Dbfetch

ID   CP000841; SV 1; circular; genomic DNA; STD; PRO; 226680 BP.
XX
AC   CP000841;
XX
PR   Project:PRJNA12997;
XX
DT   29-OCT-2007 (Rel. 93, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Acaryochloris marina MBIC11017 plasmid pREB4, complete sequence.
XX
KW   .
XX
OS   Acaryochloris marina MBIC11017
OC   Bacteria; Cyanobacteria; Synechococcales; Acaryochloridaceae;
OC   Acaryochloris.
OG   Plasmid pREB4
XX
RN   [1]
RP   1-226680
RX   DOI; 10.1073/pnas.0709772105.
RX   PUBMED; 18252824.
RA   Swingley W.D., Chen M., Cheung P.C., Conrad A.L., Dejesa L.C., Hao J.,
RA   Honchak B.M., Karbach L.E., Kurdoglu A., Lahiri S., Mastrian S.D.,
RA   Miyashita H., Page L., Ramakrishna P., Satoh S., Sattley W.M., Shimada Y.,
RA   Taylor H.L., Tomo T., Tsuchiya T., Wang Z.T., Raymond J., Mimuro M.,
RA   Blankenship R.E., Touchman J.W.;
RT   "Niche adaptation and genome expansion in the chlorophyll d-producing
RT   cyanobacterium Acaryochloris marina";
RL   Proc. Natl. Acad. Sci. U.S.A. 105(6):2005-2010(2008).
XX
RN   [2]
RP   1-226680
RA   Touchman J.;
RT   ;
RL   Submitted (25-SEP-2007) to the INSDC.
RL   Translational Genomics Research Institute, 13208 E Shea Blvd, Scottsdale,
RL   AZ 85004, USA
XX
DR   MD5; 93075f68338feca94e19cea9411300b8.
DR   BioSample; SAMN02604308.
DR   EnsemblGenomes-Gn; EBG00001236573.
DR   EnsemblGenomes-Tr; EBT00001581812.
DR   EuropePMC; PMC2538872; 18252824.
DR   StrainInfo; 373281; 0.
DR   PubMed; 18252824.
XX
CC   Source bacteria from Marine Biotechnology Institute Culture
CC   Collection, Marine Biotechnology Institute, 3-75-1 Heita, Kamaishi,
CC   Iwate 026-0001, Japan.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..226680
FT                   /organism="Acaryochloris marina MBIC11017"
FT                   /plasmid="pREB4"
FT                   /strain="MBIC11017"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Acaryochloris marina"
FT                   /db_xref="taxon:329726"
FT   gene            566..853
FT                   /locus_tag="AM1_D0001"
FT   CDS             566..853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0001"
FT                   /product="RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32498"
FT                   /db_xref="GOA:A8ZKA5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKA5"
FT                   /protein_id="ABW32498.1"
FT                   /translation="MSIYVGNLSYDVTQDEIQAVFAEYGAVSNVHVPKDRETGRMRGFA
FT                   FVELGNDAEESKAIEELEGAEWMGRTLKVNKARPRENNRGNNNFSGRNRF"
FT   gene            complement(928..1164)
FT                   /locus_tag="AM1_D0002"
FT   CDS             complement(928..1164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32499"
FT                   /db_xref="GOA:A8ZNB3"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNB3"
FT                   /protein_id="ABW32499.1"
FT                   /translation="MLVDVCQTLRWETPVYTMVSSDEWFICECELSVLGQQLEGSGVAK
FT                   KKKLAKSIAAREILEQLRERGQQQLQEWLERAT"
FT   gene            complement(1331..3244)
FT                   /locus_tag="AM1_D0003"
FT   CDS             complement(1331..3244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0003"
FT                   /product="exoribonuclease II"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32500"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNB4"
FT                   /protein_id="ABW32500.1"
FT                   /translation="MPSSTLEKLSQLRSQLQQCSNPTAAKVLKSAIKKLEAQLDPGQSK
FT                   TTASKIAQRKAALRHSKKQAKQKSLQQERTTLKPPLSQKLESKPEGVLQHKKPITLDQE
FT                   KPIEQAKSTAAVQDEKPKPLTQDSPPAKTETTPKSKNRFSPDVIKIAKRLVLADELWER
FT                   PQVQGITIDGPTSRDLDDAIWIEATESGVVLSVHIADVSELVEMGSILDKVALSRTVTR
FT                   YFSNGNAPMLPRPLSENKLSLLEGEARPTVTVQVTLNPNAQMVDVKIFESWLVSHKRFT
FT                   YAEASQPKSSTPFHNTLEMAHQWASHLYRNRLTSGSIGATQTAQGQWLTEEGSLIQGKL
FT                   HPSHILIQEFMILANLAVAQWLADQDIPALYRNHTARAIAPDRETMYQMLLMLGSNAAI
FT                   RQRLHSWMNRAVYSPVLIGHFALNLPAYCHFTSPIRRVADLINHRIVKARLKQQDLPYT
FT                   QSELEELGQHIAQVKDEHKEQASEFFKAAHQKVYQEQLQTPEDLANLTGKEFTRLLKYA
FT                   VESQGVDHLRSELVNRLDAEQLAVQDLYLLLFQSKELELHQQVIQYLSSHIHDAASVIT
FT                   IASNREGNWEAFKYLEAENKPPFHVWLEVKISGDTLTTIHPATHSRKQPARHHACLIWI
FT                   EA"
FT   gene            3374..3568
FT                   /locus_tag="AM1_D0004"
FT   CDS             3374..3568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32501"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNB5"
FT                   /protein_id="ABW32501.1"
FT                   /translation="MNHCAFQTSHQAKDLRHTQDGQAIAEFVVTIPPLREEDPPENLKA
FT                   IYWGENGETPTFPYNLATN"
FT   gene            3715..3855
FT                   /locus_tag="AM1_D0005"
FT   CDS             3715..3855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32502"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNB6"
FT                   /protein_id="ABW32502.1"
FT                   /translation="MLSQQVKVKLRVARPILEPLLFTKGMMMKSSRNAECSPLMIRYKG
FT                   S"
FT   gene            3923..4714
FT                   /locus_tag="AM1_D0006"
FT   CDS             3923..4714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32503"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNB7"
FT                   /protein_id="ABW32503.1"
FT                   /translation="MAPDNKYSTVLLELKTHYQETLAELEAQTSQLKTKITSLDTLIED
FT                   PLLGSDILSILQGEADSLTSPEPVSKTADTVELKAKSKKATPKAASKKKSTPPKKPAST
FT                   AKTKEKVKPEVDAEATPKKAAQKASPSSGKRKSSTSKKAVSQATAKKKSQKKTSSSSSS
FT                   VLTMNKPYDQMKKIDAITQIMQENPGKVMHYDDLIVRLFGELSKDDQKAERGRIKAAMY
FT                   QGAKNNLWKKANVPMCYIYDPSLKAESKATTSKTQKSRKKT"
FT   gene            complement(4747..5229)
FT                   /locus_tag="AM1_D0007"
FT   CDS             complement(4747..5229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32504"
FT                   /db_xref="GOA:A8ZNB8"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNB8"
FT                   /protein_id="ABW32504.1"
FT                   /translation="MSSKNLQISQPRTPRESVELELSAGSDVMESNLSGEILGLSMYQQ
FT                   TAWSIHETLRMCLDLVAEEHWFMNNLLPFQAISPHKIRVFHPKSFEDAEEAINAMKTDD
FT                   MLLVNLAALETKLAQRLTDYLAGSTFALSGEQMEIGRGIFLFAPPSFLISRMMASA"
FT   gene            complement(5274..6101)
FT                   /locus_tag="AM1_D0008"
FT   CDS             complement(5274..6101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0008"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32505"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNB9"
FT                   /protein_id="ABW32505.1"
FT                   /translation="MVKDNDQTTKQYSSKDLKQRKTWYSPAAEAYNRTRPHYPDTLISR
FT                   VVELTQLENGSRILEIGCGPGTATVSFANLGFSMLCLEPNPDFYEIARRNCSHYPNLEI
FT                   KNTSFEEWKPEAKPFNAVLAATSIHWIPAEVAYPKVANALQDNGVLILLWNVPAIPYRE
FT                   FHQVLQDVYQIHAPSLSHYKGRETHEAELRELGQIVATSDQFEGIVFEQIIWETSYSVD
FT                   EYLTLLSTFSQYLELDEKSRKDLFVGLQKKIDNHFAGHIKLLNISAFHIARKR"
FT   gene            6377..6619
FT                   /locus_tag="AM1_D0009"
FT   CDS             6377..6619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32506"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNC0"
FT                   /protein_id="ABW32506.1"
FT                   /translation="MTDFKHRPTNLGQHLWSPRNLAEQTHAAAQSAELHSRSVGQASLS
FT                   QKLLDIQRQLCILQLRLKDPEIQEWTGKQMQLPFR"
FT   gene            complement(6659..6802)
FT                   /locus_tag="AM1_D0010"
FT   CDS             complement(6659..6802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32507"
FT                   /db_xref="GOA:A8ZNC1"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNC1"
FT                   /protein_id="ABW32507.1"
FT                   /translation="MGAGSGVLGLKGLSYLVLSCLVGLSILLFQGKKPQFSVILNERWR
FT                   CI"
FT   gene            complement(7037..7780)
FT                   /locus_tag="AM1_D0011"
FT   CDS             complement(7037..7780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0011"
FT                   /product="two-component transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32508"
FT                   /db_xref="GOA:A8ZNC2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNC2"
FT                   /protein_id="ABW32508.1"
FT                   /translation="MPEFMNNQSNKQHSILVVDDEGPIRRILDTRLSMMGYHVFTAADG
FT                   VEALEIFDRQHPDLIVLDVMMPRLDGYGVCRAIRKTSRVPIIMLTALSEVGDRVTGLEM
FT                   GADDYMVKPFSPKELESRVRCIIRRMGSLKPFNYRVTGVLNIGSLRIDTNKRKVFRGQE
FT                   RIILTHMEFSLLELLASTPGAVVSRQELLEKVWGYSNGTIVDSRVVDVHVSRLRNKLKA
FT                   NQVGTELIHTIRGVGYTLKCEQSPN"
FT   gene            complement(7940..8554)
FT                   /locus_tag="AM1_D0012"
FT   CDS             complement(7940..8554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32509"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNC3"
FT                   /protein_id="ABW32509.1"
FT                   /translation="MTPPIVALNPKLVPKTIIPQLPKSVPSLPKLVSRTAFPKKTPEGT
FT                   RPAKLEQGHEELGGLRRSSRRTHRSAKPEYSPKTQTSEAAQTSQPRTPRVSAELERRFK
FT                   NLELKQKNLVEQTRTRGELEYLAVSKNESEEYLITVAGTGKPFVRNTFATPEFCWECAV
FT                   EIEENFEIGEVIELRPPETMERIGEMVGVWLERERVTRVWG"
FT   gene            complement(8582..8860)
FT                   /locus_tag="AM1_D0013"
FT   CDS             complement(8582..8860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0013"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32510"
FT                   /db_xref="GOA:A8ZNC4"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNC4"
FT                   /protein_id="ABW32510.1"
FT                   /translation="MNNLVIFPGQSSSEIYLSNPSSFREAKEAAHCLKNGQLLLVNLEN
FT                   LSPKSAQRISDYLAGCTNSLCGEYTEIGNGVYLFAPQTFPIVKQSKY"
FT   gene            complement(8980..9108)
FT                   /locus_tag="AM1_D0014"
FT   CDS             complement(8980..9108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32511"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNC5"
FT                   /protein_id="ABW32511.1"
FT                   /translation="MFSAVDGITGSRLGSIEEESEDGGCGDVVEESRGRSMSHFTL"
FT   gene            complement(9069..9446)
FT                   /locus_tag="AM1_D0015"
FT   CDS             complement(9069..9446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32512"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNC6"
FT                   /protein_id="ABW32512.1"
FT                   /translation="MIESRPSLSLNVLLTEEQLGFLDYLYPNDDPEDALIRLLERARNR
FT                   AIRKAEQQVHILHPRQEEAEQPETSPDQPNSQVDEQVENPIGQLQELCQKQQISLPRYE
FT                   FSEISEGFRCLVQSMGLQGVG"
FT   gene            complement(9443..10519)
FT                   /locus_tag="AM1_D0016"
FT   CDS             complement(9443..10519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32513"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNC7"
FT                   /protein_id="ABW32513.1"
FT                   /translation="MPSASIDKLNQLKRQLQDCINPTAAKLLKSTIAKLEAQLNLGQDQ
FT                   IELSKIDQLKTTNTNSFKVAQRKAAHKKSERKSRQKASQKQRTTLKPPSLNKIEPKPEV
FT                   ISQSKKLPNPAQEKPHVKTVDTPNSKNSNSKNQKQEKTTSKSKSGELSEKPPLLPGNGT
FT                   HRAWCRIPGIIRVREKEFDDGRTKSLYFVEVDGQPIKLFLSKKSFKKVKSVLDKPIMVF
FT                   GYPNIMNGQITSLQLTGTSQRASAKTENWVLIGVWRADKQRVLIQRDQERDPEIHIRQH
FT                   SPLVSEDCLETLKDGKLYEFICHRDGVTVKVVAVGERSTPKSNATESTDQEITDPEIKD
FT                   QNIIDQVLSKLESSTLQV"
FT   gene            10641..10832
FT                   /locus_tag="AM1_D0017"
FT   CDS             10641..10832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0017"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32514"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNC8"
FT                   /protein_id="ABW32514.1"
FT                   /translation="MNHFAIQGILLERSLRYTQERRAIAEFVVEINPLREEDPKENLKA
FT                   IYWGENGEKAHNALHTLG"
FT   gene            complement(11014..11559)
FT                   /locus_tag="AM1_D0018"
FT   CDS             complement(11014..11559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32515"
FT                   /db_xref="GOA:A8ZNC9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNC9"
FT                   /protein_id="ABW32515.1"
FT                   /translation="MKIYTPSFEELNFCYELEKSFPSNSEDANAKGFFLPGASFKVYED
FT                   LHDTGYIKVLSQDSNLVGFVMVVPPKHQILSRLLINNESLIWFDSEQLYPNVDNCYWIA
FT                   KIAVKAEFMRMGYAKALYDDVFLNFDGLTALTATAVSPLRNHASENFHRALGLKACGLF
FT                   LSGTKGELTNIVNILWRK"
FT   gene            complement(11534..12232)
FT                   /locus_tag="AM1_D0019"
FT   CDS             complement(11534..12232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32516"
FT                   /db_xref="GOA:A8ZND0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZND0"
FT                   /protein_id="ABW32516.1"
FT                   /translation="MQALSILIRDAWLSILENPTILRCVIHQLIRQEDYIETLSRITGI
FT                   SRLTYKKEPFTFEQLVKDDRLIIKHQANEIDFKKTDVGSILKLRHQVLRNGYPITEVMF
FT                   NEDHDYQSRHYGAFDRQENNICCVSLIQSYWNGFLAWQLRAMATAPEWRSKGIGRKIID
FT                   FMISDLEKDEQLRHIWCNCRVQSSGFYKKMGWREASNQFINGNAGLSVKMVREFFKTSH
FT                   SNNENLHTII"
FT   gene            complement(12250..13560)
FT                   /locus_tag="AM1_D0020"
FT   CDS             complement(12250..13560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0020"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32517"
FT                   /db_xref="GOA:A8ZM10"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM10"
FT                   /protein_id="ABW32517.1"
FT                   /translation="MSASRSPEPTIGFVDEYCQLFAELFPQVRSYEAFKHLHLGMISDI
FT                   KRKSLPAIARAVGLENHQSLHHFLSESPWVASHLSDKRLDIILKILDGRRLILLIDETG
FT                   DCKKGKSTDYVKRQYIGNVGKKENGIVAVTAYGLFQGMILPLSFEVYKPRERLKEEDEY
FT                   LSKPQIAAGMIRQLQGMGFCFELVLADSLYGEAQTNFVNVLEELKLPYILAIRSNHAVW
FT                   LPAEQAVFAEPWQSFERTFSNGTTETRYRQEIIYGQRHHQKRYWLLTTDPQTLPENSTS
FT                   YVMAAAPEIKLDEIGDCYGFRTWIEYGLKQSKDTLGWADFRMTHYEQIEKWWEIVMSAF
FT                   LMVSLFADVFNDSCPVAHQHFAQHPWWDNQNGWKNLLNNVRLIIQPLISWNLLKRWLEV
FT                   FPSRALKKGFEQLTSKMEAFCCPLVRKLLKHPDFLSV"
FT   gene            complement(13608..15005)
FT                   /locus_tag="AM1_D0021"
FT   CDS             complement(13608..15005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32518"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZND2"
FT                   /protein_id="ABW32518.1"
FT                   /translation="MPRISYGPAQKTRVLRILECILRFANDEFEHTQKINIQYSWQEDG
FT                   LQEKTLIVKTTINNLKYLCDHYDLRNPLQKTDIRDALHCLKDFLGILQDHRVNKQGSQD
FT                   WHFSLELWSKKTDINLNEVNSLWEKNKSNRSKKASISNKRDNQLNNIPENYANSSIKKI
FT                   SHLKKFNIDTRFNKFPIPFNIEENLIWLEKIYFEEIILMLNITDIFSRAAYSKRIKDAE
FT                   NDSSFLAFTKSKESLVCDQEKKLNRTTRLGWNLEQATRVINENPIHLVVSPAHAGTLAI
FT                   LTYLREKNINITFDYHHPHSVEIVENAIFDNFSRQVDGFTLTLATASVLLREKTGRYTS
FT                   SFMMPNMTHGILSSNIELNERSLDGEYLLMKEVPSTEFFIYENLINSKLLTKSTTTEME
FT                   PDEVTHALSNGDSNIRTIIGFPHYNFNLKFNSCNLLNNPIAQIKPVFLFLRSSIIVKSD
FT                   IIPLLSL"
FT   gene            15294..15617
FT                   /locus_tag="AM1_D0022"
FT   CDS             15294..15617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0022"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32519"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZND3"
FT                   /protein_id="ABW32519.1"
FT                   /translation="MSIHRYDLQLTENLSISKIKIDQEIQVLSKSNDAVISEFAEAMRK
FT                   GADFPPITVFYDGSEYWLADGFSRIKAKEANGDSYILAEVEFGSRHEAKLYAVVTNTNQ
FT                   KSN"
FT   gene            16057..17118
FT                   /locus_tag="AM1_D0023"
FT   CDS             16057..17118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32520"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZND4"
FT                   /protein_id="ABW32520.1"
FT                   /translation="MPPKKASRELHEVSTQSVEIAEIRMDGGTQPRAKLFEEVVDDYAQ
FT                   DMKQGATFPPVIVYFDGEEYWLADGFHRVRAKEAIGETSVTAEVHLGTQRDAVLYAVGA
FT                   NAAHGLRRTNADKRRAVIRLLRDFEWREWSDREIARRCGVDHKTVGSLRKDIYPTDDQS
FT                   KEFRKGADGRITNVSNIGKSTKTINESNKRQRRKKPAATLNTIVEQSQKVQIDDIWRLG
FT                   KSHLLFCGDSGSAKFQKLLPIEISLLLFFPRKDKPWLPEKPTNVHNTLLFHTSYGEDLH
FT                   LETLRGIIENCLSGTTDANDPIVMINLIDPSLFILIDELECSCFCAEPDPQRCTDALTV
FT                   WTAINQTVKKIST"
FT   gene            17774..17908
FT                   /locus_tag="AM1_D0024"
FT   CDS             17774..17908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32521"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZND5"
FT                   /protein_id="ABW32521.1"
FT                   /translation="MGASPCLAFKIFRVNYLQPTAPTPATSVGISQANAERQATSISA"
FT   gene            17905..21312
FT                   /locus_tag="AM1_D0025"
FT   CDS             17905..21312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32522"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZND6"
FT                   /protein_id="ABW32522.1"
FT                   /translation="MTLSGQIEGYRYLGQSKDGLWGKYVLNDGKDLSHEDRERRWQEQR
FT                   ILREQRAQAEAHRHAQSLPAIERDRLYRQLLDQLTLHPADRADLHRRGFTNEQIQDWGV
FT                   KSVEQWQPLSGELPHDLPGINLDGKSLNTPRPGYLCPIMDADGQIVGFQIRSRSSEGGR
FT                   YFWLTGKTRKRPNGPTPHLRNGELPLAIHRPEQITRDAFALVEGTGAKPHLLAQRMGQV
FT                   TIGAAGGLFAASPETLKATLAQLGITTIEFYPDAGAIQNKSVLRQYRVTWALLKEWGYT
FT                   VTVAWWKQTDKRIHTDIDELDDLSQIQYLSVADFERITAQCNGLLHQLQQALSKLTRPS
FT                   SPAQGFATPNDQQTHPTESRRTKRTAPDDERLATLPATSRRARRSRRRTARLLAAHRRH
FT                   GYISKLRLENYRSRIRRRAAQSANSRSSSLQSCPEDNGTLETTTPLVQEYEPGQRLQTW
FT                   ETLISSGFPYILDQSQPGTGKSYDSGNVTPIGFGMEQVIYLSDQHRNPTVSTLEQGNGW
FT                   CDLEARHGGLNRVKNRLQRSAKGDAFAVPANCSRIGVLNALRDKNIPGADTANLICGTC
FT                   IAREACINANGPGYGFLNQRRNVLGAPLLRAHPDSLPDPEDYPLENTMLIWDEPGQNFQ
FT                   VKQSTTVTLTDLQQTISALITYPEIFALVQPLLSALLPLMDGSMKLGKYGLNHLALKSR
FT                   LPDMAGVKLGEIALILMPNLGFLNTTSDYGIDLADLPKQLRKKFTERDSEMAEQARNGV
FT                   VKQWLIPLIRILQGGAGCIQVSRYGLLTLNTPNPRHRDLAQAAQANVFLDATLSREDLA
FT                   LKLGCSPDEILVVRQAIPDTGNLEVIQVKDMGRVGMSRGGDQLKRIGALAQHYQDLDAA
FT                   NTRTIDFKKFEKDGAWWRDSRGVNDFLTVQTLVLVGTPCRNLNDLAAEFAIVCGYYPED
FT                   DNPAFTAFIDRSILAEIHQAIGRLRAHRRPNESLQVVLISNIEMDCFVQEVQAKDLTIE
FT                   AAHKTERVEIAIESAILQLQAKGEKVTQQIVSAMTQIPRGTIARYWRLFISLLESLNSR
FT                   MNNSSNAPNPDQETHQAIAGVLDELADLPVNDLLPSLNEVFFDWLKPKEWSSVWSEVSA
FT                   SSQMAILEGLAMTLPAKMLERGMPELAA"
FT   gene            21529..21681
FT                   /locus_tag="AM1_D0026"
FT   CDS             21529..21681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32523"
FT                   /db_xref="GOA:A8ZND7"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZND7"
FT                   /protein_id="ABW32523.1"
FT                   /translation="MLLEFAAQRFLLKILAIVTDCIFCFDVLPLLALKYTQVNQSTIPS
FT                   PKFFN"
FT   gene            21888..22310
FT                   /locus_tag="AM1_D0027"
FT   CDS             21888..22310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32524"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZND8"
FT                   /protein_id="ABW32524.1"
FT                   /translation="MLTVNTQKVTATPVSDLTAMSPDEATEVYQQQYRETYVDLAIQAQ
FT                   EHLGLPVLKTFGELFQLGCTDPELSNSIDQEIAHNPILTDWPMQDSDCIGLISQGPYVQ
FT                   SQINFHGVPVRDVMEYVCDLFRETPEPNAALDDVAA"
FT   gene            22327..22482
FT                   /locus_tag="AM1_D0028"
FT   CDS             22327..22482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32525"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZND9"
FT                   /protein_id="ABW32525.1"
FT                   /translation="MADQQGIHVDPQPSSGSTYTDFLNTLHLLGVSVCFDASKSKFNLL
FT                   ELSDNR"
FT   gene            22553..23875
FT                   /locus_tag="AM1_D0029"
FT   CDS             22553..23875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0029"
FT                   /product="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32526"
FT                   /db_xref="GOA:A8ZNE0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNE0"
FT                   /protein_id="ABW32526.1"
FT                   /translation="MNKGTGLRPPPDIIATMARYPDLSPEREAELIIKAQNGDYEARQT
FT                   VIYSNLAWICSRGGQFSRKGIDDGELINEGYWGLNRAIDQWDPTKGANLRTYSERKIYK
FT                   FQSEAIRQKNHIRLPKSTYEQLSKLKKATESLGEDATVAQLAEETEIKEKRIRKLQEIS
FT                   QPVSLNSVTGERENLELLDQQADDSLGSLDPALSSELLDLVDKLHPRQREILHLYHWEE
FT                   LSFQKISDYLGLPAKQVRKLYKKALDLLRKFLQGEINEFPPLPLLEWRNFIFAKFFLAT
FT                   GLSQIFNIVVAKLKRLKRLHRNNHIATVQSQLTVSQSTTEVLPASGPECAIQAPAEPST
FT                   QYSAWYERLWQFVNRDKPTHSRVNTHQIDSGGLRDGPKYLVDTFWHGLNCIAQFLGYWP
FT                   GSPRGSDQYRCRSGDRWRCRGQTEGRYSKKKVIRIVGNPTF"
FT   gene            24113..25090
FT                   /locus_tag="AM1_D0030"
FT   CDS             24113..25090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32527"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNE1"
FT                   /protein_id="ABW32527.1"
FT                   /translation="MYKHIPHAIPIALCLAAVPGIAQAQDFPTIEVAPRHGHTFYFKNE
FT                   EAVVVEAWPGAFDAFDFGERPKIPSARFIFVNLKPKGNIDSTTLTVVYRVGTKEKTKTF
FT                   LLKKTKGIPSRFSTAIDGAPPLAAQPQPVQPITVTNVFTPPPKPVKQIHKEKKAKKPRK
FT                   LKVSKEFSSPFSSGFASSNSVAQPPASKETQQPEPEETEETDVPDSVEPKTEEKAETPQ
FT                   SEPLPLIRAPKTLQAKATIETPTEKQLIARSSLDNFGIARYLLRGLYQAERLNQINTHT
FT                   PQFGQAQDTAIWLRRGRSIEEALELSGLPPVTFNNLLGHGGVGK"
FT   gene            25087..25998
FT                   /locus_tag="AM1_D0031"
FT   CDS             25087..25998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0031"
FT                   /product="peptidase M23 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32528"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNE2"
FT                   /protein_id="ABW32528.1"
FT                   /translation="MIKPLILLSLLGQLNVAPSIGEGNIAPAIGEQPKPVETEPVVTEL
FT                   KPEPAAVQTDVPLETATAPPVPIDIPVPEPLAEESAVLAPPLEQPESTLEDHHQPYGEI
FT                   PSTPLQPPYQSPLPTPAPQPQTSVPPKPRQQIQPSSGVAYRQPTAPVPTTIVETIGYPL
FT                   TSTFAVTSAFGWREHPVQGNTSFHAGIDLGAPHGTPTLTMLSGRVIHADWEGGYGKSVV
FT                   IEHPGTGLKTRYAHLSKIHVQPGQWVDQGWHIGDSGATGLVTGPHAHIEMIMNGQPVDP
FT                   WPYLAQASRQAVLINRLHPWAG"
FT   gene            complement(26031..26183)
FT                   /locus_tag="AM1_D0032"
FT   CDS             complement(26031..26183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32529"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNE3"
FT                   /protein_id="ABW32529.1"
FT                   /translation="MLSDALELKQQLVLSRPEDNELNIACDLPLHRCLVALTRRLAEIL
FT                   GCEIA"
FT   gene            26210..26329
FT                   /locus_tag="AM1_D0033"
FT   CDS             26210..26329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32530"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNE4"
FT                   /protein_id="ABW32530.1"
FT                   /translation="MESGLFLLASALVMLLFIGNTGVIAFSLWTTRPGVKAEK"
FT   gene            26491..26607
FT                   /locus_tag="AM1_D0034"
FT   CDS             26491..26607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32531"
FT                   /db_xref="GOA:A8ZNE5"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNE5"
FT                   /protein_id="ABW32531.1"
FT                   /translation="MFDRLDLLSILLKSGLTLATVYVIYLRSAAVKAKRSSR"
FT   gene            26652..27131
FT                   /locus_tag="AM1_D0035"
FT   CDS             26652..27131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32532"
FT                   /db_xref="GOA:A8ZNE6"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNE6"
FT                   /protein_id="ABW32532.1"
FT                   /translation="MQPIQSASQSQLKRFFHEYKYLLIMIAGLAIACIAEPAAAQCLGW
FT                   LCGPKNAITNNGVINGNNSATVFIEFIFLAIQVLILVGLGGLAVVFFFKMDRDENYVKP
FT                   LVALLVALLLIFGTNFVAGYIVGDGNNAGTSASGNNNGANTTQSQPVRGATTVFN"
FT   gene            27144..30236
FT                   /locus_tag="AM1_D0036"
FT   CDS             27144..30236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32533"
FT                   /db_xref="GOA:A8ZNE7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNE7"
FT                   /protein_id="ABW32533.1"
FT                   /translation="MSDGDRITYTPVLDKKPSIWMIPQATFIVGGVSGVSLLVLYMMLA
FT                   TIHQAPPWWIPTALWVSICSVYWALLGDTPWKVQGQLHRRMPRENKHSTAVRQPVNTLK
FT                   PKLKTRRVGPKSARRKVKPAEEDVDIAAILIFEIDGLTVGAALLQRNNRLQVVWFFYSN
FT                   GIPSSTTVTQARVIGERIQEGFRDLRNGEPLTMHMGSFSDCSKRVAELNRMGEEAPLEE
FT                   STFLLSWMRKRVKALKRLGRYNPKFLRFYIAHDLGAFGQHKDWFSGLMQTIEDQVQTLT
FT                   GQKSPLKDRLHSMLVEAFEDSFYQNQNFFRTCGIPVTPASADQVWEWIYRQFNDDTVPP
FT                   IPQVITITRDGLKAQQYDRRSISSVLLKHCPDYGKKCVWLPGRKKFAGGVILEGRPNRS
FT                   YDPIEGRLDQLLDASSPILGDKNQKTSNNSLHDLEIVVTFTAEHQKGVLQESQKKTGQS
FT                   NQSLRMVEENKRLDGGALYNTRESLDAEMKLRDGCHTTRVGLMIIAYRDKKRQLDRALE
FT                   NIAALPIFSGGKVVRETGYFDSLFLEALPITMESLLSGDPKKLTERFDRRIRETTAAAV
FT                   GLMPLILDSRPDLHGVEFVSRSGSPLLVDPMGRFPHNHMIVVARTRAGKTVLVMQFASN
FT                   VLVRPNHQVIIIDAGREDGSGSYDEFTTFMDCSHFRAGEDSYNIFQIPDQAQLSAEKFE
FT                   KAFITYQKFILSALVTLTTSADDAARLISYYEDILTNLIAAFLADGSIQEKYQQAYKDG
FT                   FGSEAWQQMPCLTTFVEFMSLSRLPAELQNEDAEKAIQRMRMSLIALMQRQSGQALSRP
FT                   STFRTDKPLVVYALGGVQKNADMVPALLAASASMLAQTFSRKKTYVVAEEATHLWQFPS
FT                   YRTIVTEWFTGKAKSGVWVCWVGQSLKILLQHKEANSVLENVGTTLVGWVKEAALKPLK
FT                   EAGLDPELVQPCIGSDFNPPRDCNNCEYATNWLIETDGKYHVGLNYNDFASLGITMNDL
FT                   EKVILREEIYSQINSDNKYERVAGVASYLEETSIDKQGLKS"
FT   gene            30233..31255
FT                   /locus_tag="AM1_D0037"
FT   CDS             30233..31255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32534"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNE8"
FT                   /protein_id="ABW32534.1"
FT                   /translation="MRNIITGLTAITLIAASSLPTLAQNAASGESDYWRTTDVDYSVFK
FT                   KDQPINNKGLFEVDKKTGKQTQLSKDFQKGVEIYQQAKPVIDLVGGIFGLGGSLGFLKH
FT                   IDNNLEYGEWLFGKVPREQQAQEQQAQGTEANGAPLGDVYGVDGKVDPTKAREQALSTI
FT                   EANADIKADSPFGVSRTMYKLLVGDLAVTRAARKNLELMFGEAGQQFAKEAREYSANVV
FT                   KTSGQMVDQALEAKSTQDVNKIRAQIAANGQLLDQVQFAEQQQTRFSVDRVNDAVLTQL
FT                   ELKQQEKWDKEQDEASADIGLAQVRQLTFSMLHPSGSESGPSNQAAKVSAQQNPSFIRK
FT                   "
FT   gene            31255..32325
FT                   /locus_tag="AM1_D0038"
FT   CDS             31255..32325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32535"
FT                   /db_xref="GOA:A8ZNE9"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNE9"
FT                   /protein_id="ABW32535.1"
FT                   /translation="MFSLDAILIAGINFDSPQDIINNTKEISAEIDKALSVLWGFLGSK
FT                   LFIEISNVAAIIAALGVGFWAIKWIKEVAKSDEFFYPDKIPQMAFGLMLAVLLGAPTER
FT                   GKLLTDVLISYDRFTTNLSNIVLVAARPNPEKDPVASAQVSQAVRDRAAQDAKKCEKLG
FT                   LLTQARFDCVDEAIERVSTSLEPYKEEWASKLHRELTSALGLLNDRAIGEAAKENIKRD
FT                   FTLFAGDALNKVLIFVMFGLTVAFLVLLRVAKPLISIVFPLYIGLSYVPSSKPPVLWAI
FT                   GMLIDIVLIEIIFKIFLSMIAQLALTLPLQIDTLTLGLLIVFGGIPFSIILGRRLSDGL
FT                   TGAGVSAFPGLSRRFR"
FT   gene            32322..33041
FT                   /locus_tag="AM1_D0039"
FT   CDS             32322..33041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32536"
FT                   /db_xref="GOA:A8ZNF0"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNF0"
FT                   /protein_id="ABW32536.1"
FT                   /translation="MKVNVFDKAVASPRQIRPKAVWLGIILIILATVALSYGLINLRIS
FT                   SVEGRLDQLANRPIVVQFGKNAELVKVEPVTPSENVEEFVQEVLPPMFAWSKKVLPEVH
FT                   PTGIDPGRDTKYGKLPTLIFYYTNALEIRYRNVFRKNIANYKPDKFEQGEATLLRIERL
FT                   VKPRQTEEGWEVDVYADLITLDVDDVAYMSEPFNSTIHIKEILPPKHNASFTPIEEAFV
FT                   AVLKRGLIITRIAKLEA"
FT   gene            33045..34484
FT                   /locus_tag="AM1_D0040"
FT   CDS             33045..34484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32537"
FT                   /db_xref="GOA:A8ZNF1"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNF1"
FT                   /protein_id="ABW32537.1"
FT                   /translation="MSTALNKWQDLTGDVDDPLDEIVEEADDDSDEDYSVVTKHTLATN
FT                   PMIKLCIWGGGILVVLLGIFGIFLGVTANGGNTANNQQQQQQAAVPPNAQTGLSKSDQK
FT                   IVEDLLERETFNRQQKRQQVLNGKKQQGKPKGNQRPASVSPQNTVSAPRVIYRARPIQQ
FT                   RSHASYQQDRNRQFLVQRPVAVQPIEQPIDDPNAGFFTAPVAASSSPARTGKRKLLKLS
FT                   KSDEFKSNKSPIKRFTPPVQVASTAQTIPQPSKQFGNLSGNLQNPYMNQIVATASQAVI
FT                   PVDTAISAQVVNRVSWIPENPGLAKGKVVRLKLQDDLKDGAGDVVASRGTIALGIVTQA
FT                   TEQGLISVNLTKIGSKFVQSGAVEIHQDGDPTMIAKLETKGGNNGFIKTALDIGIGGVQ
FT                   TWASNLNNPTSQTAISNGNQTFLSTNNNNRNNTAAFVEGATGRIGERLRQSVNGPTQTK
FT                   IGVFRFGGKKVQLYFVREVRL"
FT   gene            34481..34903
FT                   /locus_tag="AM1_D0041"
FT   CDS             34481..34903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32538"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNF2"
FT                   /protein_id="ABW32538.1"
FT                   /translation="MNQLIVALLFLVSWSTVASAQQVRELNLKGTTNMRPIAVDPSGVI
FT                   VHLNNGDKIQGLSLQPPNQIELYPLDGQLCSGVKQCQGQAPSMLQLTRVKPKNIKGKIS
FT                   NSDGSSMLVIVTNSGAKHVLFVVPTSRAKYQVVNIQ"
FT   gene            35368..35823
FT                   /locus_tag="AM1_D0042"
