    105660
     agatcgcaat caggaacccc ttcgcaaaag tcgaatcata gcccgcctcc aaagtacagg    105720
     gacgatgggc caacatcttg aaccgcagct tatatgaagt ctttcctctg tattccttgg    105780
     gaacgaactc gatactgatc aggtaacctg tcaaagcagg ttgctgtagc tcaacaggtt    105840
     cagagtcttt atcgaggata taccaagtgc ttgttttgga acgattacag aatatagcca    105900
     aagccgatgg actatcacca aatcccagtg ccctttcatg gctaggatct tgggattgga    105960
     attgatattg ctgtgataag ggttgcaata cagctttggg ctgtgttgat ggggttactt    106020
     tgtttgtgtt tgtgtttgtg ttcatttttc aggttccata gggattttga taactctgtg    106080
     catttgttca gcgagactcc agcagtgatc gcaaatttca gggtagtcat catcagcacc    106140
     tttacaccag ggctgaagat agccacagca ctgacactcg tagtactgcc caggttcaca    106200
     tccagagcaa aaggacgggc tgtgattact caggcacccc aatggcttta gttgcaagac    106260
     acctcggcct ctttgaatga agttccacat tgctctatcc attggtcaaa tcctccaact    106320
     tcatctgccc aaaccattcc tgcttggtgt aagcattggc ttttcggaac ggcgcatcaa    106380
     atttcaaatg gcagggcgca cagagggcct tgagattgtc tgggtgattg ttctggggat    106440
     cttggtcaag gtgcgccact gtgagagtga atcgctgagg cttctgttcc tccccctctg    106500
     aagtgatcgg gaaccattca gggtgggtaa tcatcagcca gaaagcgaag tgtaaccact    106560
     caacccccgg ttttcgacag ggtttgccgc actcagtaca acgccagttg gcgtcttctt    106620
     tgacttgcaa cgcaatctcg tcccagttat cggggtatcg tgcccgaatc atcggcatta    106680
     cagaacctcc aatgtttgct gctctggggc tggatacttc cattcgagat aggacttaat    106740
     gcaacgccct ggatcatggt ctgaggtgac gaagatggtg aggtctgtct tactgcccaa    106800
     ctcttcgaga caggccaaga tttcatctcg actaaaacct ttgtatcgag tgctaatcaa    106860
     cacaccacac tgtttagcaa tgcgctttgc agctctcaca ggctctttct cgcacagcac    106920
     cacttcatga agccattccc gataggcgtt gtaacaaggt tcggcatcct tttctgggtg    106980
     gaagggatga aaggggctga ctagggggga ctgggcaatc ctgaaaccgg gctgggattg    107040
     gtttgtacga gttgattgag tgatagtgat attcatggcg attcctccaa atctgtagcg    107100
     gttggggatt agcaagcaat aacggtcatg ttctcggcca tctcatgagc aagagcgacc    107160
     ctcaaacgtt gctcatccgt gagtcctgca ttgaatgctt ctaagacagc ctcagcggct    107220
     tccatcctgc gagagtaggg gccgaagaac tgatgtctga gagtggtgcc gacgtaattg    107280
     gattgacgct cgacaaaatt gatgtagaca tacccgatca accgactgcc atagaaaaca    107340
     ttgagcttgc ggtcattatc agcagtgggt ctagtgtgga gttcatagga aggtagatca    107400
     atgccatcaa taacttgttg gggaagagtt gtatgattca ttttgaataa cctcgttgaa    107460
     tggttcgttc aataaaaggc atcgtttgac ttgtcccgag cttggcgatg ccttttactg    107520
     ttctgaaacg aatggcacct cgtcataacc gccatgggtc agtgcctcca gcatcaacgc    107580
     cgcttccata tgtttgaggg catcgatatg tcgccgctcc gacctcagcg tcgtcgcctc    107640
     ggccattaga taggcgacac aatcacggaa gcactgggct ttctgtcggt caaaaggaat    107700
     ccgctcaatc tctggttcta gctggggcca gaccgctgga ttaaacagtt tctgggcacc    107760
     actgagtaat aattcctggg attgcatcag gttcttagcc gtcgctaccg tcatgactgc    107820
     tacaggagaa taggccaagt taaccgtagg cgggttgagc agaaattctg ccaagttaag    107880
     gtgatgagct tgcatgggat ttctccaaga agaaataggg atgaggaaag gccagccctg    107940
     atggttgggg ggatatcgcc acagggctga cccaggtaca gacaggggga gagggttaag    108000
     ctgctttgct aacctgctca agcaaatggt tgtgtgccca gtcccaccaa gagcgacgtt    108060
     cccagttaat ggctttgatg tcttggcctt ttgcttcgtt gtagaggggc acaatcacag    108120
     cgtcgaggtc ttcaaccgcc ccaggagaaa cccccgagag ttcatacacg gtatcggcca    108180
     gagattccag ttcagttcgc ttaatggcaa gttgcttaaa gaaggtctcc cagctattga    108240
     tgcgagtgac cgtgagttga tccatcagtt cgtttagggc aacgatcatc aaaatgtctt    108300
     ggcctgctac ctgcttaagc actttgaata cagcctcttt taggggagag catttggcct    108360
     tattggtttt tcgctgttct agtcccgtcg cttccagggt tagcaatccg aagagttcaa    108420
     ggacatgatc ccggtttcgc agattgcgat tgccatggtg taattcccag gcaaacttag    108480
     ccagcttgtc ttgtcctgtg gggtcatcag gtttgtactg tttgacgatg tattttttga    108540
     tgttgacctt ctcaggctta gcaggatcga tatgctcttt gatggccttg gttagagcgt    108600
     tgcgagtggc gttgttgtct agagtggcgg tcatgatttt ctccaaaaag tgaatgaggt    108660
     ttgagtggtt ataagaaacg taggcagatt gatcctcagc agcaaatgaa gtcctgatca    108720
     tcagcttcaa catctgagcg cacggagttc agcagctcca cggggtaaga gggcttgggt    108780
     tcgggctggg ttggtagagc ggctagggct gtatatctca aagaaaaaaa gatatctctg    108840
     ggggtggaat gttggaaggt gtggacatag gggttaagtg acaaccaaag atccaaagct    108900
     tggtcatcgg tcaaatcttt gctacctagc accaggcggt tgagaattgc cgtctgctgg    108960
     tcatggagtt caatcgttgt ggtgaactga acttgtggaa tgagcttgta tcttgttttg    109020
     ggtttcattg gtttttcccc gtagcgaatg gaatgaagaa ggacaagaac atggcgaagt    109080
     agatggattg ccagagcaaa aaccaaatga gggtgtaacc gttcatcgtt gccccctaag    109140
     ttttcaaaat ctctatggaa tctgaactgc ttggatgatt agtggctcac ccaggccagg    109200
     gagattaatg ctcagacggc agcagcacaa cgccgtattc cgcatacagc ttgatttctg    109260
     gcaggacgaa atcagtgaaa ggaatatctt gggtaatgac agggctgcaa gtactggggc    109320
     tgtcttcgta gcaggctaag acagcgctat ggtcgtcgtt tacggtcagc aaccaaagct    109380
     ggaattcttg gaggttggga ttgcacttga tgagtcgcac ccgttgataa cttgcgatct    109440
     cgtcgaggag ccagaaacat tcccctttct ctgcgagtgt tttgacgcct tctgtgtatc    109500
     ggatgcccag ccaatgctga tagtgagatt cactgcaatg acaatgagca agttcagcct    109560
     gaagctctga agctgtgatc atggtattta gcccctgtgt agcgagtggg tatgtgtggt    109620
     gtgggagggg caaaggtgcc ccaggatact tctagaattc ttcgttttcg gcttcaatct    109680
     ggcgagtggt ggggatggtg cgccaatcag ctagccagtg gtcatcacca aagaaagtct    109740
     tgacccagct ctctaggcga ggctggatca gacctggctt agacttgacg ggtgcataga    109800
     cttcaaataa atcgccaccc tcacgtacac cggggtattt ttcaatctgc atctcgactg    109860
     caatcacttc aggatgaagg ggatcagtga cttgagagtc aacaagctga agcagttcag    109920
     tgacggtggt gggtgcttcg gttaaagttg tcatagttat tgcctttgat tgggttttaa    109980
     ctagggcatc cgagaactta ccaggcgacc ggatgccttt gtttgtatgt aataactata    110040
     tcacactgag tgtgtaaaat tacacactaa ataaaactat agacttattg cgtgtgtata    110100
     aaaagtacac tatgatgcaa gttgtctagc actaatgcat catagatgtg tggtgttgga    110160
     atagttgcta tgacgaataa atcacgaatg acgcgaatta acatcactgt cccggaagat    110220
     ttacttgaag agttcaaaga atactgtgac tcgcaagtaa gatctgtttc ttctcaaatt    110280
     cagtttttta tgaaacaggc agttgagtct aatcagaaac agaaagggaa tgaaagttct    110340
     tgatgctgct gaataatcaa taaaagcaac tattaccaag tggtgagata aatgaccaac    110400
     agcaaccccc aacgatggac cgatgatcgg cttgatgccc tcgctgcctc tacccaaagc    110460
     ttgctagaag caacacaggc taatactaaa gctatcgggg aaaattctga actcatgcag    110520
     aaagtgattg aaggtcagct agccatgcag actttacatg gtcaattggc agagcagact    110580
     ttgcagctga agcgggctgt tgactacttg ctgagcaaag atggagggca atcatgatca    110640
     atggaatctg aagagattat catccgctac taccgcaatc ctattcctgt aatggtcgat    110700
     cctggtcaga atcatccacg acatgagcat gatttattac taggttggat ttgtcagggt    110760
     aaggatagaa gccctgtact caagaacttc ccaaatgctg aaatagttgc taaggctaag    110820
     tctgagtctg aggctaagcc ttatctaacc ctagtaaagc aatagtcttc tttatcctgt    110880
     ctttccccgg tgcccactta tccccggcag taatcctcaa cacttccccc caagccttaa    110940
     gctgatttgc cctcgatagc ttcaccaatg gccgagccgc actctcagac tgaggcagca    111000
     cactaaaatg ctcctgcaag aacaatacga gttcagcagc ttgaatacag cgaaaagcat    111060
     ggatgtaagt aactccaaga ttctcttcca catagacctt gaatcccttg gagtctggta    111120
     aatacaactt gttgtcttga atgaccttta atgccaaccc agaagacaac agagcatcag    111180
     atccagtttc agtaggttcc aaaaatattt cttccagatc agccaaactc ttatcctgaa    111240
     aatcgcgtaa atccatcgca cccagagttt taaggtttca aagccaggtg aattatagca    111300
     agccctcctt tgtccgaaat ctttactagg caatatacaa tccatagaga aagtgagttt    111360
     ttctcatgac taaattaatc agtaaattag tctcagccaa gacctcagac cccaaaggcg    111420
     actcatcggc taaggccaaa attgataccg ctccgcaact ctcagttgaa gatatctggg    111480
     ataccctggc agaccgtgac ctgtatcgac tctcaatcga aattgattca ggcttaagac    111540
     tctcagcccg tctagatgcc gaagatttgg gcttagatcc tcatgtcgtt gatgaactag    111600
     cgggaggcta ccgcaaagcc ttctcagagg cattcacaaa ggctcgaaat cagctctctg    111660
     gcctacagaa aaagttcaat aagaaattca ccatctacgt gaagcccttc cgatttatag    111720
     atggcagcat catcaatgac gccgttgact ttgcgcagga aatcaagaat gaagcggcat    111780
     ccttacgcca aggcttagtg gatacctaca cagatcagct cgaaaccttc ttagtggagc    111840
     tggagcagaa actcaatgaa acaatacccg gaaaaaagaa gcagattgaa aaagccctga    111900
     tttactatgc tggagaattc cccagtattg acgatttttc aggtagcctc caggtgatta    111960
     tcgatggccc ggtccagctc acctccctga aaaataagct caaggccgat gctgatttgc    112020
     aagctgagtt agccaaaaag aaacggctga cagctaagca aaagaaagaa gctcaggaga    112080
     ttcaagagcg gatcaaaacc agtcagctta tgctcaatgg cattgctcaa gcagtgcaac    112140
     agtctcgtgt ggcttgcctg gatgagggct gggaactgct agctgacctg atcgaccgct    112200
     tcggtgctag ccctgatggg aagctcacaa ccaaggacca gtctgcgatt aactctacct    112260
     tttcccgact ggagctacta gagaagcaca acccagagat atcaaagcac ttggccgagg    112320
     cccggaagct gcatgaagtg atgcagggca ctcccacccc agagcagacc aaggatgcct    112380
     atgataaatt ctctgcattc cttgccaagc aatccaagtc agcgagtggt gaaggggctg    112440
     agaaacttca gaaatccctt cagtttgcca atgattacaa agctttggta agcagactgg    112500
     agaagctgat cgagacgccc gatgccgaaa cattggccga actagaggca gggcaactcg    112560
     ccaatatcga aaccacgctt acccgccgag tgacgaacct caaacgcctc accaagaaag    112620
     cccaagagtc agccaaatat gccaacgaac aggcagcagc tcaaggggga gtggaccccg    112680
     tagcaggctt ctaaagctgg aaatactttc aataactgta aggaatttat attacctagg    112740
     ctatctagat tctgtagaga aatcaaaaat ataagctgat gaaacctctt caactcaagc    112800
     ttcagacgct acgaaaagaa ctcaacgccg ctcacctgga acgcaagtct gtgattgatg    112860
     gcttgctggc tacattactg gcaaaccaaa acgccttgct gtatgggcct ccgggaactg    112920
     ggaaaagttt gattttgaga gagatatgct ctgcgatcgc agatgcgaac ttcttccagc    112980
     gcttgcttca caaggccatg tcccccgatg aagtcctagg gcaaatcagt cttaaagcct    113040
     tggaacaaga catcatgaag cgcaacacca acggcaggct tcaagaggct cacttggcct    113100
     ttctggatga agtctttaga ggcaatgggg tactgctcaa tagcttgctg gaattgatga    113160
     acgagcgcac ctacgacaac ccagataagc agaaaagccc cctccgctcg atagtcggtg    113220
     caacgaactc gattgattct gggagtgatt tggaagcctt tgccgataga ttcatttatc    113280
     gaccctggat ctttgatctg aagaccccca gctctactaa aaagctattg agctggacaa    113340
     tcaacggtaa tcgtccccag gtgagccaag ggttgattac attggctgaa ctcgatcaga    113400
     tgtgtgctga agcccaacgg gtgaaaatca ccagtggaat ggtggatgca ttcactgaga    113460
     tgattcacaa cttgatccgg gatggctttg tgattagtgc ccgccgacga gtgaaactgc    113520
     tgcaactggt tcagtgttat gcctacgtcc aaggcgatga gcaagtttat ctagagcatg    113580
     tgcatgagct attaccccag tgctgttgga aatccaagat agaggaaatc agagaaatca    113640
     agaagctgat tgaaaccaca gcacccatcg cgaaaaagaa attagcggat attgtcaaag    113700
     ccgctcaggg tgaagtatca aggctagaag agaaactgaa tgatccacga ttaggccata    113760
     ctgatcatgt ctatgctgct gactttgcca gaacacagct cagcaactta tcgaacagct    113820
     tgaataaggt tcaggctgat ttatgcagga atggggccag ccaaagaact aaagcagaag    113880
     ctgatttgaa ggcgaaagcc cagcgagtca gtgaactagt tgaaggctta tattgatatg    113940
     ttcacccagc tcaaggcaga actcaccccc atcaccaccg aagtcagcga aacctcaaag    114000
     ctgttttggc aagactatct caactcaaat cctacaatgg tggaggtgac ccaggacacg    114060
     aatatcaaaa ccctcaatcg ttttgccctg gaagtctttc atcggttgta ttactccccc    114120
     ataccggaat ggctaccgga gaaaccagaa catcaatggg cgcgagtgtt gcacaaccag    114180
     ctcagtgaat ctgaagagtt ccaaaatcta accctgactt gtacgggcga tccgttaggt    114240
     tctgccatcg ctgcccaatc catgatcacc aatctgtacc gacagcttga agaggccagc    114300
     gacgatctgg agatagacga actcgacacc cttagagcta aggcccgccg cgccaaaatg    114360
     gagggtgatg aggagctatt caaggaactc caagcccaag ggcaggccat gtcccaagca    114420
     gcacaaacct ttgctcaaaa tttggaaggc atggaaggtg aaggcattgg tgagagcgtt    114480
     gaggatgctg aggggaatgt acaggagaag aaagacgagc tggaagcctt ggggatgagc    114540
     tggggaaatg agccaggtga ccgcaacccc acacccaccg gagagaagct aaagcttgcg    114600