FT   CDS             35368..35823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32539"
FT                   /db_xref="GOA:A8ZNF3"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNF3"
FT                   /protein_id="ABW32539.1"
FT                   /translation="MTYRYKEDKPENWIDREHELPEDNTLWKQYEIYIDIFKFYLDTTW
FT                   KVVTWFYAITGAILVYYFDHADNNNPYLRYSLVLPALLSIGFFIIFGKGAQKNKKLNEW
FT                   LDYIRSELGIPGRPHTEILLIFLEQSRNLFAAVFLGLTILFVSSFFW"
FT   gene            complement(36158..36295)
FT                   /locus_tag="AM1_D0043"
FT   CDS             complement(36158..36295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32540"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNF4"
FT                   /protein_id="ABW32540.1"
FT                   /translation="MDLTIGVDRCANNAVHCSTQINGIDASNYLHLLNRKSEKELPKTT
FT                   "
FT   gene            36397..36825
FT                   /locus_tag="AM1_D0044"
FT   CDS             36397..36825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32541"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNF5"
FT                   /protein_id="ABW32541.1"
FT                   /translation="MTESVTLTATVIANLAFQEFLKTSAGEAAKQFTADALSLMGKLRQ
FT                   KIWDRLRGKHGAAEQALTQAETGDQKAIETVATLLDVEMLDETFAGELRQIAQEINIHI
FT                   SKDNDTQVQNNYGGTNFQNSISGGEVYQGDNITINKTI"
FT   gene            36994..39105
FT                   /locus_tag="AM1_D0045"
FT   CDS             36994..39105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0045"
FT                   /product="TPR repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32542"
FT                   /db_xref="GOA:A8ZNF6"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNF6"
FT                   /protein_id="ABW32542.1"
FT                   /translation="MGGIGKTELALQYAIAQLEQEQYPGGICWLRARGQEIATQIVTFA
FT                   QTKLGLTFPDGLDEKGQVDYCWGHWREGDVLVVLDDVTEFDAVEPYLPPSDPKFKVLLT
FT                   TRLNLGSSVQSLSIEELDEESALALLETLVGPDRIQSQLEDAKTLCGWVGNLPLGLELL
FT                   GRFLARKLDWSFEKLIGRLESKKLAAKALITKESGMTAQLGVAAALELSWVDLSEAEQE
FT                   LACLLGVFAVAPIPWHLVEECLSDRDKDDLEDIRDEGLRDKNLLKRVEERTYQLHQIVK
FT                   EFFRIKLQESSGNGESLKQSFCKAMVGIAQGIGNNPTIDVIAGMSASIPHLEELVRQWI
FT                   DILSDDDLTWPYVGIGRFYEGQGNYGLALPLYQECLEQTKKRFDSEHPSVAQSLNNLAL
FT                   LYDNQGRYTEAEPLYVQALEMRQNLLGTEHPDAATSLNNLAVLYYDQGRYTEAEPLYLQ
FT                   ALEMRKKLLGSEHPGVALSLNNLAALYTNQGRYTEAEPLYLQALEMRKKLLGSEHPDVA
FT                   TSLNNLAALYTNQGWYTEAEPLYLQALEMQKKLLGSEHPDVAQSLNNLAALYDNQGRYT
FT                   EAEPLYVQALEMRKKLLGSEHPGVALSLNNLAALYTNQGRYTEAEPLYVQALEMRKKLL
FT                   GSEHPDVAQSLNNLAALYDNQGRYSEAEPLYLQALEIYQKLLGDEHPNTVKVQSNFDDC
FT                   RRRIKESNT"
FT   gene            complement(39141..39266)
FT                   /locus_tag="AM1_D0046"
FT   CDS             complement(39141..39266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32543"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNF7"
FT                   /protein_id="ABW32543.1"
FT                   /translation="MKAFCTVHRYLHRCTKLVLRLTILLGFNFWQLNKFKNADYT"
FT   gene            39569..40525
FT                   /locus_tag="AM1_D0047"
FT   CDS             39569..40525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32544"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNF8"
FT                   /protein_id="ABW32544.1"
FT                   /translation="MTEPITLSAAVIANLAFQEILKSSAGEVTKKFTADAIAKMSELRQ
FT                   KIWARLRGKSQKVDDALKNTEQGDSSALSTIAKNLDVVMDEDAEFASQVQAIAQTINAG
FT                   KILDQSNMTQNLSDNAKGWQTKVEGGVAYIGEIHQQFTGDPILKYEPPTINSIRGFHNG
FT                   MQSLVLEDIGNVPVTITKEKHEGINGECDYTIEFEIFNKSRADLKIKAILVEVLSVEPI
FT                   ESIIDYIPLCGLGEARLYSCRVDGRPGIYRSNLLESTFSGYIFLQSGEQETIQIAINTK
FT                   DEGKYTLRSLLELSSVDGLKTISVGEFNNVRFLKLSR"
FT   gene            complement(41076..41192)
FT                   /locus_tag="AM1_D0048"
FT   CDS             complement(41076..41192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32545"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNF9"
FT                   /protein_id="ABW32545.1"
FT                   /translation="MHKNLLENWITKEFGKPTFFQPQLTLKCHCNVLKKTMA"
FT   gene            41393..43999
FT                   /locus_tag="AM1_D0049"
FT   CDS             41393..43999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32546"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNG0"
FT                   /protein_id="ABW32546.1"
FT                   /translation="MPRYPRRILSLLPAAALALQSFPAVAQIINQQTLEAANHNTQTQE
FT                   EGTIPGLYYDPSGVVAPTFANSQASETAGSIRLPAGSQAPSFLNGAWPANASSDQVLKI
FT                   GHLKDHPQFKQFTELNINEVLKASGKDPSTVTLSEVPIASTMTVGEYLQINPGAAEQSL
FT                   EDAPAVVQSAFGYYEDEPLLHEPIDQTDIVFIEQKASNPEISDIPAEDLLQGDWGEAFT
FT                   QEEQSQLSKTLSKVNERLRKLPLKQLIPLAQGIVSGDWDTVKKQAKDLAIKEGSKVLIK
FT                   ELMKNPKIAKAIKDLPLGTLPLDKLGLADAPGVGETAIKDIPGSEDKTLNQVPGLKDVP
FT                   LDQIDLALALSFTRLDLLGRIDTTDAAAVVDNIDYVISGGTKDQIPKPAPCKIDGKDTK
FT                   NCRHFELDNVDGGGEPTKLSGQAWIQGPDQMVPGGQGWLRIIANGKEVTGIKPWVAGNV
FT                   KLYLEDMREGSGDEVGSARLSTAWQFGYSDPITGSHYTPHFIRIPTPWRIKEGGIMLLL
FT                   ARSGGIPDAIRNLQPSQQQFCREPTLVASAQTNNATDSNQTTGGADGSSPPHSEQHHIN
FT                   QYLARIAYGESTGGTDIGPHPDTGAYGEYQFIQKSRDTLYTRTGIDAWSESKEERDRAA
FT                   LAWIDIYGQEVGHDIISYIRSGNFEAADYLLGRNQFTSLPGGAEDVKWNDPVALEVYGP
FT                   NGNAPVTPTGASASSGVPFCQPTNGSATFAQGPAPEAGQVNASIYQAARQMYGFDTSSG
FT                   PEGGSQACAWAVDHVLAKAGIEPMRTDNVLNVLDKMKSGRGTRINSGQAQPGDIILSKG
FT                   YDHIGICMTAGCTEVLSNSSSKASFSWRSDGTFDGWYDRSRFLHEAPTEEIWRIQR"
FT   gene            43996..44349
FT                   /locus_tag="AM1_D0050"
FT   CDS             43996..44349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32547"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNG1"
FT                   /protein_id="ABW32547.1"
FT                   /translation="MRKLLFVTALTVLTIFSGIQTALANEEQQIANALIQSLPKPAEVE
FT                   KVVVSGSYALVKWVGGPTGGMATLINTDNGWQVMSQTTRGWPSIEIFAKERGMTIEEAE
FT                   ELLDAYDPSWRQW"
FT   gene            44422..46203
FT                   /locus_tag="AM1_D0051"
FT   CDS             44422..46203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32548"
FT                   /db_xref="GOA:A8ZNG2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNG2"
FT                   /protein_id="ABW32548.1"
FT                   /translation="MSHHTEQPIQPPQQPSPQIDFQVYVLGGLFLVILVLVAITKGEIG
FT                   HKKQKLGDARTAKDNEMRKAQHLAYDALEKRERNKITLWAGEPKGLTIDNENREIFIPR
FT                   DLNSWIFSYLEEHFLTFGSSGCGKTFSLMAPLQRAMIKLGLPLCVFDAKGHEETEDQAC
FT                   PSSEIAGYARLHGYKVKIIAPGDKDSDVFNIFDMMEAKDDRPAYEDKDNAYVISDVLNE
FT                   NMQMNNADSGDQFFPLASKQLMQAMFMWAKMLDPDGDELILAYYLLKRVAQVGAAGIAA
FT                   LDLPPYVQIAFDQFLVSAGSPETAASIAGTALILFGRMITPATTATFCGKSTVDLNVTG
FT                   KTLVIFRLNPKMKAATGPMLATTIQCFLLSNCYTARKQPLAFFLDEFQMIKICEIQKIL
FT                   TVARSNGVSLLFATQGMSFIEETYGEKRAIGIVEGCKTQVLGQLNGNKVAEYYGKQLGK
FT                   SEVVTRSKSKSTGKSSSTSRNDSPHAKDLVSMGELMGLPQGSFYVLSRAIGNKRLARIP
FT                   MRRNFVIPKWETDDAKRGVKEWFKYRKVARKRSKAKSMSNEEMIRYREMSVAILPDPKD
FT                   DDDDDGGDTLAKGISSL"
FT   gene            46246..46668
FT                   /locus_tag="AM1_D0052"
FT   CDS             46246..46668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32549"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNG3"
FT                   /protein_id="ABW32549.1"
FT                   /translation="MTEPTESQLQFTELQLQALQSLGLSTPDLYAQYPNSHHNAIETIE
FT                   QRGTEVLPKDTVINEMQIYYGDVAYVAAVTYRGGKLVGFDPVAYAQPADNECVSYRING
FT                   VWAYIQVAGQTLLDLIGEIELPPMPTEQDLLALVAA"
FT   gene            46711..46977
FT                   /locus_tag="AM1_D0053"
FT   CDS             46711..46977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32550"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNG4"
FT                   /protein_id="ABW32550.1"
FT                   /translation="MADVLDNGGNAQEGQQINETLINGTAERLQQLIQLAWAILQKGDQ
FT                   WARGLELGNKQLLPETTTLNDLDAAEKAVQDPKNTAVEVNAVE"
FT   gene            47146..48877
FT                   /pseudo
FT                   /locus_tag="AM1_D0054"
FT                   /note="integrase, catalytic region"
FT   gene            48672..49421
FT                   /locus_tag="AM1_D0056"
FT   CDS             48672..49421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0056"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32551"
FT                   /db_xref="GOA:A8ZNG5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNG5"
FT                   /protein_id="ABW32551.1"
FT                   /translation="MTTLKQLRLRHFLDEWQSIEHQATQENWSYAQFLLALAQGEASRR
FT                   EQNRISRALTEAQLPYGKSWTNFEFAHVPTLNPAALMEFAQTTHWLESGSNILIFGPSG
FT                   TGKTHVSSALGASIIELGKRVKFVTATTLVQQLQLAKLQLELQSLLSKLDRYDLLIIDD
FT                   LGYVQKSDVETSVLFELIAHRYERKSLLITANQPFSQWDSIFPNSMMTVAAIDRLIHHA
FT                   TIFEMQAESFRKQEAAKHTAKSQKTDS"
FT   gene            49640..51148
FT                   /locus_tag="AM1_D0058"
FT   CDS             49640..51148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32553"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNG6"
FT                   /protein_id="ABW32553.1"
FT                   /translation="MKLEPKSLAYLIDIKQNAIESKDQGEVVRATVADPWDIEPDQVVD
FT                   QALDKLEPLESEAIEVDAVVVEPEQLPSQAQSNERPLVNEFIEKAGENIKQGANDFVAQ
FT                   ANAFLAENIQVEYQPIPQQDGTVALAVDTPSLLTQMQLAGGEYAQAAKEKMQSLAPQQY
FT                   ERVSEAVKNTQERVKSALESVSDTVQGRLKEPSLGQRIGELEHSVGLRLDSMGLGIEDL
FT                   FQKVFDIELDKHGTEFALTREIGEFKVEIEALRSQVGGLEGQISAMQQQQVKSQEMIAA
FT                   LQSPKPQLNNPRLSQWQSNFVSTMKDRFQAVKQYIGEKINQVKAKVSDLVESFKHKMVE
FT                   RFQPIADRLRPVYEQAQDLKQKTGEQINQVKATVGEKVDHAKQFVGEKAMDWQAQALAA
FT                   TATYVLAQQGKQTPQGTTIYEGQHFDFHRNQGNSLLIVDKATQQPVYKNGEFNQNAPKD
FT                   VKDKLVKAAQTTQKGIEQKQAHKQAKEQAQTQKPKPKVAAAARR"
FT   gene            complement(51138..55172)
FT                   /locus_tag="AM1_D0057"
FT   CDS             complement(51138..55172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="Shows homology to DNA helicase but no HMM support"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32552"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR024385"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNG7"
FT                   /protein_id="ABW32552.1"
FT                   /translation="MFRPTLINKGNAAIEEYYTEDEALKNSEDEYYAPGKDPVVSPCKW
FT                   YGNGADSLNLKGVINQKVFKKLFYGHHPQTGKRLRKKPTNGQERLGIDLTFGPGKEASI
FT                   LALVGGDRRIIELHEQALQKVFDIFQSRYTQTRVRHGNGQRSLVNTNSLIGAFINHATA
FT                   RPVTIDGKTYSDPALHTHIVVMNATQINGKWQSLSNEAIFKSLSLGSIYRHFIDKGLAE
FT                   LGYTVRPDGTIEGLSPETVWHFKKRTQEVERYLKKYGLEDTQENRQNAVLRTRNKKEDN
FT                   TNIPEKMKGWVEELIINGFTLPKPAKKSTWVHRPELTREYVDSAIAHLQERNAEFCHEL
FT                   IEQWVFDQRPPFTYEELQTEIANHPQLIRTKNDTYTTQYALDREEKTRQLWAAGQHKFT
FT                   PITTGKIEFNKMLNADQRNAVRNTLASSNRLIIWHGLSGVGKTTTLSELQKHIEAINPD
FT                   IQIKGYSPTTKAAGVLAEELGIETTTVSGLITRKLDTSPNQWWIIDEAGMKSAEQGLEV
FT                   LKRAEAVNARVLLVGDINQNSSVNAGSPQRSLMKAGAETYHIKTILRQKRIVQRRAVEL
FT                   VSIGKPLEALKLLNEYGHVTEVADHRTRAAQVAEKYLSLKPKERKQTLIVTGTHRERKA
FT                   ITILIREGLRAEGVIKGEDQALRQLVDKRLTTEQTRHLRYYKTDDYVIPNENFSSRLQK
FT                   GKLYKVVGVDEASGVVRVVSQGGQYSSFDPAKLENKTVFTAQKINVAVGDQLRWTRNNL
FT                   HGNNGDQFKVTAVEGHRIQINHKKWIDTSKPLELDYSITSTTHAAQGQTYYRVIFSGTI
FT                   DPTSSREPFYVAISRQKHELYIFTENYEGMCRQVQCSAAQLNPRELLGLDRELELPEFT
FT                   PTAFWTPQTAMAEPPKSGIAAHHWEELIEGSGIHPDLIELNCHSLKGDSVYEYLLEDKI
FT                   AELGAGQVWVEQQQKLRAKIEHCWDGGFWIGAGVDAQSLDDPILSTWGSFKPDHPRYDS
FT                   SRERFQKYEHPQGRSRGIFLTEVPDWFKEYICKKYDTTSAPGDHFWKIIRDNPQIPIKI
FT                   TEGGKKTLSITSQGHVVIGLPGVNAGYRSKDDEGIKLPERRLNPDLAIFAVPGREITFM
FT                   YDQDTKPSTVANVRRDMVRTGMLLEDKGCTVKFSKWSSLYKGADDLIVGASPEMLELAI
FT                   DAAQPLAVATAKHYEYEYQKLYEFVVRRDGELPRKVMNLEIFIEAYTRGTTEDAYKTIE
FT                   AINPDLNREELMKAALQHQDKKRNAATTVVPILEELAKTKGTKYRHTYQYRVDKWLIAT
FT                   GKRGLTVRDTDTGRILLQTKMGRLTRVSARPGVIKLFKSTVKQAKVKPIQRAQKNRKLS
FT                   A"
FT   gene            complement(55175..55471)
FT                   /locus_tag="AM1_D0059"
FT   CDS             complement(55175..55471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32554"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNG8"
FT                   /protein_id="ABW32554.1"
FT                   /translation="MGKQYVTKYKLECKPTFPGQEPVCRPGEPYQVEVPPIETGIPGVT
FT                   IPAGINSPIGLLKWDFVFLMTVCMLIGPIRRLLVKSLLLPLRLGAAIDTQRRY"
FT   gene            complement(55608..55736)
FT                   /locus_tag="AM1_D0060"
FT   CDS             complement(55608..55736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32555"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNG9"
FT                   /protein_id="ABW32555.1"
FT                   /translation="MWKYVPKKHPLAHSKKSWKNTPQMHSRSGLQRMKTADRRKKF"
FT   gene            complement(55796..55945)
FT                   /locus_tag="AM1_D0061"
FT   CDS             complement(55796..55945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32556"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNH0"
FT                   /protein_id="ABW32556.1"
FT                   /translation="MQYCTLRKIHCDAPKVSKIFHVTTLPRIKKVEPTAIAFFWQQIAN
FT                   HSQP"
FT   gene            55932..56054
FT                   /locus_tag="AM1_D0062"
FT   CDS             55932..56054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32557"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNH1"
FT                   /protein_id="ABW32557.1"
FT                   /translation="MQYCISTLILGHHQPVDFSWLTLMEEPMRDLSINLLTLAS"
FT   gene            56192..57049
FT                   /locus_tag="AM1_D0063"
FT   CDS             56192..57049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32558"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNH2"
FT                   /protein_id="ABW32558.1"
FT                   /translation="MSKADLLVPKVLAFVGLALDRVPELSPDRVKLVINFMLPISEWTE
FT                   YADLESDLLSCLLGGFGYNGRHIDFAAVDAKGYMEGAGMATIPPPDITAYVGVCGHKDA
FT                   NFIAVEDGRPLAYPKSKTFEGLGMSSIVNSVMHFTDDVQGAKAVFRFLALMDKPNKQDQ
FT                   ARKELAALIKPHRLEQKLTQTREGFNKNWGEIKQRIDSDRGIKQAQAFYLVGGNAPIYK
FT                   SRFKALFGSAFKPLNGAIKQLSDEFEEINTQWAYRAIDVWMLHLHVTGRTWTPKGVKEY
FT                   VGAK"
FT   gene            57033..57401
FT                   /locus_tag="AM1_D0064"
FT   CDS             57033..57401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32559"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNH3"
FT                   /protein_id="ABW32559.1"
FT                   /translation="MSEQSRTNIRIRRQPIVGSREALVMKSARAFYGGKFSEKAGLVLV
FT                   DVFEPLHIAMTTGSEQEVKDAIAHSLDEIRGWHREALNQCQKNGYVSASQVVQATTSAD
FT                   MSPQNCDPDEDEPELEFD"
FT   gene            57405..57953
FT                   /locus_tag="AM1_D0065"
FT   CDS             57405..57953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32560"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNH4"
FT                   /protein_id="ABW32560.1"
FT                   /translation="MSNQSFSKTLKTLQISKEDLIELRGICGLGEIEEFSESDIEMLKE
FT                   VVQHKQSGAITYTEAWQQMQAEVVPVEAEPVAEKLDGTDHILERAEKIADEDGERVLRS
FT                   LDGYGDDLQTDVTGAYMNRLNHLFQNARVQKAVVEEPDELAKKPGPFTSRLRERLAAQA
FT                   KQTALPASTTSSTETSPTE"
FT   gene            57950..58237
FT                   /locus_tag="AM1_D0066"
FT   CDS             57950..58237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32561"
FT                   /db_xref="GOA:A8ZNH5"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNH5"
FT                   /protein_id="ABW32561.1"
FT                   /translation="MRAIAQEEVFIIQARELKLQGHERTINKINRGLSLMANSSAILVL
FT                   LVVFLAGSGLIVGVNLPKYAICDNQLNPCWWLRFGGSERKVLTNDKAAGL"
FT   gene            complement(58465..58602)
FT                   /locus_tag="AM1_D0067"
FT   CDS             complement(58465..58602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32562"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNH6"
FT                   /protein_id="ABW32562.1"
FT                   /translation="MKLNQYSECSFTEFAVISSVIGVWLNLVKVCENSRHSCAETDSTQ
FT                   "
FT   gene            complement(58815..59651)
FT                   /locus_tag="AM1_D0068"
FT   CDS             complement(58815..59651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32563"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNH7"
FT                   /protein_id="ABW32563.1"
FT                   /translation="MSNPTSFRLPCTLRLKKTLGKSDAIVECTELSIREFIVNSSRATS
FT                   AHQYIQELSAKHSIRVDDSEMPFLRSHISQLYIISVYAQAEEFLEGFRDEHPLSTDWRY
FT                   EKKDDLLKSILKNICQDYQAAKRLVGSLEVELFDHYRMVRNRFVHVDIDVSKIDSKVLH
FT                   LQEEVKAHSSYGKLNAPNKYSDMSFDDFILFTRVVKQLAFKLCQASRPSDRQLADTVFK
FT                   IIQSENSPLSLQKLKQLKCNPDRVKNCLETLLRKLYGLDKLESSPIIRMIQSELLA"
FT   gene            60168..60503
FT                   /locus_tag="AM1_D0069"
FT   CDS             60168..60503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32564"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNH8"
FT                   /protein_id="ABW32564.1"
FT                   /translation="MLLEALEKLLNDLNQSRGQLMNPSQTSNLATEKKPQGMRLRDRLI
FT                   LFGLQEGYYDVSSLTAFYNLNRPSMTAQYGEQIPGERYCYRITELGIIWCQIWRSKPLI
FT                   PIPRTYT"
FT   gene            complement(60520..60708)
FT                   /locus_tag="AM1_D0070"
FT   CDS             complement(60520..60708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32565"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNH9"
FT                   /protein_id="ABW32565.1"
FT                   /translation="MESEKWGDFRCEVGIGAKLKNLAPHFRSKIQAIIPKTQPMGPARS
FT                   SKGVIRIRRTIRQPFIR"
FT   gene            60731..60904
FT                   /locus_tag="AM1_D0071"
FT   CDS             60731..60904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32566"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNI0"
FT                   /protein_id="ABW32566.1"
FT                   /translation="MTDNPPEPTEVNPSGQTASPTEKRVLEAFAGMMRSCDRIRDTVRT
FT                   TRERVNKETTNL"
FT   gene            61042..64683
FT                   /locus_tag="AM1_D0072"
FT   CDS             61042..64683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32567"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNI1"
FT                   /protein_id="ABW32567.1"
FT                   /translation="MTATKDETLTIVPGWSEDNSSDTPDALKAFLDTKPINRSTYISAP
FT                   GYSFDLEVHHWGDRFTITARMGEDAWNIYSSHTFDFSDQESSTDSWYRSDDIQMTPQHY
FT                   EAVTKLIGDIGIEGPTIPTELSGWVSQDRSESRHLNFRFEDKGNRHYLGLDLVRHGDPD
FT                   KIDRLIRDHRFDELVALATGETNAHLNYPHHANLTNLSPRQIEDFILAEAACLAPEYEL
FT                   EPHQMQNILQDMSASVLNSRGYKPDYGYQIAAGNSVEPRTNDFRSSVTCRGEWALEFNW
FT                   EDDYHSMPLGGEPGDTFQSDEDRAAVVTDYGNLGAIEKMIQDSRFRELATASVSAPAHY
FT                   HYYPELNNMQGVYPEVAKERIESHLLLVATEYGLAERGVRLLEDMRLKVMEDRGDHKNH
FT                   SYDGLLGIDRVPQDELQQTLPELDVKASGVELLPNIQEIPQSNQQPNIDLYQSLYGAAD
FT                   QYGDFDVGFTELALGNGYSVTTTDQSLNIFKDDERIIHVVAENPSPYDGFLQEPLQIED
FT                   KTTPGQREELQVELHELKQWAERDFEKNLQETPIAEGAITLEQLANNTQQIKGLADTQV
FT                   TKTPSVPIIKSTQNVFWITHEASYLKSNLTCVKTTRTHTQAKLDAYYIINEGYDHYEIN
FT                   DIEPLPESVCHLLVKFFGYEICEYDDSAIEIDLLYIWQGPRDPDIKVGNKSWYLWLNLS
FT                   RFRWGFYPELMAIMEGRLNVNRLPQYPWNSQHESVTGWDCGDYVIEVAFNLFNSQSEAE
FT                   EFGESCYALALYEEYCNLLKLLYIDPYGDEQRTPIRKDEVKVFLSSSVFDIRSGDLRDR
FT                   DEWELVPIDEWDTPSLVIGAQLYCQGRDAKAIIALEIQELGEKAHDKEEVVTESFNEDQ
FT                   SPECIQEDLENHLTVELIDGEGETQIRQLRMTIRDVVVGVKIGFESYRGGFKSYYEVDL
FT                   SVVESIAKDPRFKELVAISSGMIDYPYVKYPDFSNVQCLDSGDDLKRFVESRAYKLGEE
FT                   YGDSSIAGKLIDEVNHCYALEVDVSRYKIRNDAVKGIPFKPSKFRGGKIDQSGRLPESY
FT                   VSVGKVYTDDQTKNLELPIRIGSEEFTVTVGVETQNGTSYSYGDSLEPVQGITQDQRFN
FT                   ELVAATAGIKEYPYTHNLDFRHPDKLTVEEVQSTINRRAEILGEEYGVRIMGESLVACI
FT                   GTTYAALRGTTREALLQSFVDPSQEIELEANCQCENSRSSDQVLTSS"
FT   gene            64732..65160
FT                   /locus_tag="AM1_D0073"
FT   CDS             64732..65160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32568"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNI2"
FT                   /protein_id="ABW32568.1"
FT                   /translation="MSSKRLLEKPITCTRAKTLQQELDKHRQINKEPLAQVSKIVDLED
FT                   EVELLRSQNRELLAARKVTQEKVVNLPIRNQPVHKSDVRKDNFSVQIKTELETLGIKLT
FT                   NTLRKTMEVAHEETVVEAIEALITALETSDIKSPGGLA"
FT   gene            65147..65419
FT                   /locus_tag="AM1_D0074"
FT   CDS             65147..65419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32569"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNI3"
FT                   /protein_id="ABW32569.1"
FT                   /translation="MGWLKKAIEGGWSHNERLQKQKKVLYPEGFKKWHEQAVKVNFVLD
FT                   IPIEYLNLDERNEAKVKINKPGIFGAPYRDLHWKEAKIEMLNFHN"
FT   gene            65547..67403
FT                   /locus_tag="AM1_D0075"
FT   CDS             65547..67403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32570"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNI4"
FT                   /protein_id="ABW32570.1"
FT                   /translation="MRNNHKKKKFKKQKDNNPLDTKQIDLEIRLDAILKSRCGGAYNIN
FT                   GIRYQILYSILRGLELYNTQCSFSSIRLEGIEDLDCLKINLNNEYIQIKTSKNSWNWAK
FT                   LKEPVKNFLIVLSESPNSLFSIVLNSTFKSDVLKLSKKDKLNSNEYEGIKNKFIKLCSD
FT                   VGASRNEAELLFEKIGIKNLPEKEIYEEIKIGLTNDFQLGSNLVDTYLAVLVSKFLYWA
FT                   QERVTISKKDIELIRVSIGDHIASEEHQAYGRGLIDRISWNIDDKQSDFFEGKGTRPGQ
FT                   ISAGVDVRRIRWLEKIDTAIYKTKICVLKSSSGQGKSALLYRYAYEYWRHEEIYILRVA
FT                   ETDEQAEAVCKYIRFIDSLGLPILLLIDDAGFRARKWPQIVRECVSLGIYVLMSVRHED
FT                   WFRFARRDITNWEVIEPTLDLAEAKQIYSTLKAENYVHSNATSPEWAYEKIGTPKLLIE
FT                   YTYLLTHGRMIEDRLRDQIQQIQDHKEDPAKIEILRRVALADTLGTPVVASRLIKDISL
FT                   SSDPQQLLKSLVDEYIALEETGILRGLHWVRSNHLTSILHEGYPNIVDTLLKTINSVLD
FT                   IDRKRYIAKSLCINDLNLNEFITGLSQLVSNEDLMTFLGVAQ"
FT   gene            complement(67413..68102)
FT                   /locus_tag="AM1_D0076"
FT   CDS             complement(67413..68102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0076"
FT                   /product="IS1 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32571"
FT                   /db_xref="GOA:A8ZNI5"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNI5"
FT                   /protein_id="ABW32571.1"
FT                   /translation="MKCPECGGQHIHKNGHRRGKQNHICVTCGRQFLSTYSKRGYSDWT
FT                   KRLCLRMYVNGMGLKGIERVIGVAHTTVIHWVQQVGVLLPDAYDPDDIPQVGELDELET
FT                   FVGKKRNKVWIWTVVDHFHPGILGWVVGDHSAETFRPLWQAIVCWQCFFWVSDGNPVYP
FT                   GFIPEGDQIVSKTYMTRVEGENTRLRHYLARLHRKTLCYSKSVDMLKHSIRLLIHYLKF
FT                   GEVPIPA"
FT   gene            68454..70376
FT                   /locus_tag="AM1_D0077"
FT   CDS             68454..70376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32572"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNI6"
FT                   /protein_id="ABW32572.1"
FT                   /translation="MQQIQDKISITGAQNNFAQLGKILDWSALAEVTLLNWHELLSNIS
FT                   STQIIFELSIDEFCIFSQGFYRYDSKKYCDWFNQNYDSIIGYLKLNLDCLSLELFDDEL
FT                   YFEFLVDLNSDDPSGYEETNSRLRRFRSAIPFCKQYQSHGIWLSIKTPLFNDTDKNVNK
FT                   DLLPYSSDGTKVNTWHEVAYSNFIPDSYYDFQKAWNLIRTDAIEFVKYLSKFFRSLLTH
FT                   GSDPKIKNHTSNIEVFITLDKALDNFPSSYDDSSEIISSLLPCSLQTILKKDSYTNKLY
FT                   QSFHTFFYKMRDSLLNPESINNTKDIILNSFLFANYYLPKLHHEFDTLFESCPDYFNIK
FT                   SLNSIEKSAYSTLEDLLQACFSFKIFLINEIEKELQKSREYQVQILTNKTTEVSNFLKD
FT                   IGIDTVLSSDVYNLYDEKHDYINRYFSLAFSVHNPLNYLEVLRSVLEAILKISNIADFF
FT                   CLIPVYKEKLFLPPRNGYHISSLSLLNILGSGEDLNLLELVSITHSLTIQELPESTFSY
FT                   LPELEYEEYLPLTLKGEAVALYTLVISLVKYARAIHRLMATRNDYEVKLYEQHLSKIYA
FT                   FNRNILNKIHELKDKFASYSNQQIIDMNLLSFQQFIYKASENLETPSIDNILSIDISSD
FT                   SIDLS"
FT   gene            70505..70705
FT                   /locus_tag="AM1_D0078"
FT   CDS             70505..70705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32573"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNI7"
FT                   /protein_id="ABW32573.1"
FT                   /translation="MNAQAEKLFTEGIIRITNSKLSFREGGNRKHSSRSAADLVVTSMS
FT                   VPDLSLAGELSGEYGLLHSSD"
FT   gene            complement(70742..72829)
FT                   /locus_tag="AM1_D0079"
FT   CDS             complement(70742..72829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0079"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32574"
FT                   /db_xref="GOA:A8ZNI8"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNI8"
FT                   /protein_id="ABW32574.1"
FT                   /translation="MATTAIAIWTGNLDTIIVFAQKYLVRKKPEITEAQRQKVREELIE
FT                   ILLKQVVERLEDSLYNKIRIDIKREEQRQRVGQGNLIPAQEEETEQITVNFIRRTFQRF
FT                   LESTPPKAVSTSKSTQELYKQESIKGRLLILGEPGSGKTNELLALARDLLSQAQQSLDK
FT                   PIPVIFQLSEWKAEQDFADWLAQQLFEKYSVPFVVSKHWMRHHQLLPLLDGLDELRRVD
FT                   VHKFEGYEQTKMKSLIRGFRHQQFWIPSAVRKVFASFQIFFHKNRQIRAVASDEITPEV
FT                   LDQQWIAKQIQCVREINAFLTRFALPLVVCCRRKEYEALEQQGEYLKQLNGAIYLQALE
FT                   DDQIHDYLHKLKLPERKRDSLWEALQSQPELMKLAHSPLFLLILVVAYKGQNISSTEEL
FT                   LDEYIHKQLYDLNLRGAYPKGKAPTPKQTHHYLSWLASKLDFEGSAEFLIEKLQPSWLD
FT                   TSKAYNQYCWMFRLIGGLIGGLIYGLIHKLSSGLSSGLIFGLSSGLIFGLFGGLTHITT
FT                   SEKLSFSWGAFYRSGLGSVLIFGLFGGLSSGLSSGLFGGLSCGLIFGLISGITASQIDA
FT                   RDKTNANQGIKDSISNGLIVWLIFGLISGVVGGLFNELTGGLIVGLTGGLTGGLIFGLN
FT                   AACKHLSLRIALYHSGVAPWNYARFLDHAENQRFIQRTGGRYRFVHDLLRKRFAATLKE
FT                   N"
FT   gene            73323..73448
FT                   /locus_tag="AM1_D0080"
FT   CDS             73323..73448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32575"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNI9"
FT                   /protein_id="ABW32575.1"
FT                   /translation="MPKIRCFNISNDEMIEYSLNIFFKVINHLICYSKLDSLLQD"
FT   gene            73580..73915
FT                   /locus_tag="AM1_D0081"
FT   CDS             73580..73915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32576"
FT                   /db_xref="GOA:A8ZNJ0"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNJ0"
FT                   /protein_id="ABW32576.1"
FT                   /translation="MFALIGLGDIVGRFVSFFAKNRSSNLTRKVASFSYLFGCSIVVIF
FT                   YFSNLKSENLSRNIFFKAVNIILSLIPSIILTLRTGRVEPLYTWILIIPRVIGMYAGST
FT                   QAYEQAS"
FT   gene            complement(74214..74651)
FT                   /locus_tag="AM1_D0082"
FT   CDS             complement(74214..74651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32577"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNJ1"
FT                   /protein_id="ABW32577.1"
FT                   /translation="MRYTLSALKSAVLAAATASSKPGFEGEFATSAQLRKAVSAKWPDD
FT                   TNDARTRGYWLGLATYFDIDNQPWKDAKATKTKLSDIKTEVLAHYEVSDTNALKAKLKD
FT                   WGISHDKLSTRKAWEELLAGCKASRKGQVIELPADPLGMVA"
FT   gene            75002..75757
FT                   /locus_tag="AM1_D0083"
FT   CDS             75002..75757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32578"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNJ2"
FT                   /protein_id="ABW32578.1"
FT                   /translation="MPSPTERPNTDYTKRNNIRRIVKIACAPLLYKVLVEKRDLAGELV
FT                   RDAQGKKVLEEIPLQDATSAQLFNHYRHNVTNYEEAIDLIKQSQNGYISDKQVKWCSAA
FT                   SAEVVMAVLRTEHEITLEKYFELESDFQDIIEAAQTNNLFDIIQLIRQSVGNAVESTLQ
FT                   KSLIRANNSRNTYRNENNLQRCKLYLIDDTVNHEDDLSVIRERVNIVLKQRGTNKLAEA
FT                   WAKLTDWESSEVIELFKREGLIRDLKKLE"
FT   gene            75762..76088
FT                   /locus_tag="AM1_D0084"
FT   CDS             75762..76088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32579"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNJ3"
FT                   /protein_id="ABW32579.1"
FT                   /translation="MKKIKELKSEVFVLLNVTSTIQLKKEYKSIASGKDFRFKKTWIEL
FT                   LESLTKCIDLKASAKVIKQSMHRVGRAVGNSYQQTEEQIATIKERVRLKKIAQGKDRLV
FT                   GGGI"
FT   gene            76085..76384
FT                   /locus_tag="AM1_D0085"
FT   CDS             76085..76384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32580"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNJ4"
FT                   /protein_id="ABW32580.1"
FT                   /translation="MRFTTAKSLINLDPLPEICGIYFVVTAEDEIIYVGQTTNLKNRWK
FT                   DGHKVLKRMLAEGIDPTKARLEWQKFPKRLLNRVENCAVRVHQPRLNEKSPPVL"
FT   gene            76607..77578
FT                   /locus_tag="AM1_D0086"
FT   CDS             76607..77578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0086"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32581"
FT                   /db_xref="GOA:A8ZNJ5"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNJ5"
FT                   /protein_id="ABW32581.1"
FT                   /translation="MNNPLIYLLEVANNLNSLAFGYYSQGRYEEASPLYQQALEIYQQL
FT                   DYKHLDVASNLDNLARIKMYQFGNLEETESLYLQALEMRQKLLGTNHLDVIASLSRLAD
FT                   FYFKVTRYEDAEPFYLQALKTSEKLQSNETTDIADFQSALALNYSILERYEEAESFYVQ