     gctttgattg aacagcggcc acaactcaag aagatactag ccctcgctgg aaatgccttg    114660
     gagacagcca accgcaaacg ccgacagcac cagtccgaga cgggatatgg tgagttagtg    114720
     gggattacca cggggaatga tgtggctcaa gtcctgcctc aagagttggc aaggctttca    114780
     gattccagac agaaactgag tttttatcga gactttctag aaggtcagtt gtttcagaat    114840
     gacttacagg ccccagagga gaaggggaaa ggtccgatgg tgatttgcct ggattgctct    114900
     ggatcgatgg ttaagggcaa tcgttttctc tggtcaaaag ccctgatcgt tgcgttggtg    114960
     aagttggccc atgagcagga tcgggtggtt tcgctggtat tgtttgagtc tgtttgttac    115020
     gaccctatct atttccatcc cagagaggac attgaccagc tgatccgatt gctggttacg    115080
     agtcccacgg atggagggac agagtttcaa agaccactgg aaacagccag ggacatcatt    115140
     gagcaggaca acaactacag cgaggccgat attgtcttta tcacggatgg gattgcgcct    115200
     ttgagttcca cttttgttca agagtactca aattccctac agaatttgaa aacggatttc    115260
     tttttgctag aaattgaacc gaaacaggga tggtcaagcg aactcaggac gttggcgagt    115320
     cagtcttggg caattgatgc ggatggaaat tttgaggaat tgggggctgt gtttacggct    115380
     tgttagcgag tgtacggagt cagaagtagt aggtggttga gatggctgag gttttgggtg    115440
     aggcagcgta atcttttgat ttgcattgga aagcagatta ccaagaggcc gttaggtaat    115500
     ccgctattca gctttttctt gaatagagat aaccctgtac atagcactta ggggtgatga    115560
     tacaagagtt gcacaaatgg caaccaccca agggttaatt aggactgctg gcctaatcac    115620
     aattgcggtc aggacatagc cccaaccaac tacgcttgct gtccacgaga gccaggtgat    115680
     ccatcgaatc agatggcgta ctatagttgc ctttctgagt ctgattacga cctttcgttg    115740
     gacttgcgcg tataacatga aagcaaaact tagaaaggcg agagccccca acgcgaaagc    115800
     tacttcattg gagcccaagc tatatcttgg cattgagtcg tctccgctag acaaataaag    115860
     cagacttttg atagctattg ttagccacac ggaccaaaat ggcaaagagt atcaccgcta    115920
     gtttgaacag cacgactctt gaaattgtct tgtttagctt gctcacctca tctagggaat    115980
     cttaaaaggt agaaatcaag attacacctt ctggcagtta agggagatgc ctgaaaggtg    116040
     gtttttgacc atcacactct acctcacccg ataattttaa tggacgcaga ttttgactta    116100
     gactccctat atcagcagct tcaggatgaa gatgtcattg agttaaccat ccttgacgga    116160
     gacttggctc ccggtcaaac agccgaaatt accgttgcca gtaagtggct gaccagatat    116220
     cacctttatc tattttttga gcatcactca cagagcttcg acttggcagg ggtcaaagag    116280
     ggagccagta agacaaaggt gaatttaatc attgaccaca tggatgccat cagctcggag    116340
     aaagcttata tctttaccta tggcagtgaa acgtcttgga gtattcaact ggtgcagtgg    116400
     aagaaactca ctagggctta agactttgag tagaagttga gtgttggtaa accccgaatc    116460
     aatacacttg gacaagacaa gtgagattca accatgactc agattccatc cctgactcac    116520
     caacagctag agctgctgag aatagccaag aagaatactg tgggagaact acggctttcc    116580
     tatgagtatc cagtgctcga tgacaatgaa cctcagatcg gccatccacc gttcatccaa    116640
     gaattgattg atcaccattt catccatgtg caagtcaaag aaacttctct acgtgcttca    116700
     gagtttcagc aagaaaattg gatagagcac tgtgatggga ttgactatcc ccaccaagcc    116760
     gattgggacc gatggcggca gggattcatc acccaattaa gtgaagagat tgagagcctg    116820
     atgattccag ggaaaaatct aggacaattc acgcaggtgt ggatccgtga gattagcgtt    116880
     cgagcagttc agcctagtag tttgtgagtt ggggttgttg ctgaaagtgc actgcaccta    116940
     gtgaagaatg ggtcttcgat ggccaaaggt cggtcggaga ccttcgtaca ggcaatccga    117000
     tattaaacca ttgaaacttg gctagataga aacgaccaaa agttaaggtt ttagagatgc    117060
     tgctatggtt ggagactttg gttgatgaaa aacacgaaac tcctttactt aactggtggc    117120
     tacattcgag gacatcagtt atcgatggag atgacgaaca atcgctccaa gttggtgcat    117180
     tttagggtta atttctgtgg gaaccccatg cggaagttgc tcgctagttt cagagtgaca    117240
     ggcttgccaa gccttataca tcccattaac tgcaacatct aagggaactt gcccaagggt    117300
     ctcatggtgg tgatgcttaa gactgattac taattgatta cgcaacttat gtttctcttt    117360
     aaatttatct tttagtagag gatttctatt gatatctgcc atgaatgccc tcctcacaca    117420
     tttcacttga tggcgataga ttatcaaaga cttttattca atgaaagtat cgacaacgcc    117480
     aaatcatgaa gtataagaat atcttcagga tctgctagaa tcataaattc agataattat    117540
     cttcaaatga ataatattga ttcaaacctg gctggacctg tccatgggtt gttgattgac    117600
     atttgcgatg ttcaagtcaa ccgtgtggaa tacttggtta tagagatggc gaagtaactg    117660
     ggaggatatg actatgccca gtaatactga atcgatcaaa ggcatagcct taactgaaaa    117720
     acccgctagc atttcaaggt gtggtatgtc ttatgcgaag tttgcccaac atcgagcctc    117780
     caaaaggtgg taccaacttt ctagccaggg gaaaaacctt ggttcaccta tcgaatttga    117840
     tttttataag caagattccc caaaccgtcc aaatagacgc acaagtgttg agactagaga    117900
     attaacaggc gtttagagta tttttcataa tagtcaatat ttcctgatta atgcattaaa    117960
     ttcctagata aagctccagt atctgactat acacttagta ttttactggc attatctatt    118020
     ggtatcaaag aatagcaata tgccatgatt aacccattca ggtgatattt catgaggaaa    118080
     atattaactt atgcctagga agagaaaaca gtctaaaccc ataacaggta aagatttggt    118140
     tgcaaaagta aaacaattgg gtgatttgac ccgtgaagag aaggcaaaag cttgtggtta    118200
     ttattcgacg gataaagatg gctcggaacg gatcaagctc atggcgttcc tgaatgcgct    118260
     gttggatgca gaagggatta acttagatag tcactcctcc agtggcaatg gtaatggcag    118320
     aggagggcga aaagcgagct atcgggtcag cgtacaatcc aatggaaatt tgctgttggg    118380
     gagcgcctat accaaagaac tggatgttaa gcctggggat gagtttgaaa tctctttagg    118440
     tcggaagcat attcatttga acaaggttgc cgaacccagt tgagggaaaa gcactggtct    118500
     cttagcagga tcaaataagg tcaaaaccat ttagtgatat cggcttctgg gtggttgatg    118560
     agaaaagatt caaatgccta ttaaataagg gcaacggaac tatagatcct cttaagagat    118620
     cagcgctgca gaatatgctc catactttaa gaaatacgaa taagctattc catttctccg    118680
     gtaggtgggg tattcctcta gcaaaggtgt ttggggattt aaatatggcg actcagaacg    118740
     acagcgttca agcctatttg aaggagatgg gccgttaccc actcctctcc catgaagaag    118800
     aaatcagact ggctcgacag gttaaagctg gtgatctcaa agccaaacaa cggatgattg    118860
     agtgtaatct gcgcctggtg gtttccattg ccaagaagca tcagcatctc ggtttacccc    118920
     taatggacct aatccaagag gggagtattg gcctcaatac cgccgttgac aagtttgact    118980
     tagctcaagg ctgtaagttc agcacctatg cctattggtg gatttcagag gcgattaagc    119040
     gggcgttgaa atcccagtcc cgcacgatct atatccctat tcatcaatgg gaacgcgccc    119100
     acaggatcaa gaaggctgtt cgccaattaa cgcaagagaa agggcgtact cccaccctca    119160
     aagaactctc agcagcgact ggcataaagt cttcactgat tcggaatacc ctgcaatcat    119220
     tccaagcgat ttcttccctc gatcagcccg tgggtcctga acagaaggat gctcttattg    119280
     atttaatcca aacagaagac gctgctctct cgatcatgga tgggctagaa attgaagatg    119340
     ctctaacccg atgcatggcc tacttaactg agcgggagag attcatcgtt gatcagcggt    119400
     atggattaac ggatggtcag cccaagtcaa tgggagccat tggcaaacca attggcatta    119460
     gccgagagcg agtcaggcaa atcctcaata tcgccatgaa gaagatgact aggcaagttc    119520
     gttctgctta ggaaaatttt tacataacag gatgagttca acagtaggag aattcatgat    119580
     cgaaaatatt aacaatttac tcaaatttca gcgttcctac tgagtgattt agtatcattt    119640
     ttgcccactc tagacttata taaagtcatc aatcttggat gataaacctc atttttgagg    119700
     tgcaagtcgc ttagtctaac catgatcgca gataatatca ccgattatta tttagaacat    119760
     tctcagccca cactaacggc ctcaaacacg gtgtcgctta atgtgccaat cattgaatca    119820
     tggcgttgct acgatatcag caataatgtg attattcgtg gacaaatctt taaccactcc    119880
     aagtaccccg cagggaaatc gcttaaatct tcccctattc aaggatgctt gactaaagca    119940
     ggtcgggtgt atgtgaccac gaagaattcc atgtatgaac tgggcattcc ccatcctgat    120000
     tttgcagggg atgctcaact atggatggat ggaacagacc atcagcaatg ggccaagctt    120060
     actttctgtg ggtgatccag ccatggtggc tattatttaa tttgctcact aaatcgtttt    120120
     ctaggcctga ttggcctatt tctcaactaa agtgagctat tgaactgcca agtttatcgc    120180
     gtaaaaataa cttgggctaa cttcaaggtg aatgcattgc ttgctttagg atcatgaatg    120240
     tagctagcta aagcttcaat cagtttctca ggtttattct gctcaatttg agttagagca    120300
     tcttcgataa gaatttcagc cattggacca atatgaacgg ctaactctgc tttacattgt    120360
     tcgataaatt cactgtcaat gagcgtagga gaggcctgat cagcttcgag cttttcacta    120420
     tacttggaat cctttgattt tattccttgc tctgatggtt tggctgaagt tggggataac    120480
     ttctcatcgg gaggtgaaga atccttagcg tagactttat gagaaggcgc agcatctttg    120540
     ggaatgaagc gtcgccaagc catgaaataa gttggaaatt caaccaggat atattgacgc    120600
     ccttgtgtcc gtgcatcttt acaaaactcg atagctgcct ggcgtaacga ttttctgaat    120660
     gatggtccag gcttaaacca ttttccttgg atagtaaggg aggaagactg atcatgcagc    120720
     aaaccttttg cttctaaatc cactgattgg ataatggaca ccctattccc cctgacctat    120780
     atcttttcct attcaagatc aaagacttgc tcaactttag tattcccttc attcgaggct    120840
     aaccaaagct ttggcatttt acttgcatta tcattaatcg gtatttcaga gcttttaatt    120900
     tgtgatgatt aagatagcta ttcaggtgga aagatagcgt ggcaagcata ctttacctgc    120960
     atctgaacca ttcgcatcta caaaagtccc taggtcgaac gacttaggca ttgcgtcaaa    121020
     ccgtacactt aaacctcagt ttttttaggg tgggttattc taactggtac cttctatgaa    121080
     aagtaaaaaa gggtatagaa aaatgttcga tttcgaggta caaagagaaa agctagagca    121140
     tttgtactat tcatcaccaa gctttctatc cgacgaaatg attgaagctg aaatagggta    121200
     catcccctca gaagtcattg aggaggggga tgatctcgac ccccgaaaca acattgaatc    121260
     gtctccaacg gtccttgacc tgatcggtga agccgttgag ctatgggtgc ttaagcgagg    121320
     tggggatgac tgagcttcgc gagttttcct tcctcgtctt gcacaccagc ggcgaagaga    121380
     ccgttcagac agtcgtgagt actagtaagg atctcgccga aagtgcgctg catcgctgga    121440
     tcacagatat caaatctctg caacctatga cttccgggga tgaggaacag cattgaccag    121500
     cattgactca aattaactgg accgtattga agtactggta tatcccaatt gctcagatca    121560
     tccagtctac cgcccgatcc attgagacga tgaggacaca atttaaggaa accaaaagac    121620
     ttgctgatag agtatttcag cgtatggact ctctaaccca gtagctaacg gtcagtatga    121680
     atagtcgcaa cgaggatcgt gatttactcc gagcaatcaa ggctggtatc gataagttgc    121740
     tgagacgttc tgagtaaaca tctatcaatt cacagatata tatttaacgc tggttcaata    121800
     tacatgaact gggcgatgga gataacctat ggccgatatc ccatctcttt ctctcccaca    121860
     actagaactc ctcagacttg ctaaaaaaca ttctgtggaa gaacttcggc ttatctatga    121920
     gttcccagtg ctggatgata atgaactttc aagcggccat ccaccgttta tccaagaatt    121980
     gattgatcac catttcattc aggtgcaaga gaaaggtact tctttatgtg cttcggagtt    122040
     tcaacaagaa agctggactg agtactgtga cgagattgac tatcccaagc aaaccgattg    122100
     ggaccgatgg cggcagggat tcattgtcca actcagtgag ggctttgaaa gcctgatgac    122160
     tccaggaaaa agcttggggc aattctctaa ggtatggatc cgagagattg gccttcgagg    122220
     ggttcagcca agtagtctgt gagtggggct tggggcttta attcggttta acgaaattaa    122280
     aggccggagt tgaaattcaa cgagtgatag gtatctctac gtctatggtt caatagccat    122340
     cattcccctc atagctgtat gcaacacagc tcaatgacat gggggatgga gacagtctca    122400
     acctgaatgt tttgagtaat tattgggtat aaccgaccgt tctgttgggt gttgaatata    122460
     gaatctccaa gcaagtattg aagggttaag cagacttgga cacttttctt aattgataat    122520
     tcagcaaatc agtataagac aacaagggag agccatgatt ccattgtgca ggtagctctc    122580
     cgttgtaaat agcttggcga atgtcagtca gggtgagacc gaatagagat gtggctgctt    122640
     caggcgaaat tcgggaggaa aacatgatgt ctccactaga tgattgagga acggatacga    122700
     ggagaacatt caatgccaaa gaaattataa atatttagtt aaaaaagtat aaaaaaatta    122760
     atgttgtttt tatgattaac ggcggcttaa accgatattg gacaatcttc cctcctaaat    122820
     tctaggtgta agtttttagt ctcgatgtta gatcttgagt ccctttgggc aaaatcagtc    122880
     taatcagcta ttacgaacct gattacttca tcaaggaaat aggaatatct agcccctatg    122940
     acgacaaagg taggggctgt tttctttctt aatcgaaaaa tggctcatga agcttgcgcc    123000
     ttaaaagaaa aaacaccaca ttcttcccca agagcggtgt tttttcttga atgacaatga    123060
     atgcctcaat cagacttatt gttcccatag aggagaaaag gcaaacatca caagaatgcc    123120
     aatgaacaag acttaatcat cacagggtta ttggaattgg ggtgaacgtg gttaggaagc    123180
     tttatcactt cagataaatg aaatttgaaa cgacgtaatt atgtttgggg tgaagccaat    123240
     catcaggcca agcactaatg taacttcaag cctacagata ctcttctacc aaagtgataa    123300
     aagagggcta agcagaagtg aagatgctaa accatcctta ctcaactaga attatccaac    123360
     tcacatccag gtctggttaa ttggagttgg ataaatccgt ctcgtcctca tcaaagcgct    123420
     tttgcatctc aaagacctcg atcagttctt tgttcagaaa gtagttgaga aaggtacgaa    123480
     tgattgcgat ggcacccagt ttcccgagtg cctcaaacgt aggagcaacg gtcgtggcta    123540