FT                   ALEMRQKLLGTEHPDVATSFEDLAGFYKYQGRCEEAETLYMQALEINQNFFGYEHLKVA
FT                   ASLSSLAGFYFYQRRYEKAEYFYVQSLEIQEKLDSEDFCDICDLQNLAQLYYDQGKYEA
FT                   AEHFYAKLLVYFQELNGYEDDSAVTAQRNLDDCRHKIMELNT"
FT   gene            complement(77863..80007)
FT                   /gene="topA"
FT                   /locus_tag="AM1_D0087"
FT   CDS             complement(77863..80007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="AM1_D0087"
FT                   /product="DNA topoisomerase I"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32582"
FT                   /db_xref="GOA:A8ZNJ6"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNJ6"
FT                   /protein_id="ABW32582.1"
FT                   /translation="MSRLLIVESPGKIKKLRSILGPGWNVQASVGHIRQLANEGTDNLG
FT                   FVAENGKIKCRYEPRDDRAKKTIANLKAAAQQADEIFIASDPDREGEVIGWHVAQVLGL
FT                   KQPKRVVYQEITERAVRQAISNPKSLDMDLVEAGRCRDCLDKLVGYRGSPLVWRLNNGA
FT                   KSVGRVQSATLHLVCQREREIQAFVPQDYWSVFVDYAEGFRAYYHGSTQANGQDEHSID
FT                   DSGSETKTEESTRVLSQAEADSLVAIARSNPHQVISIEGKITPKKPPAPFTTSALQQAA
FT                   GSRLKFSPEQTMQVAQKLYEAGLITYMRTDSVALSPDYCLAAKRWLEQNDADNVPKKVS
FT                   KQKVSKQAQEGHEAIRPTDIFKPSAELKQALPDDQFKLYVLIWTRALASQCKPAQIRKT
FT                   IVISQSGEIQWKAKGNLVEFKGYSKYWKDIKADTELPTLQEQQPLTLAQADSQQKQTQP
FT                   PSRYSEPKLVQLMEKKGIGRPSTYAPTIKTIKSRGYVTLIKGRLQPTSMGLEVDQFMGG
FT                   ALPELLEAEFTAQMESSLDAISEGNQEWQDYLIGWNRSYFAPALAKAKQGLPEPTSYGS
FT                   NGGKALQKSRTKCPKCSQPMGKVPSKKVKKGHFLKCEDGCTADDGRGLVMFWSDRDKSW
FT                   QLPKAKSDQPTAPAELTDYPCPVCKAKLEIYRYEKDSQPKQMLRCSDPKARTNKKHKNA
FT                   VYFASKGRWWSPKYGELETE"
FT   gene            complement(79985..80107)
FT                   /locus_tag="AM1_D0088"
FT   CDS             complement(79985..80107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32583"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNJ7"
FT                   /protein_id="ABW32583.1"
FT                   /translation="MQYLPEVIIKTVSAKTEAMIFWVCFQKASKRNDHVSPFNR"
FT   gene            complement(80091..80900)
FT                   /gene="rpoD"
FT                   /locus_tag="AM1_D0089"
FT   CDS             complement(80091..80900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="AM1_D0089"
FT                   /product="RNA polymerase sigma-70 factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32584"
FT                   /db_xref="GOA:A8ZNJ8"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNJ8"
FT                   /protein_id="ABW32584.1"
FT                   /translation="MMATKHDSLHFYLKEMARYPLLSHEEEIELARQAKAGSLRAKQRM
FT                   IECNLRLVVSIAKKHQNRGLPLLDLIQEGSIGLSTAVDKFDLAQGCRFSTYAYWWIRQG
FT                   ITAALREKSRPIYLPHNHWDKANKIKKHYRELNQTLGRKPSLSELSEATDIKPKTINRT
FT                   LQLFQKVSSLDQPVGPEQKDSLLDLLAGDDQPTQYMESLQLDEELSQVMANLDERERFV
FT                   LSQRYGLEDNQPKSMKAIGQQIGLSHEAIRLILNKIMKKLERYAVSA"
FT   gene            complement(81075..81197)
FT                   /locus_tag="AM1_D0090"
FT   CDS             complement(81075..81197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32585"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNJ9"
FT                   /protein_id="ABW32585.1"
FT                   /translation="MQQTPQQGLMLGSFWLAMKNPAMKVPAFSAGKDFKDKVKG"
FT   gene            complement(81213..81590)
FT                   /locus_tag="AM1_D0091"
FT   CDS             complement(81213..81590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0091"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32586"
FT                   /db_xref="GOA:A8ZNK0"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNK0"
FT                   /protein_id="ABW32586.1"
FT                   /translation="MPRKKKQAKPLTGKDLVAKVKQLSDYTREEKAKACGYVSNDKDGS
FT                   ERIKTIAFLNALLDAEGIDLDSQSPNGNGNSGRKASYKVSVQSNGNILVGRTYTQALEL
FT                   EPGDEFEIAVGRKHIHLTKVA"
FT   gene            complement(81765..82007)
FT                   /locus_tag="AM1_D0092"
FT   CDS             complement(81765..82007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32587"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNK1"
FT                   /protein_id="ABW32587.1"
FT                   /translation="MPSTRDPIRGIPLKEKPEGISRCGMSHATIAQNIFTSRWYEISAN
FT                   GQVIGSALDLDFYKQDATQGQNSGSTVKTKELSKI"
FT   gene            complement(82170..82655)
FT                   /locus_tag="AM1_D0093"
FT   CDS             complement(82170..82655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0093"
FT                   /product="heat shock protein (HSP20) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32588"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNK2"
FT                   /protein_id="ABW32588.1"
FT                   /translation="MMINYWNPIEEIDTVRRQLDHLFEDAIDTGKSSNYPSWAPAVELW
FT                   DTGDALILKAFLPGVNADSLDIQATRESISIAGERHPEDLQEGTKRLFSDINYGHFRRA
FT                   SKLPVAIQNTKVEASFEQGLLTLRLPKVEEEQNKVVKVNLLNKGETSQAALEASHNS"
FT   gene            82678..82803
FT                   /locus_tag="AM1_D0094"
FT   CDS             82678..82803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32589"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNK3"
FT                   /protein_id="ABW32589.1"
FT                   /translation="MQSNSENNRFLCVASNMQYLAFVENLENPTFHVEKTLHIWQ"
FT   gene            complement(83273..84064)
FT                   /locus_tag="AM1_D0095"
FT   CDS             complement(83273..84064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0095"
FT                   /product="HAD-superfamily subfamily IIA hydrolase like
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32590"
FT                   /db_xref="GOA:A8ZNK4"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNK4"
FT                   /protein_id="ABW32590.1"
FT                   /translation="MRVSGILFDLEGVLLKAKTHEVLIGAVELIDFCRLNQLPFGVISN
FT                   NTVKRPETLITLLNERELSIEANQLLTPLQFLSSELLNIDTALVIGSPTLKTFIQEHDV
FT                   EVDDTPNVNAVICGGGYSINNHNIDAAYSAIAHEKSRFLCLHKNRVFKDANGITRPDVG
FT                   CIVTGLEYSTGRKAKTLGKPSPEYFTKATLDWDLSPEEILLISDDPISDLGGGKAMGFQ
FT                   TAFILTGKYSEEIINDLEQAPDHCWLNLVQAQSEISMMVKD"
FT   gene            complement(84216..84614)
FT                   /locus_tag="AM1_D0096"
FT   CDS             complement(84216..84614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32591"
FT                   /db_xref="InterPro:IPR025355"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNK5"
FT                   /protein_id="ABW32591.1"
FT                   /translation="MSIWGPGSFENDDALDWMAELADSDDDNPIIDALNTVIDQADESP
FT                   EAPDCAVALAAVEVVAAWMGEPTEDCPEEVEVWVEGRPAPPATMISQARYVAEAISEKS
FT                   ELKKLWKNSDDFELWQTSVNDLLGRLLY"
FT   gene            84722..84835
FT                   /locus_tag="AM1_D0097"
FT   CDS             84722..84835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32592"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNK6"
FT                   /protein_id="ABW32592.1"
FT                   /translation="MVSDVISNLDKAEWVDIQKLRETQKSSNAKHRVANIQ"
FT   gene            84852..85199
FT                   /locus_tag="AM1_D0098"
FT   CDS             84852..85199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32593"
FT                   /db_xref="GOA:A8ZNK7"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNK7"
FT                   /protein_id="ABW32593.1"
FT                   /translation="MKKLSDYAIGVFLIVIAPLVIVVAGFLYIDFGHVGPPTVEQLLVK
FT                   YPTCEQRGEFVATHIKESQTTPTALINRPARDLDGLWQRYRAKVENILEDRDERIFAHT
FT                   LYKLGSGCWHD"
FT   gene            complement(85922..86038)
FT                   /locus_tag="AM1_D0099"
FT   CDS             complement(85922..86038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32594"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNK8"
FT                   /protein_id="ABW32594.1"
FT                   /translation="MSPLETENLPIDETDILSEIDELDDIDLDDLLKELQQD"
FT   gene            86140..86289
FT                   /locus_tag="AM1_D0100"
FT   CDS             86140..86289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32595"
FT                   /db_xref="InterPro:IPR021336"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNK9"
FT                   /protein_id="ABW32595.1"
FT                   /translation="MGQIHIILWQHGLLDLEQLGQNFEWRMSKQVESAKQKCPVGKNLV
FT                   AKNR"
FT   gene            complement(86402..86731)
FT                   /locus_tag="AM1_D0101"
FT   CDS             complement(86402..86731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0101"
FT                   /product="transcriptional regulator containing helix turn
FT                   helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32596"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNL0"
FT                   /protein_id="ABW32596.1"
FT                   /translation="MILGINDAPSYEGLIQEFPPRPIHNDSQLQAAQNRIDALIDLERE
FT                   LTSDESDYLDILGTLVWEYEQTLEPIPDINGVELLKVLVEERGLRQKDLVPIFKAESIV
FT                   SDVFK"
FT   gene            complement(86816..87136)
FT                   /locus_tag="AM1_D0102"
FT   CDS             complement(86816..87136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0102"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32597"
FT                   /db_xref="GOA:A8ZNL1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNL1"
FT                   /protein_id="ABW32597.1"
FT                   /translation="MPVKSYQDDLLIRLSDSDYAARYLKVSLDETLEDGNTEAFLLALK
FT                   NVIEAKGKVKDIATAADITRQHLHRLLSGNGNPTLETLAAVLNAVGLSIDFKPIEEASS
FT                   KI"
FT   gene            complement(87140..87478)
FT                   /locus_tag="AM1_D0103"
FT   CDS             complement(87140..87478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="Shows similarity to Phage derived protein Gp49-like
FT                   (DUF891)"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32598"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNL2"
FT                   /protein_id="ABW32598.1"
FT                   /translation="MNQQQWDIQKYVTVAGQCPFDEWFDNLDPNSQVRIDVRLDRLRLG
FT                   NFGDHKQLGEGVYELRFFFGPGYRLYFGKMKGQIILLLLGGSKKQQNKDIKTAQKLWAA
FT                   YKDEQGGA"
FT   gene            complement(87678..87971)
FT                   /locus_tag="AM1_D0104"
FT   CDS             complement(87678..87971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32599"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNL3"
FT                   /protein_id="ABW32599.1"
FT                   /translation="MTASQPDRLDRIEQMLERLVNIQDNQQRSIESVLQVQEKQQSAFE
FT                   RLMEGQLGLQAQMGVLSEAMLETREEAKQLKRAVDYLLSRDGEIGRGGNPTS"
FT   gene            complement(87968..88204)
FT                   /locus_tag="AM1_D0105"
FT   CDS             complement(87968..88204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0105"
FT                   /product="helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32600"
FT                   /db_xref="GOA:A8ZNL4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNL4"
FT                   /protein_id="ABW32600.1"
FT                   /translation="MKVITKLPELMEQVGIDQKTLSARTGLSPTTVGKIYRGHFDRIDN
FT                   HTVTQLCKYFGLKTIADLVEIDWEPDDVEGVQI"
FT   gene            88525..88713
FT                   /locus_tag="AM1_D0106"
FT   CDS             88525..88713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32601"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNL5"
FT                   /protein_id="ABW32601.1"
FT                   /translation="MLTDTLTQAWQPWTDAELSERNKLTPKKWLQVPIQNGYQHQPWES
FT                   GDSRHFTSDTHPEDTWN"
FT   gene            88779..89123
FT                   /locus_tag="AM1_D0107"
FT   CDS             88779..89123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0107"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32602"
FT                   /db_xref="InterPro:IPR022243"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNL6"
FT                   /protein_id="ABW32602.1"
FT                   /translation="MATIETTALSPIAQLNDRFRQGDYTLGQVFTTQGVQALSSVVQQE
FT                   LFRLVRTFDEFTPGNDPYGEHNFGCIKLNGEVFNFKIDYFAPDLIHGSEDPGDLSKTTR
FT                   VLTLMHSSEY"
FT   gene            89187..89423
FT                   /locus_tag="AM1_D0108"
FT   CDS             89187..89423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32603"
FT                   /db_xref="GOA:A8ZNL7"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNL7"
FT                   /protein_id="ABW32603.1"
FT                   /translation="MTITKEPLMTVSNPDHLDRIEELLTGFGEDLNALKEQTIKTNERV
FT                   EIYQKASQQVVNLAFGLILTAALAIIIPVITNS"
FT   gene            complement(89851..90027)
FT                   /locus_tag="AM1_D0109"
FT   CDS             complement(89851..90027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32604"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNL8"
FT                   /protein_id="ABW32604.1"
FT                   /translation="MQINHLERAAIPGQDLSNMDFHGIASGHHEKGPLMGDTKELISKD
FT                   KKSKRRFWGRGYF"
FT   gene            90268..90801
FT                   /locus_tag="AM1_D0110"
FT   CDS             90268..90801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32605"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNL9"
FT                   /protein_id="ABW32605.1"
FT                   /translation="MTVSVPPPTLTSESPRLSHSSFNRPLGLGPSPSGLAIFCNRANTK
FT                   TWYTLDANTQPQELEYPALTGYLVSIEFPPKEYRGEKSHKLRFKMQADRLYTLEAGYKS
FT                   VFAKGFLSEIAMLTPEQLRQPITIEATPSDQEEKVLFCSVWLGSEKVYFHWDDQTNWKA
FT                   IAQRAMANVAGISG"
FT   gene            complement(90854..91000)
FT                   /locus_tag="AM1_D0111"
FT   CDS             complement(90854..91000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32606"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNM0"
FT                   /protein_id="ABW32606.1"
FT                   /translation="MLQLKASLLTGNRLFIGLLVRQQKICEHHTDYFAVVVNSDAIVNS
FT                   NLF"
FT   gene            91034..91411
FT                   /locus_tag="AM1_D0112"
FT   CDS             91034..91411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNM1"
FT                   /protein_id="ABW32607.1"
FT                   /translation="MPTETRIPTRIRLGDWNVQKKAGAYVLKTPLMTHCWRCKQYHLAI
FT                   AALPVSNPKQTQFKWFCQECARNLGIQPSQELLKKLPTMHTLHIQHRKTQIKRLQNIRW
FT                   AGVDLEKCHQAAIENRTDAVF"
FT   gene            91411..91875
FT                   /locus_tag="AM1_D0114"
FT   CDS             91411..91875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32609"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNM2"
FT                   /protein_id="ABW32609.1"
FT                   /translation="MLYSASYFEPHNHHGLLVSISRSHPRSFQVDTKLPFLAPSQALLD
FT                   DWKHHQLTEAGYIDRYRQELQQAWPQVNSWLASLTPEGDCTLLCWEKTGEFCHRNLAMK
FT                   VVRKHRPDCYGGRDISADPGLQCSNCQSLIIPGVDQSYCPRCGEWIPTPI"
FT   gene            complement(91833..91946)
FT                   /locus_tag="AM1_D0113"
FT   CDS             complement(91833..91946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32608"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNM3"
FT                   /protein_id="ABW32608.1"
FT                   /translation="MRCSRATFLPWVALDIRGVAESNIYIGVGIHSPQRGQ"
FT   gene            92104..92364
FT                   /locus_tag="AM1_D0115"
FT   CDS             92104..92364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32610"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNM4"
FT                   /protein_id="ABW32610.1"
FT                   /translation="MIEVLELWEVGCDWIGGLQGCYALGHFDPATFAQAVDPDCPAEAH
FT                   QVRHEYWMEYFLEPDGDCICFRKCNADIEGAFAVTYLEIEG"
FT   gene            92385..92636
FT                   /locus_tag="AM1_D0116"
FT   CDS             92385..92636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32611"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNM5"
FT                   /protein_id="ABW32611.1"
FT                   /translation="MNIGGKSHEQVSVLASASPGVLPRNAQETKRHPSQGVLNSLQTAC
FT                   SDDFQGQIREVEQELHHGQNHGFTPCCPTQVVLLGAGS"
FT   gene            92648..92842
FT                   /locus_tag="AM1_D0117"
FT   CDS             92648..92842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0117"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32612"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNM6"
FT                   /protein_id="ABW32612.1"
FT                   /translation="MALPLQVPGASTLPDLSTYDHILVAFSGGKDSICCLLRLLELGVP
FT                   AYAYLFIGCAHWFIPVEFA"
FT   gene            92919..93047
FT                   /locus_tag="AM1_D0118"
FT   CDS             92919..93047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32613"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNM7"
FT                   /protein_id="ABW32613.1"
FT                   /translation="MFLSSSFRELIRRLRSPNAQIQNIVHNRSEDINSGERILLEF"
FT   gene            93058..93534
FT                   /locus_tag="AM1_D0119"
FT   CDS             93058..93534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32614"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNM8"
FT                   /protein_id="ABW32614.1"
FT                   /translation="MSEYGDFNNHIPTPQLDPLLMGEVMGADAFSEGDWVLLRSEGNKP
FT                   TKVTCCHHDLIFVDQGMGENFGDSLVNFYPEELGYPLDHRFWSSHQKRCYLRCYIDPQL
FT                   NTRWKALSSTPLEQEKTKQLCFLGLFLSLIALLSKVCDYIARVYSVSTLVGLSH"
FT   gene            complement(93549..94337)
FT                   /locus_tag="AM1_D0120"
FT   CDS             complement(93549..94337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32615"
FT                   /db_xref="GOA:A8ZNM9"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNM9"
FT                   /protein_id="ABW32615.1"
FT                   /translation="MAYTLSATKLITYQQCPKAYNFRYERGLSSPSAFGSPAFGIALHK
FT                   TLADIYKDWNYDYPLPSLDWFAMCWQHHTGELKPAQIHEGWMALQLYYEKYVAPLPQIR
FT                   KPIGVEGKIKASFQVNNIEFSITGRYDRLDYTDNGLELIDYKTSKTIGPSDGIDLQLGL
FT                   YFLILEQIYPEALDTLSLIYLRQGQKVSFDVTPDHHQQVRELIGDIAVKLRADDEWKPE
FT                   VGGHCNHCGYQKYCPAKSKKPEPLPEGTRDARQVQLVLGI"
FT   gene            94342..94464
FT                   /locus_tag="AM1_D0121"
FT   CDS             94342..94464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32616"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNN0"
FT                   /protein_id="ABW32616.1"
FT                   /translation="MRWGYISIVVQDALTPFSDDLLVDGLINFNIVISDEIPGV"
FT   gene            complement(94599..94751)
FT                   /locus_tag="AM1_D0122"
FT   CDS             complement(94599..94751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32617"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNN1"
FT                   /protein_id="ABW32617.1"
FT                   /translation="MKSVFVTLVRPESWPLLKNLNVEVKSKLRVILNRDIIAFLQSHVQ
FT                   VQTEH"
FT   gene            94730..95371
FT                   /locus_tag="AM1_D0123"
FT   CDS             94730..95371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0123"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32618"
FT                   /db_xref="GOA:A8ZNN2"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNN2"
FT                   /protein_id="ABW32618.1"
FT                   /translation="MSQTQISPALSSFHWSQLLEEVYQGRQTYDYKRGFNIVLHSYDIW
FT                   IVCRGIVQLHTSDGEGNEAILGLACPEMPFGLPLTQVYPYTATALTDVVLMRISQQELE
FT                   QSPILAQGIQVQLNRRLQQTEALLALNLHRRVSERFQELLLLLAREIGEQVPNGCRIGA
FT                   RLTHQQIAGLIGATRVTATRILGELRKEGWLSIDKTRHIILHGSSIVDFQ"
FT   gene            95689..96348
FT                   /locus_tag="AM1_D0124"
FT   CDS             95689..96348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32619"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNN3"
FT                   /protein_id="ABW32619.1"
FT                   /translation="MKLITSVKIQQADHTEVIDTAATQVGLAANKAFLFVIRKEIQGWK
FT                   NFTALCSWGLSKVSQKHSPIFEEVKERTVAVYRKGCQQETAFVQALIKSQLTDRVDAHW
FT                   ELHDKAIDWFKDQTHAFLADSPTDDISEVEAEDLAPDISEDLEEAVTVAEESMTILDEA
FT                   PVPVLDPPVDPDPLDDELAVPQDPTPAVVSGEGKRRTGSKRVTLADVMKQEAAKSS"
FT   gene            complement(96480..96839)
FT                   /gene="cheY"
FT                   /locus_tag="AM1_D0125"
FT   CDS             complement(96480..96839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="AM1_D0125"
FT                   /product="response regulator CheY, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32620"
FT                   /db_xref="GOA:A8ZNN4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNN4"
FT                   /protein_id="ABW32620.1"
FT                   /translation="MKTVLVVDDSPAELKLMCLYLKEAGYLVISTDDAKEAVTKAETQK
FT                   PDLVITDVVMPEMSGFELCRTLKKSEATQQLPVIICTTKNQDLDKLWGKKQGADEYVTK
FT                   PYTREDFLKAVRSVL"
FT   gene            97048..97470
FT                   /locus_tag="AM1_D0126"
FT   CDS             97048..97470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32621"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNN5"
FT                   /protein_id="ABW32621.1"
FT                   /translation="MVCIPTLSLKQLAILRLAKESSGKTIKLHCEMPIINSGEPPAGYT
FT                   ALIQKLIDLGLIAVQFKQMRCDFSRYQRRSWAKFSAELEYPSILAWEIWRDKFIARQKG
FT                   TNRAAIPGEEFEDYSYVWIQEIGVQAIQPNEDSILQ"
FT   gene            complement(97596..98504)
FT                   /locus_tag="AM1_D0127"
FT   CDS             complement(97596..98504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32622"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNN6"
FT                   /protein_id="ABW32622.1"
FT                   /translation="MPKKNFSRVKSVTNKSNLPRKLAIVPKNPTDEVVNLERINLVDRE
FT                   NWLRAIDICKARKNQTLQSLLQEIETYQGQIDQALQTAQAQSTIYAFAIGTRLDVIEEQ
FT                   ELFKEKGYNNLTAFIKSGEVRRPSGDSITTRQVWAYRRVTRGLNEFLQIAEAIRDGEPI
FT                   STELKEHLANLGSRVNQDIVETFLNSYTESITGVLELGVSKLEQVYRLPEPMALTGLLA
FT                   GKLPLEENIVEVHDVSFSQLRKAISWHEQQRKSPTKKAKTTKADRSLNDLEKVIRSLSA
FT                   IKLNKTQRTRFKELKQLLDKL"
FT   gene            complement(98497..99393)
FT                   /locus_tag="AM1_D0128"
FT   CDS             complement(98497..99393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0128"
FT                   /product="chromosome partitioning protein, ParA family,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32623"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNN7"
FT                   /protein_id="ABW32623.1"
FT                   /translation="MVYCINCEIVQLQETTMIIAIAAIKGGVGKTTLAFCLAATLAHIG
FT                   KKVLCIDLDHQGDLSSAVGIEKDASKPDIGQILFAPRREQAKLLEEGIIEVEGGIHVIT
FT                   SGSNLGAYQLEIEKGLSSESRLKDALDAFNEVYENYDYVLLDTPKGEGLFTKNALVACT
FT                   NVIVPVQTEYFALKNIPELLNLVSEIADRVNPEMIVSMIVPNRMKPTSLHKSIYQQLIE
FT                   WDVRSQLPHQSEPSWIAPPVRDLTVYAELSAQGQSLYTYTGVKPEHRTPFIAIAEHLEE
FT                   ITSSSNMHEKYEVEVNA"
FT   gene            complement(99988..100242)
FT                   /locus_tag="AM1_D0129"
FT   CDS             complement(99988..100242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32624"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNN8"
FT                   /protein_id="ABW32624.1"
FT                   /translation="MAMSMYTASVPPLIRCLNNLAGILEKGAAHAESQGIDPSALINFR
FT                   LLPDTFPLSKQVQIASAVARKGVARLAGMDAPSIEDNEA"
FT   gene            complement(100327..100470)
FT                   /locus_tag="AM1_D0130"
FT   CDS             complement(100327..100470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32625"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNN9"
FT                   /protein_id="ABW32625.1"
FT                   /translation="MEVLTEALDGLETHISIDLQGVCSLQTFCLVLPKAASRTNSIENS
FT                   SI"
FT   gene            100602..101318
FT                   /locus_tag="AM1_D0131"
FT   CDS             100602..101318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32626"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNP0"
FT                   /protein_id="ABW32626.1"
FT                   /translation="MALRFILFSLLIMGGYTSNSFAQLSTQKTLDIYRYHGLKPAIGQA
FT                   SKDGIFQDFKLQSDNLAKIWADPDAEQHEGLDNSWVKSFIDRQGTLPHLSIQFSREGYG
FT                   ANISIAPKGLIPERLPKQGLLTFEARSSDPVCIGLRLMERDGEVWGYGNPGLEYQPLCV
FT                   SPNQEWTPLKVPLSARHPGWFHFTHSGNVDLGNQTLDADILALVTLELGLKGEGHLIPG
FT                   QAVLDIRDIRVQPDSP"
FT   gene            complement(101360..101884)
FT                   /locus_tag="AM1_D0132"
FT   CDS             complement(101360..101884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32627"
FT                   /db_xref="GOA:A8ZNP1"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNP1"
FT                   /protein_id="ABW32627.1"
FT                   /translation="MTRSELMKTALQENPVMTQSEKSQLQRRAFWNAVGGAIFIALWIA
FT                   AAIAILSASSSPSAAPPIVFFGILLILTIGIGSRAYPPLKRTYVIWQDIRNGQVQFDIG
FT                   TVNPQMFAAGRNVQMVLVVDGNRTYSALDSVLRSIRNPDTQGDQTDERYCLRIAPRSRI
FT                   VVNVVPVPEYV"
FT   gene            complement(101889..102035)
FT                   /locus_tag="AM1_D0133"
FT   CDS             complement(101889..102035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32628"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNP2"
FT                   /protein_id="ABW32628.1"
FT                   /translation="MSPFEANQQIYNTFTPLYALYLERAYKLTSSKESICTSVGIRELT
FT                   KVE"
FT   gene            102563..104827
FT                   /locus_tag="AM1_D0134"
FT   CDS             102563..104827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0134"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32629"
FT                   /db_xref="GOA:A8ZNP3"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNP3"
FT                   /protein_id="ABW32629.1"
FT                   /translation="MGGGMPLVRYWVDKMASPKGVQIWKKLMHKSACLSCAWGTGGQKG
FT                   AFMNELEEPLQRCVKSLEAIASELQPGVKPHFFEEYPLYHLQTLTSMECDRLGRLSFPV
FT                   IYRAGKSHFEPISWDEIYQIAETAFKYPPHRVASYSSGRSSNEAAYLLQLMIRALGSNN
FT                   LADCSDLCHAPSSVSLSTVFGTGTSLVSLESLQQADGIVLVGSNAPANHPRLMNELIKL
FT                   NERGGTVIVINPLREVGLMKFGSPAFPLSSLVQGSKISSLFLQPVPGSDLALFMGIQKV
FT                   LLEREWIQLDFLQSHTDNWQEVVEQVKATDWATLTNICCISKEEIETATEMIHQCDRVV
FT                   FAWAMGVTQQTNSVDTIFSIANTALMTGNVGKLGAGLMPIRGHSNVQGFGSMGVTVRLK
FT                   KEIREALEKLLGQSLKREPGYDARALIEAADTGQVDALLCLGGNLYAANPDLTQAKRAL
FT                   GQIDTIIYLATKPNLGHFHGLADKNTLIIPVYARFENPHKTTTESGNNFVRLNDEGRTH
FT                   LKNADLTSEVEFLTELAHRLHGSSPVDWRRLQETRYVRQLIAQTIPGYEKIGEIDQTQE
FT                   EFTISGRIFLEPKFPTRTGKAQMQVTPLPTLSLPTRQEFGIAHNTPSIVVALMTGRSYS
FT                   QHNTVVYKEGDRYRGVPHRYCILMNLLDVQQRGWVEHQRVNVRGDAGQLNNIEIIIGDV
FT                   REGAALMFYPEANLLMKASIEPRSGTPAYKRVPVVVFSEMSSGYSDDPLASQEHSDGSS
FT                   D"
FT   gene            104839..105318
FT                   /locus_tag="AM1_D0135"
FT   CDS             104839..105318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32630"
FT                   /db_xref="GOA:A8ZNP4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNP4"
FT                   /protein_id="ABW32630.1"
FT                   /translation="MKKITEFLEPLQQVLANPVIASILEVVLGVIVIAIDFRIASASLP
FT                   RYVRDSDRRYRIRKTFNFISYILILLFAASVLSDSLGQLTVIFGVTGAGIAFALQEVIA
FT                   SLVGWAAISLGQFYKPGDRVQLGGIVGDVIDISILRTTLMECGDWFSFRDTFFFL"
FT   gene            complement(105363..105530)
FT                   /locus_tag="AM1_D0136"
FT   CDS             complement(105363..105530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32631"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNP5"
FT                   /protein_id="ABW32631.1"
FT                   /translation="MNFTSKSAKSGDTLIERLILMATRSTFYSQQSGMQRLQSAFWPKH
FT                   SMRFIPMNLG"
FT   gene            complement(105484..105654)
FT                   /locus_tag="AM1_D0137"
FT   CDS             complement(105484..105654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="Highly similar to transposases however too short to
FT                   be an active transposase."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32632"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNP6"
FT                   /protein_id="ABW32632.1"
FT                   /translation="MFERGLEVDHSSINRWVLKYSPELDKCCRRHLKPTNGSWRVDEFY
FT                   IKIRKKWRYLN"
FT   gene            106498..106920
FT                   /gene="psbU"
FT                   /locus_tag="AM1_D0138"
FT   CDS             106498..106920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbU"
FT                   /locus_tag="AM1_D0138"
FT                   /product="photosystem II 12 kDa extrinsic protein PsbU"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32633"
FT                   /db_xref="GOA:A8ZNP7"
FT                   /db_xref="InterPro:IPR010527"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNP7"
FT                   /protein_id="ABW32633.1"
FT                   /translation="MKHFRKQLLVFGLVILTCMGMTFSFQVPVYAGEILEQPINSVQVS
FT                   DPQSIPSKESCIPIGEKIDLNNANALAFKDCPGYYPTLAKKIINNGPFETVDEVLNIRG
FT                   LNLKQKQLLEDKLDFFTVSEPKTDLATRMPPRPMMR"
FT   gene            107205..108161
FT                   /locus_tag="AM1_D0139"
FT   CDS             107205..108161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0139"
FT                   /product="cell shape determining protein, MreB/Mrl family,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32634"
FT                   /db_xref="GOA:A8ZNP8"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNP8"
FT                   /protein_id="ABW32634.1"
FT                   /translation="MIYSPIEGVVLNEASIIAINQLTQTPVSVGNTARQLLGRTSTPVA
FT                   VLRPVRNGVIADLKLTQIMLQSFIRKAQQGTRIFRPRLVLGCSCGATSVEREALTEAAL
FT                   EAGARDVVLIDEPIAAALGIGLPITKPKGNLIIDIGGGTTEMAVICSSQVIDSQVISIA
FT                   GDSFNQATVDYLRQTFQVHIGELTAESLKIQFGSASDSACNDTPMEILGVNVGSGLPQR
FT                   LEINSGELRDAISIPLHKISVALLNFLERTHPELVSDIAERGIMVTGGGALLSGIDTFF
FT                   QDLTHLPVHISPNPLNSVVLGTGKILEYEHQSSYSFA"
FT   gene            108307..108423
FT                   /locus_tag="AM1_D0140"
FT   CDS             108307..108423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32635"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNP9"
FT                   /protein_id="ABW32635.1"
FT                   /translation="MGDGISSYYPQTQCLVYRAVYPASISLVTVRSFHLAGG"
FT   gene            108427..109446
FT                   /gene="pyrD"
FT                   /locus_tag="AM1_D0141"
FT   CDS             108427..109446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="AM1_D0141"
FT                   /product="dihydroorotate oxidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32636"
FT                   /db_xref="GOA:A8ZNQ0"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNQ0"
FT                   /protein_id="ABW32636.1"
FT                   /translation="MDLSTTYLGTRLRSPLVVGACAPLSEKIDHLRHMEDAGAAAIVLH
FT                   SLFEEQLRQDRLGFHHHLTHGTESFAEALSYCPEPDVFHVGPEQYLEHIHQAKAIVDTP
FT                   IIASLNGATIGGWTNYAKKIEEAGADALELNIYTVPTEMAIAGAEIEQSYIDIVHTVTS
FT                   TVNIPVAIKLSPFFSNLAYMAKRLTDAGVNGLVLFNRFYQPDIDIETLEVRPNLLLSTP
FT                   QDIRLPLRWIAILYGTLPVDFAATSGIHTAADVLKMMMVGANATMLVSVLIRHGIDHLR
FT                   TLEHALCQWLKEHEYESIQQLQGSMSQVNCPDPSAFERVQYIEALQTYHSLGLMPMRV"
FT   gene            complement(109464..109604)
FT                   /locus_tag="AM1_D0142"
FT   CDS             complement(109464..109604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32637"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNQ1"
FT                   /protein_id="ABW32637.1"
FT                   /translation="MRIPIRLTWCIEMDETMASKQEQTDQKGMNFEGSVDRLNQDLDRL
FT                   A"
FT   gene            109573..110730
FT                   /gene="pfkA"
FT                   /locus_tag="AM1_D0143"
FT   CDS             109573..110730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /locus_tag="AM1_D0143"
FT                   /product="6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32638"
FT                   /db_xref="GOA:A8ZNQ2"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNQ2"
FT                   /protein_id="ABW32638.1"
FT                   /translation="MHQVKRIGILTSGGDCPGLNAIIRAVIKCATHKGWEVFGIPYGTQ
FT                   GFINLELGHCTPEDLRLKEHGYDVPGLLGGLDILQFLSGSILGALNKGNPSDPAISQEI
FT                   LQGFQRLNLDALIAIGGDGSLDIIDDLAQKGQWRWVAIPKTIDNDVPFTEISLGFDTAV
FT                   NTVTRSLYDLTFTAASHDRIMVVQVMGRDAGHLALHSGIAGGADVILIPELTPSLNPSV
FT                   IDQVCRQIAVLRQGGRRFALVVIAEGVRRPDGQKVASICDFLAQQIQVQSQTLCSSGNP
FT                   KFCSLQEVDSRAIILGHIQRSGVPTAFDRLLAARFGREAVDLISQHHYNRLVVWENGEV
FT                   ASKPLTEVIPKIKDCHREKKCPDPVDPQGGLVQTAKELGIYVGTS"
FT   gene            110727..111833
FT                   /gene="hypD"
FT                   /locus_tag="AM1_D0144"
FT   CDS             110727..111833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypD"
FT                   /locus_tag="AM1_D0144"
FT                   /product="hydrogenase expression/formation protein HypD"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32639"
FT                   /db_xref="GOA:A8ZNQ3"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNQ3"
FT                   /protein_id="ABW32639.1"
FT                   /translation="MKFVDEYRDPDLIKYWVREIDHLVTQPWTIMEICGGQTHTIVKHG
FT                   IDQLLPKAITLIHGPGCPVCVTPVALIDDAITLAKTPGVMLCSFGDMLRVPGTKGDLLS
FT                   AKAQGGVVRIVYSSLDALKLAQANPDQQIVFFAVGFETTVPATAMAVYQAHQLGISNFS
FT                   VLVAHVLVPPAMEAILSAPNCLVQGFLAAGHVCTVMGYTAYEAIATQYHTPIVVTGFEP
FT                   VDILQGIYRCIHQLEVGKAVVENQYSRVVQSNGNSEAQRLMADVFVTSDRQWRGLTSIP
FT                   NSGLKLRPRYAYLDAQALLPANSSTSDCVAPAPESDCISGKILQGVLKPPDCPAFGHQC
FT                   TPEHPLGAPMVSSEGACAAYYRYRQFRV"
FT   gene            111945..112058
FT                   /locus_tag="AM1_D0145"
FT   CDS             111945..112058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32640"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNQ4"
FT                   /protein_id="ABW32640.1"
FT                   /translation="MLKDVAASIKGGHIPSTTGGVDNDTDRKAIQFKTGKR"
FT   gene            complement(112112..112228)
FT                   /locus_tag="AM1_D0146"
FT   CDS             complement(112112..112228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32641"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNQ5"
FT                   /protein_id="ABW32641.1"
FT                   /translation="MTKDFGKSLFKMLLPNHSIFHEWILVNEIAMAFEVRQD"
FT   gene            complement(112436..112924)
FT                   /locus_tag="AM1_D0147"
FT   CDS             complement(112436..112924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0147"
FT                   /product="heat shock protein Hsp20, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32642"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNQ6"
FT                   /protein_id="ABW32642.1"
FT                   /translation="MMSIVLRDPFRSFERMYPLGWEPFQELESWRREMDRMFGRLMPIS
FT                   KSDGEKSLTFMPSAEMDETDQEIHLKFELPGLDAKDLDIEVTKDAVYIRGERKTEIEAE
FT                   SEGTVRSEFHYGKFERVIPMPSPIKTDNVQAEYNNGVLSLTLSKSEEDMKKSVKVEVS"
FT   gene            113116..114126
FT                   /locus_tag="AM1_D0148"
FT   CDS             113116..114126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0148"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32643"
FT                   /db_xref="GOA:A8ZNQ7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNQ7"
FT                   /protein_id="ABW32643.1"
FT                   /translation="MRAMQLDAPGQLLRLVERPIPTPNPHQLLLRIHICGVCRTDLHIV
FT                   DGELPDPKLPLILGHQIVGTVIELGEQVTGFKQGDRIGVPWLGRTCNCCRYCLSGRENL
FT                   CDQARFMGYNLDGGFAEYAVADAQFCFPIPEEYPDQQAAPLLCAGLIGYRSYRMVGKAE
FT                   RIGFYGFGAAAHILIQVANYQGRQIYAFTRPGDMQAQQFARELGAVWSGGSDESPPQSL
FT                   DAAIIFAPVGSLVPAALTAVTKAGVVVCAGIHMSDIPSFPYKSLWEERSIRSVANLTRQ
FT                   DGEEFLTLAPQIPIQTQVQAFPLSTANEALSALRNGKVTGAVALVMTDESGQKDF"
FT   gene            114306..115067
FT                   /locus_tag="AM1_D0149"
FT   CDS             114306..115067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0149"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32644"
FT                   /db_xref="GOA:A8ZNQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNQ8"
FT                   /protein_id="ABW32644.1"
FT                   /translation="MSQPSQISNNKGSSLMSLASTSLFKVRGVTKTYVMGEVTVEALRS
FT                   VDLELFAGEFIVLLGPSGSGKSTLLNILGGLDVPSSGQVIFQGQDLTAANDRTLTRFRR
FT                   QSVGFVFQFYNLIPSLTARENVALVTEIAPQPMHPREALELVHLGDRVNHFPAQLSGGE
FT                   QQRVAIARAIAKRPQVLLCDEPTGALDFQTGKLVLEALAQVNRELGTTTAVITHNAGIA
FT                   AMADRVITMRSGEIVAVRENEHKVKPGELEW"
FT   gene            115061..117424
FT                   /locus_tag="AM1_D0150"
FT   CDS             115061..117424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0150"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32645"
FT                   /db_xref="GOA:A8ZNQ9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNQ9"
FT                   /protein_id="ABW32645.1"
FT                   /translation="MVALDQKLLRDLRHLRGQVIAIALIVACGIACLVTMLSAYDSLQL
FT                   SQQTYYDRYQFADVFAQLKRAPDSLIERIAELPGVQQVQTRVVVDVNLDVPSLPEPATG
FT                   RLIAIPEQQTPMLNDLFIRQGQYIEPGRRDQVLVSEVFAQANHLELGDTLGAVINERWQ
FT                   QLRIVGIALSPEYVYEIRGVELFPDNQRFGVIWMGREALGTAFDMDGAFNDVALSLMPS
FT                   ANPASVIFRLDQLLKPYGGLGAYERADQISHQFINSEIESLAATAVMVPFVFLGIAAFL
FT                   LNLVLARLVSTQRDQIAVLKAFGYDNLAVGWHYLKLVLVITLLGAGLGTIVGIGLGAVI
FT                   TENYARFYHFPVLRYRAGLQIMITAIVVSGGAAVLGTFTAVKQAVSLPPAEAMRPEPPA
FT                   SFRRTIIERMGMQQFIPPVGQIILRNLERRSLQASLSILGIAAAVAILVIGRYFEDATN
FT                   YMIEAQFRQVQREDVTLVFNEPLSSRARYELTHLPGVMQAEPFRAVPARLRFQHQTHLS
FT                   GLTGLEPQGELRRLLDQDFYPVPLPDQGVVLTTKLAEILGVTPGDPLTVEVLEGERPTR
FT                   TVPVVGFVDELIGLGAYMDIHALNRLMREGPTLSGAYLTVDAHHLEQLYTQLKQTPAVA
FT                   SVALRERVITEFEKTIGGSFAIFTTVLVIFSSVIAFGVVYNVARIALSERDRELATLRI
FT                   IGFTQGEIAVILLGEQAIVTVVAIPFGFALGFGLAALITRAYDWELFRFPLIVTPASYA
FT                   FAFVIIFLVALGSGGLIRRQLNHLDLIAVLKTRE"
FT   gene            117639..118928
FT                   /locus_tag="AM1_D0151"
FT   CDS             117639..118928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0151"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32646"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNR0"
FT                   /protein_id="ABW32646.1"
FT                   /translation="MGVATLVALAFRPTPIAVDLGQVQRGPLQVTVDAEGKTRVRNRFT
FT                   IAAPVAGRLARIDLDPGDPVQSGAVVARIDPLPLTTKVKEAQARLQELRAQLAGVETQR
FT                   PKSAALAQAQAQIRVAIAAKQQAEARLADAKAALAQATRDRKRAQDLEVAGAQTRKVRE
FT                   DAELAATQRQQELEVAQKQVQGAISTVAAAQKAFSVLKAEQQDPDYLLEVYRAQISSTE
FT                   STLVNLADEARRTVVRAPVGGKVFRVLQESARFIPAGEPLLELGDARQLELVIDVLSTD
FT                   AVKVKPGAFIQVDHWGGPHTLQAQVRYVEPSAFTEVSALGVEEQRVNIIADFIPPPRSL
FT                   GDGYRVEARIVVWEDKDALKVPVSALFRCENQKWCAFVAEQGKAQRRQVIISQRSQREA
FT                   AVKKGLEVGEKVILHPTEQIKANQRIHSRS"
FT   gene            119035..119424
FT                   /locus_tag="AM1_D0152"
FT   CDS             119035..119424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0152"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32647"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNR1"
FT                   /protein_id="ABW32647.1"
FT                   /translation="MEYLYFFDNASLTIRVIEYLQQCRGLSLDLVTVIYLSGGWLMRIK
FT                   FKEWLAPKTATNVRAVMDEFGYACMPSPAMMAALKSLVDGQSPAAVMQRFRIAVVTHGP
FT                   PSREEIEAFQQQFILQSGAYPKSLR"
FT   gene            119450..119890
FT                   /locus_tag="AM1_D0153"
FT   CDS             119450..119890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32648"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNR2"
FT                   /protein_id="ABW32648.1"
FT                   /translation="MMNIKLNQHPEPFQPVTDPWQGTLVQSIPQHPSETPTVPWNLQAI
FT                   LSPTGIPDAPALSAGVREKSPTVQFLLRWGLKLSPTDHSVAGLRDALALLLWQASICQL
FT                   SQILIEEELRLNVFGQDKLKTQIEKALALLFWLGQSDAMMPA"
FT   gene            119920..121008
FT                   /gene="hypE"
FT                   /locus_tag="AM1_D0154"
FT   CDS             119920..121008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypE"
FT                   /locus_tag="AM1_D0154"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32649"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNR3"
FT                   /protein_id="ABW32649.1"
FT                   /translation="MPIDSISCPIPIEQYPQVLLAHGGGGKLMHQLIEQMFGRLFQSED
FT                   RHHHDAAVLGVPPGRLALTTDSYVVHPLFFPGGDIGSLAVYGTVNDLAMAGARPLYLST
FT                   SFILEEGLSMTTLWQVVQSMQQAAHQADVQIVTGDTKVVERGKGDGVFINTAGVGIIEH
FT                   HQTIHPQSIQPGDLVILNGDLGRHGMAVLAEREGLEFESEIKSDSAPLNHVVLDLFAHG
FT                   VELHCMRDLTRGGLASALNEIALATGVAISLDETCIPIREDVQGACEILGFDPLYVANE
FT                   GRFIAFVPPQSVDLALARLNAPLSFPLSGQSDTHPQMRHQHPAQVIGQVTTTTSPRVTL
FT                   TNRLGVERIVDFLSGEQLPRIC"
FT   gene            121009..121134
FT                   /locus_tag="AM1_D0155"
FT   CDS             121009..121134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32650"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNR4"
FT                   /protein_id="ABW32650.1"
FT                   /translation="MIESRQRKYTSRTMPCFWYLDAQKILTIEALTIVSALKILM"
FT   gene            121202..123715
FT                   /gene="ppsA"
FT                   /locus_tag="AM1_D0156"
FT   CDS             121202..123715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppsA"
FT                   /locus_tag="AM1_D0156"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32651"
FT                   /db_xref="GOA:A8ZNR5"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNR5"
FT                   /protein_id="ABW32651.1"
FT                   /translation="MIHTEPRLFSETSRKQALILGFDEVGIADIPLVGGKNASLGEMIQ
FT                   HLVPLGVNVPNGFATTAYAYRYFIQQAGIEAQLRQIFTDLDIEDVDNLRQRGRQARALI
FT                   LHTPFPKDLELAISTSYCQLCEQYGVGNVAESRDSKTQERLQAYHYNVDVAVRSSATAE
FT                   DLPDASFAGQQETYLNVHGVKQVLESCHKCFASIFTDRAISYRTLKGFDHFQVALSVGV
FT                   QKMVRSDLASSGVMFSIDTETGFKNAALVTSAYGLGENVVQGAVNPDEFLVFKPTLQEG
FT                   LSPILSKRLGSKEIKMVYDLGGSKLTKNIAVPQSDRAEFSANDAEILTLARWVCIIEDH
FT                   YSQVRGMDTPMDIEWAKDGQTGELFIVQARPETVQSQKVANRLSSYRMTVDTRPAALIE
FT                   GRAVGDRIGQGTARVIASVQGISEFQAGEVLVTNRTDPDWEPIMKKASAIVTNQGGRTC
FT                   HAAIIAREMGIPAIVGCGTATEVLQTGQDVTISCAEGEAGQVYPGLLPFVVEETALDEL
FT                   PPTRTQILMNVGNPDEAFGLAAIPCDGVGLARLEFIIANQIKIHPLALLRYDELTDVDA
FT                   KLIIAQLTSHYDHKPDYFVDKLAQGVGMIAAAFYPNPVIVRMSDFKSNEYANLIGGRQF
FT                   EPMEENPMIGWRGASRYYDPNYRQAYSLECQALKRVRDEMGLRNVIPMIPFCRTPEEGQ
FT                   QVLKEMAQHGLQRGENGLQVYVMCEVPSNVVLAEEFAEVFDGFSIGSNDLTQLTLGLDR
FT                   DSALVAHIFDERNAAVKNLVRQVISVAKAKGRKIGICGQAPSDYPEFAQFLVEEGIDSI
FT                   SLNPDTVLKTRLAIAQVEAQTTTTH"
FT   gene            123957..125327
FT                   /gene="atpD"
FT                   /locus_tag="AM1_D0157"
FT   CDS             123957..125327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="AM1_D0157"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32652"
FT                   /db_xref="GOA:A8ZNR6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR017691"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZNR6"
FT                   /protein_id="ABW32652.1"
FT                   /translation="MVDVHFSDEVPPLRHLLRAGPQAQIAIEGLTYLSANLIRGIALTP
FT                   TQGLARGARVIDTGQSLQVPIGEHLLGRAFNVFGDPIDGLGPLKGMKRSLHGQAVPLHQ
FT                   RTTGTDILVTGIKAIDLLAPLERGSKAGLFGGAGVGKTVLITEMIHNIVSRYDGVSIFC
FT                   GIGERSREGEELYREMKAAGVLNNTVMVFGQMNEPPGSRFRVGHAALTMAEYFRDQAHR
FT                   DVLLMIDNVFRFIQAGSEVSGLMGQLPSRVGYQPTLATELAELEERICSTAHGAITSVQ
FT                   AVYIPADDLTDPAAVHTFSHLSASIVLSRKRTSEGLYPAVDPLQSGSKMLTPSVVGQRH
FT                   YQVAQAVRKTLAEYEDLKDIIAMLGLEELAQNERQTVYRARRLERFLTQPFFTTEQFSG
FT                   IPGKMVSLDQTLTGCEAILDDKCSGLSEQALYMIGAVDEAELEHQEREAQEVEEIGQ"
FT   gene            125317..125712
FT                   /gene="atpC"
FT                   /locus_tag="AM1_D0158"
FT   CDS             125317..125712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="AM1_D0158"
FT                   /product="alternate F1F0 ATPase, F1 subunit epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32653"
FT                   /db_xref="GOA:A8ZNR7"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR024037"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNR7"
FT                   /protein_id="ABW32653.1"
FT                   /translation="MANSGRLHIRIFLPHAILMEQPVIKVTAESKQGVFCLLPHHIDCL
FT                   AILVPGIVSLITEQGNECFVAVDEGILVKCGPEVRISTRNAIQGTDLGSLKQQVDQQFR
FT                   QIDEKERLTRSALAQLEASLARYFSRL"
FT   gene            125727..126041
FT                   /locus_tag="AM1_D0159"
FT   CDS             125727..126041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0159"
FT                   /product="F0F1-ATPase subunit, putative"
FT                   /note="H(+)-transporting ATP synthase, gene 1"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32654"
FT                   /db_xref="GOA:A8ZNR8"
FT                   /db_xref="InterPro:IPR011744"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNR8"
FT                   /protein_id="ABW32654.1"
FT                   /translation="MENARLAKGINQVDKHGFQKQVKDKVNRKLKARHEKKSVWFGLGL
FT                   FGLVGWSVAIPTLLGIAIGSWLDNHVPSRYSWTLTMLVVGVGLGCLNAWYWIKKESHHE
FT                   "
FT   gene            126034..127263
FT                   /locus_tag="AM1_D0160"
FT   CDS             126034..127263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0160"
FT                   /product="Na(+)/H(+) antiporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32655"
FT                   /db_xref="GOA:A8ZNR9"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNR9"
FT                   /protein_id="ABW32655.1"
FT                   /translation="MSETILLYLVLLVGTTIVLAILFKAGAERLGIPPLVGYLLLGFVL
FT                   QLLDFRGFLASEVVLEVYSFLAELGIISLLFRVGLECNLTGLLRQLPRACLLLVGDVIC
FT                   SGSLGFITAYFLLNLSLVASLFIGIALVATSVGISISVWQDSQALNSINGELLLDIAEM
FT                   DDIAAIILMSLLFSLAPSWQHGTEIKFLPLLETIIGPFCLKVIIFSTFCLIFFRYIEQP
FT                   LTQFFERIEPAPDPMLMVAGTGFVIAAIAGLLGFSVAVGAFFAGLAFSRDPHAVRIDAS
FT                   FGTLYEFFVPFFFINIGLQIQFTGLATTVGISLVLLSAALIGKLMGVGGLLLLTQGDLS
FT                   SATLLGISMIPRAEITMVILQRGRDLGTWAVSVQIFAGMTLVAIATCIIAPMLLYPLLK
FT                   QWPQLQEVEA"
FT   gene            127260..127595
FT                   /locus_tag="AM1_D0161"
FT   CDS             127260..127595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32656"
FT                   /db_xref="GOA:A8ZNS0"
FT                   /db_xref="InterPro:IPR017581"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNS0"
FT                   /protein_id="ABW32656.1"
FT                   /translation="MNSHSPALFTSLILGSSLGLLYFGGLWITILRFNRTTQPILLMWS
FT                   SFLLRLGTVLGVFHLILQNGMSDHLLAPLLLTFLGFLGARNLLISSIIPLPKKIKKGRK
FT                   DVVNYDL"
FT   gene            127737..128441
FT                   /gene="atpB"
FT                   /locus_tag="AM1_D0162"
FT   CDS             127737..128441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="AM1_D0162"
FT                   /product="ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32657"
FT                   /db_xref="GOA:A8ZNS1"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR017692"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZNS1"
FT                   /protein_id="ABW32657.1"
FT                   /translation="MHLTPDQTIFWQWGLFSLNATLIFTWLVMGVLVVGSWFVTRHLSA
FT                   STQISRGQNLLEVIVLGIRDQIQEIIDQPADPYLPFIGTLFIFIALSNLLSVIPGYQPP
FT                   TGSLSTTTALALCVFFAVPLYGVQKKGVRGYLQQYLQPNPIMLPFNIIGDFSRIVALAV
FT                   RLFGNVMSGTMIVGILLSVAPLFFPVMMQVLGLLTGVIQAYIFAILAMVFIAAASQVDQ
FT                   HNYQTDSEVSHG"
FT   gene            128434..128721
FT                   /gene="atpE"
FT                   /locus_tag="AM1_D0163"
FT   CDS             128434..128721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="AM1_D0163"
FT                   /product="ATP synthase C chain"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32658"
FT                   /db_xref="GOA:A8ZNS2"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR017708"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNS2"
FT                   /protein_id="ABW32658.1"
FT                   /translation="MDNIALVGMASIVISGLTIAIGSIGPALGEGRALSQALSALAQQP
FT                   DEANTITRVLFVGMALVESTAIYCFVITLILIFANPFWTYVVEQASTNGG"
FT   gene            128724..129515
FT                   /gene="atpF"
FT                   /locus_tag="AM1_D0164"
FT   CDS             128724..129515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="AM1_D0164"
FT                   /product="H(+)-transporting ATP synthase, subunit B,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32659"
FT                   /db_xref="GOA:A8ZNS3"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR017707"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZNS3"
FT                   /protein_id="ABW32659.1"
FT                   /translation="MLIDPLTVVAQIINFLILVALLRRFLYTPITQVMKKRERLIAQQL
FT                   QDAAHQQEVAQQEAERWRQMQQSLEHRQASFLTQAQDAADEHRHQLLQQIRDEVDSTQA
FT                   QWREAVKREQHVFLSALQQRAGQQLAATLRCILQDLASANLEQQILETFITRLSHLPFS
FT                   EQGVLETSLSNARGEELVISSTFPMPEDRKAQILAVLHQYAPAMESSVYQFVTIPDLIC
FT                   GIELKIPGYKLAWTIEQYLEQLEVKLNQVWDGMEKSWVEQG"
FT   gene            129519..131060
FT                   /gene="atpA"
FT                   /locus_tag="AM1_D0165"
FT   CDS             129519..131060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="AM1_D0165"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32660"
FT                   /db_xref="GOA:A8ZNS4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR017710"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZNS4"
FT                   /protein_id="ABW32660.1"
FT                   /translation="MEAPKLDILKPVLQHIFAAFDQVEGEYPFELQSQEIGIVTSLGHG
FT                   IARATGLLQVQSEELVKFPGDRMGLAFNLDPDEVGLILLDDGHSLKAGCEVQRTGRVLD
FT                   VPVGEGLLGRVVDATGRPLDQRGLVTAQERRPVEREAPAIMDRAPVTVPLQTGIKAIDA
FT                   LIPIGRGQRELIVGDRQTGKTAIAVDTILNQKDQDVICVYCAIGQRSSAVAKLIAELRN
FT                   RGAMDYCIVVVAEGEASPGLQYITPYAATTMAEYFMEQGQDVLIVYDDLIQHARAYREL
FT                   SLLLRRPPGREAFPGDIFYIHARLLERATCLRPELGGGSLTALPIVETEAQNLSAYIPT
FT                   NLVSITDGQIYLTPDLFQKGIFPAVDVGKSVSRVGGKAQLPAYRDVAGDLRLSYTQFEE
FT                   LESFARFGTRLEESTRQSLERGRRVREVLQQPQFQPLPVAEQIAVMLAVTQGQFDLVPI
FT                   EQVSQAQQLIGEAIRRELPNICDRIQNAGQLSETDRETLLNWIANHILKDSDNEL"
FT   gene            131155..132033
FT                   /gene="atpG"
FT                   /locus_tag="AM1_D0167"
FT   CDS             131155..132033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="AM1_D0167"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32662"
FT                   /db_xref="GOA:A8ZNS5"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNS5"
FT                   /protein_id="ABW32662.1"
FT                   /translation="MQTLETLKRKIASTQELQTVAKTMKALAAANIRQYEQAANALQHY
FT                   RQTLAMAIQILRINYPDTLTHLRPRAHPRLGIVIFGSDQGMCGRFNEQLSEMVIQHLEQ
FT                   HSSQGGQPLLLGMGARICDSIIDQGYAIERYLSVPASVDGITSKAQTIVVQLEQWRNQC
FT                   QVDQIWVFHNQPIRGHTSTPHRQQLFPLESDRDRSSSWSTRCRPMVFLSRERLFSAIFR
FT                   QHFFVALYQACAESLASENASRLTSMQLAQTNIAEHLMELQAAFQQQRQTKITEELLDI
FT                   VSGFEALNQSH"
FT   gene            complement(132030..132599)
FT                   /locus_tag="AM1_D0166"
FT   CDS             complement(132030..132599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32661"
FT                   /db_xref="InterPro:IPR021469"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNS6"
FT                   /protein_id="ABW32661.1"
FT                   /translation="MRVWIRRNLLLLLMISTLVLLLLTNMGNGISSSAIADVSMTREAQ
FT                   GQMLYQSRQHLLDQQGNDWLVVASKHVGIASPPKIDLMLAGCPGFVDIDHSLPLTLVTS
FT                   QGKTVKVKNLPESLYTELLPGPNVAQYNLQPVVPKLDAALYLLIPTKGMKFIKVEVPTQ
FT                   VVQEWQTVATCADILCEPLAAPALSH"
FT   gene            complement(132659..132874)
FT                   /locus_tag="AM1_D0168"
FT   CDS             complement(132659..132874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32663"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNS7"
FT                   /protein_id="ABW32663.1"
FT                   /translation="MKPKHSFTRLVMMVWLYLNQPLFKPKSILNPMMFSHTYDRELLER
FT                   CYVRKCEIEQQRMLLERCWQYSCEIF"
FT   gene            complement(132934..133380)
FT                   /locus_tag="AM1_D0169"
FT   CDS             complement(132934..133380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32664"
FT                   /db_xref="InterPro:IPR025458"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNS8"
FT                   /protein_id="ABW32664.1"
FT                   /translation="MKLTYRGIDYDYRPPVVNYGHSAGVGKYRGLSYRRRELQEPPVPP
FT                   ISADLTYRGVAYHAGESPTDMPQSQRVNQTETVGDDWVSVAEEARWLMMDHHRIIKHRQ
FT                   QSMLGRATSEIHLKVDPSKYWNHIQGKVHPSFRVTYERSHAAMS"
FT   gene            complement(133426..133545)
FT                   /locus_tag="AM1_D0170"
FT   CDS             complement(133426..133545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32665"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNS9"
FT                   /protein_id="ABW32665.1"
FT                   /translation="MKGICPTPLSIRLIQLSEFEELVKIEVSTILHKLLRPSQ"
FT   gene            133641..136019
FT                   /locus_tag="AM1_D0171"
FT   CDS             133641..136019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0171"
FT                   /product="two-component transcriptional
FT                   regulator/diguanylate cyclase (GGDEF)"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32666"
FT                   /db_xref="GOA:A8ZNT0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNT0"
FT                   /protein_id="ABW32666.1"
FT                   /translation="MRILVVEDDELVAEALQTLLVDLNYAVELATDGQTAAELVEAFEY
FT                   DLILSDVMLPRLDGVGLCQQLRSQGYQIPILLLTGKDSSHDRAIGLDAGADDYVVKPFD
FT                   PEELAARVRALLRRGEAIKPPILKWENLQLDPRACEVKYQDVLLKLTPKEYALVELMMR
FT                   NTRRVFSCGMILEHIWTYEDTPGEEAVRTHIKGLRQKLKASGAPTDLIETVYGIGYRLK
FT                   PLAELKKNQGTSVQTPEVKIKQQTMSAIADIWIKFQPRIQEQINQLDKAVVAVTEGCLN
FT                   NELRQSAQQEAHTLAGGLGTFGLSKGSQLAREIEHLLRSHSSLDAKQSLQFQQDVEALR
FT                   REINYASQPATQVTSDRQDELGQWVVLVIDADTPSRDALATEARQHQIRYLTAESIDLA
FT                   RDLIQEQSPHLILFDPAGQSPIQSLTFLEALLYLPLPIPVLIWTADEERYQEMAKAYSS
FT                   GQRPISKSLPLQQVWDRVEHTLQSKGGKEARIMIVDDDPQILETVAALCKPWGLEVIGL
FT                   DEPTQFWETLTNSPPDLLLLDVEMPEIGGIDLCRVVRNDIQWEQLPIIFLTAHTEADVV
FT                   NQVYASGADDFISKPIVGPELVVRILNRLERTRLQRRLSTIDPLARVLSRHESTHALEL
FT                   LLSEVAHQPRSMCLVILEIERLQQINDCFGYAVGDSILRQFAQALLGLASTEDVIARRG
FT                   GNQFLVGLLGATKAEGGQRVQDFLNVVHKTPYSIPDGTNIQITCSASVVHCPEDSQDFQ
FT                   DLCILAEETLTEARALGWGQVRIANQSLSLPAKLHAEKG"
FT   gene            136192..137103
FT                   /locus_tag="AM1_D0172"
FT   CDS             136192..137103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0172"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32667"
FT                   /db_xref="GOA:A8ZNT1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNT1"
FT                   /protein_id="ABW32667.1"
FT                   /translation="MFRQNLRVDTFERQLAAIVGVSLLMAAYSFGSPVNLTTPRGENLS
FT                   VEKITVSLDERSSSIHDAQTLKLASNEPPSTCYQFPTQFQGQTIYGVQLPRHQKAIALT
FT                   FDDGPWPHNTSTVLTILQQHQVKATFFVLGRNVAQYPHLIQQIATAGHAIGNHSWSHGY
FT                   QDHSLEMAQAEIQQTTDIVKQHTGHKTALFRPPGGFLDNGLVAQASSQKMVTVLWTIDD
FT                   TYEGSVDLAVQNVIQNATPGGIVLMHDGGGNRELMIKALPLVISELKQQGYQLVTIPQL
FT                   LNLADTQVRSEDAIDCMSSDLT"
FT   gene            complement(137182..137817)
FT                   /locus_tag="AM1_D0173"
FT   CDS             complement(137182..137817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0173"
FT                   /product="universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32668"
FT                   /db_xref="GOA:A8ZNT2"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNT2"
FT                   /protein_id="ABW32668.1"
FT                   /translation="MPALRQNLLSLLVKIKLYHGDIGGDGNCQDGCYFYGGILMRYHRI
FT                   LVALDTSFLQPAVYEQALVEAKLHAAEVKLFHSVEAEINPLGNSTISPVGTPLESGYLS
FT                   PSAVDYELARQAWDAQIAESKLWLQEFCLKAEHQGIKTTFETELGNPGPQICKRAKDWH
FT                   ADLIVVGRHGRTGLKELFLGSVSNHIVHHAPCSVLVIQGETVVSEDSI"
FT   gene            138079..138951
FT                   /locus_tag="AM1_D0174"
FT   CDS             138079..138951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0174"
FT                   /product="nitroreductase family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32669"
FT                   /db_xref="GOA:A8ZNT3"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNT3"
FT                   /protein_id="ABW32669.1"
FT                   /translation="MATIQIDAERCQKCGKCVQICPTIFAQHTKGAIPHLLDTTRCIEC
FT                   GHCVAICPSEAISHSSFPSGTIAPIQPEQLPDTAQFMELLRSRRSIREFSKRQVDRALI
FT                   EQIIEAACFAPSSHNVQSTEYIVVQDPAMRQQIVELTIAQYRQWRKLLGNPIARTLTRL
FT                   VRGSTGQATLDELREAFTNLINQYGQGSDPILREAPTLLIFHGDRHIGFAGVNANLALQ
FT                   NASLVCETLKLGAFYTGYVVAGSNFNPRLARLLKLPPNHKIYAGLAIGHPRFHYKNWIE
FT                   RKPTQIQWF"
FT   gene            139213..140286
FT                   /locus_tag="AM1_D0175"
FT   CDS             139213..140286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0175"
FT                   /product="universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32670"
FT                   /db_xref="GOA:A8ZNT4"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNT4"
FT                   /protein_id="ABW32670.1"
FT                   /translation="MLKKILVALDHSAFSQKTFMQSLVLAKATHAKLMLFHVISSTEEG
FT                   YPPYPLMPGVLEEFDLSYAGVANSYLNDLDVFKASSFELLRSRANQAKEKGLTVFYQQS
FT                   MGDPGREICEISRQWKADTIIIGRRSRNLLSKVLLGSVSNYVTHHAPCSVLIVHHQDVP
FT                   EFIPKQSINTLEANKLSFEEWRGKLSYRSILVALDGGDINQPIVNRAINLAKRMSTARL
FT                   MLLHVLPHDVAKVPIPSPPPTAIAQQRLDNYPSLRDDILYSQQRQWNAYDSDCLPQLRS
FT                   YTAIAREAGIPTEFIQQPGSPGEVICEFAKNRSSDLILVGNRGRSGLSEMLLGSVGKYV
FT                   ANHASCSVMVVRPQQPA"
FT   gene            140334..140867
FT                   /gene="hoxE"
FT                   /locus_tag="AM1_D0176"
FT   CDS             140334..140867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxE"
FT                   /locus_tag="AM1_D0176"
FT                   /product="proton-translocating NAD(P)H-quinone
FT                   oxidoreductase, 24 kDa subunit, chain E"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32671"
FT                   /db_xref="GOA:A8ZNT5"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNT5"
FT                   /protein_id="ABW32671.1"
FT                   /translation="MSEGSQTIVDGKPHPSGDQRFRVLEATMKRHQYQPNSLIEVLHKA