     agacatctgc ccccaattga aactccagag ctaatgctaa ccatcgtcca aaagttaacc    123600
     gcaatcgtcc caatgggaac tgtatagttg agcgacgacg gcgcaaatta accgagagct    123660
     tgatgctcac gagcaggccc aacacaatac aaaaagccgc tactgcttcc agtactactt    123720
     ctaaaaaaga tacgatgatt tccaagttgc cttgcaaatg gtggacgact tccatcaagc    123780
     ttcaaccttg accagcacaa caccctgcca aagagactac cctgttgtgt acctttattg    123840
     agttattctt gctggaggat tggcaattca aggccatacc tccgattgct cgggtgtagg    123900
     gaagtgactt aattaggtaa tacagattct cagcggaatc tgaaagttta agtatggggt    123960
     gcaagcggcc acttttaggt gcaatattga gtattggtat cagggatgcg atctcggcct    124020
     aatccctaac ccagcatacc ttcattctct ataccgatct gagcctgctt tcttagtcat    124080
     gcggttcact cccctttgcc ttgatacctt tgagggaatg catcataggt gtttaatgtc    124140
     aattagatag gccaaacttt ttggttctaa cttcatactt ttaatagcgg ctcgtgagtc    124200
     gatttagatc tttgcaatat catcttgaga tgcccgaaga gcggtcggag accatcgaaa    124260
     atcatggttt ttacctcagg tgatcgcgcc atggacaaaa tgacaattat caataaagcc    124320
     actattaata gagttgctta taagtaagca actctattaa tagtggggta cagaggtttt    124380
     attctgacta gagatcagct gtcagtcttt tgagacttgg ctgtgtgttt ggccgcttct    124440
     tgtttgcgga agctttctgc ttgcatctcg aaaatggtgg cgtggtgaat taagcgatca    124500
     atggcagcca cggtcatcat tgagttagga aagatgctgt cccattgact gaaaggttga    124560
     ttagccgtga tgagtaggct ctttcgctca taccggtgag caatcaactc aaacagtacc    124620
     gaggtttcaa catcggactt ttggacataa ccgagatcat caatgataag cagatcatag    124680
     cggtcaagtt tggacaagag actctgcaat tccaattgaa gtttggccag ctgtagttgt    124740
     tgcaccaggg ttgtggctgt gacaaatttt actcgcttac ccaactcaat aatagaagct    124800
     cctaatgcag agctgacgtg tgttttccct gttccgctcg gcccaaaaat tagaatgttg    124860
     ctaccggact ctagccagtg agtcgtttgg gcaaactcca tgagagcagc tggattaagg    124920
     gtgggaacat gggcaaactc aaaattggtc caggactttc cgtaaggcag ctgcgcttcg    124980
     gttagagcgc gtgaaatccg attctgctcc cgacggctgg cttcgccttg agctaaagcc    125040
     aacagaaact gggcgtagga ccaattctcc tgagtcgctt gatgctcgat gctctgccac    125100
     tcgtcgagga aatgcctcaa ccgcaactgt tttagggttg tcatcagcaa ctggtatggg    125160
     ttgtccgggt ctgctgtgga ggagttgatc atagtcagat aaatcgtgct gttgtgaggt    125220
     gacgtcagga tattgctcag tcgagagctt gaattcaaag gcttgtttta atctgctcaa    125280
     ggtcagggtg gactgttcca gttgagtttg taggtagtca gccacctgag attcttgatc    125340
     ttgagttgca gcgatataga gggcttcggt gattaatcgt gcggcctggt cctgctcaaa    125400
     attagctttg agtgattccc acagctgatg ccactgaaga ttgggcagta gctctgattg    125460
     ccattggcag tagagaaacg cgtttggctt tctcctgaga ctttctgcca catgcttgta    125520
     atcgatgctg cgagcgcgtc ttttcttctc agagccatgg acatggaccc gcgccaattc    125580
     cactacggga gtggtgccta agaaaccgac aaggcggtca tggtataggt gtaatttcaa    125640
     gcggtggcca attaagcgag aggggactgt gtaaaggaca cagcggacgg caatcgtgct    125700
     attgcagctg actttggcac tgcgcacttc ataatcagga gttcggtatc tgggcaaggg    125760
     ctgtaaggtg ggcagctcca gtgcaaactt tttttggcac ttggcattca gcttggcgat    125820
     gacttgctcg atgaactgct gatactcagc taccgagtca aagtcaaagc tgcctcgacg    125880
     atacagggct tggcacaggc gtcgtttgaa atagccatga gacccctcta ttccgccatt    125940
     ctcatgagag acacccagat tgttgcgtgt tggctgcatc cggtaatggt cacacagagt    126000
     cgaatacaac tgggtcagct ggggattgcg gccgccagta ttgcgataag ccgcactcag    126060
     actatcggta cgatgaatct tgggcacgcc accacaggcg gttagagcat tttgtagccc    126120
     ttgggataag ccgataaaac tttctccgcc ttgaatcacc tgcacgtact gccagccgct    126180
     atagctcagt cgatagtgat acaagatatg gtgaaaggct tcaccctgaa ccgtcacact    126240
     gaaacctttg agctgagcga agtctgactg tcccatctcc ccaggatgat gttgaatttt    126300
     gaacatcact tctttgggct tgccatgagc tgccttccat ttagcggttc ggcgttgcac    126360
     ggttctgatc ttgtcatcat attgcccagg atggttctct tgtaaggtct caaatagagt    126420
     agtcgcttct aatcgaggct cacgctctaa catcggctca agttctaatt cccataatcc    126480
     atccagcgga tcttcacggg ttttccagtc atgagggcgg ccgcgttggg gacgatgagt    126540
     accactatca atgcggtggg ctgtgcgggt agaaatgcca gctttagcag ctgctgtttc    126600
     ttgagaagag ccggattgtt ttgtctgcat ataaagatga acctgttgag gtttaatagg    126660
     agctggcact agaggttcct aattgcgtag gagtacaaac cctagtgtct ttcctgtatg    126720
     gggatataaa aaatcgaaag tgactgatgc tctctctgca gatgtgatct ctggattgaa    126780
     ctagatcctg attcctagag aagactatgc aattgacaac ctctgtctac gtaattgtca    126840
     ctcaactatc ataggcgctc atctctaagc gcatgcctat cgttttggat aattcttctt    126900
     cagtattgtc ctctctggga atgggtttga gataatttta tcagtcagcc caggctataa    126960
     cttgtgcaac cccagtgttc cattttcggt attcggggac cacaccatcc tcgttttttt    127020
     aattctctag caataaacag attggtgatg ccatggccaa ctaaaacaac agagctagct    127080
     tcataagatt gctgttctaa taattcggca gcttttttca ctcgtttttt gatgtgggct    127140
     tgagattgag catgtgatga gcaacccaaa ctcaatagca acctatccag aaaaagccat    127200
     atatgaaagg gtaaacgaat attgatggga cactcaagcc aaaaatctac ttcacgaaaa    127260
     atgggatcac tgacaggagg aatggtaggt tcaaggattt gggcagagtg catcgaacga    127320
     ggaatatcgc ttgtgaacac tagttttgct gattgaacga gtacttgaac atcacctgta    127380
     ggaaaggagt cactggcaat cttagctgat tgaattcgat taatgacctg tggtaactcg    127440
     tgaccaccta tccacccttg tggagtgatg gtaggtttcc catgtcttat caaggatatg    127500
     gttctgctca tatctcagaa gtctattgtt catcactaaa gataggctag ctcacaatgg    127560
     aagatgccaa atttagttac caaacttagt aggtaggctt gggaagcgtt actagaggga    127620
     tgcaaggcta gtcggaagcg gcaggtggtt gagctaccag ccgatctatt gggtgtagca    127680
     gcttagccct tggtcttatt cacaagagtc catatcccct tagctatgaa gcttaaaggg    127740
     ttactacttt cgtattgtct tgcgatcgca aaaccgctca ttccacattc cctccatatc    127800
     agaccttaac tagttaatat aaatcccctg tagaatctga gattttatcg cttcaaaagc    127860
     agtcaacggt atttcacagg tagaattgca gagctttcta agcagcatct ccagcagtca    127920
     tgtggattgt cgctgcataa atcatctcta ccaagggttc ggagtctttt aactggagaa    127980
     attctaagga atgaaccact catcagttgg ctttagattc cttagtagct gcatgataaa    128040
     gaggggtggc gatggttcca agtacgttca atacggaaag tatactaatc agcttccatg    128100
     atgttgaaaa attatctgga gccataatgt ttcccaaaag caccatggaa aacatggcaa    128160
     taatgccaag ggtcacatat cgcacattct ggacagtctg attggttgta tggatcctta    128220
     ataacagaga acagtgagca aaggcgactg caacaacgag gaaagagaaa cgaacctgga    128280
     gcaattctcc ccagttgttg atttcttgat tggctaagat agccagatta ttcacgaaag    128340
     cccaaaatcc gctaaatact gatactgcaa tacctatctg accaaatcta tggtgttgtg    128400
     gatgaccaat taaagtcgag caacacaaac cagtcatact gtaggttcct agagatactg    128460
     tcgtaagcaa gatagtggct tggctggtat caaaactaga tgtaatcagg gaatagatag    128520
     cggtcaaagc gccaaaaatc aagcacccaa ttagactaat taaaaataag cgtcgataaa    128580
     caaacccctg tgtcggaagt gagtcagact tcttaaggtt agccttcgac tttgcagaaa    128640
     gttctgaaat cggtggaggt ggtaccaaga tatctgcgct acagctggga caggtcatca    128700
     attgtccaga ttgcccattg cttgtttcga ttttgtagcc gcaataggtg cagtgaaatt    128760
     tcatgttgac ctgctctgag gtgcggtttt ctggattcgt tctttataag cagactgagt    128820
     ataaggatca ttcctagacc caatgtgccc acatgattgg aatctatgat tgttcaaaga    128880
     catcccatta tcatcagctt gccctaagaa ttgacatagt tgatcgttgg gctagtattc    128940
     tatatctgct gtttagacat agaaaaccca ctaaatcccc ttctgaatca aaaatctcat    129000
     caccctaggc tgttcactga aatgagattc attgagtacc actgtgaaat ctttgcccga    129060
     agtattagag taataggcca gttcaaacaa aaaaactatc gttggtgatg ctaattacga    129120
     gatttactga cccgaagggt cactctagat caacggtcat gattcatcca caattactga    129180
     gtaatacaga atccgcagag attccaaaag tttgaaagtc tgggtgaaat gaataggtgt    129240
     aatgtcggag tgttggtatt gttcaagagt tcgcattgcc tcactcctaa tccccaacac    129300
     cacttcccca aaacctgctc aatgggcgaa gacacagccg catcctaccc aacagtcaag    129360
     gcatatgtca tgctgttttt ttaacaatca cgatcaggat tatgcttgga gccttttgga    129420
     agtttagttc tacataagag tgctttacca agctgctgat cagtccattc agaaacgttt    129480
     gtaagaatag catttgtcag gttagcggat tcaaaattag ccctaccaag agaagcttta    129540
     ctcaggttag cttcgctcaa atttgcttta ctcaggttag cttcaagaag gtcggcttca    129600
     gcaaggtttg caccccgcaa atcagcatct tcaagatggg ccttatacag ttgagcattg    129660
     accagactaa catcttgcaa accgataaat tgatctaccg gatcttggct tacttgtcgc    129720
     gcaataatca ccttgatggc tgcctgtata tcttcagaaa tgggttcgct ctgagcctta    129780
     tccctatcta ggggtgattc tttggcaata taactgacca gaaattccat aattgtccaa    129840
     tgatcacttg gggaatcctg agctattttt tccaaagaat aaatcccccc aattcgtacc    129900
     aatggatctg gattgccgaa cagtttaatt gcttctgcaa atcgatctga aacacttctt    129960
     tgttctgaaa cagcaagttg ctttgttgca attgatcgat cgaatacgga atcttggtaa    130020
     ttcagaaaca atccgaaagc aatagcagtg ctccccacta aacccaatag agaaataaga    130080
     accttagcag cttctcgatt atcttcctgg agcaaaaagt tccatacttt attaaaagtc    130140
     atcattcttt tattgttata tagtcaaata gaaaacagcc ccccttaaaa tagtttgatg    130200
     aattgtccat tagtcagttt tagcggagaa tggctgtaac agccgcttaa ggcatttact    130260
     gccaatcttg attaggacta accacaccaa cctgacaatc tcgccaaatc taaaatatcc    130320
     tcttttggga atataaggct ggttcgattg gtaactagat gcagccagag caatgatctg    130380
     gatactgacg attgccaaaa tcctatagat caatggaact gacttaacct tgatcaagca    130440
     gccagcttag gctttgagaa tagagcacag ttattcatct ctacctccat agtccagtct    130500
     ggataagagt ttttaacgac ttttaaaata gcctcgcact gatttcaaaa aaaagtgtat    130560
     gtgagtcata aagatgaaag cacttctgta catttctcta tcgcttcggc aaaagttcgc    130620
     aaaatttcat ctatttgtct gtgaatagac cagggggaac aacaccttcc catttagcgt    130680
     tgaattagag tttggcattt gttgaagtcc tggcataggt gtgggttatt gaataatctt    130740
     gcctaagcaa tatgaattct ctagggattt caaaagactg agttgtgttt aggtggatag    130800
     gtgaatgatc gagataggta atacaaaatc cgtcgagaat ttgaaaatgt gaaagactga    130860
     gtgaattaat aggtgtgatg ccgaggtgtt ggtattgagt tgcgatagcg gggcaacact    130920
     cggaatgaga tcccaacacg aaactcatct ttacggttcc agcggctgat acaacagcgg    130980
     tagcagcgaa gaaaagtcaa gggtcacctt gaagtacaag ccacctaaaa ggaagccaat    131040
     caagacaccg ttgctggtgt gtccaatact aaatggccta ttttaggcca gccacattta    131100
     aagtttttga cacagccaca cacttggaat ctggactgta aacccagatt tctcataagc    131160
     tcgacgagct ggggcatgac ttgggtctcc acccgtagcc accgttgcaa cttgcatccc    131220
     tgcttctttc atttttgaga tcacaaagtc atacatgatg gtgccaatgc cccttcccgc    131280
     atggttgggg tttacggcgt taagtccaat ctcaccaact ttccgatcta agttgagttg    131340
     gaaagagata aaaccaacga ctgagctatc aatcacagca gtatagactt cccaatcaga    131400
     gtcaggtgcg agtaatgagg caagaagttc gccttgtgct tcatcttcat gcgcttgagc    131460
     caaattgtag atctcatccc ccaaaatttt acggaatgag gcaaagacag gtgcgaacgc    131520
     tgcctttcgt atattttcta aataagggag atcagttgag ttcgctgagc gaattacaac    131580
     atttggttta gagcccatat tcgctatttc tcgggttctt agacaatacc cctagttata    131640
     gctattgttc ttcacttttt actaaccagc ccctactatg tcacgaatat cagtcactac    131700
     gaagcgaggc aagttcaata agtctctatg gctactacta attattgccc ttgttgctct    131760
     ttacctaatt gcctggcctg tacccattga acctgtcgca tgggaggcac catccaaccc    131820
     tggctacagc ggagcatttg aatccaatca gcgtctcaaa gatattcaga aattacctct    131880
     aagggacaat catggccctg aggatattgc cctagatagc caaggacgta tttatgcctc    131940
     gacccatgaa ggtcggattg tgcgactgct acccgatggt tcaagctcac agaattgggt    132000
     cgaaacgggt ggtcgcccac tgggcatcga ttttgacaag agtggtcatt tgattattgc    132060
     tgatgcgttt cgtggccttt tatccatagc agaagacaaa actattacag tgttggccac    132120
     tgaagcggac ggggtaccaa ttagctatgc aaatgatgta gacatagccg atgacggcaa    132180
     aatttacttt tcagacgctt ctacaaaatt tggggcaaag gaatggggag gcacctacga    132240
     agccagcctt ctggatctga tggaacatgg aggtcatgga agactgttag tttttaaccc    132300
     tactgatgga agtgttcaga cactattaga cgatctgaac ttcgccaatg gcgttgcgct    132360
     cagccacgac caaacgtatg tgctagtcaa tgaaacgggg aattaccgag tgattcgtta    132420
     ttggctcaat ggcccccaga aaggtcaatc tgagaccttt ctcaaagact taccggcttt    132480
     ccccgataac atatccacgg ggctaggcaa tcgcttctgg gtggcactgg tttctcctcg    132540
     aagtgcggta ttagaccaac tatcgaataa gccatttatg cgcaaggtga tacagcgtct    132600
     gccagcattc ctacgaccta aagcacagcc atatggtcat attattgctg ttgatggcag    132660
     tggtaacgtt gttcagaatt tacaagatcc acaagggacc tatcccctga acacagccat    132720
     aactgaaacg gaggaatatc tctatattgg tagcctggta gcaccaaata tcggacgttt    132780
     atcaaagcca gatgattttt aatcctaagg aactttcaat gagttagttg ccaaactcaa    132840
     cctgaaattt cttaggtaat acaaaatcta tagagattct gaaaaattga aagactaggt    132900
     gatttaatag gtgtgatatc ggggcttggg tattggggct gcgatctcag ccccaatacc    132960
     cagctcacaa acctgcggcc ttatcattga ttggtcaaca ccttgcgctc cgaaccaccg    133020
     aaccgcaacc accagcaagg attgagtggg tcggagcaga tggcatactt gggcaggttc    133080
     actcccacga tcaagccaga gccagctagg aacacaacca agaggataag gattgctgac    133140
     gagttcgcca tcagggatag gcaccgatta atttggttga tagttcgctc atgccccaga    133200
     agcttcagct ccctggcttg gatgatagat acctcgtcta aggcaatcgc tctcattcgg    133260
     tgggcaatgt ctcggtagat gagttcgtcg aggctggcag cgctgtttgc ttggcttgag    133320
     ccgctagccg ctctcttagc ctggaggtga acggcccagg cttttttgct aactcgtctg    133380
     gatcctccac aactgctttt tgcacacggg catttgcaaa gacgtggttc agccgactca    133440
     tgtaggcacc caaaacagcc ttttgcagat catcgccata accatcaagg gtctgcagca    133500
     ccctttcccc atcctcatcc gcgattttct cggcgcgctc caagatatgg tcggtgccat    133560
     ctgacttttc agcaactggc tcagcttcaa cgggcaccac ctctgcctgt atttgctgcc    133620
     atgcttcggt ataggtgatt gctccgcttt gcttgtgctg caccacctcc ttcaacatct    133680
     caatatctga ttcagagaat tcctctgtct cccctagccc acagataccg cgaagttcaa    133740
     tgaggtcttc tttgctaatc tgtaaggtct tgagggtctt gctaaaactt tgattactca    133800
     ttttctagtc aaactccaat tcaggttcat cttcgtctgg ttcacaattt tgaggggaca    133860
     tatcagcaga ggttgttgct tgcaccacct ggctagcaga aacataccca tttttttggc    133920
     attggttcag ggcttctcga tgaagatccc gtatttcatg agctgatgat tcgatagcat    133980
     tttggatatc tgccgcactc cctccctcaa tcgcaatatg aatcggttca aaaagatcca    134040
     ctaatgccag ctcaactgtc ttcttgaact tagagccata aaaactcctt gcacttttaa    134100
     tgatcagctc ttgcttagag cctgaaatcg gttggcagcg aataataatg tttgtcctat    134160
     ttggcttggg catattcttt tactcctttg ggtgtccagg tgcgcccggt tacgtgtaga    134220
     tgcaacatcc aaacatcgat ggctctatag gcccactggg tattaatctc ttcaaactca    134280
     tccgatagct gcttgatagc cccattgagg ggtttaaacg cactaccaaa cagggccttg    134340
     aatcggcttt tgtaaatggg ggcattccca cccaccaagt aaaacgcttg ggcctgcttt    134400
     atcccccggt cgctatcaat acgttgctta atctcacccc aatttttgtt gaacccttcc    134460
     cttgtctgag tcagtttctg ctctaagcgg tggggcttga tgagtgcggc taattctttt    134520
     ctggcctggt cttgcttgtt gggtttatcc atcaatgcca gaaaccggaa gacggctttt    134580
     gccccctgca catcatccgt aaagtgcatc actgaattca ctatcgaaga catccccaac    134640
     ccttcaaagg ttttggactt cgggtatgcc aggggtcggc catcctccac ggcaataaag    134700
     ttggcatcct tatgaccgca gactccgaca taagctgtga tatccggtgg gggtatcgtt    134760
     gccatccctg ccccctccat ataccccttg gcatctacag ccgcaaaatc aatatggcga    134820
     ccgttgtacc caaatccacc cagcaggcac gagaggaggt cactctccaa gtctgcatac    134880
     tcagtccact cactgatcgg tagcataaag ttgatgacga gcttgacccg atctggggat    134940
     agctctggga cgcgatccag ggccaaaccc acgaaagcaa gaaccttggg gaccagcaga    135000
     tcggccttac tcatgtttgg gtcagtcttc gtcccagcat ggccagggat ttcccccaca    135060
     atgcggaaga cccaatcgct accctgcctg aaggtcaccc gtgacgtttt ggttgtactt    135120
     ctcctcttgt cgttttcata gttgctctgc attaagaagc caacattagg aggttgattg    135180
     ataaatccct catgggttcc tccatcaaag tcagctaaga aaaatccacg ggttgatgat    135240
     gacccggtgt caatgttgag atgcaatatt gcaccctgag aaaaattcat tgtgacgctc    135300
     caaaagtttc aaaaatcttt cacgtcacaa cattacccag aataaaaaaa gttgaaccca    135360
     aagcactgca ctgaaaatgc attgttgtag tcaaaaaatg cactagattt gcaaggtttt    135420
     gcactaggaa tacactacat agcttcaaaa atgcactaga tttgcatggt tctgcaccga    135480
     aaatgcactc taaaaaaatc ctggaaaaac acccctcaaa tgcagtctag gagtggatta    135540
     cagcggatga aaactgcgga tcgtcggaaa aaattttaat atatgcacta cgcccacctt    135600
     ttgggccatc gcgaaaattc cgaaaaacag aaattctggg taatgttgaa gtgtggaaat    135660
     tttcttagtg agaggtgatc gacatgagcc aaactcgata taagacaaaa gttatttatc    135720
     aaacttgtaa atatgatcat caagggcaga agtattgcat caacccgaaa gtggtcgaag    135780
     ataaaactca gcccatcaag ggtgtggaag tgccaatctt aggtgaaatc attccgcctc    135840
     ctccgtttgg tctagaaagc tatagcgatc tgttctggct cctcatcgct agtgtgttct    135900
     tcctgaaaat cttccccaac ccaattgcaa tcatgatggt gtttttctct ccatcccgac    135960
     gataatgttc cgcccaacgc tcatcaacaa aggcaatgct gcaattgagg agtattacac    136020
     cgaagacgaa gccctgaaga acagtgagga cgagtactac gcacctggca aagatccggt    136080
     catcactccc tgcaagtggt acggaaacgg cgcagacagt ctgaatctca aaggtgtcat    136140
     caaccagaag gttttcaaaa aactgttcta tgggcaccac cctgaatcag gcaaacgcct    136200
     tcgcaagaaa cccacgaacg gccaggaacg gttagggatt gatctcacct ttggaccggg    136260
     taaagaagcc tcgatcctcg ccttggtcgg tggggaccgt agaatcatcg atctgcatga    136320
     gcaagccttg cagaaagtct tcgatatctt ccaggcccgg tacactcaaa cccgtgtcag    136380
     atatgggaat gggcagcgtt ccttagtcaa caccaacagt ttgattggtg ccttcatcaa    136440
     tcacgccact gcccgcccag tcaccattga cggtaaaacc tattcagacc cagccctgca    136500
     tacccatatc gtggtgatga atgccaccca gattaacggg aaatggcagt ctctatcgaa    136560
     tgaagcgata tttaaatccc tgtctcttgg ttccatctac cgtcacttta tcgacaaggg    136620
     tctagcagag ctggggtata ccgtgcggcc tgatggcagt attgagggac ttagccctga    136680
     gacagtttgg cattttaaga aacggactca ggaagttgag cggtatctga agaagtatgg    136740
     tctagaagat acccaggaaa accgccagaa tgcagtcctg cgaacccgca acaaaaaaga    136800
     agacaacacc aatatccctg aaaagatgaa gggatgggtt gaggagctgg ttatcaatag    136860
     gttcaggctt cccaagcctg ctaagaaatc cacctgggtt catcggcctg aattagcgcg    136920
     taaatatgtg gatagcgcca ttgcccatct acaggaacgc aacgccgagt tttgccatga    136980
     actcatcgag cagtgggtct tcgatcagcg tccacccttc acctatgaag agttgcagac    137040
     tgagattgct aaccatcctc aactgatccg cacaaagaat gacacctata ccactcagta    137100
     cgccttggat cgggaagaga aaacccggca actttgggct gctggtcagc ataaattcac    137160
     ccccatcacc acgggtaaga ttgagttcaa taagatgctg aatgcagacc agcgtatcgc    137220
     tgtacgcagt actctcgcta gcagcaatcg gctgatcatc tggcatggcc tgtctggagt    137280
     gggcaagacc acgaccctca gcgaactcca aaagcatatc gaagcgatta accctgatat    137340
     ccagatcaaa ggctacagcc ccaccactaa agcagcaggg gtgttagccg aagaattggg    137400
     cattgaaacc accaccgtct ctgggttgat tactcgcagg ttagacacta ctccaaacca    137460
     gtggtggatc attgacgaag ccgggatgaa atcagcggag caggggcttg aagtcttgaa    137520
     gcgggctgaa gccgtcaatg ctcgtgtgct tttggtcgga gacatcaacc agaacagctc    137580
     tgtcaatgcg gggtcacctc agcgttcttt gatgaaagct ggagcagaaa cctaccacat    137640
     caaaacaatc ctgagacaaa aacgcattgt ccagcggcgg gcagtcgagc tggtcagcat    137700
     tggaaaaccc ctggaagctt taaagctact caatgagtat ggtcacgtca cggaggtcgc    137760
     agatcgcagg gaccgggccg ctcaagtcgc ccagaaatat ctaagcctga aacccaagga    137820
     gcgcaaacaa actctagtgg ttacgggcac ccatcgggaa cgaaaggcaa tcaccaccct    137880
     gatcagagaa gggctacgtg ctgaaggtgt gatcaagggg gaagaccagg cgcttcggca    137940
     gttggtggac aaacggttaa ctacagaaca gacccatcat ctcaggtatt acaagaccga    138000
     tgattatgtc attcccaatg ataatttctc tagtcggctc cagaaaggga agctctacaa    138060
     agtagttggc gttgatgaag cctctggggt cgtccgtgtc gtctctcaag gggggcaata    138120
     ctccagcttc gacccagcca agttggagaa taaaaccgtc tttaccgctc agaaaatcaa    138180
     tgtctccgtg ggggaccagt tgcggtggac gagaaataac ctgcatggca acaatggcga    138240
     ccagttcaag gtgacagccg tcgagggtca cagaatccag attaatcaca agaaatggat    138300
     agacacctcc aaacctttag agctggatta ttcgatcacc tcaaccactc atgcagccca    138360
     aggccaaacg acctaccgag ttatcttcag tggaacgatt gatcccactt catcaagaga    138420
     acccttctac gttgccatca gccgacagaa gcatgagctg tacatcttca ccgaaaacta    138480
     cgagggctta tgccaacaga ttcaacggtc agccgctcaa cttaatccca gagaactact    138540
     agggctagat ggagaactgg agctacctga atttactcga tccgcattct ggacacctca    138600
     aacggcaatg gccgagcctc ccaagtcagg cattgcccct caccactggg aggagctgat    138660
     cgaaggatca gggattcacc ctgatttcat tgagctaaat tgccacagct taaagggtga    138720
     ttcagtttat gaatacctgc tagaagacaa gattgcaggg ctgggagcag gccaggtctg    138780
     ggttgctgac cagcagaagg cgagggcaag aatagagcat tgctgggatg gaggattttg    138840
     gatcggggcg ggagtggagg cccaaagcct ggatgatcca atactttcca cctggggcag    138900
     cttcaaaccg gatcatcccc gctatgacag cagtagagaa cgctttcaga aatatgagca    138960
     tccccaaggc agaagcaggg ggattttcct gactgaggtt ccagactggt ttaaagaata    139020
     tatctgcaag aagtacgaca tcacctcagc tcttggcgat cacttctgga aaatcattcg    139080
     agacaaccct caaattccca tcaagattac tgagggtggc aagaaaaccc tatccattac    139140
     ttctcaaggc catgtcgtca ttggtctgcc tggagtcaat gccgggtatc gctctaagga    139200
     tgacgagggc atcaaattgc cagagcgaag gctaaaccca gatcttgcta tctttgccgt    139260
     gccaggtcga gagattaaat ttatgtacga ccaggacacc aaaccctcaa ccgtggcgaa    139320
     tgttaggcgt gacatggttc gcacgggaat gctgttagag gacaaaggct gcacggttaa    139380
     attcagtaag tggagtagcc tctacaaggg agctgatgat ctaatcgtcg gagctagccc    139440
     cgaaatgctg gagcttgcca tcgatgccgc tcaacctttg gcagtagcaa ctgctaagca    139500
     ctacgaacat gagtatcaaa agctctatga gtttgtggtg agaagggatg gcgaactccc    139560
     ccacaaggtg atgaacctgg agatctttat tgaggcgtat accagaggaa cgacgaagga    139620
     tgcctacaaa accatcgagg ccataaagcc agaattgaat cgcgaagagc tgatgaaagc    139680
     tgcgctccag caccaagaca aaaagcgcaa tgctgctacc acagttgtcc ccatccttga    139740
     agaattagcc aagacaaaag gcaccaagta ccgccatacc taccaatacc gtgtagacaa    139800
     gtggctgatt gcttcgggta agcgtgggct gacagtgagg gacactgcta cgggacgcat    139860
     actcctacag acaaaaatgg gccgactcac aagagtatcg gcccgaccag gggtaattaa    139920
     gttgtttaaa tccaccgtca aacaggctaa ggttaagccc attcagcaag tgcagaaggg    139980
     caggaaatat agcgcctaag agcgatagct ttctgtttat gaggctatat tcataagctg    140040
     ctgtcgattt agtcaactgc cccgctgcaa gcagacgggg tatggaatac gatttgctcc    140100
     ctaatcgtag atttggattg caatcccatt tcttcgctgc aagcagcggg gaatctaccc    140160
     tcactagatt gaagcggagt tttcccaggt ataactgtga atacctgatg gagaaaactt    140220
     ttgggcttta gcagtagaag gctacaattg gtcaggtaat ggtttccctt gctcaagaaa    140280
     caatccagta atctggtacc aagcatggcc aaatgcgggt ccacttcact ccctacccag    140340
     ccatgacaca cggaactcta accataatga ttcgtgagta agaatcgaat gtgccttgtg    140400
     tcagcttatc tgcagttctt aacaaagttc caagacaatt actttgttta aaagaaggtc    140460
     aacgaccgca acgggtaaag aatcatgggt ggaaaggaca aaggagcaaa tccaggggaa    140520
     tgcgaaggaa ggtgcttata tacttcgagt cggataatag cttgaggata gttgatgcaa    140580
     aatcaagata aaccaacttt aaagctccca attaaatcta tattttatat atttctatta    140640
     attgggggaa tacaacttat ttctcaactt gacagactta taaggtgcaa ctttattagc    140700
     atacgaaacg taaatcaatg tacgttatat ggccaaacaa cttgggaatg gctaaaactt    140760
     ttaattggtc cattaatagc cataaccgga ggtttcattc ttaatggata cttcaaaaat    140820
     cgcgatgaaa ggcgcttaga taaagctaaa gaaactgaat tagatcaact aagacatgaa    140880
     actctgatta cttactttaa tgaaatatca aacttgttgt taaacaaaaa ttggcctaag    140940
     tatgggagaa atacaaacat cgaagaaaat cctaacttaa cgatagttgc tttagctaaa    141000
     gcaagaacat catcagtatt aaacgaaatc aatggaaaac gaaaaggttc attattactc    141060
     ttcttacttg agtcaaaagt atggcagatc attactgata ttgatggaaa ttctagttgg    141120
     gcaaatttaa gtttttgcga cctaaacaaa gccaatttaa ctaggattaa tttaagtgga    141180
     gcaaatcttt ctgaagcaaa tttaaactta tgtaatctat ctgaagctga acttagcaac    141240
     actatcatga tcaacactaa gctaacgtca gttgatctta agaaatctaa tctaagtgga    141300
     gctaagctga taaaagctaa cctaagaaga gcgaatctca gcgatgccgt cctcgaaaat    141360
     gcaaatttta aggaagcaaa acttactggt gggattcttc tttcagaagg caaagttaaa    141420