FT                   QELFGYLERDILLHIAHSLKLPPSQVYGVATFYHFFSLTPSGRHTCVVCMGTACFVKGA
FT                   ASLLSTVEQIAHIQAGETTQDGGLSLSTARCLGACGSAPAVVLDGQVVGYQTSENLGQQ
FT                   VTQMMDHPQSKVAT"
FT   gene            140868..142523
FT                   /gene="hoxF"
FT                   /locus_tag="AM1_D0177"
FT   CDS             140868..142523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxF"
FT                   /locus_tag="AM1_D0177"
FT                   /product="proton-translocating NAD(P)H-quinone
FT                   oxidoreductase, chain F, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32672"
FT                   /db_xref="GOA:A8ZNT6"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNT6"
FT                   /protein_id="ABW32672.1"
FT                   /translation="MDLQELQTLAEREQEILDAPCIRCCTVGGCLSANALAVKEQIEVE
FT                   IATQDLNPPMHVRGVGCMGLCSRGPLVRLDPAGILYDQVTPEDAPELVHACHKTLQPHL
FT                   PKALSNSSPLQPSSYQPRHHPFFTLQHPIVLENSGHIDPKEIKDYMAQKGYLALTQALY
FT                   DMTPSDVIDQITQSGLRGRGGGGYPTGLKWSTVAKMPPGQKYVICNGDEGDPGAFMDRS
FT                   VLESDPHRVLEGMAIAAYAVGANQGYIYIRGEYPLAINHLETALRQARKQGLLGSQIFE
FT                   SPFDFRIDIRIGAGAFVCGEETALMASIEGKRGLPHPRPPYPAESGLWGCPTLINNVET
FT                   FANIAPIIRNGAEWFVGIGTDKSKGTKVFSLAGKIQNTGLIEVPMGTSLRQIVEQMGGG
FT                   VLDGSAKAVQTGGPSGGCIPAHAFDTPVDYESLTRLGSIMGSGGMIVMDQATNMVDVAR
FT                   FFMEFCMEESCGKCVPCRAGTVQLYQLLTKICDGKARKEDLESLNQLCEMVKDTSLCGL
FT                   GKSAPNPILSTLRFFKDEYLTLMHNEGSGDYHPP"
FT   gene            142720..143286
FT                   /locus_tag="AM1_D0178"
FT   CDS             142720..143286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32673"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNT7"
FT                   /protein_id="ABW32673.1"
FT                   /translation="MQCIHCQSENVVKNGTKTLKTAQVVQYFLCKDCGRRFNERSGTPM
FT                   ARLRTPVETISMAINARTEGLGIRAAGRVLRKSPNSIILWEKRLSAQLSNFSPPSPKES
FT                   EVTIEGDEVYTRVGENLPPPGLVKVGPFISSTVRVAIGSRLTRVLRMNHYLRKVSKLLG
FT                   IGLNPVHRFVGSQMENVDTPRCCGS"
FT   gene            143274..143717
FT                   /locus_tag="AM1_D0179"
FT   CDS             143274..143717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32674"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNT8"
FT                   /protein_id="ABW32674.1"
FT                   /translation="MWKLASTYLPRSTTTQAYPFRKVWRAGLEVAMKIKGSQGKPRVVW
FT                   VNREHPYTAISPKSDVHANHLEALHSSLRRRASGYRRRQNHYAKTVEGLQRALNVQRLI
FT                   HNWCRTHYSHGYQRTPAMVMGFIQRPVKIGEVLTVRAFNCLTS"
FT   gene            143732..144691
FT                   /locus_tag="AM1_D0180"
FT   CDS             143732..144691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0180"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32675"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR026358"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNT9"
FT                   /protein_id="ABW32675.1"
FT                   /translation="MQNPVEPSRFPHPPVKVWGRGVRLTLLTTLCSLFTLANPQLVSAE
FT                   TVLEKIERTSTVTAGTNKNTLPFAFQDEQGQFQGYSIEMLKQIQAQLSKKLGKEINLEL
FT                   VALTPNERIPKLVAGEVDIVCDASSYTWERDKDIDFSVSYGLTGTRLLIKQGKKAWEPE
FT                   MLVNQKIAAVAGTTNEIAIRRAQPKAQIIVLPDHTQGYKALEQGTVDAFAADGILLEGW
FT                   LQTSQNPEDFTVVGYFSREGIACMVPENNSKFVNQVNYSLVRFMEGYLKGKEPYVKTFD
FT                   RWFGPEAKVPLTQDLRSLVLETMQLVIDFKEEIPESDL"
FT   gene            144990..145181
FT                   /locus_tag="AM1_D0181"
FT   CDS             144990..145181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32676"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNU0"
FT                   /protein_id="ABW32676.1"
FT                   /translation="MATLKDKSLSIQSLSKTVRRFLSYIAQPILRIFSPSHDDYPKVGV
FT                   QPFEGDPADPDLNQEGSW"
FT   gene            145222..145941
FT                   /gene="hoxU"
FT                   /locus_tag="AM1_D0182"
FT   CDS             145222..145941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxU"
FT                   /locus_tag="AM1_D0182"
FT                   /product="hydrogenase subunit U"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32677"
FT                   /db_xref="GOA:A8ZNU1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016214"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNU1"
FT                   /protein_id="ABW32677.1"
FT                   /translation="MDVKTLKIDDQLISARGDETILEAATASGIHIPTLCNLQGVSLWG
FT                   ACRLCLVEVSGSSKLLAACVTPVAEGMIVQTQTKRLKHYRRMIVELLFAEGNHICSVCV
FT                   SNHHCELQDLAIEMGIDHVRFTYQFPDRSVDISHPQFGVDHNRCVLCTRCIRVCDEIEG
FT                   AHTWDMAGRGRKSRVITDLNQPWGEAESCTACGKCVNACPTGAIFRRGSTVAEMEHDRS
FT                   QLEFISTARTRREWVQK"
FT   gene            146062..146607
FT                   /locus_tag="AM1_D0183"
FT   CDS             146062..146607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0183"
FT                   /product="Ni-Fe hydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32678"
FT                   /db_xref="GOA:A8ZNU2"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNU2"
FT                   /protein_id="ABW32678.1"
FT                   /translation="MAKLKLATVWLGGCSGCHMSFLDLDEWLFELAHQVDLVYSPFMDA
FT                   KQYPQEVDVALVEGAIANTDHWEMIHQVRDCTQYLIAFGDCAVTGNVTALRNLLGTAEG
FT                   VLERSYINLADLVPQIPAEEAIVPPLLDWVKPVHTVVPVDLYLPGCPPSPSRIKFVLEA
FT                   LLQGKRPQLEGRDQIKFG"
FT   gene            146681..147226
FT                   /locus_tag="AM1_D0184"
FT   CDS             146681..147226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0184"
FT                   /product="CBS domain containing membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32679"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003823"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNU3"
FT                   /protein_id="ABW32679.1"
FT                   /translation="MLKVRDIMTQEVIAIQDTATVAQAIALMQYHKVRSLIIEHPEGQT
FT                   AYGIITERDIVYRVMAVGKDPHEIGVQELVREPCITAHPDLTVEEMAQLFAAAGIQRAP
FT                   VIDGQQLLGIISVTDLVMKTDGKQNYQADWLALQVENALKHARIICGDPQTQISKECSV
FT                   AWDVVEAFEDQAALNGAI"
FT   gene            147324..148700
FT                   /locus_tag="AM1_D0185"
FT   CDS             147324..148700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32680"
FT                   /db_xref="GOA:A8ZNU4"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNU4"
FT                   /protein_id="ABW32680.1"
FT                   /translation="MALVITPLLLAVSAVGAPNFVTQDQITVGATEVIQGNYYATGDRI
FT                   TVDGTLKDNLFAAGDTIQLSGTVEKDVYLAGDEITIDGTVKGDAILAGALVALNGSVEG
FT                   DLIAAGQAVVVNGTVQDDVRIAGEALLLKNQARVKDDMIAAGLSLESQPQTSIGGTLTV
FT                   ASGQALLAGTVDQDVVGGMGGLTLEGTVGQDVAVTVGDNQTWKPIFGPSPRLKIPDVPA
FT                   GLTLTDSAQVKGRLTYKSPTTASLKDGSQVTGKITHQPIPEWEPTPVKPTNIVLDQLQR
FT                   LLTIGLVGCAMLWAFPKWTEGLTQNIQTRPLRTLGWGIVTSVLVGVASVVIAVLTILAF
FT                   IVLILTLQGLAWPILGVGTLANLALWVGIGSFVSLIAPVLISNLGGRWLCSQFNLNKTA
FT                   NRFIPFLMGVVVLMLITAIPLIGGIISIVIIFLSLGALWNWGRSRWAKPPLQAQEALVG
FT                   "
FT   gene            148741..149367
FT                   /locus_tag="AM1_D0186"
FT   CDS             148741..149367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0186"
FT                   /product="CBS domain containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32681"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003823"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNU5"
FT                   /protein_id="ABW32681.1"
FT                   /translation="MMKVADIMTTEVIKIRNSAKVAEAVRLMRRHGIHALIVDRNHEQD
FT                   AYGIVTAFDIVAKVTAFGRDPRQVRVYEIMTKPCLVLNPELGVEYAARLLTTTGIHAAP
FT                   IIQWSLLGILSISDILDQGDFLENPLEVELAQKTQQLIADAHAICKQKGTNSKACRQAW
FT                   QDVDAVQAEAAHQRAEKLEKTAFEAFCEEYPEAFKDREYDAWCSG"
FT   gene            149405..150889
FT                   /gene="hoxH"
FT                   /locus_tag="AM1_D0187"
FT   CDS             149405..150889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxH"
FT                   /locus_tag="AM1_D0187"
FT                   /product="hydrogenase large subunit HoxH"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32682"
FT                   /db_xref="GOA:A8ZNU6"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNU6"
FT                   /protein_id="ABW32682.1"
FT                   /translation="MPQRIIIDPVTRIEGHAKISIYLDDAGEVTDARFHVTEFRGFEKF
FT                   CEGRPFWEMPGITPRICGICPVSHLLASAKAGDQILAVHIPPAAEKLRRLMNLGQIIQS
FT                   HALSFFHLSSPDLLLGWESDPAQRNVFGLMAAEPDLARSGIRLRQFGQEVIQHLGGQKI
FT                   HPAWAVPGGVRSALTDQGREQIRAGLLEVRSTALSTLKRFKDLLEDHASEARIFGNFPS
FT                   LFMGLINPKGLWEHYQGCLRFVDSVGNIIADHLDPSQFQSFIGEAVQTDSYLKSPYYRP
FT                   LGYPDQTPGLCRLESGMYRVGPLARLNVCDRMGTPLADQELQEFRQRGNGTVTSSFYYH
FT                   YARLIEILACIERIEQQIEDPGLCQPPLRAQADVNQLEGVGVSEAPRGTLFHHYQVDAT
FT                   GLLQSVNLIIATGQNNLAMNRTVAQIARHYLHGPDIPESMLNRVEAGIRAFDPCLSCST
FT                   HAAGQMPLHIQCKSAHSGQVLSEVWRTSTGEFQVKG"
FT   gene            complement(150923..151159)
FT                   /gene="hypC"
FT                   /locus_tag="AM1_D0188"
FT   CDS             complement(150923..151159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypC"
FT                   /locus_tag="AM1_D0188"
FT                   /product="hydrogenase assembly chaperone HypC/HupF"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32683"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNU7"
FT                   /protein_id="ABW32683.1"
FT                   /translation="MCLAVPGQIVSILDHDDPLLRAGKVSFGGVLKDVSLAYVPHAEVG
FT                   DYVIVHVGFALNVIDVEEAERTLQLLDNISPPV"
FT   gene            complement(151150..153654)
FT                   /gene="hypF"
FT                   /locus_tag="AM1_D0189"
FT   CDS             complement(151150..153654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypF"
FT                   /locus_tag="AM1_D0189"
FT                   /product="Ni-Fe hydrogenase maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32684"
FT                   /db_xref="GOA:A8ZNU8"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNU8"
FT                   /protein_id="ABW32684.1"
FT                   /translation="MDDRGNGYLMMTHQRLQLTIQGAVQGVGFRPFIFRLATRLKLRGW
FT                   VSNDTQGVVIEVEGGPERLNQFLAQLQANPPVLAEIETIKQKCIPPLGEHTFTIRPSQN
FT                   GPKTTLLLPDVATCADCLRELFNPSDRRYRYPFINCTHCGPRYSIIRALPYDRGNTAMA
FT                   SFHMCPDCLSEYQNPLSRRFHAQPIACPTCGPIVEVGYWQKERWVSNQLQGQAVQQNQE
FT                   GIAEKTEGLGAIGLAAVALRQGLIVAVKGVGGFHLLVDARNSDAVKRLRTRKKRPNKPF
FT                   ALMYPSLERVKHTCEVSELEAELLQSPKAPIVLLQRRHLSLADPIADEVAPGCSHLGVL
FT                   LPYTPIHHLLMADLDFPIVATSGNLNGAPISFNGEKALDDLKSIADLFLIQNRPILHPI
FT                   DDSVVQVINGQTQLRRRARGYAPLPLSVTFPSHHSSPKGLSATPQSTRPPKRPTILAVG
FT                   SHLKNTIALSLDDHVFMSQHLGDLDTVPSIDRFQQTLQALLQLYECQPNLVACDAHPDY
FT                   ASTQAAQALAQQWQVPLLSVQHHYAHVLACMAEQHLAAPVLGIAWDGAGYGLDETVWGG
FT                   EFLQITPTGFERVGYWRPFFLPGGDQAAREPRRTAMGLLYTCFGGEIFEWEGLAPLKAF
FT                   SQPSAQVLQSMLDRSLNTPLTSSVGRFFDAIASLTDLMQTTHFEGQAAMALESILGRVA
FT                   TEDDYPFHLSSSLPFVMDWEPMLIAILADIDQGVDTSWISTKFHNTLVEIIVQIAHQIG
FT                   EPYIVLTGGCFQNQYLSEKAIHRLRENQYRPYWHQQVPTNDGGIALGQIMAAHRHYAGR
FT                   FPKVNETFDRQQPFVEADSPCA"
FT   gene            complement(153680..154162)
FT                   /locus_tag="AM1_D0190"
FT   CDS             complement(153680..154162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32685"
FT                   /db_xref="InterPro:IPR007153"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNU9"
FT                   /protein_id="ABW32685.1"
FT                   /translation="MEVTTVVLHVPEHTNLILGQSHFIKTVEDLYEIMVGTCPQAKFGL
FT                   AFCEASGPCLIRFAGNDPSLQDIAVSNAKKIAAGHSFILLMQDAFPISVLNAIQQSPEV
FT                   CTIYCATANPVEVILAKTDQGAGVLGVIDGFSPKGVEGEEDILERQDFLRQIGYKF"
FT   gene            complement(154194..154871)
FT                   /locus_tag="AM1_D0191"
FT   CDS             complement(154194..154871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0191"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32686"
FT                   /db_xref="GOA:A8ZNV0"
FT                   /db_xref="InterPro:IPR011672"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNV0"
FT                   /protein_id="ABW32686.1"
FT                   /translation="MIHMIYLPVSLLLFLLFLLFLPFVWLVLTIDVVQLAAAKLGFTPQ
FT                   VALALLVLVILGSTINIPLYRMDSPVYAMDNFLMYYQRQFWGIPLLKMRQTKVVALNVG
FT                   GGLIPIILAIYQFRQANPAAILLITSIVTVVCFYAAHIVPGIGITMNPLLAPLTAALTA
FT                   MLLGINHAPATAFAGGIIGTLIGADLLHLRDITAMSGGVLSIGGAGVFDGIALCGLLAL
FT                   LLT"
FT   gene            complement(154931..155746)
FT                   /gene="hypB"
FT                   /locus_tag="AM1_D0192"
FT   CDS             complement(154931..155746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypB"
FT                   /locus_tag="AM1_D0192"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32687"
FT                   /db_xref="GOA:A8ZNV1"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNV1"
FT                   /protein_id="ABW32687.1"
FT                   /translation="MCEDCGCSAGSVQIHQGHDPQLNQAGTSIEAPSVRHLDLHAKILE
FT                   HNDRIANQNRVLFQHQGWLTVNMLSSPGSGKTALIERLAQDKRNDWQIGAIVGDLATDN
FT                   DAHRLGHAGVSAVQITTGTACHLEARMVSHALSKLPPKPWDLLVIENVGNLVCPAAFDL
FT                   GEQIRVVILSVTEGEDKPQKYPAMFKSAQVVLINKTDIAEAVGWQRDLAISSLQQIAPQ
FT                   ATLFEVSARTGAGMDAWYAYLDQCRQDLSRPSFHPQNSQVLQIGRLSSN"
FT   gene            complement(155748..156089)
FT                   /gene="hypA"
FT                   /locus_tag="AM1_D0193"
FT   CDS             complement(155748..156089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypA"
FT                   /locus_tag="AM1_D0193"
FT                   /product="hydrogenase nickel insertion protein HypA"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32688"
FT                   /db_xref="GOA:A8ZNV2"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="InterPro:IPR020538"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNV2"
FT                   /protein_id="ABW32688.1"
FT                   /translation="MHEVSLMQTTLDIAFDHAAQQGAQHIHWIKLRVGELSGVIPEALT
FT                   LAFEIVTAGTMAANARLEVETVPVMCHCSACDLDFQPTSWVYVCPTCHQFTTDLRQGRE
FT                   LELTAMEVS"
FT   gene            complement(156082..156612)
FT                   /locus_tag="AM1_D0194"
FT   CDS             complement(156082..156612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0194"
FT                   /product="hydrogenase specific protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32689"
FT                   /db_xref="GOA:A8ZNV3"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNV3"
FT                   /protein_id="ABW32689.1"
FT                   /translation="MNASPAVPQPTKPHSILVIGYGNQLLCDDAIGPRIADEVAIWRLP
FT                   QVRSLTVQQLTPELAAELANTETVIFIDACRMDPDQAVRITQISPRGMETTGSTVPSMG
FT                   HTCDPRSLLALTHSVYGHHPQAWWVEVKAIEFAVGEHLSTTAEEGIAEALDAIQELIQL
FT                   QLDSVSSSIKPHA"
FT   gene            156876..157451
FT                   /locus_tag="AM1_D0195"
FT   CDS             156876..157451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0195"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32690"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNV4"
FT                   /protein_id="ABW32690.1"
FT                   /translation="MFAITLLQILAMMGIPLIVTTVSSPMNVTEHPSVPTLATSQTWRL
FT                   ELLADGNYQVCSLPEPKDGRDGNGVCFTFAKRGEYVDGYYGFPHSGTYICVQGKAEQNR
FT                   VRGQGLALSWPGHPWPPITTSQYTWRLDQHLTLQNGYVVRSVREQSGRVNWLRFDEVKL
FT                   DMDGFHQYPTVKMRSPTQLCDWQTPTEF"
FT   gene            157517..158401
FT                   /gene="ubiA"
FT                   /locus_tag="AM1_D0196"
FT   CDS             157517..158401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="AM1_D0196"
FT                   /product="prenyltransferase, UbiA family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32691"
FT                   /db_xref="GOA:A8ZNV5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNV5"
FT                   /protein_id="ABW32691.1"
FT                   /translation="MVTLPSSPKQFNFPNLVQGVAQLCRPTLSVLAAMASCLSVFVLQP
FT                   QTSVWVYLQTATVLICMTAGAFAINDFDDIEKDRINHPERPLPSGTLLPHHAWWIAVML
FT                   FCIALGAAIPLGLSCWIVVAISALLLWNYAPILNISGILGNGVVSMIVAALIFFASLVA
FT                   ERPWAMLYPSIFLFFYILAKEIVWDIHDAEGDQQRGVNTIANLWGLTPAFSIAWGLIGL
FT                   LLISIPLAIARLTMAHPALFGCCAILMLLSYALALWRYQIIQTSQTYTNLIVLGRIGMI
FT                   LGLFGLFGTVPSL"
FT   gene            complement(158414..159433)
FT                   /gene="hypE"
FT                   /locus_tag="AM1_D0197"
FT   CDS             complement(158414..159433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypE"
FT                   /locus_tag="AM1_D0197"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32692"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNV6"
FT                   /protein_id="ABW32692.1"
FT                   /translation="MTQDPLPVGKLPSHLLAHLLSQTPIHDPQVLLGPGIGHDCAVVDG
FT                   GAKLWVIKSDPITFVTDDIGWYVVQINANDIATTGATPRWLMATILLPEQRTTATLAER
FT                   IHQQIYTACQEINVSLIGGHTEITYGIDRPIVVGTLIGEVARDSLITPRGAKPGDRILL
FT                   TKSVPIEATAILAREYSEQISQALTSDELTQARGYLYKPGISVLRDAQLANQAGQVSAM
FT                   HDPTEGGLLAALWELAQASNCQLVIDLEKVPISDLSAHICRVFKIDPLAAIASGALLLT
FT                   APQRDAPSICRTLNTSGIPCCEIGDVQSGNATVWSRTALEKERLPCPSRDEIATVISP"
FT   gene            complement(159461..164110)
FT                   /locus_tag="AM1_D0198"
FT   CDS             complement(159461..164110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0198"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32693"
FT                   /db_xref="GOA:A8ZNV7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNV7"
FT                   /protein_id="ABW32693.1"
FT                   /translation="MQQFMTFPLEAALDLQPLIAAPDTPLTEVIGLTSRSALHCHLMAD
FT                   EVNQPTLPQLGIEQTGCVLFEEDTQMVGILTERDIVRLIAENRSLGELTAAAVMSQPVV
FT                   TLVDDGHSTVFTALERMNRQHIRHLPVLDQQGQVKGLLTPRRIRNLLQPSDLLKIRRVR
FT                   EVMTPDVVQALPTNSLLQITQCMNLQGVSCIVMVEPADDLTENHCPIGIITERDIVQFQ
FT                   RLELDFAQTQAQEVMSTPLSLVTPDDSLWTVHQKMQQQKVRRLVVADGHGTLRGIVTQR
FT                   NLLPVDPAEIYEVVELLQQQITQLETQNHQLLQKRNQELEQLVQDRTSKLERRDLMRHH
FT                   LAKGLATSTGEDFFQSLVTHLNQVLPADFAHIGQLVNIEGQATIRTLAVAKAGQLQSNF
FT                   EYALAGTPCEEVIEQQSCMYHQGVQAVFPHDQMLRDLSIEGYLGIPLISSAKQVVGLIV
FT                   VLCRQPLDDLAFIEEVLTILAQKTTAELERQTAETDRNRFLSVSLDLHCIAGFDGYFKT
FT                   VNPAFISTLGYSIKELLAQPFLNFVHPEDRDATVRELEQLAMGTNTIAFENRYRCHDGS
FT                   YRWFLWSATPYLQQQQIYASASDITKQKIIEQTLALRARQQTSVAQLGALALASRDIDG
FT                   LMNEIVRVVSQTLEVEYCKVLQLRPDGESLLLKAGVGWQPGLVGQAIIGTEQESQAGYT
FT                   LRSSRPVIVDNLETETRFSGPPLLLDHKVVSGMSVILQGQHQTYGVIGAHTGHHRLFNE
FT                   NDIDFLQSVANLLAQALDRHQIDQTLRQSEQEYRTLAENLPGIVYRVFPEDHNRMVFLN
FT                   DQCKTLTGNDSIDLSVGEVCSIDPMIVPEDRPQVVTTVQEAVSSLMPFQVEYRIQDKQD
FT                   QIRYFWEKGQPIPAQNGQPLHIDGVIFDVTEGKLAEVAHQESQQRLNNILESLQDIVWS
FT                   VKADSFELLYLSPAAEEIYGRPISAFIDNSQLWLQAMHPDDRAKVSGFSERILETGSQE
FT                   VEYRIVRPDGSIRWLLDRGRVIKDAEERVLRLDGVATDITERKQSQEQISELAALLNVA
FT                   TDAILVQGLDGRIQYWSKGASALYGWTQGEALSQEVGQLLEVTDEKAAEIEQYVRQHGK
FT                   WQGEQQQVTKSGDAITVMSRWTLVKDSLGNPKAILIVNTDVTQAKKLEKQFLRAQRLES
FT                   IGALASGIAHDLNNILTPIYGVAQLLPLQLPNASEQIQHQFEILQTCAQRGSKLITQVL
FT                   SFSRGADGERAILYIKPLLSELRDFTLKTFPKSIEVSTHIPDDLWSIHADATQVHQVFM
FT                   NLLVNARDAMPEGGSLSIHAMNFPLDEALAADFLNAQAGPYILITVTDTGIGIPPELQE
FT                   QIFEPFFTTKEPEGGTGLGLSTVNKIIQSHHGFITVYSEVGQGTQFKVYLPAIESVSSL
FT                   EEEELECPNGQGEVVLVVDDEAPIREVAQSMLVKHNYQVMVAADGIDAIAQYAQHHTEI
FT                   DVVLMDMQMPTLSGETTIQTLRKINPQLKVIVTSGLLVDETFALSLGQCVKAFLQKPFS
FT                   SDTLLRMLQNILQEKSQDTETEASANKSD"
FT   gene            164374..164508
FT                   /locus_tag="AM1_D0199"
FT   CDS             164374..164508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32694"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNV8"
FT                   /protein_id="ABW32694.1"
FT                   /translation="MECGENRVLLSTNKPTIAIYFGLYTLARKVHGHRFTQGIVLSRY"
FT   gene            164576..167203
FT                   /gene="glgP"
FT                   /locus_tag="AM1_D0200"
FT   CDS             164576..167203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="AM1_D0200"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32695"
FT                   /db_xref="GOA:A8ZNV9"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNV9"
FT                   /protein_id="ABW32695.1"
FT                   /translation="MNKPSEQRSLNRAQNSFRLSELSPEHITEIYDSFHIEDDRTGLSS
FT                   ETLQRAIADNLYYIQGKFPEIATLYDYYMAVAYTVRDRLLHRWINTVKTYREQDVKVVC
FT                   YLSAEYLPGPHLENNLVNLGIYDQVQQAVESSGLDLRSILAQEEEPGLGNGGLGRLAAC
FT                   YMDSLATLEIPAIGYGIRYEYGIFDQEIREGWQVEITDKWLRLGNPWEIPRPENAVEVK
FT                   FGGYTEPYTDDQGDYRVRWIPHQVVNGIPYDTPISGYRVNTTSTMRLWKAEAPESFDFQ
FT                   AFNVGDYYGAVDAKIISENLTKVLYPNDEPIQGKQLRLEQQYFFVSCSLQNLLKIHLLR
FT                   GDPIETFHEKFVIQLNDTHPAIGVAELMRLLVDEYLLHWQKAWDITQQAFAYTNHTLLP
FT                   EALETWPLNLFGSLLPRHLEIIYEINQRFLDQVRLKYLGNPDKLARLSLIEEGGSKRIR
FT                   MAHLACVGSHAINGVAALHTELLKEGVLKDFYDLWPHKFTNITNGVTPRRWMVLINPRL
FT                   TQLITREIGETWITQLEDFKRLESLAEDPAFRQEWRRVKRAVKQDLADYIQAHQGLTLN
FT                   PDSIFDIQAKRIHEYKRQHLNVLHIITLYNRIKHNPRLAVPPRTFIFGGKAAPGYQMAK
FT                   LIIKLITSVGEVVNHDPDICDLIKVVFLPDFNVTNSQRIYPAADLSEQISTAGKEASGT
FT                   GNMKFSMNGALTIGTLDGANIEIREAVEADNFFLFGHTSEDIVDLKAQGYVPKTFYNTN
FT                   PALKEAIDLIASGYFSHGNRALFQPLVDQLLQADPYCLLADYQSYIDCQDQVGQAFQDQ
FT                   DTWTKTAILNVARIGRFSSDRAIREYCREIWWVNPVSIHLEEYQQAKASLAGEHCLDAD
FT                   ACPF"
FT   gene            complement(167209..168108)
FT                   /gene="rpoD"
FT                   /locus_tag="AM1_D0201"
FT   CDS             complement(167209..168108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="AM1_D0201"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32696"
FT                   /db_xref="GOA:A8ZNW0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNW0"
FT                   /protein_id="ABW32696.1"
FT                   /translation="MFTIMRSNKDALGAYLTRMGGYSLLTHAEEVSLGQQIQSALNPPQ
FT                   GISQAELDQIQKRGKRAKHRMICGNLRLVVTIAKKYQKRGMDLIDLIQEGSLGLERAVE
FT                   KFDPAKGYRFSTYAYWWIRQSITRAIAMQSHTIRIPVHMTEKLNRIKRVRRELSQTLGR
FT                   TPTHQEMVAELGITLEQLQKTLQAAQISNPESLNIRVGKDQEMELGDLLEDLQMPSPNE
FT                   VVEQDFLRNALWSALAQLNDNERTVLILRYGLEDGRERSLYRVSQQMGISREWVRKLEQ
FT                   TAKSKLLQSGNLQDFMAA"
FT   gene            complement(168185..168343)
FT                   /locus_tag="AM1_D0202"
FT   CDS             complement(168185..168343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32697"
FT                   /db_xref="GOA:A8ZNW1"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNW1"
FT                   /protein_id="ABW32697.1"
FT                   /translation="MRIPSDLKLFFHPVYPEWVTVLSWLLMALFLLLSFAIMLGRSESE
FT                   SDFLDPH"
FT   gene            complement(168665..169510)
FT                   /locus_tag="AM1_D0203"
FT   CDS             complement(168665..169510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32698"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNW2"
FT                   /protein_id="ABW32698.1"
FT                   /translation="MVWEVVVPLRLAILLALALLFILHFGSTWQFHRSIEQQVQALRML
FT                   TNDEQVLQPPRLICALAMRSHRSDSDQGPSQDSPTTIQIHQTGEMRLSEQGRWLPFTAT
FT                   QDFAIRQPGFVWRAIFRLAPFIHIEVVDSYVQGKGRLEGRLLGSIPFLRVAGPSTDKGE
FT                   LMRYLAELIFFPAAFLNNSALHWHKLNEFTVKVTSEPDVGVHYNFDPNGDLVSITAPNR
FT                   PRMVAGQAVETPWSCVVSEYRTLGGYDMPTFGQVSWQLEDGPFTYWRGRITHLETDPGN
FT                   "
FT   gene            complement(169557..170642)
FT                   /locus_tag="AM1_D0204"
FT   CDS             complement(169557..170642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0204"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32699"
FT                   /db_xref="GOA:A8ZNW3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNW3"
FT                   /protein_id="ABW32699.1"
FT                   /translation="MRYRHVIISRHGGPDVLEIVMDERPEPRAGEVGVRVLATGVAFTD
FT                   VLIREGLYLGLPKVPFTPGYEIVGIVDQLGSGVAGLDIGQRIAALTVVGGYSEYVCLPA
FT                   HECVLVPPEVDVAEAVGLVLQYVTAYQLLHRIAKVQSGDRILIHGAAGGVGTALLELGH
FT                   LAGLKMYGTDSTTKHDLIANLGATPIDYLPENFQPQIRRLTPNGMDVVFDAIGGRHLLG
FT                   SYQTLAPGGQLISYGFSSALSAHWGRLLKVGESMGLLTLLSIWPDRRSAVFYNITDLKR
FT                   RQPNWFRDDLTSLLDLLADGSIQPIIADRLPLADAAVAHNLLDHAAVRGQLVLLCDETF
FT                   RANSSKPERKSSPVDHPSARG"
FT   gene            complement(170673..171008)
FT                   /locus_tag="AM1_D0205"
FT   CDS             complement(170673..171008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32700"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNW4"
FT                   /protein_id="ABW32700.1"
FT                   /translation="MFQRCCARSMVIINISDRFPCWKPVRRFFINQDILHSHNLMARKR
FT                   LKSSVMCSGRGGRINLEGQFRSSLAMRLKRKVEDNVRGLDRRYWVLTALTIFTISHSRL
FT                   EARCPQL"
FT   gene            171046..171810
FT                   /locus_tag="AM1_D0206"
FT   CDS             171046..171810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32701"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNW5"
FT                   /protein_id="ABW32701.1"
FT                   /translation="MFNIIRYSQMVGLTAIGNTTNSHLGNVEEIWLDESGYVTYLSSRQ
FT                   RYWSLRQVASVGKETVSVDRPLIVSTPPHLHHGYQLPVRSRVGETLGWVEDFLFDWHTG
FT                   EIVAYILAGEIASYLGERAILFPGDIEKYTPEALLIPEGAKNLLKPESEGSKDFICEKS
FT                   TEVKFVIQEMTDRLQRLFNLNDGPYEIQIKIQQVSEALASTNKYDQRHLAEATEFLQGQ
FT                   WASLQHGISRNLNLAQTALEKAWQEIVSQNKL"
FT   gene            171902..172213
FT                   /gene="groS"
FT                   /locus_tag="AM1_D0207"
FT   CDS             171902..172213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groS"
FT                   /locus_tag="AM1_D0207"
FT                   /product="chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32702"
FT                   /db_xref="GOA:A8ZNW6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNW6"
FT                   /protein_id="ABW32702.1"
FT                   /translation="MSTLTLNVSTVSPLGDRVFLKVNRAEEKTAGGILMPDTAQEKSQV
FT                   GKVVSVGPGLRSGNGSYAPIDVQVGDQVLYAKYSGTDIKLGNEDYVLTKAQDILAIVT"
FT   gene            172239..173852
FT                   /gene="groL"
FT                   /locus_tag="AM1_D0208"
FT   CDS             172239..173852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="AM1_D0208"
FT                   /product="chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32703"
FT                   /db_xref="GOA:A8ZNW7"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZNW7"
FT                   /protein_id="ABW32703.1"
FT                   /translation="MMAKSIQYDTAARHALEQGIDLLTEAVAVTLGPRGRNVVLEQKFG
FT                   PPQIVNDGITIAKEIELDNPLANTGVALLRQVAAKTNDAAGDGTTTAVVLSHAMVKEGL
FT                   RNIAAGANPMAIRRGIDQATQFLLDQIAEHALPVKDSNAISQVGTIAAGNDETVGQMIA
FT                   AAMAKVGQQGVISLEEGQSMQTEVEVTEGMRFDKGYISPYFVTDAERMVTTLDDAYLLL
FT                   TDKKITLVNALLPILENVTQTGKPLVIIAEDIEKEALATLVLNQLRGTVRVAGVKAPGF
FT                   GDRRKDLLADIAVLTGGQVISEDTGLTLENATLEMMGRARQVVITKDHTTLISESNEAA
FT                   VKARCEQIHRLIDETDSSFEKEKLHERLAQLSGGVAVIKVGAATETEMKDRKLKLEDAI
FT                   NATQAAVEEGIVPGGGTTLVHLAPQLEDWSAEHLVGDELIGAMILVRSLSAPLRQIVEN
FT                   AGLNGGVVVEQVKTLPFNTGYDALNNQYVDMFTAGIVDPAKVTSAGLRNAASIAGMVLT
FT                   TECIIAEQSQATTKDLANAG"
FT   gene            174051..174302
FT                   /locus_tag="AM1_D0209"
FT   CDS             174051..174302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0209"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32704"
FT                   /db_xref="InterPro:IPR014964"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNW8"
FT                   /protein_id="ABW32704.1"
FT                   /translation="MSSASTGVLDRCPDITELPEKVMCRYVNEMQRTQIIRIVNIPQDF
FT                   LERTVLPGDHLVFETYPDAELEVHTYEMASATLTAKII"
FT   gene            174452..174709
FT                   /locus_tag="AM1_D0210"
FT   CDS             174452..174709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32705"
FT                   /db_xref="InterPro:IPR014945"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNW9"
FT                   /protein_id="ABW32705.1"
FT                   /translation="MLWIYSQKQAPFWWIEIVTLEPQSTLYYGPFKTSTEAASYQSNII
FT                   KDMKAMPQRITVTIRTCQPEILAITNIEDPNREPPFLPER"
FT   gene            174745..176016
FT                   /locus_tag="AM1_D0211"
FT   CDS             174745..176016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0211"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32706"
FT                   /db_xref="GOA:A8ZNX0"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNX0"
FT                   /protein_id="ABW32706.1"
FT                   /translation="MDTQHLKFIPQSNVFKLLWVLFLSFLIGLEREGHHTQTGRYAFGG
FT                   VRTYPMIGLVGYCIAFLTNGQSIALGMGFLAIAGLMALSYWHKLQTVENAGVTSEIACL
FT                   ATYLVGALVYFGHYWEAATLAITSLFLLELKSVLEKLATQFSSEDILTLTKFLLLTFVI