     ttttttttat tttatttttc cttgcggttt tattcacttc ttgtaagaac ctatcccttt    141480
     agaatatcga aatacgctac ctataaatct gataaaatac gtgtttatat aaactatctt    141540
     tttggggcca atctcaaagg ggccaatctc aaagaggctt atttaagaca tgtttctctt    141600
     cttggagcta acttagatag agctgatctt gaaagtgcta acctatcaca agcaaattta    141660
     agtttcgcta accttagagg ggcttccctt atagaggccg accttaaagg agcttctctt    141720
     ataggggccg acctcaaagg ggctgacctt aaaggggccg acctcaaagg ggctgacctt    141780
     aaaggggccg accttaaagg ggcaaattta tgtgacaaaa atattatcaa gcctatcaaa    141840
     atcacgacag gtcaaataaa aaaaaccttt aactgggaaa cagccctcta taaggaagat    141900
     ttccgtaaaa aactaggact cccccctacc ccatcatcta acccaccaaa agaagaatca    141960
     gagtaagcac acccaggata ttcctcccct atcccttccc gaaaccaaca accaaaacgg    142020
     gtcatctacc aaaagacaac ccgacaatga acccaatatt gcttgcccct caacgcctag    142080
     ccgctgctgc aaccttcggc tttggcttat gagcctgagc tttgaccttg gcttgcttgt    142140
     gagcttgctg tttctccaaa ccctgctgag tcgttttagc tgctgatata agcttgtctt    142200
     tcactgcctg gggagccttc tgattgaact ctccattttt atacacgggc tgctgagtgg    142260
     tcttatcgac aatcagcaaa gagttaccct tgcttctatg aaaatcgaag ttttcaccct    142320
     catagatggt ggtgccttgg ggagtttgtt ttccttgttg ggccaaaaca tatgttgcag    142380
     tggcggttag agcttgagcc tgccagtcca tcgctttctc acccacaaac tgtttagcct    142440
     tatcaacatt ctcgccaaca gtcgctttga cttggttgat ctgatcaccc gcttgttgct    142500
     tcaatgcctg agcctgatca tagacaggct gaagtctgtc aatcacgggc tgtaagcgtt    142560
     ctctcacttt ttgcttgaat gtctcaaata gctcagatac cttggccttg gcctgatcga    142620
     ttttctctcc gaggttctgt ttgattttct cgaaacgatc tttcatagct gatacaaggt    142680
     ttgattgcca ttggttgaga cgagggttac tgagctgcgg tttaggggct tgcagtgctg    142740
     cgatcatctc ctgagctttc gcttgttgtt gttctaaatg ggcaacattg gactctaacc    142800
     ccgaaacggt ttgctgcaag tccttgatct cggtggcaaa ctcggctttg atagccgcac    142860
     gaatctgatc cgtgctagtt tccaatgcgg ctactctgtc cttcatggaa ggctggttta    142920
     accgagcttg caccgcttct gtagccgaat ccaaagcact tttcatccgg tcttgggtgt    142980
     tcttaaccgt ctgggaaacc cgatcaaatt gctgaggggc tagatttcgc atcttttctt    143040
     gggcggcttg agcatattca ccacccgcta actgcatctg ggtaagcagg gatggcgtat    143100
     ctacggctaa agccagggaa ccatcttgtt gtggaatggg ttgataatca acctgaatat    143160
     tctcacgcag gtaagcattg gcctgagcca cgaagttact agcattctgt ttagctcgtt    143220
     gacccgcttg ctcaataaat tcattgacga cagggcggat agattggttt ggggagggga    143280
     gttgatctgg ttcaactaca actgcatcta cctctatggc ttctggctca agggattcca    143340
     attgactcat agcctgatcg acgacttgat caggctccat gtcccacgga tctgcgacgg    143400
     gttggcgaac gacttctcct tgttcagtgg ttgcgatcgc attcacctct accttggcat    143460
     tctctggatc ttggactgct gtttcaacgg cttccagatc gtctggggtc gtggtttcgg    143520
     gaagcagttt cttattgcca acttccaggt ccttgaatgc agccctcccc cattcatccc    143580
     ccttcttgac gagctgccat gcagcttgac ccaactgttg caatagctca aggggagtca    143640
     gaaggattgc ctcattggcc cgctcaactt cctgttcatt gccaccattc tctaaaatgt    143700
     ctgccattat tctttatctc caaaattgct tatatcgaga aatatggatt taggctgcga    143760
     ctaaagccaa tacatccttt tcagtgggca tcgggggaag ctcaagctct cccgtcagat    143820
     ctacgaggat tcgccctgca acctggatat aagcccacag gccattgatg cggaagctta    143880
     cacattcact atcagcgggt tgagcgtagg cattcggatc aaagccgatc agcttgcccc    143940
     ctcgatattg gatagcgggg gaataggcaa catccccgta gtagatctgc atctcatcaa    144000
     tgacggtatt tttaggcaat gcatcacacc cccgttgctc cagggtttca atagcattgt    144060
     gatgagagtt gggatattgg gcatacaact caggagtgct aattcccaag cgtgttagtg    144120
     cctgtaactg cgtttccgtg aacgttattt gtgattcggt ttgttcagac atagatgtag    144180
     gttttgaatg ctatgtcaga acattaccca gaatttaaag ggctgaaatt ccaatcgcta    144240
     agatttcact gccgtcgtct tggggagatg aggattgctg ctgttcgggt tcaggctctg    144300
     gcaatgcttc tctggcacgg gtttgatatc ggaccaactc ttcatcggtt ttagcgaggg    144360
     ctttgctgtt cgcccgtgcc actctgcgat accgatacca ttcactaatc ccctgtttga    144420
     tttcctgttg ctcccactgg gggatcactg tttcatagag gacagggatt ctcgccatct    144480
     ttttatttct aaaagctcgg ttcaagtagt agaactgtcc ttgggggaga cccagtaatt    144540
     cttgtagtgg caccagatcc ttcagatgag gctgattact ttcggagctg gatgaatgct    144600
     taccttttga tttggattta ctctgagact tgatttcttt ttgaccaaac tgtttgctgt    144660
     agtattctgc gggttcgttg gcgttgagct gaccaatgac ctgtgttttg cagccctcta    144720
     tcaggcccat tgcagccttc tctccatagg tgcctttcaa gaaggagaac ccttggctag    144780
     caaacacaaa aaatacgcca ttggaacggg tgacggtctg catctcttgg acaccgcaca    144840
     gtttaatcat ttggcattca tccaggaaga agccaagggg ctgcgttctg gcccggtaag    144900
     cgttagctaa cataaagcac tggatcgtcg tcgcgatcat cggccccacg ctggccttca    144960
     gttctgggtt gagtcggaag ataacgaggg tcttaccttt aatttctaag tcaacggtgg    145020
     agtcaccgca aaacgtagat acattcgcgg gagtgaacat gcggttgaac tgaaggaggg    145080
     ttgtacccgc aatgctggcc cccgtctccg ctgatttctc agatgccaga tattgactga    145140
     aggaggatct gagatatggg ggaagatcta aggatctaat ccccgctgct ccaatttcga    145200
     caattcgttc caagaggtag aacgccaaga caaaattagc gttggggtct agatagagtg    145260
     ccagcaagaa tacggattgc aagagctgct tcgcggccag ggggaaaaac tcatctccat    145320
     tatcagcggc tgttttcgct aagttctcgc taaggacttc ggcaacgact ccagccccat    145380
     ctttatcttc ataggcttct cggccaaacc gagagcggat catctgatag atattgaaga    145440
     catccgagtc gtcgtatcct ggtgcaatta ttttgacttt gtacccgtga agcctggcat    145500
     aacccgcaat ctctgaagag gggcaagtgg aggtctctga ctcttcatga cctttggcat    145560
     caaacactgc cagaggatag cccagcttga tcatgcatcg ctggagagga ttgagaagtg    145620
     agtaactttt acctgacccc gttgaaccta atgcaaccag atgttcttca agatgagata    145680
     gtatccacga attgacataa tctctgggaa tgaatatctc tctagcttcc ttatcaacca    145740
     ccaccccttt aggttctccc acccacaagg caactttgtt gcgcttgcgc tcctccatca    145800
     tgtcaaagcc ataggtctta gctttcttta cctctttcgg agtcgcttta cgggcatcgc    145860
     caagcttttg ctttttactg aagccgtctt tgaaaatcag caaaatgatg agtattagaa    145920
     acaaaccacc catcaaataa acctggaagt caatctgagg cccaaattgt tgagggggct    145980
     gagggggttg ctcggtatgt tgtggcatag gtgaaatttc cgaaggatat ctctatcgga    146040
     aacttaccca gaattagtat tactggtctt gatgtcttat cgctgccatt gtcgccattt    146100
     tggattaaaa gcatcaaaca aagcttcagc ttcctcaact gtcataccgt tctcacgagc    146160
     ataaacatcg acaggaggcc aacctcgcat tgaatcagta acaacaaccc aaccttgatc    146220
     tgagttacgt agcgttgctg aactaccagc atgtccatca gtccaactta ctaatgcaaa    146280
     attccctaca attgcaactt tattaattac tgctgaagga gataacgcag aactggcagt    146340
     agcaattact tcctcaactt gatcatttga ttggacttgc gcgatcgcaa ctggagaact    146400
     cagaacaaac attaagacaa ctgcactcaa tattttccca atcatcttgt tactctccat    146460
     atttgtgttt gaggattgtc agacaagtat cttgaattat catacgttcc atcaaaattc    146520
     ctatctgaaa cccaactaaa cgatgcacga ccagaagaat tagacagaat ctgactacag    146580
     cctacattca tacatacacc aatgtgttga taaccttttg aaagggcaat atctccgggt    146640
     tgtgcttcag aaggattgac ttgcttacct cggccagcag caaacttatc agcccaagtc    146700
     ggaacccaat cagtctgcat aggctgaatt cctgctctag ctagtacatg atctacagac    146760
     caagcacaag cttgattccc accttcaggt ccacctgatg tatcaaatcc ccgcatttgc    146820
     ttagccgatt caaagatagc gttattgatt tctcccgctt ccggtgctgg accttgagca    146880
     aaagtggctg agccattggt gggctggcag aaaggaaccc caaaagatgc agtggcaccc    146940
     gttggagtaa ccggagcatt gccattagga ccatagactt caagggcaac tggatcattc    147000
     cacttcacat cttccgctcc tccagggaga ctggtgaact gattacgccc caacaaataa    147060
     tcagcagcct caaaattacc tgaacgaata tagccgatga tgtcatggcc gacttcctga    147120
     ccatagatat caatccaagc taatgcagca cgatcacgct cttctttgct ttcagaccaa    147180
     gcatcaatac ctgtcctagt aaaaagcgta tttcgactct tctcgatgaa ttgatattca    147240
     ccatatgcac ccgtatcagg atgtggccca atatcagttc ctccagtaga ttcaccatac    147300
     gcaatgcggg ctagatattg attgatatga tgttgttcac tgtttggagg tgagctacca    147360
     tcagcaccac cagtcgtctg atttgaatcg gtggtattgt tcgtttgtgc tgaggcaacc    147420
     aatgtaggtt cccggcaaaa ctgctgttga ctgggctgga gattacggat tgcatcagga    147480
     atgcccccag atcgagctag aagcaacatg attccacctt ctttaatgcg ccagggggtt    147540
     ggaatcctga tgaaatgagg ggtgtaatga ctcccagtaa ttggatctga atagccaaac    147600
     tgccatgccg tggacaaccg ggcagatccc acctcatccc ctgacccttc cctcatgtct    147660
     tccaggtaca gcttgacatt gcctgccacc caaggcttaa tcccggtgac ctccttgcca    147720
     ttggctataa ttctcaacca gccttgccca ccgggcacca tctgatctgg cccttgaatc    147780
     caggcttgcc ctgataactt cgtgggttcg ccacccccat caacattgtc caactcaaag    147840
     tgacgacagt tcttggtatc tttcccatcg attttgcagg gtgcaggttt aggaatttgg    147900
     tctttggtcc caccactgat tacatagtcg atgttatcga ccactgcggc agcatcggtc    147960
     gtatcaattc gccccagcaa atccaatcga gtgaagctca acgctaacgc taaatcaatc    148020
     tggtcaagcg gtacatcttt gaggccaggg acttgattga gggtcttatc ttcagaaccg    148080
     gggatatcct taatcgctgt ctctcccaca ccaggagcat cagccaatcc cagcttatcg    148140
     aggggcaagg ttccaagggg taaatccttt attgctttgg cgattttggg attcttcatc    148200
     aactctttga tcagaacttt ggacccttct ttgatcgcta aatccttagc ctgctttttg    148260
     acggtatccc aatccccgtt gataatcccc tgagttaatg ggatgagctg ctttaagggc    148320
     agtttccgca gacgattatt gaccttgctt aaagtcttcg ctagcttgct ccgttcctct    148380
     tctgtgaata cgtcacccca gtctccctct attaaatctt cagcagggat atctgaaatc    148440
     tctgggttag acgctttctg ttcgataaaa acaatgtctg tttgatcaat gggttcatgt    148500
     agaagcggtt cgtcctcgta gtatccaaat gcagattgca ccactgcggg ggcttcttct    148560
     aaagattgtt cagccgcacc aggattaatt tgcagatact ctcccactgt cattgttgat    148620
     gcgattggaa cctcagacag ggttacggtt gcggggtctt tgccactggc tttcaaaacc    148680
     tcattgatat tcaattccgt aaactgctta aactgcggat gatttttcag gtgtccgatc    148740
     ttgagaactt gatctgagct tgcgtttgcg ggccatgccc cattgagata ggagggtgct    148800
     tgggaacctg cgggcaatcg aatactcccc gctgtttcag aggctggact attggcaaag    148860
     gtcggtgcga cgacaccaga tgggtcatag tacaggcctg gtatcgtgcc ttcttcctgg    148920
     gtttgagtat tttgattagc agcctttatg gactgctggt tgataatctg tgctactgct    148980
     gggaacgatt gtagggtgag tacagcagca ggtagtaggc tgaatattcg ttggggatat    149040
     cgaggcatga tcaacagagt tgagtgacag tctgttgaaa cttacccaga attttgggat    149100
     caggattggt taatttagtc taatttttta gcccaaatgt acagtacatc gctatttgca    149160
     cagatgtaca aaattagtgc tccgattgac gaatctgctg ggtttcaatt tttgccaaat    149220
     tccagttatt caaaattact gcacacctaa gttcattatt catcaaacag ttaagtatcc    149280
     aactccttta tttttttaca gcaatcgtca aaattgctct gaactttaaa tgtgtatgga    149340
     tgttcatcac ccaagaggtt ctggagtata ttcaggcttt gttcgtagag ggatttcgct    149400
     ttgctgtacc gtccttggat atcgtagagt tctgccaggt tattgaggct acgagcaaca    149460
     ttggggtgtt cgttgcccaa gagtttctgg agcatctcca aggattgcac atagaggggt    149520
     ttcgctttgc tgtaccgtcc ttggatgtag taaagttttg ccaggttatt gaggctttga    149580
     gcgacatcgg gatgttcgtt gcccaagagc ttctgtctca tctccaaggc ttggtcatag    149640
     aggggttcgg cttcgctgta ccgttctagg gtgtagtaga ggaaggccag gttattgaga    149700
     ctttgagcga catcggggtg ttcgttgccc aagagcttct ggcacatttc caaggtttgg    149760
     acatagaggg gttcggcttc gctgtaccgt ccttggcttt cgtagagtcc tgccaggcta    149820
     ttgaggcaca ccgcgacatc gggatgttcg ttgcccaaga gcttctgtct catctccaag    149880
     gcttggtcat agaggggttc ggcttcgctg taccgtcctt ggctttcgta gactgttgcc    149940
     aggttaatga ggcttgttgc gacatcgggg tgttcgccgc ccaagagctt ctgtctcatc    150000
     tccaaggctc tgtcatagag gggttcggct tcgctgtacc gtccttgttt gtagtagagt    150060
     gttgccaggt tattgaggca catcgcgaca tcgggatgtt cgttgcccaa gagcttctgg    150120
     cacatttcca aggcttggtc atagaggggt tcggcttcgc tgtaccgtcc ttgcctgtcg    150180
     aagagtgatg ccaggttatt gaggcttgtt gcgacatcgg ggtgttcgcc gcccaagagc    150240
     ttctggcaca tttccaaggc ttggacatag aggggttcgg cttcgctgta ccgtccttgc    150300
     ctgtcgaaga gtaatgccag gttattaagg ctttgagcga catcggggtg ttcgctgcct    150360