FT                   LPVLPNQAYGEFQLNPFKTWLVVIAVSGISYASYLLQRAFQGRGTLIIIALIGGAYSST
FT                   VTTVALAKQSTSDPLPRRYAGAILIASGMMYCRLIVLTGIFNKSLAALLWGPMSLVASI
FT                   AILGGGIWLIFTGRSAKVYSVRATSQNPLELRFALLFAGVFVMLLVLTHYAIEVLGQAG
FT                   IYTLAGILGFADVDPFVMGITQSAGQSTALNISAIAILIAAASNSIAKGIYTLGIGDWK
FT                   VGKSSLILQSILALISLLPILYLR"
FT   gene            complement(176049..176405)
FT                   /locus_tag="AM1_D0212"
FT   CDS             complement(176049..176405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32707"
FT                   /db_xref="GOA:A8ZNX1"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNX1"
FT                   /protein_id="ABW32707.1"
FT                   /translation="MVYTIDLIKILVEQEQISRKIILVNQLDIPNPREVSDNHVSSSIN
FT                   LGIVIAILVVILICCSPNFIKLFRRSLVYLRKDSCNHCLKCKFYNRNAYLSCAVHPGRV
FT                   LTSDALNCQDFQSK"
FT   gene            177272..177526
FT                   /locus_tag="AM1_D0213"
FT   CDS             177272..177526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32708"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNX2"
FT                   /protein_id="ABW32708.1"
FT                   /translation="MKETNQNHLISASTEQKMLSNQRKISFGTSVEILKGPLRGCKGKI
FT                   IGSTNDGVFFILKDFDSVQKDNSQFVEGPYLGCELKILS"
FT   gene            177830..178381
FT                   /locus_tag="AM1_D0214"
FT   CDS             177830..178381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0214"
FT                   /product="universal stress family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32709"
FT                   /db_xref="GOA:A8ZNX3"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNX3"
FT                   /protein_id="ABW32709.1"
FT                   /translation="MNKRILIAMDDSDSSEFVFEQAFLIAQEHKSSLKLLHVLNSQDQN
FT                   LPSNKTLSDQLQSTQKNSNVMPVQKSNFPKSNSEGRILRRLVGCVERAKAARIDADYIC
FT                   IIGEPGQLICDLALSWRADLILLGGEEPASDSTPSHNSVRNYVTHHAPCSVEVARLSRN
FT                   QQPSNSLENEVLYSHLSGWQ"
FT   gene            complement(178687..178950)
FT                   /locus_tag="AM1_D0215"
FT   CDS             complement(178687..178950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32710"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNX4"
FT                   /protein_id="ABW32710.1"
FT                   /translation="MKVKGSQGNRRVEWVKAEHPFTAMSTGSEVYANHNEAHNAALRRR
FT                   CSAYRRRQNLYAKKRPGLQRVLDVRRLIQKLDPIGDSVSRPH"
FT   gene            complement(179363..179485)
FT                   /locus_tag="AM1_D0216"
FT   CDS             complement(179363..179485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32711"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNX5"
FT                   /protein_id="ABW32711.1"
FT                   /translation="MARLRTSSSVVSCAINARTEGMSVRATGGIFGKSHTIIMR"
FT   gene            complement(179603..180007)
FT                   /locus_tag="AM1_D0217"
FT   CDS             complement(179603..180007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32712"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNX6"
FT                   /protein_id="ABW32712.1"
FT                   /translation="MSEIAIRYSFQLYDQFLYESLSYPVLRSLTMLIHSQLFTGKSFTT
FT                   LLQVQAYFQRHHRHIRYRHFEQQQMPLGSGMVESACKWLIQQRFKGVGMRWSEDGFNHL
FT                   LILRLTWVNERFDSLFPGVTIPKSKASPIH"
FT   gene            complement(180038..180151)
FT                   /locus_tag="AM1_D0218"
FT   CDS             complement(180038..180151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32713"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNX7"
FT                   /protein_id="ABW32713.1"
FT                   /translation="MGSSELTILPNILEISQSIETTLQSNSEFKNGSKTTI"
FT   gene            complement(180172..181068)
FT                   /locus_tag="AM1_D0219"
FT   CDS             complement(180172..181068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0219"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32714"
FT                   /db_xref="GOA:A8ZNX8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNX8"
FT                   /protein_id="ABW32714.1"
FT                   /translation="MNQPLATVATQFLDRPHLATSTARSYELTLMPLLKRYGSWSVELL
FT                   DADILSEYLNSLTHLSYTTHHRHQATLKALLNFAVRQRYIRSNPIAQLEHRSPDKAKGE
FT                   HLSDQPIRFLKPEQLTTLYQAVYNDARLYALVKLLHHSGARISEILALDLAEVDLEQRQ
FT                   FQVVGKGNKTRWCFYSENAAAALQTYIQHYRYTPSPALFTARKTPTSQVTRLSYRTAHH
FT                   HWHQSIQGYPQLQGIRLHDLRHTFATERVGLMGLEELRALMGHQHIQTTLRYQTVTSEQ
FT                   AKGAAQRAFQYLENAVQ"
FT   gene            181107..181622
FT                   /locus_tag="AM1_D0220"
FT   CDS             181107..181622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0220"
FT                   /product="helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32715"
FT                   /db_xref="GOA:A8ZNX9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNX9"
FT                   /protein_id="ABW32715.1"
FT                   /translation="MHYTSGEEISSDKSMQPLESDSLPLADESLAEYLRRLRVRLGLTQ
FT                   KEVALKANIHAQSLGKLERGKTLSLNHKTRQGLACALQIPPDYLDSISRGRAIQATQTL
FT                   KFCPQCWRIGSAPEPLWMDLRSKHCFACGTRLQDRCISCQEPITSLKHRFCPYCGTPYQ
FT                   TQQQIQGV"
FT   gene            181627..182151
FT                   /locus_tag="AM1_D0221"
FT                   /note="fragment; similar to N-terminus of transposase"
FT   gene            182187..182663
FT                   /locus_tag="AM1_D0222"
FT                   /note="fragment; similar to N-terminus of transposase"
FT   gene            complement(182708..182869)
FT                   /locus_tag="AM1_D0223"
FT   CDS             complement(182708..182869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32716"
FT                   /db_xref="GOA:A8ZNY0"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNY0"
FT                   /protein_id="ABW32716.1"
FT                   /translation="MRLKDGLDGFRRDLTAIIKGIKGLTEGLVTVGATVTLAAFTGFTV
FT                   FVGCWMIT"
FT   gene            182930..183073
FT                   /locus_tag="AM1_D0224"
FT   CDS             182930..183073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32717"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNY1"
FT                   /protein_id="ABW32717.1"
FT                   /translation="MSVIRSASQKAQMIHNQEVQAVSTDVINADELWSFVKKSKSTVNR
FT                   KS"
FT   gene            183025..183525
FT                   /locus_tag="AM1_D0225"
FT   CDS             183025..183525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to insertion element IS1"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32718"
FT                   /db_xref="GOA:A8ZNY2"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNY2"
FT                   /protein_id="ABW32718.1"
FT                   /translation="MVLCQKKQKHCEPEELSVGDCWIALSLAKDSGLVLSGRIGKHTDE
FT                   LAQKLIENTEGKTVCHHWQTDGWEGYSRQLADEVIHHVSKALTQRLERTNGILRQQTGR
FT                   WHRRQNKFGKVWQQSAVTLRLVLTYFNWIWCHSRFKNTAAQRAGLTEHPWGWQDLATYP
FT                   TLY"
FT   gene            183575..185566
FT                   /locus_tag="AM1_D0226"
FT   CDS             183575..185566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0226"
FT                   /product="transposase, Tn3 family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32719"
FT                   /db_xref="GOA:A8ZNY3"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNY3"
FT                   /protein_id="ABW32719.1"
FT                   /translation="MKIVIGDDPQPLIDDCQEHLAYVGNNYFSFLTRFYRSHRAVFFRL
FT                   LEQLPLCSSTQDQSLINAIEFIKAHGSKRSKWVPMTQIVNQGPPDEAVVPLLDLSWVPN
FT                   KWRSLITDPQQTTPTKIHRLYFELCVFSHISLELQSGDLYIPGSNEFGDYYSQLISWEE
FT                   YQDSAEEYGKMINLPTEGKAFVQEMKQRLRAAAKTADQAFPTNAHLSFKKDRLVIHKRQ
FT                   RQLPEGLAEVKALIERKIKPVSILDVLCDTEKWLNWTQCFGPLSGFDTKIIDPVERYIT
FT                   TTFCYGCNIGPNQLARSLPGTDRRQIWWIHHRHISEEKIQQAITGIIDSYNRFSLPKVW
FT                   GSGKQASVDGTKWDMYEQNLLAEYHIRYGGYGGIGYYHISDTYIALFSHFIPCGVWEAV
FT                   YILDGLLKNTSEIQPDTIHGDTQSQSCTVFALAFLLGITLMPRIRGWQSLAFYRPSRGT
FT                   RYKHLDSLFTEVTDWDLIETHLPDMLRVALSIKDGKVQASTLLRKLGTNSRKNKLFQAF
FT                   HELGGVLRTIFLLQYINDPQMQETIHAETNKCEAFNRFIKWLAFGGENQVLSSNNRAEL
FT                   RKRIKYNHLVANCLIFYNVSEMSRILNEEAQNGRTYDAEVLALLSPYWMDHLNRFGIFF
FT                   LDEQRNPPPINFEIPIAQKEQEAEPMLV"
FT   gene            complement(185706..186026)
FT                   /locus_tag="AM1_D0227"
FT   CDS             complement(185706..186026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32720"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNY4"
FT                   /protein_id="ABW32720.1"
FT                   /translation="MGDIDQFIPLLQLEAHKQDFESAPSVIWLSDGGRGFWRVYRTLFS
FT                   HCAVAVLDFFHAAGHLARATKVMFGDARSAQAQVWFRRWRHQLRHGQHLLVLGSDNDSC
FT                   RN"
FT   gene            186223..187959
FT                   /locus_tag="AM1_D0228"
FT   CDS             186223..187959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0228"
FT                   /product="transposase, putative"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32721"
FT                   /db_xref="GOA:A8ZMG6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZMG6"
FT                   /protein_id="ABW32721.1"
FT                   /translation="MPNKRIDSYHTRVYMNGRDLGLKQADAAYIAEISTRTGQRIEAGT
FT                   HQPNRGRLQDQRTVPDPLADVWEDELEPMLRRDPRLKPMTLYEYLQDKYPGQYPQVLRT
FT                   LQRRVRTWKALHGPSPEVMFELRHEPGVQGFSDFTELKGITITIAGKPFEHLIYHYRLG
FT                   YSGWRYAQIIQGGESFVALSEGLQNAFAACGGVPTQHRTDSLSAAYRNMGGRRSKNLTR
FT                   LYDELCDHYRLEPTRNNKGVAHENGSIESPHGHLKNRIKQAIYLRGSADFTSVAEYQAL
FT                   IDAQVAKLNQQCQTKYEQEKDHLQPLPKYRTPDYEVLTAKVSKRSTIDVRCILYTVPSR
FT                   LIGRQLELHLYHDRIVGYLERHPVVELPRKRVSGKGKRRDRCINYRHVIGSMRLKPRAF
FT                   IYCTWQSDLLPNPEYRQIWEQLKAQFDLEQAAKIIVEALYIAAVQDKEQAVAVYLQQQL
FT                   RSSSLTLNRLKKQFEPPQMKQVPELSIEQHSLELYDKLLPSCSVPAEPLPAPEPLFKKA
FT                   QALPHVDPLGIYRIPSHAGKLVLCGILTSLVRNGGPTKRTSSSKTCPHRSQAPKRKKFY
FT                   QL"
FT   gene            187787..188518
FT                   /locus_tag="AM1_D0229"
FT   CDS             187787..188518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0229"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32722"
FT                   /db_xref="GOA:A8ZLR9"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLR9"
FT                   /protein_id="ABW32722.1"
FT                   /translation="MLTHWESIESQAMQENWSYAEFLLALCETEAQRREQARLKRALTE
FT                   ARLPNAKSFTNFDFSHCPQLNPAPLMQLAADPGWLERAENCLILGPSGVGKTHLATGVS
FT                   KKMLEFGKRVKFFAANALVQQLQQAKLQLQLHPMLKKLDRYDLLILDDLGYCKKSEAET
FT                   SVLFELIAHRYERKSLLITANQPFSQWDDIFTDSMMAVAAIDRLIHHGLIIEIQADSYR
FT                   RKSATQRTAQTQSQPQKSQSK"
FT   gene            complement(188597..189097)
FT                   /locus_tag="AM1_D0230"
FT   CDS             complement(188597..189097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32723"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNY7"
FT                   /protein_id="ABW32723.1"
FT                   /translation="MRLGCLFSLFMPYELASWMLSQWSGLSVSSSSLWNWVQVMGNKAY
FT                   QALETQLKAQASGDQAPCEAISELLSALPLAVAADGVMVPFRPTPKTPKGKIQWREVKV
FT                   AILARLGTRVTRAKKSVPQLLRRRLVAVLGIGCQPHRRCRDNHKADQPPNLNRIIWRTL
FT                   PLR"
FT   gene            complement(189203..189475)
FT                   /locus_tag="AM1_D0231"
FT   CDS             complement(189203..189475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32724"
FT                   /db_xref="GOA:A8ZNY8"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNY8"
FT                   /protein_id="ABW32724.1"
FT                   /translation="MSLPSQLPAVLDHHDVLVQAKALKEATSLSQMVYIVLHMGLFLAR
FT                   WLLEDELSRRAKTVFEWPRCPTCGTRLHSKGWESRQMQTLVGNIY"
FT   gene            complement(189584..189712)
FT                   /locus_tag="AM1_D0232"
FT   CDS             complement(189584..189712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32725"
FT                   /db_xref="GOA:A8ZNY9"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNY9"
FT                   /protein_id="ABW32725.1"
FT                   /translation="MLQSTLQYLNSVDFWVKISILILEILIYRWAIYNLEDKYFSK"
FT   gene            190018..190161
FT                   /locus_tag="AM1_D0233"
FT   CDS             190018..190161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32726"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNZ0"
FT                   /protein_id="ABW32726.1"
FT                   /translation="MFLHKFLILFGYSQNELIILYIKNAINKIKSLSDFYLFTKVSLDK
FT                   PY"
FT   gene            190229..190774
FT                   /locus_tag="AM1_D0234"
FT   CDS             190229..190774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0234"
FT                   /product="universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32727"
FT                   /db_xref="GOA:A8ZNZ1"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNZ1"
FT                   /protein_id="ABW32727.1"
FT                   /translation="MIKKILVAMDHSINAIQAFEVAMEIAESCHARLMLLHVLSIEGEG
FT                   YQAHPVFPGTYLYPAFSDIPLNRFQQEWNKYKEKELHRLAILSEQAKSVGITTEITQKF
FT                   GNPRQEICDFAKEWNADLILMGSRGHSGLKELVLGSISNYVVHHALCSVMVVRTPNQLA
FT                   VQPSTNSSAEQLRFMIST"
FT   gene            complement(191018..191164)
FT                   /locus_tag="AM1_D0235"
FT   CDS             complement(191018..191164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32728"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNZ2"
FT                   /protein_id="ABW32728.1"
FT                   /translation="MIFSTSYKEQNIKYSLNIIDYLLSLDVYESGGEARKDNHLCLHLV
FT                   QIY"
FT   gene            complement(191127..191663)
FT                   /locus_tag="AM1_D0236"
FT   CDS             complement(191127..191663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32729"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNZ3"
FT                   /protein_id="ABW32729.1"
FT                   /translation="MRILIIYFSFSGNNRRLAEYLAKEIQCDICPIIEKKRRTMLTIVL
FT                   DMIFKRSPKIEAIETPISNYDHTILVAPIWDSKIANPLKTLIKRKKNSLNNYSFISFCG
FT                   FDRPGQKERITNQLTDLTGYPPKAVSELKVCELFPSEYRDEVNTISRYHITSKDLFKFE
FT                   DKIYDFLHLIQRTKY"
FT   gene            complement(191838..193805)
FT                   /gene="ftsH"
FT                   /locus_tag="AM1_D0237"
FT   CDS             complement(191838..193805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="AM1_D0237"
FT                   /product="ATP-dependent metalloprotease FtsH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32730"
FT                   /db_xref="GOA:A8ZNZ4"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZNZ4"
FT                   /protein_id="ABW32730.1"
FT                   /translation="MPIETEPNRTRKNFEPKRFGGSLFILFTLLLFLNLFVLRGPRFPI
FT                   TAYSDFITQVEAGQVERVEVRPDRIRYILKSDQYGFNEGTETAAVFDTVPVGIDLELPK
FT                   FLREHDVQYFAPPPSSLSWLPTLLGWVVPPLIFFGIWSWLINRNQGAGPAALTVGQSKA
FT                   RIYSEGSTGVTFDDVAGVEEAKTELLEIVDFLAHADKYTRLGAKIPKGVLLVGPPGTGK
FT                   TLLAKAIAGEAKVPFFSISGSEFIELFVGIGAARVRDLFEQAKQQAPCIVFIDELDALG
FT                   KARGGPGGFTGGNDEREQTLNQLLSEMDGFDPNVGVILLAATNRPEVLDPALLRPGRFD
FT                   RQIVVDRPDKMGREAILKVHVRGVKLAEDINLTKLAVRTPGFSGADLANLVNEAALLAA
FT                   RQSRDAVVMSDFNEAIERVVAGLEKKSRVLNDLEKKTVAYHEVGHAIVGSLMPGAGTVE
FT                   KISVIPRGIGALGYTLQLPEEDRFLITASELRGRIATLLGGRSAEELIFGVVSTGASDD
FT                   IQKATDLAERYVTLYGMSDELGPIAYEKAQQQFLEGVPNPRRTVGPQVVEAIDQAVKDV
FT                   VDGAHHMALSILSINQDMLQLTASHLLEKEVLESQELHSLLSQPQFPPDMDEWLQTGKL
FT                   PQGKELIQTTLNSHQLIGIN"
FT   gene            194348..195295
FT                   /locus_tag="AM1_D0238"
FT   CDS             194348..195295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0238"
FT                   /product="3-beta hydroxysteroid dehydrogenase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32731"
FT                   /db_xref="GOA:A8ZNZ5"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNZ5"
FT                   /protein_id="ABW32731.1"
FT                   /translation="MSNQHPKVLVAGATGYIGGGVLEVLHQQGFWVRALCRDQNRLRNA
FT                   NWCDDIFIGHATQPDTLKDLCEDIDVVFSSIGIHSFNRHPTFWDVDYQANLNILEAAKA
FT                   AGVKHFIFVSVLRASEMARLSPLAKARDQVAQAIMASGMDYNIFAPTGFFNDAQEFLVA
FT                   AKRKGVIHLFGDGSSIYNPLSALDFGEEVARVIKEPLLRNTVRPVGGCEKYSNRQMAEL
FT                   VFEILDQEPNIKSIPTWVIALWALALRPFNYNAYALVKFFEFTARTPDMTGEAIGHRHV
FT                   GDFLRNLAKGMSLVEADRALGLWNESRLPVDAKR"
FT   gene            195480..196184
FT                   /locus_tag="AM1_D0239"
FT   CDS             195480..196184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32732"
FT                   /db_xref="GOA:A8ZNZ6"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNZ6"
FT                   /protein_id="ABW32732.1"
FT                   /translation="MSTISNQPHNSAHEVELSSTAEQPLGQWLLPGGEDPSQFTWQDAW
FT                   HPIAYVKDLDPSQLSTFTLLEQDLVIWWDQSAETWRVFADQCPHRLAPLSEGRLTADGL
FT                   LECPYHGWAFSGLGQCCRIPQQVGGQSVEQSRRACVQSLPTTVRQGMLFVYPGQSERAA
FT                   HIPIPLVAPLEEAPNKWIVLDGVRDLPFDVLTLLENVLDPSHLPFAHHRSVGDRSVAGP
FT                   MDLVLDHTELDR"
FT   gene            196221..196661
FT                   /locus_tag="AM1_D0240"
FT                   /note="fragment; similar to N-terminus of transposase"
FT   gene            196709..197338
FT                   /locus_tag="AM1_D0241"
FT                   /note="fragment; similar to C-terminus of transposase"
FT   gene            197202..198128
FT                   /locus_tag="AM1_D0242"
FT   CDS             197202..198128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0242"
FT                   /product="cell death suppressor protein Lls1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32733"
FT                   /db_xref="GOA:A8ZNZ7"
FT                   /db_xref="InterPro:IPR013626"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNZ7"
FT                   /protein_id="ABW32733.1"
FT                   /translation="MNNSGTRSLHGKKGGTMIRQRLIGCLRWMMHELNSADSIPKLSCH
FT                   NHCGEALEINHADRQGFQGIWKTAVGPKKGQFGTQLTTFIAPNLMWHDLTTQEKNRTLT
FT                   VAYCTPIRKGECRLFARFPFQFASPLPAGLMRYTPSWVFHLLQNSILEDDQIFLYLQER
FT                   HLTQQKQGIPIAQSYYMPTRADRFVVALHQWLQRYTADPFPNKPLPPAIGREQVIERYH
FT                   SHTVHCASCRTTLSRIKRGRQGMVMGALVAWITVQLYLLDWGGTAKLARVASISFIVCT
FT                   IIWLSLGWLERKFYEGRSIPLRNVSEK"
FT   gene            198343..198939
FT                   /locus_tag="AM1_D0243"
FT   CDS             198343..198939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0243"
FT                   /product="methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32734"
FT                   /db_xref="GOA:A8ZNZ8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNZ8"
FT                   /protein_id="ABW32734.1"
FT                   /translation="MAQLKHWLFADLHGTVLELGPGAGINLSYYPPDINWIGIELNPFL
FT                   HPYIRQEADRQGLSSINVFKGTAEQLPVADNSIDTVVSTYVLCSVTQLEECLSEIQRVL
FT                   KPGGLFVFLEHVAAKPMTLERRIQEAVKPLWKTLLHNCHPNRETWKTLEKAGFEWVHYQ
FT                   HFRLSLPVVSPQIVGKARKSLETTLPKALALTSGN"
FT   gene            199140..199916
FT                   /locus_tag="AM1_D0244"
FT   CDS             199140..199916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0244"
FT                   /product="endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32735"
FT                   /db_xref="GOA:A8ZNZ9"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZNZ9"
FT                   /protein_id="ABW32735.1"
FT                   /translation="MFRLNTAEQVLIENHQFSLMVIDQASLRILNWNIAKNNHRHEWLQ
FT                   DFSKLVEWYPPDLIFLQEFRFDSTLKKPFYCDAMSWQFAPNMSNPYTDQHFGVLTASKV
FT                   KHQSGKSFLTQACEPFLNTPKVSLITEYSLAGSKQTLLAVNIHGINFVSTRKFQSQLQQ
FT                   LEAQLTIHPGPIILSGDFNTWNEYRMKVLQTMVRRLDLRQVTFSSAHYKNLKQFFDYPL
FT                   DHIFYRGFTQCLGSEIVLGELSSSDHSPLVVELMLH"
FT   gene            199948..201420
FT                   /locus_tag="AM1_D0245"
FT   CDS             199948..201420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0245"
FT                   /product="cardiolipin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32736"
FT                   /db_xref="GOA:A8ZP00"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP00"
FT                   /protein_id="ABW32736.1"
FT                   /translation="MTFIAIEHPNHFLSAHGMTVPSVLLLLVYALGVLNAAHAVMNVRS
FT                   SQSAIAWSLSLITFPGIALPLYWILGRVEFHGYTQAYHQAYAQNHDLAHNTYLEILSYK
FT                   AVLPTQLASLQRVAGALTEFPFTHSNSVQLLINAEQTYSAMQEAILNSKEYILLQSYIL
FT                   NDDHVGDIFQKILMQKAQEGIRIYILYDEIGSKNLSKNYINVLQKGGIQVSAFNSAQGW
FT                   GNQFQLNFRNHRKILVVDGQVAFVGGINIGDEYLGQNAHVGLWRDTHLKVKGPAVQCLQ
FT                   LPFLKDWFWAVREIPEACWEVHPDRGKNQTVFIFSPGPTDPQNDCTLFFGSIINLAQHR
FT                   LWIASPYFVPDDPVLTSLKMAALRGVDVRILLPDRPDHWLVYLCSYSYYTEMDATGIKL
FT                   YRYNHGFMHQKVMLVDGCLAGVGTVNLDNRSFHLNFEVMTFVSDVEFARNVEQMLCDDF
FT                   EHSMEINLSEYELKPNWFKLIVRVSRLLAPLQ"
FT   gene            complement(201523..201639)
FT                   /locus_tag="AM1_D0246"
FT   CDS             complement(201523..201639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32737"
FT                   /db_xref="GOA:A8ZP01"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP01"
FT                   /protein_id="ABW32737.1"
FT                   /translation="MKNQPKPPITLNVDPATLLWVCVLLFLIPLLLTGLLSH"
FT   gene            complement(201669..202748)
FT                   /locus_tag="AM1_D0247"
FT   CDS             complement(201669..202748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0247"
FT                   /product="DJ-1/PfpI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32738"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP02"
FT                   /protein_id="ABW32738.1"
FT                   /translation="MSQHPTPRKRIAILLENQFEGSAYQVPSTALRKAGGTVSVIGSRM
FT                   NEGYQDKQGSVTVKPIATSTEVRAGDFDAIVIPGGHIRANPNMVRLVSQSIDQGIWVAA
FT                   VGYGPQILIEADRLRDKHTTSARSIHKDLLNAGAIYVNEPVVVDGNLITARQPSDLPMF
FT                   TTMLLKCLNLTIKGTRLPEFTDSTFNWWKLGEAWGGSSKQEIVKALNTTIVGERYTLEA
FT                   FRQYSHRVSHQDLRLFLQGISSTKHYHVERLEAHLYDVFGERATWRAVGSEAYAALQSW
FT                   LQSSNDTSILRRALGDIQTGVIDVHHLCNQLTDPQTVSILEEVEHDLANHEQRLADLYR
FT                   ARSGDHIKPPMPTTIAAVT"
FT   gene            complement(202779..203129)
FT                   /locus_tag="AM1_D0248"
FT   CDS             complement(202779..203129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0248"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32739"
FT                   /db_xref="InterPro:IPR035223"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP03"
FT                   /protein_id="ABW32739.1"
FT                   /translation="MTEQTIQETQQIPQEQWLAFFDHLTKNYKGCSLAIEVTDEDIGDE
FT                   NLVQQSPLASITYDPPAKGNDLMIAIGGDQVNYAHTVNAPKAVWVAKDISGQVVAIDIV
FT                   DHNGTQTILRLS"
FT   gene            complement(203183..203311)
FT                   /locus_tag="AM1_D0249"
FT   CDS             complement(203183..203311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32740"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP04"
FT                   /protein_id="ABW32740.1"
FT                   /translation="MFNEWLMGLGQGYSPSIEISVNTYRAAFGLWQCLHKFLNFIF"
FT   gene            203512..204651
FT                   /locus_tag="AM1_D0250"
FT   CDS             203512..204651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0250"
FT                   /product="phospholipid/glycerol acyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32741"
FT                   /db_xref="GOA:A8ZP05"
FT                   /db_xref="InterPro:IPR007130"
FT                   /db_xref="InterPro:IPR016676"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP05"
FT                   /protein_id="ABW32741.1"
FT                   /translation="MANAGKKVRILESQEHHTSLYTVESFHYRDEVVESNGENNTYHVG
FT                   AYLEDGLHEGAITSALRVAQQIGLKLVCVSYNFLSLYYVDGDNNHTPHVSMLLKANGHA
FT                   APLGWSLEYRDPKVIEQLMPLLSWLYHHYFHVQTSGWHHVPSDAPILMVGSHNGGLSAP
FT                   DMYMSMYDWCRQFGAERPIYGLLHPGIWQAFQQTCPPLARLAGQIGSIMAHPKMAINAL
FT                   RQGASVLVYPGGAQDVFRPYCQRHQIHLAGRKGFIKLALEEKVPIVPLISNGAHETLIV
FT                   LADFYQAIQQLHDWGIPWLGGIDPDVFPVYLGLPWGLAFGPLPNIPLPVPIQTQVCPPI
FT                   VFEHYGAEAARDRTYVTACYEQVQAQMQQDLDALVDSNP"
FT   gene            204706..205323
FT                   /locus_tag="AM1_D0251"
FT   CDS             204706..205323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP06"
FT                   /protein_id="ABW32742.1"
FT                   /translation="MKILLVHGLGRTPMSMMGLAYSLDQSGYQTEFFSYTAFAESYEQI
FT                   VTRLRNRFQMLSNKGPYGIVAHSLGGILTRSALSLSRSFPRHIVMLGTPNQPPRLAKIA
FT                   WNLWPFQWFSGTSGANLASSEFYASLPHLHASYTIIAGTSGPRGPWSPFGMELNDGLVA
FT                   LNETRLLESDQPITFPGIHGFMMNQATVQTAVAQVFRHTSSK"
FT   gene            complement(205348..205752)
FT                   /locus_tag="AM1_D0252"
FT   CDS             complement(205348..205752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0252"
FT                   /product="YeeE/YedE family membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32743"
FT                   /db_xref="GOA:A8ZP07"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP07"
FT                   /protein_id="ABW32743.1"
FT                   /translation="MFWLPNPHPRVYKVNLASERIARSSSTSSSKTLDVIGHNRELERA
FT                   AKDNRTPRLYVWGGISKQAIDLQLLIGSAIFGIGWGMAGYCPGPGLVALVLGIWNPFLF
FT                   IISLMFGSLFYHWITTQRINRSPKVPNPNP"
FT   gene            complement(205709..205948)
FT                   /locus_tag="AM1_D0253"
FT   CDS             complement(205709..205948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0253"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32744"
FT                   /db_xref="GOA:A8ZP08"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP08"
FT                   /protein_id="ABW32744.1"
FT                   /translation="MGTFYWVRALLGGILIGLSAAIFLLFNGRIAGVSGMVNGAIKLTP
FT                   HERWRWTFILGLFIGGALYEYVLAPQPTPTGLQG"
FT   gene            complement(205961..207697)
FT                   /locus_tag="AM1_D0254"
FT   CDS             complement(205961..207697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0254"
FT                   /product="sulfate permease"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32745"
FT                   /db_xref="GOA:A8ZP09"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP09"
FT                   /protein_id="ABW32745.1"
FT                   /translation="MPLHRLTHLSRYLPFLKWFLEYRSQHLIGDLMAGVIVAIMLVPQG
FT                   MAYALLAGLPPQIGLYASIMPLILYALLGTSRTLAVGPVAIVSLLVATGVGQLAQPNTS
FT                   EYLTLAMMLALLVGILQMLMGVVRLGFLVNFLSHAVISGFTSAAAIIIGFSQLKHLFGL
FT                   QLPKTESFPELLQEIWQHLPQRNSITLILGLTSLVVLLVFNHQLQPLLKKLGMPQNLIL
FT                   PLTRGGPLLLVLVNTVLVWRLQLHEVAQVKIIGEIRAGLPPLTLPTFDLKSWQALMPTA
FT                   VAISLVGFMESISVAKSLASKRRQKIDANQELIGLGAANLSAAFTGGYPVTGGLSRTMV
FT                   NFSAGANTGLASIITALLIALTVLFFTPLFYFLPQAVLAAIIIVAVLNLIDFTSLQRMW
FT                   QYNRADAASLLITFGAVLGLGIEAGILVGVLASLCLYLWRTSHPHLAVVGRIEGSEHFR
FT                   NVLRNPVKTYPHVLAIRVDESLYFANIKALEDYVLHAVSHISDLQHLVLICSAINFIDA
FT                   SALETLEALFADLNSAGVRVYLAEVKGPVMDQLEKTDFVEKLGRERIFLSTHQAMLALG
FT                   CN"
FT   gene            complement(207761..208315)
FT                   /locus_tag="AM1_D0255"
FT   CDS             complement(207761..208315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0255"
FT                   /product="rhodanese family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32746"
FT                   /db_xref="GOA:A8ZP10"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP10"
FT                   /protein_id="ABW32746.1"
FT                   /translation="MLTPKDQFFTNPISLMGSFQRGKTMTFAMHNLKEIDALTLKQWMD
FT                   RNEVLLIDVSKPQEFEKSHIPGAKLIPIDKFDPATVPRLQGQRIVLQCQSGDRSTQAAH
FT                   QMLQAGFSHVHHLQGGLAAWKAAGYPTQGKRSINILRLAQILTGSCVLLGTSLGSTLSP
FT                   WFVLFSIVVGGSLVLIGVSND"
FT   gene            complement(208335..209057)
FT                   /locus_tag="AM1_D0256"
FT   CDS             complement(208335..209057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0256"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32747"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP11"
FT                   /protein_id="ABW32747.1"
FT                   /translation="MARHSHSEIWLFRQLFDQQSNTYTYLIADPETKAALLVDPVLEQV
FT                   DRDLKLIHELGLKLQFCLETHIHADHITGTEALRAKTGCQGIVPEHAHAACADRYLQDG
FT                   ETITLGTIPIQAIATPGHTDSHNAYLVNGDRVLTGDALFIRGCGRTDFQSGDAGTLYDS
FT                   VTQKLFTLSEEILVFPGHDYRGLTLSSIGEEKQWNPRFKGRDRNTFIEFMNALDLPNPQ
FT                   KIMEAVPANERCGQVITA"
FT   gene            complement(209099..209614)
FT                   /locus_tag="AM1_D0257"
FT   CDS             complement(209099..209614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32748"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP12"
FT                   /protein_id="ABW32748.1"
FT                   /translation="MTGLLLLLLTACQQSMESSFEQFPAQSNAQTNASPASESECLNSP
FT                   PRWQRRHRRQNYGQYSRLYNPSTVETIQGQVIQVDTVTPRWGMSTGVHLQLRSDADNVE
FT                   IRLGPTWFFEEQNFIIQQGDKITLTGSRVEVDNQPAVIAAAVTKADVTLKLRDQEGIPV
FT                   WSNWGACP"
FT   gene            complement(209710..213333)
FT                   /gene="nifJ"
FT                   /locus_tag="AM1_D0258"