     aagagcttct gtctcatctc caaggcttgg tcatagaggg gtttggcttc gctgtaccgt    150420
     ccttggttgt agtggagtaa tgccaggtta ttgaggcttg ttgcgacatc ggggtgttca    150480
     gtaccgaatc ttttttttgc ctgtaccagg catttttgtc tccagggtaa agctaaacca    150540
     tagtttcctt gcccttcata atatcgaccg ataccttgaa aaggtaggat caagtcatca    150600
     tcactgagat ggtcaatcca ttttctgata agttcctcta gatgaggaat gcaacctttt    150660
     atctcagtaa ttacatcaat cgttggacgt tcatcaatac cctgttcaat acccactatt    150720
     cctctgcaat aagccgtttt gagggattcc cccttgtcag tgcgctcatg caacttaatc    150780
     cgaaagaact cctttacaat ttgatggagt tgataggtac tctcttccac tcgtttgagt    150840
     aaatttctat ctcttaaacc ttcatctcta aggtcttcca gatcatcatt atcctgatca    150900
     aatagacact cttcaaccag atgccaagga atcggtgcaa tcgcaaacat gcctaataaa    150960
     caggcaagtt cttgttctac ctcacttagt tctacccagc tcaactccaa tgcagaagct    151020
     acccctaact gagccgtcat ccctgattct ttggcaataa gagctttcgc tgttagtttc    151080
     ttggattcaa gacgctcaac tagtttttca aaggaccagt ctaattttct cgctagaaat    151140
     cgtcccaaca attctaatcc taacggtagg ttacccaccc aaccacatag ggttttagca    151200
     gcttctagct gtgaataaat ccggtctggt cccactagcg tttctagaag tgccaaggca    151260
     ctttcatcat cgagttcttc aatggacaaa gactgcacag agctacccaa gttcaaacga    151320
     gttgtcagca acactttgaa cttcggatct gagggaggca gataaggctc aactgcatca    151380
     aactcagtta catcatcgag aacaactagc acatccccct ctcgccaatg tccccaggaa    151440
     tagtcaacct ggcctttttc atctaatcca tctgggagag taatacccag cttggtctga    151500
     gcaaacgaca caatttgggt tgcgatctct tggtccctgg ctcttagcca gcaaaatcca    151560
     ccggggtatt gctcctgttc taattgagct atggcgtatt gcaatgccag ctctgtttta    151620
     ccaatgcccc ccatcccagc gatggctgta atcgcaatcc gctggttgtt ttgtaattgc    151680
     tcgcgaaggt cttgaagctt ttggttacgg ccaacaaact ccttgacacc acttcgggga    151740
     aggttagagg gaatgccagt aggaggattt aactttgccc agtcccgctc aggcgactct    151800
     agtcaaacgg tcttattgat ggtgatgttt tcaccttgaa aaacctcacc acctgaaatg    151860
     ctgttttgga agttggttcc accgtagtta ttttgaactt gggtgtttgt gtccttactg    151920
     atatgaaaat taatttcttg ggctatctgc cgtaattccc cagcaaaggc ttcatctagc    151980
     atttctacgc ctagcagagt agcgacggtt tcaattgcct tttgattacc ttgttctgcc    152040
     tgggttaaag cctgtcctgc cgcgtcatgc ttaccacgca acctatccca aatcttctga    152100
     cggagctttc ccatcaaggt aagggcatca gcagtaaact gttgtgctgc ttcaccagcg    152160
     ctggatttta gaaactcttg aaaggcaaga ttagcaatta cagcggctgt tagggtaact    152220
     ggttcagtca tggctttttg tctggcagat atcgttaaat tatctgggga aagccataaa    152280
     attacgcggc cctttagcaa gttttgataa tcgattgact aatagagaat cgactgatcg    152340
     gaagaaatag tgcaactaat tccttaaaga atttaatttt ctctcagaaa cagtgcatcc    152400
     atctcttgaa aaatcatcct tgagtatcat tacctataaa tcaacagaat actctctgag    152460
     ttcagtttgt agcgattcaa agttgtgcag ctaattctat aaattgctca ttcttgtgca    152520
     tacaaagggg tcttgtcctc ttttggtgaa acagaaaaaa gtgttgtaat tctgctcaca    152580
     gataagaact aaacaaggct aaaacccttg atatagcgtt atatttctca ctcaatttgg    152640
     caagtaatga ggcgttaaat tgtatttcct acgcagatca ccaaaagagg acaagaccca    152700
     tacaaagaaa taatggacaa aagctcaaag cgaattgttc attcaaagag tagttatact    152760
     ctttgaatta ttttcattat ttaggaatta aatgctgtca atactaatat aattccaagc    152820
     acgacaacaa tttgattgaa gcttaaatat ataggttcta tttttggaaa agtactttct    152880
     cttttggcag aatcaactcc ataatccaaa gaaagaattt tttttgcctg aagacgcttt    152940
     ttcctcatct gaaggcgcac tttcctcatc tgaaggcgca ctctccttat ctggtaaagc    153000
     acttcattta ttagaatatt gatttttcca tttgaaaaat acttgggaaa gtttgaaaat    153060
     atttcgcgga ttccggaaca aagactcgac caaaatctat accggaatgg atttctaggt    153120
     ttgctcaaag aataaaattt atttactatt ttttttctaa gtttacttat atgcttagcc    153180
     tttatcgatt taatttcctt ttcaatcaat ttaatgtctt ctttaataga atcaatttct    153240
     tcctcctcta ttattttttc caataagaca atttcttttc gtgctttacg ggcacgaagt    153300
     atatgcttac gagcagcttt ttcaattctt ttaacagcgc aatatccaac tcctccaagc    153360
     aaaatcatta tagccccgag gaaatagagc aaatattgtc tagctatagt atttttttcc    153420
     aattcccaaa ctgaaatata ggcagcaaca atggcagtag cagcgactaa gatttgaaat    153480
     gtcagagatg atcgaagtga ttcgtgatgc cgaacgtgcg tccattgatc ttcgtagtat    153540
     ctaaaataca ggtcatgatt attcgattca ttctgatttt cagtagagtt agccatttaa    153600
     atatccgtaa aataaagaat tacagtgaaa tcatacatat caaatattca tgtgatttta    153660
     tctatcttcc ttacacttca caaagtttcc atcattaacc agaactcaat ctatcaatat    153720
     acctggataa cgtgatgtgc aacttagatt ttggataatc acttcgcttg taatgctatc    153780
     tatacaagga ctacaggctc attagagtat ttagaaagcc cttttatttc taagatttat    153840
     aacctctaat gagaatattc gcatttgaat ttggaagaaa tatgaacctt acactaattt    153900
     aaagggctga aacaacgtaa accggttgaa attatagctg gacatcccgt tagataagaa    153960
     tcagcagact agttaaatca tgccagcacc ctcgacccaa atcatatagg gtgtcaacaa    154020
     atatcctcct agcttgcctc tcaagaatat cttcgactcc agcccgataa cggttccacg    154080
     aatcttcaag actcgtcgct ggccgatcaa tgaactccat tggagagtat ctcatcgata    154140
     aatcaatagg ttctgcttgt ctctctttga cataattgga tacaaattct gaccgttgct    154200
     cacaagtcgg atacttcgcc ctcaattcat caattgttgg aagacctaca tgctgagaac    154260
     tgatataaaa aaatccgatg attacaatgg cgaacggcgt cagaaaaaac aaagcaaaaa    154320
     aggctgggat acctaaaaat ttcttcatca gttttctcta agaacccctg taccccaggc    154380
     cagggtggat caattgattg atattgttat catgctgtaa tagttcattt gtaatatagt    154440
     agatttttac cttgattttt caattttcag agataaaagc cccctgcgtc acaacctatg    154500
     cttaattcac tgaatattta caacctgata cttggcccga ctcgtaggca ccacaaatag    154560
     cacatgctta gccccagagt tcgttacgat cacgagcatt gatgacccat cagagtttga    154620
     gagtttaccc ttgatatttt tgggtctgac cctcgtcaat tgcagcatgg aaggagcctg    154680
     cccttggcat tgctgtaccc cagtacaaag ctgaccatcc aagggataaa gctcaatttg    154740
     attcggtggc tgaaggctca aaccctgaat cttgtcacca ttgttgaggt ggacaatcac    154800
     cccggatgga tcaacggcaa tgggccgcat attggttgtt cctttgaggt tcaactctct    154860
     aacttgctgt gctgaggcga ccgttgacca gctcagtaga aatagtagtg gaactaataa    154920
     tcccttcaca gacgcacctc tcttacaaaa tagagctgaa ctcttttacc gccaaaccga    154980
     aatacgccaa tcttggtttg cgttaggcca ttaacagatt gtcttagtcg ttccccaatc    155040
     cgtccagtgg ctccctcaac aaaagcagcg gtgctattga gatcgctgtt gttcgtggaa    155100
     aggaacgttt ggttcccatt ggtaaaggag gtttggctag taggattatt ccggttactg    155160
     gcccaggtct gaaccccacc tatcccgata tccagagccg tcttcaacca attactattc    155220
     cctcctttcg tctccagctt ggcaatcatc gtcggatcgc catcttgatg gatttcaacg    155280
     gctcctgact ggacaaactt agatccaatc ttagtgagat tgacggagat taagccttgc    155340
     tctgtggcct gggtgacaaa gccaagggct atcgtgcctc gactcgcaac gacatcccct    155400
     gcaccatcct tcaaatcgtc ctgaagcttc aaccgtacaa ctttcccttt agctagcttt    155460
     ggattttccg gtatccatga gacacgatta accacctgag cagaaacagc ggtatccacg    155520
     ggaatcaccg cttggctagc cgttgccaca atctgattca tgtaggggtt tttgaggtta    155580
     ccagagaggt ttccaagctg ccggggttga ggctgaggaa tggacttaga cgcactcgcg    155640
     atctgggtag gaggattaaa caacttaacg ggtttctgag ttgtcttaaa tccttcagac    155700
     ttggttagct tcaacaattt ccgttgacca gatacaggag actttcgggt tgcagccaag    155760
     ggagccgtaa agtaccccgc attcggatcg tccacttcag cctgtgcggc cactgccacc    155820
     gggcgttgga ctgaaaactg tcgttgaggt tgctgagggg gtggagcaac aggtctcggt    155880
     cgataaatca cccgtggagg ggtcacggtt ctttgtggcg tcacggagac tctagaccgt    155940
     gagggttgac ccagtgtaga gggtgcagtg acgcctttgt tcttgttagc caaccttcga    156000
     ccttgctgat cctggcggtt aaaggtttcc cgctttaaga cctcttgcaa gagctgctta    156060
     tcttcgggtg acagggcgga ctgggcaata gcttgggagg gattgaactg ctgctgctgt    156120
     tgagccgtga tagcgctgct ggagttcatg atcagcagta gcccccctcc cagaatcaga    156180
     acgatgctca cacaggcacc cacgaggata attttagttt tgggattttc ggcaaagttg    156240
     tattgggtac ggacggtata gtcctgatcc ccatcatcaa tctctaccgt cgtgtcaatc    156300
     aaagactcat cttccaagcc gtcattaacg gtatctttcc atttatctaa aacagcggcc    156360
     attactagct cctctcgtta aacgcttcaa ttcggataat catcaatccc cgtcgcctca    156420
     cctcggcata gatttgctca atgggcgtaa atgctgcccg ctttttgggg gcctcaactt    156480
     caacgaggtg gatgacgttg ttgaaggggg tagaggcata ggcatcgtca tttttgtcca    156540
     ggtcaatcaa ctcagcgaac accaagactt cccagccctt ctcggttttc tgagggggtg    156600
     caatccgagt gatattgagt aatcgagctt caccctgatt aaacttttta ggcttatagt    156660
     cactaatccc ttgtcgaaac gcttcccggt agggagaggc cagggcatta ctgtagacat    156720
     caatcagggt gggaaggggg ccatatcgcg tattgcgacc tggatcaatg cccgtaggat    156780
     gaacgtctgg actcacccgc tgactccagg caaacaaggc aggtagggcc tctttgataa    156840
     actctttggc gttcgcgtct ggattcagcc gttcggcgga aatcagtttg gcatcttgac    156900
     ccacctggac cacgggtgga cccgcttcaa tcgccgtcag gcgaccattg atggaggcca    156960
     gttgccaaaa caggggggat aggaccacca agccccccgt cgtcgcaatc agagctttga    157020
     gtaaaaaggg cgtcagtcct gacggggtat ccctcgccac ctgttcaaag atagaggttt    157080
     tcagcatatt tatcgtctcc taagtaatcc aagggcagac aagccaaacc ccagtccacc    157140
     accagggggg cgtcgtgcca gataaacgac agcgggaatc ataacgatca ccaggaagat    157200
     cggcagcagc agcggatctt ccccaggcag caaaagcatg accctggcaa ttaacacgag    157260
     aaaaatcttg aagaccaact cgattaagaa caaatccata aacaagccca tgccaaagac    157320
     gatgggtggg ttgtcactcg ggacaaaggt cagtcccaca tataggggca taatcagggc    157380
     cacaatcggc ttggcaaccc gcagcagaat cataaatgct gcggtgatta agaacaggat    157440
     tgaggcaatt agcttcctag cggtgtcggc gataaacagc ttgatctcct tctccacggt    157500
     ctgcccaatc accttgtcgc tataggcgac ataatcatcc gtaatctcac caaacaaggc    157560
     gattgaatct ttcctgagct tctgcgccca ttccacattc ccaaagggtg ccgtggcaga    157620
     ggtcacccgc tgctgtccct cgatgatgca ctgctctcgc tcctccccag agggcagctc    157680
     cgaacaacgc tggaaatcct cttgcattcg ggcttgaact gcccgctgta cctggagttc    157740
     attcaaggaa ctgttcggtc ccgtttccag cttgtctaaa accatctgag tcagggcatt    157800
     gccgaggcga tccgcattga ccaccacatt ccctaacagc ttgccgcgat tcgtgggggt    157860
     gcccagcagg ataagcaaga ggatggcaat gagaaagaga cggatgctat ctggggcttg    157920
     gttcatttct ggatcaagcc agtgacgcac gaggcgaaag aaccaaaacg ccgcaaacaa    157980
     gaaggcgata atcgccccca agttggcaat ctcgataaat agcggggtat tgaggacatc    158040
     ccacaacact tgcactgccg cttccactcg gttcgtgagt tcgttggcgt tatcgataat    158100
     gtcttgggga ttatcggtga tggcagctag ggtgatcatc ggttattcgc cacaaaggga    158160
     ggggcttgct gagtttgagc cgtctgtagg ttgggattga cgggatcagt ttgctggccg    158220
     gactgggcga cgctaaacac gaggttctgg gcattggcga gggagaggtt ctgggccgtg    158280
     cgttcaattt catccttcca gtcctttttc tggttaatct ccagattggc gagggttgta    158340
     tcgtgaactc gattcacgga aaaacgggtc tgctgttgct cagagaactg gaactgtccc    158400
     agcaactggc cgttggcctc aatctgagcg cggatcttct ccacatcctg ggtggagttc    158460
     gcgtcatggg cctggtccac catttcaccg gaggtgcgga tcacattggc cacaaagtct    158520
     ctcgcttcct tggcaaaggt ctgaccatcc tccccaaaca gaacctccaa attcttgcgt    158580
     tgggcacggg tgacggccaa gtcacccacg agggtctgat aggcataccc gctcagcccc    158640
     agtggacccg tgggatctgg gacggaggcg aggaccacgg aggcgatctg ctctctgact    158700
     tttgcgggat cgatctgacc atcgacccca tagacatccc caatcggcgc gccatcaacg    158760
     gtaaccccgt tttcctgctg ctgccgaggc actttaccaa acagccattc tccgtacgct    158820
     aggttgttat caatatgctt aaggaagctg aaatgcttgc caatgccaaa caggcccccg    158880
     accagatcaa tcacgggctt ggcctgctga tagatttcaa cccccttctt gaagtccttg    158940
     gagatctggg tctcttcccc ggttttctta tcgacctcaa agagtccttt gttgttgatg    159000
     ggctgatctt ttttgaagac gctgtagtcc acatcggttg tacgccaata gtcattctct    159060
     ccttccgcaa cgttttgggc ggcaactggt gtggcgatca ccagaaggga gatggggagg    159120
     agttttaagt atctattaca catgatcgat caccttttga tcttcagatt gctgctggag    159180
     gtatagggcc aaagcactgg cctgctcgta tttatccgtg gcgttgctct cggcaaagat    159240
     gcggtcgcgc agctccacct catcgaggtt gttcatcgtc agcccgaagc tggcaaagtc    159300