FT   CDS             complement(209710..213333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifJ"
FT                   /locus_tag="AM1_D0258"
FT                   /product="pyruvate-flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32749"
FT                   /db_xref="GOA:A8ZP13"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP13"
FT                   /protein_id="ABW32749.1"
FT                   /translation="MKNSTCTTLDGNEAVARIAFFLNELIAIYPITPVSPMAEWADTWT
FT                   EANNKNLWGVVPLVVEMQSEAGVAGAVHGALQMGALTTTFTASQGLLLMIPNLFKIAGE
FT                   LTSTVFHIAARSVAAQALSIFGDHSDVMAARGTGFAMLSAASVQEAQDFAAIATAATLE
FT                   TRIPFLHFFDGFRTSHEIQKVELLSIATLKELIQDKSVMAHRARALSPDHPVLRGTAQN
FT                   PDIYFQARETVNPYYLDCSTVTQTVMNDFAQLTGRQYQLFEYHGHPEAERIIVLMGSGC
FT                   ETVHETVDALNRQGDQVGVIKVRLYRPWDAQRFITALPPSTQSIAVLDRTKEPGSLGEP
FT                   LYLDVLATLSEHSSHLSVQKVVGGRYGLSSKEFTPAMVKGIFDHLATTNPKNHFTIGIN
FT                   DDVTLTSLPYDSSFSTDSDQGMRAIFYGLGADGTVGANKNSIKIIGEHTDHYAQGYFVY
FT                   DSKKSGSVTVSHLRFGPDPIRSTYLIEQANFIACHHWDFLDKIDVLKAAQPKAIVLLNS
FT                   PYPATEIWERLPAHVQQQVLQKHLKLYGINANQIAQAVGMGGRINTVMQVCFFVLSDIL
FT                   PRDVGVACIKESIHQTYGKKGEEIVRMNLKAVDAALEQLYKVPMDDSIGQLKVNNSQAS
FT                   TMPETAPKFVREVLNYMIQRQGDMLPVSALPADGTYPTGTAKWEKRNIAQFIPVWDPEV
FT                   CIQCGKCVMVCPHSVIRSKVYDPEHTEKAPTTFKSTAARDHAWSDLKFSIQVAPEDCTG
FT                   CGICVDVCPAKNKSKPRLKALNMEPQRPLRETEVQNWDYFLTLPHPQRQSLNLHKISHQ
FT                   QMQQPLFEFSGACAGCGETPYIKLITQLFGDRMVVANATGCSSIYGGNLPTTPWTVNAD
FT                   GRGPAWSNSLFEDNAEFGLGFRVAIDQQKELARKLLEEVVNTIEDEHDYIQFLAERLLA
FT                   AKQDDEADIAEIRQEVVLLKQWLTEQEIHLESHKNDRRDNSLIEKMSQLKALADYFVKK
FT                   SVWIIGGDGWAYDIGYGGLDHVLASGRNVNILVLDTEVYSNTGGQMSKSTPRAAVAKFA
FT                   AGGKPTPKKDLGLMAMTYGNVYVASVAMGARDEHTLKAFIEAESYEGPSLIIAYAHCIA
FT                   HGIEMSSAMHHQKSLVDAGRWLLYRHDPRRVTQGQNPLVLDSHAPKVPINPSMYAENRF
FT                   KMLTRSQPETAQQLLQEAQQDVNTRWLLYQYLAARPQRSQS"
FT   gene            213390..213515
FT                   /locus_tag="AM1_D0259"
FT   CDS             213390..213515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32750"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP14"
FT                   /protein_id="ABW32750.1"
FT                   /translation="MLKQTLGKEFEKNMKIESLWLEILTMWRLIKNGENFDIPVH"
FT   gene            complement(213669..214724)
FT                   /gene="xerC"
FT                   /locus_tag="AM1_D0260"
FT   CDS             complement(213669..214724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="AM1_D0260"
FT                   /product="tyrosine recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32751"
FT                   /db_xref="GOA:A8ZP15"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP15"
FT                   /protein_id="ABW32751.1"
FT                   /translation="MAESGLVRLEIDESAVDVDLLRAVLVEKTKPSTREGYTKDLVDFF
FT                   LFVTQGEMVYGVEGPKRKSEIKAQVKVELSRLSQSFVGIGRLKALELAARYRECMMQRG
FT                   LQANTINRRLSAVKSMVRMARRLEMCDWTLAEVDGLTVKPYRDTRGITASQFRLMMVFV
FT                   NRFSLAGSRDFAMLTLLWEAGLRRSELVGCDVRHFDSEQKRLSILGKGRNEREWIDLTE
FT                   SGVLAISEWLELREVYGLTEPLFISLDRANWGSRLSGTSVYRIVRALAKKAGVSENFGP
FT                   HKVRHSGTTTYLEMTGGDLRGAQAYSRHANLNTLKFYDDNRKQLQKKASAKLAETISWQ
FT                   KNSDESSEVRK"
FT   gene            214870..215004
FT                   /locus_tag="AM1_D0261"
FT   CDS             214870..215004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32752"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP16"
FT                   /protein_id="ABW32752.1"
FT                   /translation="MGVFAEKEQILGQNPSPTYGLRRWPVQSQKNAGGVPSYPWTKQS"
FT   gene            214938..215417
FT                   /locus_tag="AM1_D0262"
FT   CDS             214938..215417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0262"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32753"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP17"
FT                   /protein_id="ABW32753.1"
FT                   /translation="MARAIAEKCRRCSKLPVDQAKLKECWVGQRCHVRRSSYKHRDRYN
FT                   RNKKRKYQLQTGKLIPEVTVDVPVQPAAIRRMYRARRDAPLHAMSAELWIGQKRVAFVE
FT                   PVHTLGWTNSDVTKYSRSILNRFSEHLDGKVLHQFDSQVEVDPSQCPIRPCPLFP"
FT   gene            215431..216096
FT                   /locus_tag="AM1_D0263"
FT   CDS             215431..216096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0263"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32754"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP18"
FT                   /protein_id="ABW32754.1"
FT                   /translation="MALQLELDLWQQLNQAEAVPVESDLQQLQERLDLVVAQLPLEEKL
FT                   STAGTALLQMAEILSRRAEVFLRDWRDAHNDDGPILDLDDEMGMVRQSMVLDDDLIAEP
FT                   DPVTRRTLPKEECESIVVLKDKASLLEELETELRLEQPDEVLQVLEEEDVLAWVQAIST
FT                   YLQGTSGMVPLVELKQELQLSLVPIWLGMLLGGFQFEQRGGFYDQNVWIKTGALNSQP"
FT   gene            216210..217142
FT                   /locus_tag="AM1_D0264"
FT   CDS             216210..217142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0264"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32755"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP19"
FT                   /protein_id="ABW32755.1"
FT                   /translation="MTQQESIDHDGLFKELIETFFWEFLDLFLPQVLDYVERGPVTFLS
FT                   QEVYSSIGAEEKRIIDLLARVQFREQESYFLFHIEPQSSVQADFEKRMFYYFGRLQEKY
FT                   DLPIYPVVIFSYDSPRKEAESRYTVEFPDFQVLQFNFRAIQLNRLHWRDYLRQHNPVAS
FT                   ALMAKMQIAKEDRPQVKMECLRMLTTLQLDPARTEFISQFVDTYLRLEADEEQLFQAEI
FT                   DTLELGERDAIMQTLTSWEEKGLARGRQEEGATIVLRILNRKLGNLLPEVEAQIQSLEV
FT                   EKLEELSEALLEFESLENLNAWLQNFENS"
FT   gene            217252..218364
FT                   /locus_tag="AM1_D0265"
FT   CDS             217252..218364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0265"
FT                   /product="xenobiotic reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32756"
FT                   /db_xref="GOA:A8ZP20"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP20"
FT                   /protein_id="ABW32756.1"
FT                   /translation="MTATGASPTLLSSFNLHDLPLANRIVMAPMTRSRAGEEMLANAMM
FT                   AEYYAQRASTGLIVTEGTFISDQAIGWQHVPGIYTQEQTQAWQVVTKAVHEKGGKVFLQ
FT                   LWHCGRASHSSFHQDHQLPVAPSAIKLEGDSIHTPQGKQPYETPRALSTDEIPLVVEDY
FT                   RNAAINAKTAGFDGVEIHSANGYLLDSFLQSKTNQRQDRYGGTLENRYRFLKEVVEAIS
FT                   QVWPTHRIGVRLSPNGVFNDMGSPDYRETFLYVAQQLNAFDLAYLHILDGLAFGFHELG
FT                   EPMQLSEFRSVYNGTIIGNCGYSQEDADDRISNGNADLIAFGRPFISNPDLVERFTNGW
FT                   PLNPPAEQSIWYSFEREGYTDFPIYSESQA"
FT   gene            complement(218508..219491)
FT                   /locus_tag="AM1_D0266"
FT   CDS             complement(218508..219491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32757"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP21"
FT                   /protein_id="ABW32757.1"
FT                   /translation="MNHNISIFTALLISLLPACSLIGSSYGGHLSRPDEARINISAEPM
FT                   ASFDAEPRSILFRYLAGNSRWEIRQERGIKYAVRREKVMGEYKTTRHGFYSNDDDDSVH
FT                   QTRVLIAFEEPYGIGRDRGNITRAIAGSDDVAVIVEGAHEGTPGNTSYVIIEGDRLYLE
FT                   IYDQAPETARQFTKKTIGEVFAELADVLKHQDEIKTTGLIPVESRYPGKRPNSPHFKVS
FT                   DGMQPGIYLLNGAINPTTPGYVYTRVYDVETGQRLSEEQLTSRSTRYVGWSDSGETFFP
FT                   YNAEVTVYEGDWSNKYEARFELWHKSEQGNEFKIAEITRMINGWER"
FT   gene            219551..219664
FT                   /locus_tag="AM1_D0267"
FT   CDS             219551..219664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32758"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP22"
FT                   /protein_id="ABW32758.1"
FT                   /translation="MSTSQIQAFSTLASRYKDSVLMEIHQVSVLKVWGKAT"
FT   gene            219763..220524
FT                   /locus_tag="AM1_D0268"
FT   CDS             219763..220524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32759"
FT                   /db_xref="GOA:A8ZP23"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP23"
FT                   /protein_id="ABW32759.1"
FT                   /translation="MKLINQYQMAKTIYIYPRPNKRLHFFLGSNRERYFGRTTKSDESG
FT                   REDLTDSMIQEPNQAKRNRFLALWSLISPGCLLLTVGLYYLLGIHWNPGTLDASLLMIT
FT                   IYVIYWGLLGSLQGALLLKFQYKTLAYKWLRNTSATGFLIMLVHDLTLLSTGINMGGQG
FT                   VLILLLSLPIVAILGGWVLGYAQFLLLRGHHSVASQTNRLPFMWFVASFISWIMGFIGI
FT                   FFSGSIPVFFILFAAVGGAIKGWAVMKYLGL"
FT   gene            complement(220783..221397)
FT                   /locus_tag="AM1_D0269"
FT   CDS             complement(220783..221397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32760"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM67"
FT                   /protein_id="ABW32760.1"
FT                   /translation="MNKVLTDWVTVKNLDIQNRSLLFRVGGQDRAGVVAKVTGLLELQH
FT                   LYVEAIQFNLILPEQNQFEMEILAKGALEDLTCIQGRIQSNQFLQPVSAAQNTYLYWPQ
FT                   AYMMHLALNTPDQEGLIARISNIVSTPRDNNNPFSAGNFVYLAGITHNSDGPQGGTAYF
FT                   SVRANIASQSLEVQHQIQNHLLEWAKESCIEEDIWIRDLNP"
FT   gene            complement(221473..221670)
FT                   /locus_tag="AM1_D0270"
FT   CDS             complement(221473..221670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32761"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP25"
FT                   /protein_id="ABW32761.1"
FT                   /translation="MAGTGKPFVKESFATPGFCRECTVEIEENFEIGEVIELRPPETME
FT                   RIEEMVGEWLERERVSRVWG"
FT   gene            221973..222116
FT                   /locus_tag="AM1_D0271"
FT   CDS             221973..222116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0271"
FT                   /product="CAB/ELIP/HLIP superfamily protein, putative"
FT                   /note="CAB/ELIP/HLIP superfamily, putative."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32762"
FT                   /db_xref="GOA:A8ZP26"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP26"
FT                   /protein_id="ABW32762.1"
FT                   /translation="MNSSGNFFGFNPFAEAWSGRLAMVGFYLAIAIELVTGKGVLHFWG
FT                   LM"
FT   gene            222180..222332
FT                   /locus_tag="AM1_D0272"
FT   CDS             222180..222332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0272"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32763"
FT                   /db_xref="GOA:A8ZP27"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP27"
FT                   /protein_id="ABW32763.1"
FT                   /translation="MNSQSSFTGFSAFSETWNGRLAMIGFTLALITEALTGEGIIGQII
FT                   SWFTF"
FT   gene            222611..222844
FT                   /locus_tag="AM1_D0273"
FT   CDS             222611..222844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0273"
FT                   /product="RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32764"
FT                   /db_xref="GOA:A8ZP28"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP28"
FT                   /protein_id="ABW32764.1"
FT                   /translation="MSIYVGNLSYAVTEKDLKIAFAQYGAVKQVKLPIDRETGKKQGFA
FT                   FVEMDNDAEEAKAIKKLDGGEWMGKTLTINKA"
FT   gene            complement(223327..224148)
FT                   /locus_tag="AM1_D0274"
FT   CDS             complement(223327..224148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0274"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32765"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP29"
FT                   /protein_id="ABW32765.1"
FT                   /translation="MAMDSPRIYCIPASEAPVIAVFRRGPSKWFHVGRWDLTQQTYEPG
FT                   AWLHGRIYPRRSDLSPDGRFLCYFAHKPNATWEHGETYIAISKLPWLRAIYAFGTCGTW
FT                   TRGYYFIPPDQSDEHLKIDVPFPYNLSSIPVVQFANERHRGWTETADSPLRQPNDLWDE
FT                   HRNARLYKIQPEGHRILYLESLGLAGGEFGEDQAVDGMSVLYSMQSNEGIEILDAYQWA
FT                   DWDLQGNLLVATRSGKLQVNQVEDNGLRVVFEVDLSVMDPDPLPPPSWAQN"
FT   gene            complement(224173..224376)
FT                   /locus_tag="AM1_D0275"
FT   CDS             complement(224173..224376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32766"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKA2"
FT                   /protein_id="ABW32766.1"
FT                   /translation="MAIETLTDLVGFPDGWLVGVSCSLEWGYQCWVITPERQVHTDGEF
FT                   YESSFVALSAGRFLVEHSLEVE"
FT   gene            224492..225550
FT                   /gene="recA"
FT                   /locus_tag="AM1_D0276"
FT   CDS             224492..225550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="AM1_D0276"
FT                   /product="protein RecA"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32767"
FT                   /db_xref="GOA:A8ZP31"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP31"
FT                   /protein_id="ABW32767.1"
FT                   /translation="MSAKTEMTEKQKALDLVMKNVEKTFGKGAIMRLGDAARMQIETIS
FT                   TGALPLDLALGGGLPKGRVIEVYGPESSGKTTVALHAIAEIQKSGGVAAFVDAEHALDP
FT                   VYAAALGVDVSELLVCQPDSGEMALEVVDQLVRSSAVDLVVVDSVAALTPRAEIEGDMG
FT                   DSHMGLQARLMSQALRKITSNICKSGSTVIFLNQLRQKIGVTYGSPEVTTGGNALKFYA
FT                   SVRLDIRRVQTLKKGTEMYGIRAKVKVAKNKVAPPFKLAEFDILFGQGISTVGCLVDMA
FT                   EEAEVIVRKGAWYSYDGSNIGQGRENTIQYFGDHPEFSQKIEQQVRQKLELGGEVSANS
FT                   TTPVEVEDEEAA"
FT   gene            225560..225937
FT                   /locus_tag="AM1_D0277"
FT   CDS             225560..225937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0277"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase, putative"
FT                   /EC_number="1.13.11.39"
FT                   /EC_number="1.13.11.27"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32768"
FT                   /db_xref="GOA:A8ZP32"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP32"
FT                   /protein_id="ABW32768.1"
FT                   /translation="MNTQGKKLYPFVPSGPNFQESLKFFVELGFEKLWENENDGLAALR
FT                   FGEAQFLLSNIDIQEWQSNQIIVYEVDDLEAYYLELQAKDIPTKFPGRKIGPPTDYPWG
FT                   REVQFIDPGGVCWHVRQYEGN"
FT   gene            complement(226097..226288)
FT                   /locus_tag="AM1_D0278"
FT   CDS             complement(226097..226288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32769"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZP33"
FT                   /protein_id="ABW32769.1"
FT                   /translation="MRVLHLDQDQAEDQEEDPEESVSLAGDVTENPIGALQELCQRQQI
FT                   SLPRYEFETIPEGFRCSV"
FT   gene            complement(226447..226659)
FT                   /locus_tag="AM1_D0279"
FT   CDS             complement(226447..226659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_D0279"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_D0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32770"
FT                   /db_xref="InterPro:IPR021231"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKA6"
FT                   /protein_id="ABW32770.1"
FT                   /translation="MSTTISILADIPEELHDALRGYLDTHPDWDQSRVLSAALSLFLMQ
FT                   NGTTDRRTTRVYLDSLFRRELPTAC"
XX
SQ   Sequence 226680 BP; 61232 A; 51958 C; 52036 G; 61454 T; 0 other;
     tagtagggtt atcaacgatg gtttttattt caaaaactaa gcacaacaaa tgttgccctc        60
     atgagctaac caagctggtg gtaaaactcc tccgcccttc agcttgttaa gttgagtgca       120
     agccttatcg ctgggagtta tatcttgcta ccaacctacg agaatgtcaa tctatttttg       180
     aaatacattt aatggcctca aagccatatc tatcatagaa taagctgact tcagtttcta       240
     gaatattcca cagaaatagc tgaacatcaa gccctacagt atagacctgt ggaaatcatc       300
     ccatcagatg tggataacat gggaaatatt gtgggaaatg tggggaaaat ctggggataa       360
     aattttaatc tttactaacc taaatatctg taaagtttat tagttcacct aaacggaaaa       420
     ttggggatca gttagtattg caattgagat gcaagtatcg gttttacgtt tgttttcaga       480
     attgtttggt atccgccagt ttaattccca agaccgcgca ccgaaatcta tatctcctca       540
     ccttattgat tttggatatt tgtttatgtc gatttacgtt ggtaaccttt cttacgacgt       600
     tacccaagat gaaattcagg ccgtgtttgc tgaatatggg gccgtctcta acgttcatgt       660
     tcccaaagac cgcgagactg gcagaatgcg aggatttgcc tttgttgaat tgggcaacga       720
     tgccgaagaa tccaaggcta ttgaagaact cgaaggggct gaatggatgg ggcgaacact       780
     caaagtaaac aaggctagac ctcgtgagaa caatagaggt aataacaact ttagtggtcg       840
     aaaccgtttt taacgcaatc tgaaattcga tgatgggctc tcccagtctc aggaagaatg       900
     gactgggaga gagttttttc tatgcggtta agttgctctc tccagccact cttgcaattg       960
     ctgttgacct cgttctctca attgctctag tatctctcta gcggcgatac tcttcgccaa      1020
     tttcttcttc tttgctaccc cactcccttc aagctgctga cctaaaaccg ataactcaca      1080
     ctcgcagata aaccattcat cggaactgac cattgtgtac acaggggtct cccatcttaa      1140
     ggtttgacaa acatcaacca gcatcccgac aaagttctgc ccctccttaa ggggcttcac      1200
     caatgccgta tgcattgatt tggataaggg tgctgttact cgttttatgt cttcattacc      1260
     agacttgaac tgcggctcag gtagtactgg ctgtgctcgt tgctctggtg agactaagct      1320
     gtggtggatt ctaagcttct atccatatca aacaagcgtg atgacgagcg ggttgtttgc      1380
     gggaatgggt agcgggatga atcgtcgtta aagtgtctcc agaaattttc acctctagcc      1440
     aaacatggaa tggtggttta ttctccgctt ctagatattt aaatgcttcc cagttccctt      1500
     ctcgattgga ggcaatggtg atcacactcg ccgcatcatg gatatggcta gacagatact      1560
     gaatcacttg ctgatgtagc tcaagttctt tggactgaaa gagcaatagg tagagatcct      1620
     gtacggctaa ttgctcagcg tctaaccggt tcacaagttc actgcgaagg tgatcaaccc      1680
     cctgagactc aaccgcatat ttcaggagtc gtgtgaattc tttcccagtg agatttgcta      1740
     agtcttcggg ggtctgaagt tgctcctggt agaccttttg atgggctgct ttgaagaact      1800
     ccgaggcctg ctctttatgc tcatccttga cctgggcaat atgctgtccc aattcctcca      1860
     gctcagactg ggtatagggt aggtcttgct gcttgaggcg ggctttgaca atccgatggt      1920
     tgatcaggtc agcgactctg cgaatcggac tggtgaagtg gcaataggca ggcaggttca      1980
     gggcaaaatg ccctatcaag acgggactat acacggcccg attcatccaa ctgtgcaacc      2040
     gttgacgaat ggctgcattt gaccctaaca tcaacaacat ttggtacatt gtttcccgat      2100
     ctggggcaat ggctctggcg gtgtgattcc gatacagcgc tgggatatcc tgatcggcta      2160
     accattgagc gacggcgagg ttcgccagga tcataaattc ttgaatgagg atatggcttg      2220
     gatgaagttt accttggata aggctgcctt cttctgtgag ccactggcct tgagccgtct      2280
     gggtcgctcc aattgaacct gatgtcagcc gatttcggta cagatgggag gcccattggt      2340
     gagccatttc cagagtgtta tgaaaaggag tagatgattt aggctgggag gcttcagcat      2400
     aggtaaagcg tttgtgactt accagccagg attcaaagat tttgacgtca accatctggg      2460
     cgttcgggtt gagggtaacc tgaacggtaa cggtaggtcg ggcttcacct tccagcaggc      2520
     tcagcttatt ttcggacagg ggtcttggca gcatgggtgc gttcccattg ctgaaatagc      2580
     gtgtgactgt gcgagagagg gctaccttat ccaatatcga gcccatctcc acgagttcgg      2640
     agacatcggc aatatgtacg gagaggacta cccctgactc agtcgcttca atccagatag      2700
     cgtcatccag gtctcgagaa gtcggtccat cgatggtgat gccttgaact tggggacgtt      2760
     cccagagttc atcagcgagg acaaggcgct tggctatttt aatgacatct ggggagaaac      2820
     ggttcttgct tttgggagtc gtttcagtct ttgctggtgg actatcctga gtcagtggct      2880
     taggtttctc atcttgcacc gccgctgtcg actttgcctg ttcgattggt ttttcctgat      2940
     ctaacgttat gggcttttta tgttgaagta cgccttcagg ctttgactcc agcttttgcg      3000
     ataaaggggg tttcagcgtt gttctttctt gctgcaatga tttctgtttg gcctgcttct      3060
     tggagtgcct taatgcagct tttcgctggg ctatcttgga tgctgtggtc ttggactggc      3120
     ctgggtcaag ctgggcttca agttttttaa ttgcactttt gagtaccttg gcagcagtgg      3180
     ggttgctgca ttgctggagt tgagaacgca gttgtgaaag cttttctaaa gttgaagaag      3240
     gcatgggaga ggaaaatctc gctaggagca gacttgcagg tattctaatc tagagaagaa      3300
     ggattccagc agaatctaag ggtctggcta tgacgaacca ctatctaagc ctagccccat      3360
     aatcaatgac attatgaacc actgtgcttt tcagacctcc catcaagcca aagatttgcg      3420
     gcatacccaa gatggtcagg ccatcgctga atttgtagtc actattcctc cattacgaga      3480
     agaagatccg cccgaaaacc tcaaagcaat ttactggggt gaaaatggag aaacgcccac      3540
     ctttccctac aacctggcga ccaactgatt ctacaagggc agctcaaaat cacaaaagtg      3600
     acacactaga tgggtgaaaa agaatatgtt gagcaacagg caagtctgat cgtagagaag      3660
     attaaccgaa ttcaacgtgc cagttaacgc agcaatctat cgcaatcctc agtaatgcta      3720
     tctcaacaag tgaaagtgaa gcttcgagta gctcggccaa tcttggaacc gttgctattt      3780
     acaaagggaa tgatgatgaa atcctccaga aatgccgaat gtagcccatt aatgattaga      3840
     tacaaaggaa gttaattctg ggaatgctat acgttagcat tcttagtttt gctgaaataa      3900
     atacactgat ctacgacgaa ctatggcccc tgacaacaaa tactccacag tactccttga      3960
     gttaaagact cactaccagg agacactcgc tgaacttgaa gctcaaacga gtcaactcaa      4020
     gaccaaaatc acgtctctgg atacgttgat tgaagatcct ttgttaggtt cagacatcct      4080
     ttcaatcctt caaggtgaag cagattcact cacctcacca gaaccagttt ctaaaactgc      4140
     cgacacagta gaacttaaag ccaagtctaa gaaagctact ccaaaagctg cttcaaagaa      4200
     gaagtctaca ccccctaaga agccagcttc aactgcaaag acaaaggaga aagtaaaacc      4260
     ggaagttgac gctgaagcta ccccaaagaa agccgctcaa aaagcttcgc cctcatccgg      4320
     gaagagaaaa tcctcaactt ccaagaaagc tgtatctcag gcaacagcaa agaagaaaag      4380
     tcagaagaaa acaagcagct cttcatccag cgttctgaca atgaacaagc cctatgacca      4440
     gatgaagaaa attgatgcga tcacacagat catgcaggaa aatcctggga aagtcatgca      4500
     ttacgatgat ttgattgtga gactgtttgg tgaactaagt aaagatgatc agaaagctga      4560
     gcggggtagg attaaagccg ccatgtacca gggggctaaa aataatcttt ggaaaaaagc      4620
     aaacgtacca atgtgctata tctacgatcc aagtctaaaa gctgaatcta aagcaacaac      4680
     ctcaaagact caaaagtctc gtaaaaagac ctgatgtccg atcagtagag taaagacgtt      4740
     caagattcaa gctgaagcca tcattcttga gatcaggaat gatggtggag caaatagaaa      4800
     aatgcctcta ccaatctcca tttgctctcc tgacagcgca aaagtactgc cagccaagta      4860
     gtctgttagc ctctgagcta gcttggtttc taaagccgcc aaattcacta ggagcatatc      4920
     atccgttttc atcgcgttga ttgcttcctc agcatcttca aatgacttgg ggtgaaacac      4980
     acggatttta tggggcgata ttgcttgaaa gggaagaaga ttgttcataa accagtgctc      5040
     ctctgcgacc aagtccaggc acatcctcag cgtttcgtga atactccagg cagtctgttg      5100
     atacatgctc aagcctagga tctcacctga taggttactc tccatgacat cagagccagc      5160
     ggaaagttcc agctccacag attctcttgg agttcgcggt tgactgatct gaaggttttt      5220
     tgaggacact gactgaggta gtccgtccgg aatagagttg aaaattgaag aagttatctt      5280
     tttcgggcaa tgtgaaaggc agaaatgttc aagagtttga tgtgacctgc aaagtgattg      5340
     tctattttct tctgcaatcc tacgaacaag tctttcctgc ttttttcatc taactccaag      5400
     tattgtgaaa aggtactcaa cagtgtcaaa tattcatcca cactatatga ggtctcccaa      5460
     ataatctgtt cgaaaacgat gccttcgaat tgatctgagg tagcaacaat ctgtcctagt      5520
     tctctcaatt cagcctcatg agtttctctg cctttgtagt gagacaggga tggagcatgg      5580
     atttgataca catcctgtaa cacctgatgg aactctcgat aaggaatggc tggcacattc      5640
     cataacagta tgagcactcc attatcctgt aatgcattgg ccactttagg gtacgcaact      5700
     tctgccggaa tccaatgaat cgaagttgct gctaaaacag cgttaaacgg ctttgcttct      5760
     ggtttccatt cctcaaatga ggtgtttttg atctcgagat ttgggtagtg agaacaattt      5820
     ctccgagcaa tctcgtaaaa gtctgggttt ggctcaagac agagcattga aaaacccagg      5880
     ttagcaaacg aaactgttgc agttccaggg ccacaaccta tttcaagaat tctcgaccca      5940
     ttttcaagtt gagttaactc gacaactcga ctaatcaatg tatcaggata atgaggtcgt      6000
     gttctgttgt aagcctctgc tgcgggagag taccaagtct ttctctgttt caagtctttg      6060
     ctagagtact gcttggttgt ttgatcgtta tctttcacca ctcagcctca aactcaaaat      6120
     gctctctgcc tattctgaaa ctacattcta ataaatagga ttagatacct aaccttggat      6180
     atctgtcggt cagccaggtt aagggggtga agtcaactct caaacaaatc ataatgagac      6240
     actcagatac caataacggc aaagaaaata tgtaggttaa attgtgcgat cgcttgtcca      6300
     aatcaactca ttgacgggga actatctggc tatcaataga ctcaacttca ccaacgcaga      6360
     taatagaagg tttctaatga ctgatttcaa gcatagacct actaacttag ggcagcacct      6420
     atggagtcca aggaatttag ctgaacagac ccacgctgct gctcaaagcg ctgaactaca      6480
     ctcccgtagt gttggacaag ccagtctctc ccagaaatta ctggatatcc aacgtcaatt      6540
     atgtatcctt caactaagac tcaaagatcc tgaaattcaa gagtggactg gaaagcaaat      6600
     gcagctacca ttcagataaa atgctcaact ctcccagatt catacctgtt cttaacattc      6660
     aaatgcacct ccatctttca ttcagaatta cactgaattg aggttttttt ccttgaaaga      6720
     gcaagatact caaccctact aagcaactga gaaccagata ggaaagacct tttaacccca      6780
     acactccgct acccgctccc actcaaactc cgcctgaacc ctctcccaga tccgcttcat      6840
     ctccttctgt ggacgaagct caatcacttg taaaatctca aagttctctt caatttcgac      6900
     ggcgcactca aatcaaaccc ccggtgtagc aaacgattcc ctcacgaaag gcttccccgt      6960
     tctcttcacc aaaactatta ttgccctaag ttattcttgg agatggtcag cgtctctaac      7020
     tcgcttcgac atccatctag ttaggagatt gttcgcattt cagtgtataa cctacccctc      7080
     gaatcgtatg gataagttcg gttccaacct gattggcttt gagcttattc cgtaggcgag      7140
     acacatggac atcaactact cgcgagtcaa cgatggtccc attactatat ccccacactt      7200
     tctctaacaa ctcttgacga gacactactg ctccaggggt acttgccaat agttctaaca      7260
     gactaaattc catgtgggtt aggatgatac gttcttgacc tctgaagacc ttccgcttgt      7320
     tggtgtcaat ccggagtgaa ccgatgttta gcactccggt aactcgataa ttaaaaggct      7380
     ttagagaacc cattcggcgt atgatgcatc gcactcgtga ttctaattcc ttaggtgaaa      7440
     agggcttgac catgtaatca tctgcaccca tttctaagcc agtaacccga tctcctacct      7500
     cagaaagtgc cgtcagcata atgatcggaa ctctcgaggt cttgcggatg gcccgacaga      7560
     caccataccc atccagtctg ggcatcataa catctaaaac aatcaaatca gggtgctgac      7620
     gatcaaagat ttctaatgct tctacgccgt cagcagcagt gaagacgtga tagcccatca      7680
     tggatagcct agtgtctaaa attcgtcgaa tcggcccttc atcatcaact accaagatag      7740
     aatgctgctt attgctctga ttattcatga attcaggcat ctttggctac gctttagttc      7800
     aacgtagcat ttatacctaa gtaataatgc ttaagacgct tgatagaaat gattcttatg      7860
     attaggtcat tttcgagaga aattgcctag tctactgctt cggcatttgc ccaaaactca      7920
     actcactccc aaactcaact cacccccaaa ccctcgtcac tctctcccgc tccaaccaca      7980
     ctccgaccat ctccccaatc cgctccatcg tctccggtgg ccttagctca atcacttccc      8040
     caatctcaaa gttctcctca atttcaacag cgcactccca acagaactcc ggcgtagcaa      8100
     acgtattcct cacgaaaggc ttccccgtcc ctgccaccgt aatcaagtac tcctcagact      8160
     cattcttgga aacagccaga tactccagct cccctcgcgt cctggtctgc tcaaccaaat      8220
     tcttctgttt cagctccaga ttcttgaatc gccgctccag ctctgccgac actctagggg      8280
     ttctcggttg actagtctgg gcagcttctg aggtctgggt cttgggagag tactcaggtt      8340
     tggctgatcg gtgagttcgc ctagaactcc ggcgtagtcc tcccagctcc tcatgccctt      8400
     gttctagctt ggctggccgg gttccttccg gtgttttctt aggaaatgct gtcctactaa      8460
     ccagtttggg caaggaaggg acggacttag gtagttgtgg gatgatggtc ttgggtacaa      8520
     gcttggggtt gagggcaacg attgggggag tcattgggga atcctcaaat gcactaaagt      8580
     ctcaatactt ggattgtttc acaattggaa aagtttgagg agcaaacaga taaacaccat      8640
     ttcctatttc tgtatattca ccacataaag agttagtaca acctgcaaga taatcactta      8700
     ttctctgggc cgattttgga gatagatttt ctaaattgac gagtagcagt tgtccgttct      8760
     tcaggcaatg tgccgcttct ttagcctccc taaaagaact cggattcgac aaatatattt      8820
     cagatgaaga ttgtcctggg aatatgacta aattgttcac agaatgatgc tattacttgc      8880
     tcagaggtat gtcttaattc ttccatgaag gaatttgctt ttctttaatc gaaaaataag      8940
     tttaatgttc acatcacttc aaaatcgcat ccttagcctt tagagggtga aatgtgacat      9000
     agaccttcct ctgctctctt caacaacatc tccgcagccc ccatcttcgc tttcttcttc      9060
     gatgctccct agcctactcc ctgtaatccc atcgactgca ctaaacaacg aaacccttct      9120
     gatatctctg aaaactcgta cctgggcaac gatatttgct gtttctggca aagctcttgc      9180
     aattgtccaa tcggattctc cacctgttca tcaacctggc tgttgggttg atcaggggag      9240
     gtctcaggtt gctcggcttc ttcctggcgt ggatgtaaga tatgtacctg ctgttcggcc      9300
     ttgcggatag ctcggttcct agcccgttca aggagcctga tcaaagcatc ttctggatca      9360
     tcattggggt acaaatagtc gagaaatcca agctgctctt cggttagtag aacgtttagg      9420
     ctgagggaag gtcgagattc aatcatacct ggagagtgga agactccaat ttagaaagga      9480
     cttggtcgat gatgttctga tctttgattt ctggatcagt gatttcctgg tcagtggatt      9540
     cagtagcgtt actcttaggc gttgaacgtt ctccaacagc cacaaccttg acggtaacgc      9600
     catctctatg gcagatgaac tcatagagct ttccatcctt gagcgtctcc aggcagtcct      9660
     cactcacgag cggggaatgc tggcggatat gaatctctgg gtcgcgctcc tgatcccgct      9720
     gtatcaaaac cctttgctta tctgctctcc atactccgat caatacccag ttctctgtct      9780
     ttgctgatgc ccgttgcgag gtacctgtta actgcaaaga tgtaatctga ccattcatga      9840
     tattgggata accaaacacc atgattggtt tgtctaaaac tgacttgact ttcttaaagc      9900
     tcttcttcga taggaagagt ttgatgggtt gtccatcaac ttccacaaaa tacagagact      9960
     ttgttctccc atcgtcaaac tccttctctc gtactcgaat aattccggga attcggcacc     10020
     aagcccgatg agtgccattt ccagggagca gtggaggttt ctcggaaagt tcacctgatt     10080
     ttgactttga tgttgtcttt tcttgttttt gattttttga atttgaattc ttactgttag     10140
     gagtgtctac agtcttaaca tgcggctttt cctgggctgg atttgggagc ttcttgctct     10200
     gagagattac ttcaggtttt ggctctattt tgttgagtga agggggtttc aacgttgttc     10260
     tttgtttttg tgatgccttc tgcctagatt tcctctctga tttcttgtgt gcagctttcc     10320
     gctgagctac cttgaaagaa ttcgtgttag ttgtctttaa ctggtctatc ttggataact     10380
     cgatctggtc ctggcctaag ttgagctggg cttcaagctt tgcaatcgta ctcttgagta     10440
     gcttggcagc agtggggtta atacaatcct gaagctgcct tttaagctgg ttcagcttat     10500
     cgatagatgc agagggcatg agaacctccc tgggatcgga cttgcggcca ttctagtgta     10560
     gagaattggg ttttggggaa agtaaaagtt ttttccacga atcgttactg gcctttaatc     10620
     tagccttaag atcagaaatt atgaatcact tcgctataca aggaatactc ctagagagat     10680
     ccctgcgata tacccaggaa agacgtgcga tcgctgagtt tgttgttgaa attaaccctc     10740
     tgagggaaga agaccccaag gaaaatctca aggccatcta ttggggagag aatggggaga     10800
     aagcacacaa tgcattgcat accttaggat aaacaaacgg tacacatttt ttatttatta     10860
     cgtatttgtt ctatttttaa ggtttctcta aaactttttt ctctttatat tattaatatt     10920
     taggccatga tagacacaat atcatgacat caaataggct tcagcagaga actattatta     10980