     gggatagtga tagccaaagt gatatcgtcc ccccgtgcgg atcagccatt gagaggcaaa    159360
     ttctaagggg ggattgtccc gatctgggtt aaagtcgctg tcggtgcagt atcgagcaat    159420
     ctcagggtta aagccgatct ccgttaaatc ttttacggca gtgtccttaa tcgccccgac    159480
     gagataggtg ccgacgttgt ctaggatgga gctggcttca tccttatgct ggagcaggat    159540
     gttaagggat tgacccaccc aacaggccca aaccccggat ttggctttcc ccgtaaacca    159600
     ctccgcgaca atgccccgat agctttcaaa gcgccagagg ttggtggatt cctcggccac    159660
     gacccaggtc cgtttgcggg taaaggtctg gttgagcata ctggcttgag cggccagcaa    159720
     ggcgggaacc atatctgcat catcctggac agaccccaag ccatagacca ctaggggctt    159780
     atcgacttgg aaggaggagg gttcagagat ggctttcccg gactggcgct gcatcagggc    159840
     cactaaggac atcttgatcc gtaaaatggc ttgctctgcc tcatcagact gtagctctgc    159900
     gggcagacgg gcgagggcga tatagtccac gaatttgcgt aggcaaggca tctgacgcca    159960
     tgcctgagtt ccatatcctt ccgcataggc gttggcatag gcggtctgga cgggtggctc    160020
     agacaggtag gccgtgacta agttggtcaa tatatccgta tagaacttga tcagggtggc    160080
     cgtatcatca cgggtggtgg ttaggttctt gagggcaccc actagaaatt tcttaaacaa    160140
     cccttcggcg atatcccgct gctctggtcg cataattctg ggatctggtt tctggaagat    160200
     attgaagaaa tccgaccccg catcaaagtg agaagcgtcc acgaactggg tataggcatc    160260
     aaagctgcct gtgttatcct cccggcccgc gtcaataatc acgacttggg tatcgggttg    160320
     cgagaggacg taggtggaga tggcctggac gataaaggac ttcccggtac gggtcgtgcc    160380
     catcaggatc atatggttat ggggcttacg gccaaagggg tccaccttta agggggaacc    160440
     tgccttggaa ataaattcaa tcccccgctg gtcaggccgt ccgtccatca ccaagggcat    160500
     catcccaatg gccgcagcgg tggtctctcg catttgccga ttaaacttct cggtgagttt    160560
     agccaaggat cctttcaaga gaacgctggt ggtcacgggc tgggcttcca gaaataggga    160620
     atcaaagtag cccgtttccc gtttggcttt ctccccagca aagatgggga tggaagagag    160680
     gcgctgaatg gctcggtcta aggaccgctt atctttccgg tacacaatcg ccatccatcc    160740
     cactttgagg gtatgccccc cttccctgag cttcatttct gcttctaggc ttttgcgagt    160800
     gttatagatg gcccctccat ccaggcgctt acggttctcc gtcatcacca aggactggtt    160860
     ggattgaccc gtattccgct gggaggtctt gaggaccgct ttttgtggct ccgcttcaaa    160920
     ggtggcgatg atctctaggt tagagagggc atcgggtttg acggaatgcc gatctccgag    160980
     gatgggggag ctggcatcca gtagctggtc tagtcgtccc gtgtggggat gatactctcg    161040
     gttggggcgt tggttcagga ccaggccccc ggcatacatt tgccgaccgg gaagccaaac    161100
     cacggattta ccgtagtccg gggtgttctg taagaggact gaggaaatgg cccggcgacc    161160
     attgcgatgg gccgtgatgc tctctcgggt gacgacaatc acctggggaa tggggggaac    161220
     ctcaccggaa ttaaagcgac ggtagaccgc agcccagact tgttcaggag tcatgggccg    161280
     agcggacagc ccacatttat tgaagaaatt tcggtagtgg ataaaggatt catcgtaggc    161340
     agagatcagc agctcatgta gccgctggtc gagctgctgg cccttgcgtc gctcatccca    161400
     ccaatccacg atgctttgca cggtggaggt gaagggatct tgatgccgcc ccattgcccc    161460
     taagtcatgg tggatataga aatgcagaaa tttgggttga tatttccccc gcttctgtaa    161520
     ggctctgacc cgtcgtcgaa tccagtacag aagaaatgag atcggttcac tggggcactg    161580
     ttccccctgg cgattaattt cccggatgcg gtcctcgcag ttggcaaagg cccccatatg    161640
     catggtcaat ggatcgccga tgcgcaggtc tctaaatcct tcttggattt tctctgcggt    161700
     gacgcgggcc tgttctcggg tgctggtgga gggaatgcca tctgaatcct tcatccagac    161760
     ggcctgcaat ttcccctcac gctggagcag gagggcaccg catctaggat ctggatcaag    161820
     ctggaagtca atcaccgctg cgatatcgat atcatcctct gcggggctaa ctttccgctg    161880
     ggccgttttg gggccaatgg tcttggtttt accgattcgc ttcttaaggc ccgacccaat    161940
     atccttctct gttttgaggt tggcattgac tctcagtttg tctgggtgga gtgcccccat    162000
     caccttccaa ggctgagacc ccaagagcat ccagtagctg acggtcaatc ccagccatag    162060
     acccagaacg ggaatccagg gcaaggatag gtgcagggtg gcgatgatcg attggaggag    162120
     gacgatcagg accaacacca cgaccccaaa gacaaacacc tcacggggaa tcatgaggat    162180
     atggggccgc tcgtccaggg cgggcgtata ttgaatcgac tttacttctt ctgtcattag    162240
     acccccctta attggttcct ggattcacaa cgccaccgat gggtgtgcca ccagtggttg    162300
     tgttactggc agttccagtc gttccgttcc ccaggagata ccccccgaga taattaatgc    162360
     caataatcaa taacagtgcg gccaggatgg ctacgaaggg ggccatataa tcttcttccc    162420
     gccgaagttt gtgaacgagg gggacggcca atgccacaag gatggccatc accaggattt    162480
     gcacgacaat gaaaaagaaa tcaatcatgg cgactgcttt ggtgtcctgg gataacactg    162540
     cattcccccg cagtacatct ttcgggccgc acagccagcc cacgcactgc gcgaaggtgg    162600
     gttcacagaa ggcgaaggct agaccaatcg cggcaagaat gacccactta tatttattga    162660
     gaaatcgata gagttgacgg cgctggatgg gattgagtcg agacatagga aatatcctct    162720
     aaagtattgc tgtgtgggca ttgaaacgtt atcgataggc tttccaccaa acgaccccag    162780
     ccgttagggc agtggtgatc aggataaaga cggccaggga agcacagatc ccagataagg    162840
     taccgttacc tgcggtgaat gcccatgaac cgatgtggct aattcccacg gtgatcagga    162900
     gcaatccagg gcagaacaac aggagaactc gccacggatg ggcttctgtc tgatacacca    162960
     tctgcttaat caggggaagg gctgctaacc attgaatgaa cacatctgct ttagctatct    163020
     ttttcatggc atttgaaacc tttaatgacg tgagtaacta cccagcccag gggtggaacc    163080
     gattaataag aacggcttga cggctggcct gagctagata cggccaggga tctacaggct    163140
     gaccgttcat aatcatctcg atatgagcat gggggcctgt gactaatccc gttgccccgc    163200
     tatccccgat atgccaacct tgctccaccc attgaccggg ctgaacatga atcttggaca    163260
     ggtgtgcata gcgagtcttc agccccgtac cgggatgctc aatcaccacg gatttgccat    163320
     agcccccttc ccagtcggca tgtataaccc gtccgctcag catggttagg gtaggggtgc    163380
     cgtggggtgc gcctaggtca atgccagcgt ggaaactggt attaccctgg accggatgtt    163440
     ctctccaacc aaaagcactg gtaacggcaa atattgaggt caggggatac cctatcgttt    163500
     ctacaatggt tgtgggcacg ggctgacgat aggcaacacc ggaagagggc tgaatctgtt    163560
     gtcttggctg agggggaacg gatgtctgag gttgcggtgc tggcgttggt aaaggggcct    163620
     gatagggagg ttctagaggc gttgaaggta tttctccata gggttgattt gtttcctcta    163680
     atgcgggttt aggttgctcc aatggaggag cgaggaccgc tgaatcatct gctaatggct    163740
     ctggaacggg aatatcgata gggactgggg gaaccgtggc agtctccaat ggggcatctg    163800
     tctgaacggc ttcgggttca gggtttggct tggtaacgac tggctctgtt tcgacgggct    163860
     tgggttgctc tccaatggca ggggcaatgt tcccctctcc aatagatgga gctacattga    163920
     gctgcccaag gagtgacagg aggattagag gcttgatcac ttccccacgc ctccatgtcc    163980
     caaaagatta ttgaaagtca cgggcggtaa gcccgatagc tctagcgctt cttcaatgct    164040
     gcgccctcgt ctaagccaga tagcggtgtc ttgagcttgt ccaaattggg gtgtgtgggt    164100
     gttgatttga ttcagccgtt cagcctggta caaccctctc aggagatagc gggcaattcc    164160
     atagttgtcc aagccagagc gcgcgatcag ttgcttctga gtcggcgtct caatcgtcgc    164220
     tttggcctgg agcgtcttgg gtgcgcggat caggggcaat ggttcagact gggctgtttc    164280
     agccttctct tcagtcgttg gctcaactga atcgggtacg tcagactcct ctgtctcttc    164340
     aggtgcaggc tcctttgccc tttttgctgg ttggggttca tcgactggct tggatgctac    164400
     aaaaccagat gagaaagcac tactgaactc cttggagacc tttagtttct taggcttttt    164460
     gcctttcttc tctttgtgga tctgcttaac gggcctggga ggaggtgaaa atatgtttgt    164520
     gacagattga gtgggctgag gctgggcagc atagacaggt tgatttccaa tcagggtagt    164580
     ggtctgactg ggaatcccct tcactcgctt gaggacataa gatttagttg tttccttgcc    164640
     cagaccatca tcaataatca gggtgagggt ggtgctgtcc aacttggccc ctggcttgag    164700
     tttgacgaag ataaatttgg cattgggaat ctggggatgt tcaccaaaat caaatgcctc    164760
     aaactgtcca ggccaagctt tgacgatccg ggcttgggag ccttccaggg taaaggtatg    164820
     cccatgtcct tcagaaattt cgacaacggg tgtcgtctgc gcccgcacca tagcgggtac    164880
     agcggccatc agtaaggcca aggagataga tttgtacatg ataattactc ggaatgaacg    164940
     atgagaaata gtgagtcaat taatcagttt tcaaggactt aagcactaga aaatatatgc    165000
     caatagtcaa gctaaatagc ccaagttaat tagctaagta cattgaatta actaatttgt    165060
     aactgattaa ttgaaagtct taaaaatggt ctaatcgaat tgaaatattc tatttttggc    165120
     tttgtctttt tccttgagaa ctgacagtgg tgaactaaag gaatctttaa acgaatcctc    165180
     agttttacct tcttttttga gtaacgtcct tgagttttgc cccgacatct ccagcgatct    165240
     ccgctgcggc atcggtattg atcacttccg cgaggcgatc cgggccaata ccccaggaat    165300
     tgagcaatac agttaagaac atgccaaaaa gagtccaaaa gaaatttcgg gccatccctt    165360
     aaacctcctg aatcaatctg atgagtattt actcgtgaat gagttggttt atcacgattc    165420
     acaaattgcc ataaccgctg ataccaaaca gagtattgag ttgagggttc tactggtgct    165480
     tgaatggcaa tttcaggatc tgattctggc aatacctctg tagagctttg agatactgtc    165540
     agttgtgatt ggacaggtgc agtgtggtta ttttggtgga gacgcttcag tcgttttagt    165600
     tgagcaacga ccacattaaa tatctgagac aatccagttg ctagaaagaa tttagcaaag    165660
     acaaaattgc gccattccaa tagggggaga ggtggaaatt cgttaatctc gccttgaagg    165720
     aacttccgca gaaggtctaa agcttgcttg tagagtttcc gtaccttttt tgcgggtaga    165780
     cccagataat cactaatctt ttgaaaagac agttcttccc agtgatacag gtgcaatatt    165840
     tcccgctggc gaggatgcag cttgtccact aaatccaata gttctgatga gagagcggga    165900
     tctaggcttc cttggcaatc atctgcttgc tgatccaata gctcaagatt ctcgcgagta    165960
     cccgtgacac tgttgaggga aacgggctga gatatctctt gtaatgtcct gattcgcttc    166020
     tcttttatct cggttccttc tgctagctgg gcaacagtgg catcctcacc caatacagca    166080
     gtagctttct ttagtttaga gagctgctca taggtcgatt taggcagtcg aatatggttt    166140
     ttctgatgaa cggcttcaga ttggaacttg taaatcttgt ctctactgaa ggtacgtata    166200
     ttggcacctt tctcagaact ccattgatca atggccttat ttaacccaaa gtatccttcg    166260
     ctgatcagct caccatcttc aatgcctttg cgggacaagc ttccccccat agagcagatc    166320
     caggcaagat ttgagtaaat cacggtttgc cttgcgtcgt tatcaccatc ctgagctttc    166380
     aagatcagct cagcttcttg ctcaggtgac aagttaggat gtcgggcgat ggtggcgatg    166440
     atatcgggtg agggtcgaag tccagtgcct ttgatcatga gtcggtactc cgaatgaagg    166500
     ggtggagtga atgagagagt gcattaagag attgagggga tactcggttc tagcgaatat    166560
     cgggtaaatg taaagttcga tcgcaatact ggccatcttt gcggtactgc ttggtgtcca    166620
     ggtcaatacc atttgctggt tgttacttgc cgtcagctaa acaccagcaa actggttgga    166680
     atttctggag tacgcttttt attagttgtg ctcagtatct gaaaagtcta aataatgaga    166740
     ctcttcttga gagatggtca gtttttggat ttcccctacg gaccgatcta tcggaaccgt    166800
     cgcaggattc gtgaaggctg acgtggattt gatcgccaac agcccaagtg gtaagaacgt    166860
     ggttttaagc attttatgtc tggtcgaata cctatacagg gaacataggc agaatggcac    166920
     ttgaggtgca aatttgcctt aacgataggt gtttcagtga ccgacgcccc cgtgacatac    166980
     gaccagcacc actaggttcg ccctctttac caagttgctg aatttcatta ctggataggc    167040
     gaagcaccaa agaatgctgg gggttattga gaaaacttgt tcgatgtgaa tggtggcaaa    167100
     atgagcgaga gctgacgtgg atttgatcgc caacagtcca agtgacaata atgtggtttt    167160
     gagcattttc tgtgtggctg atgagctaca caggaagggt aggtagggtc gcccttgaag    167220
     tgcaaattgg aatagtgggt atactgttta agtacagaca ccttgtactt atcatgctct    167280
     ccaaagatat aagctatacc caagctagag cgaatctgac tgacactctc aatgatgtgg    167340
     aagacaatcg ttccattgtt gtcattcgtc gtcgagggcg gcccggtgta gctttaattg    167400
     cggaagatga actgaccagt ctcatggaaa cagttcacct attgaaatca cccaccaatg    167460
     ctaagcgcct tttcgaggca ttggatgaag tacaatcagg ggatttcgaa gtggctgata    167520
     gcattcacga actggctgag gagctagggc ttgagcaaga agcgtagtct atcagcctcg    167580
     aaagactcta ctgaaatcgc tttctcgcgt aagtttagag aagacttgca gtattgggtt    167640
     aaaacggatc gaaagactgc cctacgatta ctcgatatcg tggatgcaat tgagcgtgat    167700
     ccctttaagg gaatcggtaa acctgagcca ttgaagtttg ctggatccga tttgtggtct    167760
     cggagactga cccaagaaca tcgaattgtc tacttagtcg aacacgagaa agtctatttc    167820
     ttagctgcca gattccacta ttagtcagga acatcaatat gatgagatac tttccaagct    167880
     gagttcccag aatgatcctt tgaataggag tatccctgca ttgagacaca tcatcaaagg    167940
     ctcgtgacta ttgatggtgt cgatctggac tctaagtttt ctaggttgaa agtctgagtg    168000
     gatcgagtat ttttagcagc cttgaagatt caagggttgt tcatcctgcc ttgaaggata    168060
     ggtcaaagcg gtgaagagca ggaatacaac atcaaagaca agatgcaagg ccacttttat    168120
     cacatccctg agcatcacta aaacacccat caacaggagt ctcattagcg ttaatcttgt    168180
     ccgggagact gaacgggact tgaaggtaat cagcttccca ggtaaacaga cgaaaatcga    168240
     tagggcgatc acgttgacga tcaataagcc taaaagcagg taacctccaa tgccagctag    168300
     aaaggagcct ttttcaatgg agggtatcag cttaatcaag gctgctaaga ctcccaccat    168360
     acttaaggga gctagccagc tgggaaggtt gataccttgg gtgaaatcct ttagtagatg    168420
     taacccttta ttgagggcaa acccaaacca atcaatctgg caatctgaca tcacttgcac    168480
     ccagagacat tgccgatatt ctagccacgc ttttagcgtt gtcaatattg gattcagacc    168540
     ccaggtaaga tatgccccaa tggtgtagct ctcgtcaatt catgaacagt tttctcactg    168600
     agtcaaatca gaatcaacga tccagaataa aaccaagtgc agcctgatca gcgtggccta    168660
     agctcaagaa gcagatttga cctgtaattg attgcaagga atactgtcta cttgaagtgc    168720
     cgttgctagt tcactggaat ggacttcaag gtgcgctctt ggcggtgcat ggaatagtaa    168780
     tttttggagt ggaaaaacga cccgctcaaa ataccaattc tcaatattgg agatgcggac    168840
     gatttgtacc tggtgagttg gatttcgata gcagcacaag agcaaatctg tctgctgtga    168900
     ctcaagagta gtattcataa gaaggtataa aacaaccttt agaatcaaga ttctaaaggt    168960
     tgagctgagg attttagacg aaagtgatgc gcacgcttaa cgatggattt atgttctatg    169020
     ggaactgtct aagcaagaac aaaatcacgc gaattttcaa gtcttgctga caagaacaac    169080
     attaacaaac ctaaatttta ttctctgaat cgttatatta atttgcaatt ttatcctttc    169140
     tgtgtattag gtatctttga atactttgat ttctatacag gatggttttt gtgatgacta    169200
     tgtaccgacc tgcagaaaat cgagaatagc ttcgttgact tgctgcggtt gggctaaagg    169260
     taagtcatgc cctgcgttct ttacgactgt aacttgaata tcgggagcaa ctttctgcag    169320
     cctgttgagg gtcttgggaa ctgaatagat gatttcattc tcacctgtta tgaacagggc    169380
     gggaatcttc aaggcttgaa gttcggcatc tttgaatact ttggcaaaca caattggctg    169440
     tgcttggtgg ctttgaatgc ctaagtagat aaactcaaac caatcctcaa acttttcctc    169500
     accctgactt tgtgttttga taaagtcttc aaacatccac ctcgtcagct gcttaaataa    169560
     caatttgctg cgaaattgga acaaacttaa aaagagtgca aacgctataa acttgactgg    169620
     aaatggagaa ataccagcgg gggcaatcag gcaaatctta tggagtcttt gggggtacct    169680
     caaagcatat cgactgacca accacccccc ataggacaat ccagcgaggt taatcccttg    169740
     ctttaacccc aatccatcaa atagctcttc aagccagtag ttgtaatcat caattccttt    169800
     catcactttc gtataggtac tacgaccggg atctgagatg atatcgacga cataggttct    169860
     gtactgctga gacagttctt ggatattcgg caaccaattg agcccattct cagaatgacc    169920
     atgtagcaat accagaggac tgccttcgtc tggaccacta actcttacga aggtttgacc    169980
     ataagaagta tcgatgtaat gctctgtgga aggtatcggc catttttttg cccgagcatc    170040
     atagtgagct aagtatgttt ctttggcctc tgctgacctg aagggatgat aatcgctgat    170100
     cttcattggt tgggttgtgc aatttatttc tcaatttatt ggttctttat catttggtat    170160
     ttgttccagt tgctcttgca atacttcaat aggcggaagt ttgtcttgaa cgggtagggg    170220
     tagctgatca ccaaggtgat aggtggaaac gccaatggct tggttcatat ctcgcaatga    170280
     gtattcaatg atggtttgat tcttagattt gcaaaggatt aaaccaatcg tcggttgatc    170340
     accaggtgat ctgagcagat catcaactgc tgccacatag aagttcattt tccctgaata    170400
     ttcaggctta aaccctgtca tcttcaattc gatgacgaca tagcagtgca ggcggacatg    170460
     ataaaacagc agatctaaat agaagtcttc tcctccaatg gttaacgggt actgattccc    170520
     taaaaaggcg aacccaactc ctagctctag taaaaaatct cgcatgtgat gcaggagagc    170580
     gttttccaga tcgcgctctt ggacctcttc agcgataccc agaaattcta agtggtaggg    170640
     atctttgagc aatgcttggg ctaggtctga ttgaggttgg ggtaaagcac ggtcaaaatt    170700
     ggtgatcgcg cttccttgtc gtttgtgtag atcgctttca atttgatgga cgagaacact    170760
     ccgactccag ccattctcaa tggttttctg gctgtaccat tgcctaatct gtgggtcttt    170820
     taccttgtct aaaagaacgc aattatgaaa ccagggtatt tgtgcagcag cttgctgcac    170880
     tatttgttga tcatcatagg cttctgcaaa agcccgcata tatttaaggt tacgagcaga    170940
     gaatcctttc atctctggga attcttgtcg caagtctttg gacagctgat cgatgacttt    171000
     tgcaccccat ccctgctgtt gctgacgagt caggatctct cggcctattt gccagtagag    171060
     caataccaat tcttggttaa cggctagttt ggccttgact tgagcagccc gtatacgagt    171120
     tttgacatca ttcagaaaaa tgtcatatcc ctcaaatgat gataatgaac ctgccatgaa    171180
     cgtccctagc gttgtccata gctgttatac cgcttgtcta aagccgtggc aattcgtcta    171240
     atcgattagt ggctttactg ggggatggtg ttgctgattc agcttaaaac tctttcaaaa    171300
     aaaatatttt gaagtttcag atacctaata aatgcactaa aacttcaatt tcttttagga    171360
     tacaaactat tttcttgatt gctgatgggt tgaagttttc atttctgctg tggtgtatga    171420
     cagaacaatc aaatcttcta gctcaattaa acgagtccct ggtttccgca tctggttgat    171480
     acacatgatc aactgattaa ggcgttctcc attgagacgt ggcatttctg actttctcat    171540
     gttggatatt gaattactac taacacccat cgattcagct aaggctgaag ttgtgatgcc    171600
     atgcttatcc atagtttgtt taagcttcca agttatcaat gacccattct cactcacaaa    171660
     atcctccaaa ttgtaagtta gacaaggttt taccttatat atcaaattga agtctagttc    171720
     atattatttt aaattgtttg aaacaagttt aacttgtatg atataagcat agtatccaca    171780
     aattagtttg caaaactaac gtataaatac ctggtgtaag agcttacaga tggaaaattc    171840
     gaccttactt ctatagtcca aaccatgtcg attgaaatag tgtccagtgg atattggata    171900
     ttggaataaa gtgtttaatc caacaaacaa tcgatctcgt tcaacaaaac tggtctgagt    171960
     cttccaagca gttcttcagg taaattaacc attctgcaat aagccattga tacttcattc    172020
     actcaagttg tcgatgtgca aaccaaaaat ctatttacag ggaggtgatt atttgatagc    172080
     tttagtgcaa atttatctat ccttaatgag aaagattatt atctagctac gtaattctca    172140
     ttccgttctc tggcctgaag atagagagaa caccaacatt aaataaatgt ctaccggggg    172200
     gtatgacatg aataacccat atagatcaca tcctgcaaca acttcagaat tcctagcttt    172260
     tcattccatt ctgcctagat tgccaaccaa aaactgctct ctaaccgctt ccaaacaatc    172320
     agagagccat aaaccttaaa cacaacaata ggctgagcaa ggtcttcagc cttacataaa    172380
     attcaaagac cctctaaccg cttccaaaca accagagggc cataaacctt acacacagat    172440
     tacggatctg aaaggtttca attatggtag ccacacttgt atcggatcga caatcgaatt    172500
     tatcagaatt taatgaccgt cagtcgcaat atactctgat tatccaggcg caagctgggg    172560
     atttaagggc tagagatcga tttattcgcc aaaatgaagg tcttgttttt caacaagctc    172620
     ataaattccg aggattagca gactgggacg atctagttaa tgcaggaaat cttgggttag    172680
     ccattgccat ccaaaagttt gatgttgcca aaggctataa gttcagttcc tatgccgtca    172740
     aggttattag aactgaaatc agacgattga tccatgagtt caagggaatt agcattgaaa    172800
     tctccttgca cctcaaggag attgaacaag cctctcaagc cataaggatg gacttagatc    172860
     gagaacctac gatcacagag ctatctgatg agacggggta ttcccagcag gtgattttca    172920
     atgcttggaa taaagcgaac gtcgttgaaa cggctagctt gaatattcct ttgaatgatg    172980
     atcaaggttg cgaacagctc gatgtcattg gggttgatga ccgaacttgg gaattcactg    173040
     aaaccctcga tcagaagaac tatattgctc aactcccaga tcgagaggct tttatcgtca    173100
     gagccaaacg agacggtttc agcaacaaag agatcggaac aatgttaagt ctgtctggtg    173160
     agagagtcag acaactgttg aaacaagctc gtgcctttct caagcactta atgacttacg    173220
     gggcttgttt cgttcagttt cccaagcctg ttccaatttc tccagtgaag agtaataagc    173280
     aagtcctaaa gcgagtggac gctacacgtc tgggtggacg catcggcaag gtcattacac    173340
     aggttttcaa tccatttaag gagtggctga ttgaagagaa cggagggcta aaccatgctc    173400
     aggaacattt tttggatttt cgtcggtgta gcaatcacgg ggctgttgat gtcgcgaggc    173460
     atcaacttac cccagtgaat cagcgatgcc atcaactgga gagacctcaa gtcaattggc    173520
     taggatatct gggattcaac ccagtaattc tcaatatact tttactgcca ttagcgcttg    173580
     tatctaagag cattagagga tttcagaaca atgatagacc gaacataagg aggccaatga    173640
     tgtcgtttgt tattacaggt gtatttggag atgtaggcat cggatattgg aaagaacacc    173700
     ctcgaccgcc gaatgattgc ccagagacta acgaaagttt gcactaatca agcagcgaat    173760
     ctcttcattc tgatacgagg aattaaccga tgtttttctt cttcggatca tattgcctca    173820
     gatcctgaaa cccttgatga tcttttgttt taaagccttt gcgtattgag ggctgaagcg    173880
     tagtatggtt cactaagaat ctttgtattt ttccccagga ggtgacgatg ccctaaaaaa    173940
     aaggaatccc agctacggaa atagccaggg ctccaggaaa aaacaaatat tttttcgaga    174000
     ttgcgggatc taactgattg ctttgagcgg gcagaaagtt agtgatccac gaggtgtgtt    174060
     ctcattattc tagaacagcc gactttgtgc tgcaagaatt ttgtaattga actttactta    174120
     taacacctct ctatctcgct actgataaac gatagaggga ctttccatgc tttctatatt    174180
     cgtgtatcct gagccgctaa tggttcggga atcgactcat atacccatgc atcatcaagg    174240
     aggccatcaa tgacctccac cacctcactc aatctgaaca cacctcacct tggctttggc    174300
     acctcaacga gaaccccatc taagctgacc cccttccgag gagcaaacca ctgccccatc    174360
     tgtgactccc acgatggccg ctgccggggc ggtggtgaaa tcgttctctg catgtccgag    174420
     actcaggaca tcggtgtcgt caacggctac aagttccgca agctcaccaa aaactatctc    174480
     tggggcatct gggcacccca cgcgagtgaa gacttcaatg ccattgactg ggaaacccgc    174540
     aaagccttaa gggaaaagca agcagaagaa aaacgacaac agcggattgc cagagagctg    174600
     cccccacaac tccgcgatca gcaatatcga caactcctct ctgacctctc cctctgctca    174660
     atggatcagg gagacttagt tcgtcggggc atgtcccaag ctgaaattga tggcttccca    174720
     gccttctccg tgggccagtt ccagcgagtc caagacctgt ccccagatct gcccggtgtc    174780
     ttacccggtg gcatcctcaa ttctcaaggg ggctatctct ggcccctcta caatgtccac    174840
     ggtcaaatca cagcgttgca gctcaggaag cggaatgttg ataaagacaa tcgctacatc    174900
     tggctatcca gctctaccaa acgcaatccc aacggcaatg gtcctcatgt taacggcgaa    174960
     attcctttag ccatctacaa gtcctttggt ccatactctc ggattgccct cgttgaagga    175020
     acgggggtta aaccctattt actctctcaa cgattaaatc tacccacgat tggagcagcg    175080
     gggggactct gggcttcctc tcctgaaacc ttgcaggaaa ccctgaccgt cttatcgaaa    175140
     gatgctgagc aatccccaat tatcaccctc tatccagatg cgggtgctgt gcggaatctc    175200
     aatgtcttcc gtcagtatca gcgagtcatc cgcttactag aagaatgggg ctattccgtg    175260
     gaagtggcct ggtggggaca gacctacaag gagaactcct gcgatataga tgaactcacc    175320
     tcattggaac tagctcagat tgggttcaag cccacttggt tcttcaatag cttgggtctg    175380
     gaatatgaac tgggtcagtt atttctgaag ctcaatggct tatcggatca agccacgacg    175440
     attatcaaca aacagtacat cgaactctcg gatctaggca cgattgatcc ggggtccgtc    175500
     gtcgctattg catccatgtg tggcacgggc aagacggaga tgctgaagtc gctggtgggc    175560
     caggtcaagg gccaggtgat tatgccaggg tatcggaata acctgctgtt taatactgag    175620
     gaccgattca ttgaacaaga cgccaacggc aataccctct ataagctgat tcacttgttc    175680
     cgactcaaca aggaatacca gggcaatatc agcatgggct ttcgctctga acggtccatc    175740
     ctgctctgct ttgatagtct tctcaagatt gaacttgatg atattgaacc cgatagctgc    175800
     atcatcctag atgaagccga tgctgcttta ttccatgttc tcagtggtca gaccttgggg    175860
     gatcggcaga atcagatctt ggagcatttt catgcgatcg caaaccgggt cttagaaact    175920
     cggggcaata tcattctctt agaagattcc ctgtctcaaa ttcccattga ctatatcaag    175980
     ggcattacag gcgggaagta caacactaag attgtcgtta atgaatacaa gcccgatgat    176040
     aactttccca cgaaggtgtt ctctgggcag acttctcagt ttctagagag aatcctcaat    176100
     gccgtagccg ccaatgagcg gtttatcgtt gttgcgacct ctcaggaatt cctagagaag    176160
     ttagagcgga tgattgcgga gatgaacccg gagtttgcca aggggatttt gcgtcatgac    176220
     cgcaagactt cggagcgcac ggagaacaag atattccagg ccaatcccac ggagtttgtc    176280
     gaggactatc aacccacggc attatttttg agtcccacgg cagaaagtgg ggtcagtatt    176340
     gacgaacctc gtctgattcc ctatttcagt cgagtcttct gctatgcctc atccaaccat    176400
     gcccgcagtg tctatcagca gctctggcga tatcgggcca aggtcactcg tgaaatctat    176460
     gtgactcgca aggctcatat ccctgatatt ccttcgatta agtccgtgga acaagtcatc    176520
     atgctccagt ccaaatatgg acaagatgtg gctgcctcca ttgatttaga acagcagttg    176580
     atccatgacc agtccccgga aacggctcag cagttagcgg cactgaaagc ctatcagcag    176640
     aatcccaaca actgtcacaa cgtcagcttt gctcgatatc agactcgctc gattgcctca    176700
     ctgttagctc tcagagagtc cttgatgctg ttgctggagg atcatggaca tcctattgag    176760
     atggaggaac tgagagaccg caatgccgat atcgtcgagt ccttcagtaa ggtgcggaag    176820
     cagatggagc gggagacagc cgtcatgatg gggacggcag acggggagcg attcacggtg    176880
     gagcaggcca tacgagtgat ggggagttct tctgccacct ataaagatac gttggatgcc    176940
     aaaaaagtct tactgcaaga tgagctgccc ggtgtggacc ttacagatga gtttattcat    177000
     caagtctgtg tggaacatcg agggcggttg aagagtgcca cgaagttgca ttggatgtct    177060
     tatcaccctg aaattgctga ggaattagac cggagaaact ttatgaaaca gctcaatagt    177120
     cagttcgttc tcactcatcg gttaaccaat aatcgcatcc ag                       177162
//