     agtattcaat aatagttctc tattataatt gcactatttt ctccacaaaa tatttacgat     11040
     attagtaagc tctccttttg ttccagataa aaataaacca caggctttca aacctagggc     11100
     acgatgaaag ttctcagatg catgatttct tagaggactc acagctgttg ctgtaagtgc     11160
     agttaaccca tcaaaattta gaaatacgtc atcgtataat gcttttgcat atcccattcg     11220
     catgaattca gctttaacgg ctatttttgc aatccaatag caattatcta catttgggta     11280
     taattgctct gaatcaaacc aaatgagaga ttcgttatta attagtaatc tacttaagat     11340
     ctgatgcttt ggaggaacaa ccattacaaa tcctactaga ttagaatctt gagataaaac     11400
     ttttatatag cctgtatcat gtaaatcttc ataaacctta aatgaggctc cgggtagaaa     11460
     aaaacctttt gcattagcat cttcagaatt agaaggaaaa gacttttcta attcatagca     11520
     aaaattcagt tcttcaaatg atggtgtgta gattttcatt attactatgg ctagtcttaa     11580
     aaaattctct aaccatctta actgacaatc cggcattgcc attaataaat tggttagatg     11640
     cctctctcca tcccattttc ttataaaaac ctgaagattg aactctacaa ttacaccaaa     11700
     tatgtctaag ttgctcatct ttttctaaat cggaaatcat aaagtcaatt atctttcgac     11760
     ctattccttt agatctccat tcaggtgctg tagccattgc tcttagctgc caagctagga     11820
     atccattcca atatgactga attaaagaaa cacagcaaat attattttct tgtctatcaa     11880
     aagcaccata atgtctactt tgataatcgt gatcttcatt gaacataact tcagtgattg     11940
     gatacccatt tcttaatact tgatgcctta atttaagaat tgagcctaca tcagtttttt     12000
     tgaagtcaat ttcattagct tgatgtttta ttattagcct atcatcttta actagctgct     12060
     cgaatgtaaa tggttctttt ttatatgtaa ggcgactaat tcctgttatt cttgataaag     12120
     tttcaatata gtcttcttgt cgaataagct gatggattac acatcttagg atagtgggat     12180
     tttctagtat tgataaccaa gcatctctaa tcaatattga taaagcctgc ataaccctct     12240
     tttatcactt tagacagaga gaaaatcagg atgcttgagc aatttcctca ccagtggaca     12300
     gcaaaatgcc tccatctttg atgtgagttg ctcaaacccc tttttcaaag cacggctggg     12360
     aaagacttct aaccagcgct ttagaagatt ccaactgatt aacggttgaa tgatcaagcg     12420
     cacattattg agcagattct tccacccgtt ttggttatcc caccaaggat gctgcgcaaa     12480
     gtgttgatgt gccactggac aagagtcatt gaagacatca gcgaacaaac tcaccatcaa     12540
     gaaagcgctc atcactatct cccaccactt ttcaatttgt tcgtagtgcg tcatgcgaaa     12600
     atcagcccaa cccaaggtat ctttagactg tttgagacca tactcaatcc aagttctgaa     12660
     gccatagcaa tccccaattt catccagctt gatctcgggt gccgctgcca tgacataaga     12720
     ggttgagttc tctggtagcg tttgggggtc cgtggttaat agccaatagc gcttctggtg     12780
     gtgtcgctgg ccataaatga tctcttgcct gtaacgagtt tcagtggtgc cattgctgaa     12840
     ggttcgttca aatgactgcc acggttcggc aaagactgct tgttctgcgg gtaaccacac     12900
     cgcatgattg ctacgaatcg ctaggatata gggcagcttt aactcctcta agacattcac     12960
     aaagtttgtt tgagcttccc catacaagct gtcagccagg acgagctcaa agcaaaagcc     13020
     catcccttgc aactgtcgga tcattccagc agcaatttgg ggtttgctga gatactcatc     13080
     ctcctcttta agacgttctc ggggtttgta cacttcaaag gacaaaggca aaatcatccc     13140
     ttgaaacagc ccgtaggcag tgactgcgac gatgccattc tctttcttgc ccacattgcc     13200
     gatatactgc cgtttcacat agtcggtact cttgcctttt ttgcaatcgc ccgtctcatc     13260
     gatcaataga attaacctgc gcccatccag tattttcaag atgatgtcca atctcttgtc     13320
     agacaaatgt gacgctaccc aaggtgattc actcagaaaa tgatgcaggc tttgatggtt     13380
     ctccaagccc actgctcttg caatggcggg caatgattta cgtttgatat cactaatcat     13440
     ccccagatgg agatgcttga aggcttcata actgcggact tggggaaata actctgcaaa     13500
     tagttggcag tactcatcaa caaagccaat ggttggttct ggacttcttg aagctgacat     13560
     cactcattag aaaaatagaa actgagaata gtctattttt tatctgtcta aagtgataaa     13620
     agagggataa tgtcagattt gacaattatg gaactacgta aaaacaagaa tacaggttta     13680
     atttgagcaa taggattatt aagcaaatta caagagttga acttaagatt gaaattataa     13740
     tgtgggaatc caataatcgt tcttatattg ctatcaccat tactcaaagc atgcgtaact     13800
     tcatctggct ccatttctgt tgtagtgctt tttgttagaa gcttagaatt aattagattc     13860
     tcatatataa aaaattcagt tgatggtact tctttcatta aaaggtattc accgtccaaa     13920
     cttcgttcat ttaattctat atttgaagat aaaatcccat gtgtcatatt tggcatcata     13980
     aatgatgaag tatatcttcc tgttttttcc cttagaagaa cactcgcggt agcaagggtt     14040
     agagtaaaac catcaacttg ccttgaaaaa ttatcgaata ttgcattctc aacaatttca     14100
     accgagtgag gatgatggta atcaaaggtt atattaatat ttttttctct taaataagtt     14160
     aatatggcaa gtgttcctgc atgagcagga gagactacta aatgtattgg attttcgttg     14220
     atcacacggg ttgcttgttc aaggttccaa cctaaacgag tcgttctatt aagctttttc     14280
     tcttgatcgc ataccaaaga ttcctttgat ttagtgaaag caagaaaaga tgaatcattt     14340
     tctgcatctt tgattcgttt actatatgcc gctctgctaa aaatatctgt gatatttagc     14400
     attaatataa tttcttcaaa ataaattttc tcaagccaaa tcaaattttc ttcaatattg     14460
     aatggaatgg gaaatttatt aaacctagta tcaatattaa attttttcag atgacttatt     14520
     tttttgatag atgaatttgc ataattttca ggtatattat taagttgatt atctcgtttg     14580
     tttgatatgc tagccttttt gcttctattt gatttattct tttcccaaag agagttcact     14640
     tcatttagat ttatgtctgt tttctttgac caaagctcta gagaaaagtg ccaatcttga     14700
     gaaccttgct tatttacacg atgatcttga aggataccca aaaaatcttt taggcaatgt     14760
     agtgcatctc taatatctgt tttttgcaaa gggtttcgta aatcgtaatg gtcacacaga     14820
     tatttgagat tattgattgt agtttttaca atcagtgttt tttcctgaag cccatcttct     14880
     tgccaactat attggatgtt tattttttga gtatgttcaa attcatcatt agcgaatcta     14940
     agtatgcatt ctaaaattcg taatactctt gttttttgcg caggtccata ggaaattcgg     15000
     ggcataagct aaacatccta taaagttttg ggaaacccta gggtatttga cttaccccaa     15060
     ggtaccttaa aacctactgt ccttgatttt tcgttatcct agcctgaagg ttgcaatggg     15120
     gcatatcctc aatgggatag taatgcacag ttgttaagaa gatttagtac aaagtattgc     15180
     tcctgatggt aaatggcagt tccaaccagg ctaaccaagc ttaggtacag aaactaacta     15240
     ttctgtcatc caagtcttca agcagctgta actttatatt tctagtatcg acgatgtcta     15300
     ttcacagata tgatttgcaa ctcactgaaa acctttcaat ttccaaaata aaaatagatc     15360
     aggagattca agtactatct aaatcgaatg atgctgtaat atcagagttc gcagaagcta     15420
     tgcgaaaagg ggctgacttt ccacctatca cagttttcta cgatggttct gaatattggc     15480
     tggctgacgg atttagtcgt ataaaagcca aagaagcaaa cggagacagt tatatactag     15540
     ctgaggtgga gtttggctcc cgtcatgaag cgaaacttta tgctgttgta actaacacga     15600
     atcaaaaatc gaattagcat agatcaacag aaaatcaaat aagccctttt aaataaatca     15660
     gctagtcgta agggactgtg gaagtagccg caaaaccgtt ttacactccg tcttgaacta     15720
     gttcgaacta gaacagcgcc cagatttctc tggggaagtt ccccagagac aaaactcctt     15780
     tacttgatag tcactcaaca aattggtact ccataaattg aatgtccgta catgtagtga     15840
     agagtaatat cagtatcaat tctcttaact aagctatctc tttgatagtg ctcatctaac     15900
     tacaaggaac aaagataatg aaactcaaag atcagataac caagatcttt acttaactca     15960
     agttaacaaa aactatagcg attctctgaa ttgcttgttg cttaaaggct gagatgtttt     16020
     catagcggta ttgttgttgt cacccaataa ccctgaatgc cgcccaagaa agcctctaga     16080
     gaattacatg aagtttctac ccagtcagtt gagatagctg aaattcgcat ggatggaggc     16140
     acgcaacctc gtgccaaatt atttgaagaa gttgttgacg attatgctca agatatgaaa     16200
     caaggggcaa ctttccctcc tgtgatagtt tacttcgacg gagaagaata ctggctagcc     16260
     gatggcttcc accgggtcag agctaaggaa gctatagggg aaacatcagt tactgctgaa     16320
     gtccatcttg gaactcaacg tgatgctgtt ttatatgctg ttggcgctaa cgctgcacat     16380
     ggcttaaggc ggacaaatgc tgataagcgc cgtgccgtta ttagactact gcgtgacttt     16440
     gagtggcgtg aatggagtga tagggaaatt gcaaggcgtt gtggggttga tcataaaacg     16500
     gtaggaagtt tgcggaagga tatatatcca actgatgatc aatctaaaga gtttcgcaaa     16560
     ggcgcagatg ggagaataac taatgtcagc aatataggca agtctactaa gacgattaat     16620
     gaatcaaaca aacgacaaag gagaaaaaaa ccagcagcta ctctcaacac tattgttgag     16680
     caatctcaaa aggttcaaat agacgatatt tggaggctag gtaaatccca tcttttgttt     16740
     tgtggagact cagggtcagc caaatttcag aaattgttac caatagaaat ttcattactg     16800
     ttatttttcc cacgcaaaga caaaccttgg ttaccagaga agccaacaaa tgtgcacaat     16860
     actttactat tccatacctc atatggagaa gacctacact tagagacatt aagaggaatc     16920
     attgagaatt gcttatcggg cactactgac gcaaacgatc ctattgtaat gatcaacctt     16980
     attgatcctt cactattcat tttgatagat gaactagaat gctcgtgctt ttgtgctgag     17040
     cctgatcctc aacgatgcac agacgcacta acagtctgga cagccatcaa ccagacagtg     17100
     aaaaaaatat ccacctaact gaaattacaa gctcttaaaa tctcggagat taatattgat     17160
     actcatagaa attctgacga tcacctattg agaatatgtt gtatgatcgc gttaagcatt     17220
     tttctagtac aaggatatct cttctagtcg aactctaatt cggctcatag tcataagact     17280
     aaccttatcc aaaattatcc ttattttgat taggtttatc cgcgaacagc attagttatt     17340
     actaatgctg cctccaagat atctcttgag acccaactca agagatataa ctttacactt     17400
     ccctactagg tatgggttgt gtgtctcctt aattaaatag gctgaaccct tgatcgatca     17460
     cgggtttcag tgtatttaaa gtctaatact taaccgataa ggaggtaatt tatggcccaa     17520
     taagtgacaa aaccccaact tctgcaagta ggggcatcag tcacatattt aacgtggtat     17580
     taggcaggaa ccgaaaagct tgattggacc cttgcatttg gttacctggg ctttgccgtg     17640
     cttagatttt agccttagct tgcaacaaat tgcaagcatt tgctgaaacc tatgccacgg     17700
     ctccctttcg ctacattcgg aaaacttcag ggagttcgta aatgaaccat ttttttcgca     17760
     tccagctacg ggcatgggag ctagcccatg tctagctttc aaaatatttc gagtaaatta     17820
     cttgcaacca accgctccaa cccctgcgac ctctgtgggg atatcacagg caaatgcaga     17880
     aaggcaggca acctcaatct ctgcatgacc ctctcaggcc agatcgaggg atatcgctac     17940
     ctaggccaat ccaaagatgg cctctggggt aaatacgtcc tcaatgacgg gaaagacctc     18000
     agccacgaag accgggaacg ccgatggcaa gagcaacgga ttctcagaga gcaacgcgcc     18060
     caagctgagg ctcaccgcca tgcacaatcc ctccccgcaa ttgagcggga tcggctctac     18120
     cgccaactcc ttgaccagct caccttgcac cctgcggatc gggctgactt gcatcgtcga     18180
     ggattcacca atgagcagat ccaagactgg ggagtgaagt cagtcgaaca gtggcaaccg     18240
     ctctctggtg aactacccca tgacttgcca ggaataaacc tggatgggaa gtctctcaac     18300
     accccaaggc caggttacct ttgccccatc atggatgctg acggtcagat cgtcggattc     18360
     caaatcagat cccgcagttc cgagggtggt cgctatttct ggctcacagg caaaactagg     18420
     aaacggccca acggacccac accccacctt cgcaatggtg aattacccct agccatccac     18480
     cgtccagagc aaatcacgag agatgcattc gcactcgttg aaggtactgg agcaaaacct     18540
     cacctcctag ctcagcgcat gggccaagtg accatcggcg cagcgggggg attattcgcg     18600
     gcatcccctg aaaccttgaa agcaacccta gcccagcttg ggataacaac tatcgagttc     18660
     taccccgatg ctggggcgat tcagaacaag tcagtactgc ggcaataccg ggtaacctgg     18720
     gcactgctaa aggagtgggg ttacactgtc accgttgcct ggtggaagca gacagacaaa     18780
     cgcatccaca ctgacattga tgaactggat gacctaagcc agattcaata tttgtctgtg     18840
     gctgactttg aacggattac agctcaatgt aatggtctat tgcatcagct tcagcaggca     18900
     ctctcaaaac tcactcgtcc ttcatcgccc gctcaagggt ttgccactcc caatgaccaa     18960
     caaacccacc ccactgaatc tcgcagaacg aagcgaactg caccagatga cgagcgtctt     19020
     gcaacgctgc ctgcaacaag ccgtcgagct agacgatccc gtcgtcgcac tgcacgactc     19080
     cttgcagctc atcgtagaca tggatatatt tccaaacttc gactggaaaa ttatcgaagt     19140
     cgcattagaa gacgtgcggc acaatcagca aactccagaa gcagcagcct acaaagctgc     19200
     cctgaagata acgggactct cgaaacaaca acacctctag tccaagagta cgaacccggc     19260
     caacggctcc aaacttggga aacccttatc tcatcaggat tcccctacat ccttgaccag     19320
     tcccaacccg gtactgggaa aagctacgac tctgggaatg tcaccccgat tggctttggg     19380
     atggagcagg ttatctatct ttcagaccag caccgaaacc ccaccgtatc aactttagaa     19440
     caaggaaatg gctggtgtga cctagaagca cggcatggag gactaaaccg agtcaagaat     19500
     cgactccaac gatctgccaa aggggatgcc ttcgctgttc ctgctaactg tagtcgcatt     19560
     ggtgtcttga atgccttacg ggacaagaat atccctggtg cagataccgc caatctcatc     19620
     tgtggtactt gcattgctcg ggaagcttgc atcaatgcca atgggccagg gtatggcttt     19680
     ttgaaccaac gtcgcaatgt cttaggtgcg ccgctattga gggcacatcc tgactccctg     19740
     ccagacccag aggattaccc cctggaaaac accatgctga tctgggatga accgggtcag     19800
     aacttccagg tcaagcagtc cacaactgtc acactcaccg atctacagca aaccatctca     19860
     gcattgatta cctaccccga gatctttgcc ctggtgcagc ccttactctc agcactgctg     19920
     cccttaatgg atggctctat gaagctaggg aaatatggcc tgaatcatct agctctcaaa     19980
     agccgtttgc ccgatatggc aggagtgaag ctgggggaaa tcgctctaat tctgatgcca     20040
     aacctgggat tcctcaatac cacttccgac tatgggattg acctcgcaga tttacccaag     20100
     caactcagaa agaagttcac tgagcgagat tctgagatgg cagagcaagc gaggaacggt     20160
     gtggtcaagc agtggcttat tcccctgatc cgcatcctgc aagggggagc aggatgtatc     20220
     caagtcagtc gctatggcct tctgaccctg aataccccaa atcctcgcca tcgagattta     20280
     gcccaagctg cccaagccaa tgtatttctc gatgccactc tatcccgtga agatttagcg     20340
     ctgaagctgg gttgctctcc tgatgaaatc ctagtagtcc gtcaagccat cccagacacc     20400
     ggaaacctgg aggtgattca ggtgaaggac atggggcgag tgggcatgag tcgaggaggg     20460
     gatcaactga aacgcattgg ggcattggcc cagcattacc aagatttgga tgcagcgaat     20520
     acccgaacga ttgattttaa gaaatttgaa aaggatgggg cctggtggcg agatagccga     20580
     ggggtcaatg atttcctcac cgtccagact ctagtccttg tcggcactcc ctgccgcaat     20640
     ctcaatgact tggctgctga attcgccatt gtctgtggat attatccaga agacgataac     20700
     ccagcgttca cggcatttat tgaccgctct atcctcgcag aaattcacca agccattggg     20760
     cgactgaggg cgcatcggcg tccgaatgaa tccctacaag tggtactgat ttccaatatt     20820
     gagatggact gcttcgttca ggaagtccaa gctaaggatc tgacgattga agcagcccac     20880
     aaaacggagc gagtagaaat cgccattgag tcagccattc tccaactcca agccaaaggc     20940
     gagaaggtca ctcagcaaat cgtttcagca atgacccaaa tccccagagg gacgattgcg     21000
     cgatactggc gtctgttcat ttcgctatta gaaagtttaa atagcagaat gaacaattca     21060
     agcaacgcgc caaatccaga ccaagaaacc catcaagcga ttgcgggtgt tttggatgag     21120
     ttagcggatc tgcccgtcaa cgatctacta ccaagcctga atgaagtatt ctttgactgg     21180
     cttaaaccca aggaatggag ttcggtatgg agtgaagtca gcgcatcgag ccagatggcg     21240
     attctggaag ggttagcaat gacgttacct gcaaagatgc tggagagagg aatgccagag     21300
     ctggcggcat gagggtgctg tttgctatca gttgatatca aacagcagta gatcctgaag     21360
     cttcattatt attttaaaaa ttggatattc agccgtttat ttttatggcc tttctacatg     21420
     gaatctacgc tcctttttga gtcgttagag ctacctttta tgtagcagca atggttttag     21480
     ttcttgcatt ccgtttaggt acatatcttt tgaaagtcac tcatagaagt gcttttagag     21540
     tttgcagcgc agcgattctt gttgaaaata ctcgcaattg taaccgattg tatcttttgc     21600
     tttgacgtgc ttcctttgtt ggcgctaaag tacacgcagg tcaatcaatc gactattcct     21660
     tcacctaagt ttttcaatta agtacttcta ctagcgctca agaaaacagc aaaggtctag     21720
     cctttgctag agttcatttt aaaagccaat cctaacggga attcctagta aggttcctgc     21780
     aatgtttcat atagtcagac cccgatctac gtttaaacga caaccacggt ctgccaagtt     21840
     gcaccgagtc agaccgtgat ctactcccct acaaaggaga tgatttcatg ctaactgtta     21900
     atactcaaaa ggtcactgct actccagtgt ctgatctcac tgctatgtct ccagacgagg     21960
     caacagaagt ctatcagcag cagtatcgcg agacttatgt tgacctagcg atccaagcgc     22020
     aagagcattt ggggttgcca gtattgaaaa cctttggaga actctttcaa ttgggttgca     22080
     ccgatccaga actcagtaac tccatagatc aagaaattgc ccacaaccca atactcactg     22140
     actggccgat gcaggattct gactgtatcg gcctaatttc gcagggtcca tacgtccagt     22200
     ctcaaatcaa ctttcatggt gttccagtgc gggatgtcat ggagtacgtc tgcgatctgt     22260
     tccgtgaaac gcctgaacct aatgcagctc tagatgatgt cgcagcataa gtttgtgact     22320
     tctcccgtgg ctgatcaaca aggcatccat gtagaccctc aacccagttc tggcagtact     22380
     tacacggatt ttctcaatac tctccatcta ctgggagtga gtgtctgttt cgatgcctca     22440
     aaaagcaaat tcaacctttt ggagctgtcc gataatcgct agaaccgggt atctcctcaa     22500
     cctcttaaag ccccttctca ttcactccac atcttcactc ggagtaagaa ccatgaacaa     22560
     aggcactgga cttcgaccac cacccgacat catcgccact atggcgcgat accctgacct     22620
     atctccagag cgagaagctg aactgatcat taaagctcag aacggggatt acgaagctag     22680
     gcaaaccgtg atttactcta atcttgcctg gatttgttct aggggagggc aattttcccg     22740
     aaaagggata gatgacggtg agttgatcaa cgaagggtat tggggattaa accgggcgat     22800
     tgatcaatgg gatcctacca aaggtgccaa tttacgcacc tatagcgaaa gaaagatcta     22860
     taagtttcaa tctgaagcta tccgtcaaaa aaatcatatc cgactgccca aatcaaccta     22920
     tgagcagctt tctaagttga agaaagcaac tgaatccttg ggtgaggatg ccactgttgc     22980
     ccagctagca gaagaaaccg agattaaaga gaagcgaatc aggaaattac aagagatatc     23040
     tcagcccgtt tccctgaata gtgtcacggg ggagcgagag aaccttgagc tactggatca     23100
     gcaagcggat gattccctag gaagcctaga tcccgctctc tcatcagaac tattggattt     23160
     agtggacaag ctacacccac gccagcggga aatattgcac ctgtatcact gggaggaact     23220
     gtcttttcaa aagatcagtg attatctggg tctacccgca aaacaggtgc ggaaactcta     23280
     caagaaagct ttggatcttc tgcggaagtt ccttcaaggt gagattaacg aattcccacc     23340
     tctccccttg ctagaatggc gcaattttat ctttgccaaa ttctttcttg caactggatt     23400
     atcccaaata ttcaatatcg ttgttgccaa actaaaacgc ctgaagcgtc tccatcggaa     23460
     taaccacatt gcaaccgtcc aatcgcaact gaccgtatct caaagcacta cagaggtatt     23520
     gccagcatca ggtcctgaat gtgccattca agcaccagca gaaccctcaa ctcaatactc     23580
     tgcttggtat gagaggctat ggcaattcgt gaatcgtgat aaacccactc attcacgagt     23640
     aaatactcat cagattgatt caggaggatt aagggatggt ccgaaatatc ttgtggacac     23700
     tttttggcat ggccttaact gtattgctca attcctgggg tattggcccg gatcgcctcg     23760
     cggaagtgat caataccgat gccgcagcgg agatcgctgg agatgtcggg gacaaactga     23820
     aggacgttac tcaaaaaaga aagtaatacg gatagttggg aatccaactt tttaggatga     23880
     attttgccca ttagtaaata gagatccaca gctaaaaata gagtatttga actcgattaa     23940
     gcctttttta agggattcaa tatctcttgt ctaagtgact tataaaaggc gcttagggtg     24000
     gatatttatt ggattgtgct ttagattcgt gcgcttttct aggcttattc aattcttttg     24060
     attttttgac tttttgttga ctgttgttca ccgtttattc tgagtaagtg acatgtacaa     24120
     acatattcct catgcgatcc ccatcgcttt atgtctggct gcagtaccag ggattgccca     24180
     ggctcaagac tttccaacca ttgaagttgc tccaaggcat gggcacactt tttacttcaa     24240
     gaatgaagag gctgttgttg tcgaagcatg gcctggagcc tttgatgcgt ttgattttgg     24300
     agaacggcca aagattccca gtgcgaggtt tatttttgtc aatctcaagc caaaaggcaa     24360
     tatcgatagc acgacgttaa ccgtggtcta tcgggttggc actaaggaaa aaacaaagac     24420
     attcctcctg aaaaagacca aaggtattcc gagtcggttt agtactgcta ttgatggggc     24480
     acctcctctt gctgcccaac cgcagcccgt tcaacccatt acggttacaa atgtatttac     24540
     tcctcctccc aagcctgtta agcagataca taaagagaag aaagctaaaa agcctagaaa     24600
     attaaaggta tccaaagaat tcagtagccc cttctcatca ggatttgcgt catccaattc     24660
     agtagcgcaa cctcccgcta gtaaagagac tcaacaacct gaacctgaag aaactgaaga     24720
     gactgacgta cccgattcag ttgagccaaa gactgaagag aaggctgaaa caccccagtc     24780
     tgaaccatta cccctgatcc gcgcacccaa gacgctccag gccaaagcga cgattgagac     24840
     gccgactgag aagcaactga tcgcgcgctc tagtctggac aactttggaa ttgcccgcta     24900
     tctcctgcga gggttgtacc aggctgaacg gctgaatcaa atcaacaccc acacacccca     24960
     atttggacaa gctcaagaca ccgctatctg gctcagacga gggcgcagca ttgaagaagc     25020
     gctagagcta tcgggcttac cgcccgtgac tttcaataat cttttgggac atggaggcgt     25080
     gggtaaatga tcaagcctct aatactcctg tcactccttg ggcagctcaa tgtagctcct     25140
     tccatcggag agggcaacat tgcccctgcc attggagagc aacccaagcc cgttgaaaca     25200
     gagccagtcg ttaccgagct aaaacctgaa cctgctgccg tacagacaga tgttccattg     25260
     gagacagcca ctgctccccc cgtgcctatc gatatacccg ttccagagcc attagcagaa     25320
     gaatcagcgg ttctagctcc acctttagag cagcctgaat ccacattaga ggatcaccat     25380
     caaccctatg gagaaatacc ttcgacgcct ctgcaacctc cttatcagtc ccctttacct     25440
     acaccagcac cgcaacctca gacatctgtt ccccctaagc caaggcaaca gattcagccc     25500
     tcttccggtg ttgcctatcg ccagcccacg gcacccgtgc ccacaaccat tgtagaaacc     25560
     ataggctatc ccctgacctc aacatttgcc gttaccagtg catttggctg gagagaacat     25620
     ccggtccagg gtaataccag tttccacgct ggcattgacc taggtgcacc ccacggcacc     25680
     cccaccttga ccatgctcag tggacgggtt atacatgccg actgggaagg gggctatgga     25740
     aaatccgtgg tgattgagca tcccggtacg gggctgaaga cgcgatacgc tcacctctcc     25800
     aagattcatg ttcagcccgg tcaatgggtg gatcaggggt ggcatatcgg ggatagcggg     25860
     gcaacgggat tagtcacagg cccccatgct catatcgaaa tgattatgaa cggtcagcct     25920
     gtagatccct ggccctatct ggctcaggcc agccgtcaag ccgttcttat taatcgcctt     25980
     cacccgtggg ctgggtaagt tttttcgttt attccactca gaggttcaac tcatgcaatt     26040
     tcacaaccta aaatctctgc caaccgcctt gtcagagcaa ctagacaacg atgtaaaggc     26100
     aaatcgcaag caatatttaa ctcgttatct tccggtctcg acagcactag ctgttgcttc     26160
     agttccaatg catctgaaag caaagtcttt taactcaact catttaacag tggaaagcgg     26220
     cttattcttg ctggcttctg cattagtaat gctccttttt attggcaata cgggggtgat     26280
     tgcttttagt ctctggacga ctcgaccggg tgtaaaggca gaaaaataac catttgccat     26340
     cccgtctcac cctggtctgg gtaagtttcc accagtagcc aatacttgga ggcttccgtg     26400
     aaaaacgaaa cagcccttag tcaccgcatt aaacgcctca ccaacgcttg ttactatatg     26460
     tcgctcgtgt ctggggtcac tatctacttc atgtttgacc gcttagattt gctttcaatc     26520
     ctgcttaaaa gcggactgac cctagcaacg gtttacgtga tttatctgcg gagtgcagca     26580
     gtcaaagcca agcggtctag ccgctaattc ccaatcattc aacaccgcga aacacacaga     26640
     ggattttccc aatgcaaccg attcaatcgg cttcccaaag ccaactcaaa cgatttttcc     26700
     acgaatacaa ataccttctg atcatgattg caggcttagc aattgcctgc attgctgaac     26760
     ctgctgctgc tcaatgctta ggttggttat gtgggcctaa aaatgccatc accaacaatg     26820
     gggtcatcaa tggtaataac agtgccacgg tttttatcga attcattttc ctggcgatcc     26880
     aagttctaat tcttgtgggt ctgggtggac tcgccgttgt cttcttcttc aagatggacc     26940
     gcgatgagaa ctatgtgaag cctctggttg ctctactagt agcgctttta cttatttttg     27000
     gtacgaactt tgttgcgggc tatatcgtgg gggatggcaa taatgccggg acgagtgcga     27060
     gtgggaacaa caatggtgcg aacaccaccc aaagccaacc cgttcggggc gctacaacgg     27120
     tgttcaatta agggggctaa tccatgtcag atggtgatcg tattacttat acccccgttc     27180
     tggataagaa accatccatt tggatgatcc ctcaagccac ctttatcgtc ggtggggtat     27240
     ccggggtttc cctactcgtg ctgtacatga tgctggcaac gatccaccag gcaccgcctt     27300
     ggtggattcc gactgcgtta tgggtatcga tctgctccgt gtactgggcg ctgttagggg     27360
     ataccccctg gaaggttcag gggcagctcc ataggcgaat gccaagagag aataagcatt     27420
     ctacggctgt acgtcaaccc gtcaacaccc tgaagccgaa gctcaagacc cgcagagttg     27480
     gccccaagtc agctcggcgc aaagtcaagc ccgctgaaga ggatgttgat attgcggcca     27540
     tcctgatctt tgagattgac ggtctaacgg taggggccgc tctcttgcag cgcaacaacc     27600
     gtctacaagt ggtgtggttc ttctattcaa acgggattcc gtcttctacg accgtcaccc     27660
     aggcccgtgt aatcggtgaa cggattcagg aagggtttcg ggatttgagg aatggggaac     27720
     ccctaaccat gcatatgggt tccttctcgg attgctccaa acgggtggca gaactgaacc     27780
     gtatggggga ggaagccccc ctagaggaaa gcacattctt gttgtcgtgg atgcgaaagc     27840
     gggtcaaagc ccttaagcgc ttgggacggt acaatcccaa gtttttgcgg ttttatatcg     27900
     cccatgattt gggggcattt ggacagcaca aggactggtt ttccggtctg atgcagacca     27960
     ttgaggatca ggtgcaaacc ctgacgggtc aaaagtctcc tctgaaggat cggttgcaca     28020
     gcatgttggt ggaagccttt gaagattcct tctatcagaa tcagaatttt tttagaacct     28080
     gtggcatccc cgtcacccca gcatccgcag atcaagtctg ggaatggatt taccgtcagt     28140
     ttaatgatga tacggtgcct cccatccctc aagtgattac gattacacgg gacgggctga     28200
     aggctcagca gtatgaccgt agatccatct cctccgtgct gctcaagcac tgcccagatt     28260
     acggcaaaaa atgtgtgtgg ctccctggcc gcaagaagtt cgctgggggt gtgatcctag     28320
     aaggtcggcc taaccgttcc tatgatccta tcgaggggcg gttagatcag ctcctagacg     28380
     ccagctctcc gattctggga gataagaacc agaagacgag caacaactcc ctccatgatt     28440
     tagaaattgt ggtcaccttt accgcagagc atcaaaaagg cgtcttgcag gagtcccaga     28500
     agaaaactgg gcagtctaat caatccttaa ggatggtgga agagaacaag cgcttggatg     28560
     ggggagcact ctacaacacc agggaatccc tggacgctga gatgaagcta cgcgacgggt     28620
     gtcataccac tcgtgttggc ttaatgatca ttgcctatcg ggacaagaaa cggcagttgg     28680
     accgggcact ggagaatatt gcagctctac ctattttctc cgggggcaag gtggtccggg     28740
     aaacgggcta ctttgattcc ctgtttctag aagccttacc gatcacaatg gaatccttgc     28800
     tatcggggga tccaaagaag ctcacggaac ggtttgatcg gcggatccga gaaaccaccg     28860
     ctgctgccgt gggcttgatg cccttgatcc tagacagtcg tcctgatctg cacggggttg     28920
     agtttgtctc tcgcagtggg tcacccctgc tcgtggaccc aatgggccga ttcccccaca     28980
     accacatgat tgttgtggcg aggactagag cgggtaagac cgtcctggtg atgcagtttg     29040
     cgtccaatgt actggtgcgt ccgaaccatc aggtgatcat cattgatgca ggccgagagg     29100
     acggctctgg ctcctacgat gaattcacga cgttcatgga ttgctctcac ttcagagcag     29160
     gggaagattc ctacaatatc tttcaaatcc cggatcaggc ccagctctcg gctgagaagt     29220
     ttgaaaaagc gtttatcacc tatcaaaaat tcatcctgtc cgccctggtt accctgacca     29280
     cctccgctga tgatgctgca cggttaatca gctactacga ggatatcttg acgaacttga     29340
     ttgcagcttt cttggctgat gggtccattc aggagaagta tcagcaagcc tacaaggatg     29400
     gatttgggtc agaagcatgg cagcaaatgc cctgtctaac aacctttgta gagtttatga     29460
     gcctgtcccg actccccgct gaattgcaga atgaggatgc agagaaggcc atccagcgca     29520
     tgagaatgag cttgattgct ctgatgcaac gccagtcagg ccaagcccta tcccgtccct     29580
     ccacctttag aacggataag cccctggtgg tctatgcctt gggtggggtg cagaaaaacg     29640
     ccgatatggt ccctgcccta ttagcagcca gcgcatccat gctggcccaa acctttagcc     29700
     gcaaaaagac ctatgtggtg gcagaagaag ccacccacct gtggcaattc cccagctacc     29760
     gaacaattgt gacggaatgg ttcacaggta aggccaagag cggagtttgg gtttgttggg     29820
     tgggtcaatc cctcaagatt ctcctccagc ataaagaggc aaacagcgtc ctcgaaaacg     29880
     tgggtacaac cctagtgggc tgggtcaaag aggctgcatt gaagcccctg aaagaggcag     29940
     gcttagaccc tgaattggtt caaccgtgta ttggctccga tttcaaccct ccccgagatt     30000
     gcaataactg tgaatatgcc acgaactggc tgattgaaac ggacggtaaa taccatgtgg     30060
     gcctgaatta caacgatttt gcctctctgg gtatcaccat gaacgaccta gagaaggtga     30120
     ttttgcggga ggaaatctac agccagatca actccgacaa caagtatgag cgggtggcag     30180
     gcgttgctag ctacctggaa gaaacctcta tcgacaaaca aggacttaag tcatgagaaa     30240
     catcattact ggactgacag ctatcaccct gatagcagcc tcttccctcc ccaccctcgc     30300
     ccagaatgct gcatcgggag agagtgatta ctggcgcaca accgatgtgg attacagcgt     30360
     ctttaagaag gatcagccca tcaacaataa ggggctgttt gaggtagata agaaaacggg     30420
     taaacagact caactgtcta aggactttca gaaaggggtt gaaatctacc agcaggctaa     30480
     gcccgtgatc gatctcgtgg gtggaatttt tggcttgggg ggtagcttgg gttttctcaa     30540
     gcacattgac aacaacctgg agtatggcga gtggctattt ggcaaggtgc ccagagagca     30600
     gcaggcgcag gagcaacagg cgcaaggcac agaggccaac ggggcaccgc tgggagatgt     30660
     ctatggggtt gatggcaaag ttgacccgac caaggcgcga gagcaggcat tatcgacgat     30720
     tgaggccaat gcggacatca aggccgattc tccctttggg gtgagtcgca ccatgtacaa     30780
     gctcttggtg ggtgatctgg cggttacccg tgcggcccgg aaaaaccttg agctgatgtt     30840
     tggtgaagcg ggtcaacagt ttgccaagga agcacgagag tactcagcca atgtggtcaa     30900
     aacgtcaggg cagatggtgg atcaggctct tgaagcgaaa tctactcaag atgtcaataa     30960
     aatccgtgcc cagattgcgg ccaacggaca gctcctcgat caggtgcagt ttgccgagca     31020
     gcagcaaacc cgcttctcgg tggatcgggt caatgatgcg gtcttgaccc agttggagct     31080
     aaagcagcag gagaagtggg acaaagagca agatgaagcc tcagccgata ttggcttggc     31140
     tcaagtccgt cagcttactt tctcgatgct gcatccgagt gggtccgagt caggtccaag     31200
     taaccaagca gccaaagttt cagctcaaca gaaccctagc tttattcgaa aatgatgttt     31260
     tctttagatg caatcctgat tgctgggatt aactttgata gccctcaaga tattatcaac     31320
     aacaccaaag agatttcagc ggagattgat aaggctctgt cagtgctgtg gggctttttg     31380
     gggtcgaagt tgtttattga aatatccaat gttgcggcga ttattgcagc gttaggcgtg     31440
     ggcttctggg ccatcaaatg gattaaggag gttgccaaat cggacgagtt cttttatcca     31500
     gacaaaattc cgcaaatggc ctttggcttg atgttagcag tcttgttggg cgcaccaacc     31560
     gagcggggca agctcttgac ggatgtcttg atttcctatg accgttttac aacaaatctc     31620
     tccaatattg tcctagttgc cgcccgaccc aaccctgaaa aggatcccgt cgccagtgct     31680
     caggtttccc aggcggttcg tgaccgagcg gctcaagatg ccaagaagtg cgagaagttg     31740
     ggtctattaa cccaggctcg gtttgattgt gtagatgaag ccattgagcg agtctccacc     31800
     tccttagaac cctataagga ggagtgggca tcgaaacttc atcgtgagct gacttctgca     31860
     ctgggtctct tgaatgaccg tgctatcggt gaagccgcta aagagaatat caaaagggat     31920
     ttcactttat ttgccgggga tgcgctgaac aaggtgttga ttttcgttat gtttggcctg     31980
     acggttgcat ttttggtcct acttagggtg gcaaagccgt taatctccat tgtgtttccc     32040
     ctctatatcg gcttgagtta tgtgcccagc tcgaaaccgc ccgtgctctg ggccattggc     32100
     atgttgattg acatcgtgct cattgaaatc attttcaaaa ttttcttatc catgatcgct     32160
     caattggccc tgacgctccc cttgcagatc gacacgttga cattgggtct actgattgtt     32220
     tttggtggaa ttccattcag cattattcta ggtcggcgtt tgtcagatgg tctgacgggg     32280
     gcaggggtga gtgcatttcc tggtttaagt cggaggttca gatgaaggtt aatgtttttg     32340
     ataaagctgt cgctagtcct cggcagatcc gtcccaaggc tgtttggtta ggaattatcc     32400
     tgattattct ggctactgta gccctatcct atggactgat taatttacga atatcgtcag     32460
     tggagggcag gctcgatcag ctagccaatc gcccgattgt ggttcagttt ggcaagaatg     32520
     cagaactggt taaagttgaa cccgttaccc cttctgagaa tgttgaagaa tttgtgcaag     32580
     aagttcttcc ccctatgttc gcctggtcta agaaggttct ccctgaagtc catcccactg     32640
     gtattgatcc aggtcgagat acgaagtatg gcaagctgcc aaccttgatt ttctactaca     32700
     ccaacgctct ggaaattaga tacagaaacg ttttcaggaa aaatattgcc aattacaagc     32760
     ctgacaaatt tgagcagggt gaggcaacgt tactcaggat tgagcgattg gtgaaacctc     32820
     gccaaaccga ggaagggtgg gaggttgatg tgtacgccga tctaatcacc ctggatgtcg     32880
     atgacgtggc ttacatgtct gaaccattca acagcacgat ccacattaaa gaaatattac     32940
     cccccaagca caatgcatca tttaccccca tcgaggaggc attcgttgcc gtgcttaaac     33000
     gagggctgat catcacacga attgcaaagt tggaggctta agcgatgtcc accgcattaa     33060
     acaaatggca agatctgacg ggtgatgtcg atgatccgtt ggatgagatc gttgaagaag     33120
     cggatgacga cagcgatgag gattacagcg ttgtcaccaa gcacaccctg gcaacgaacc     33180
     ccatgattaa gttgtgcatc tggggtggtg gcattttggt ggtcttgctg ggcatttttg     33240
     gcatcttctt aggtgtgacg gctaatggtg gcaataccgc taataatcaa cagcaacagc     33300
     aacaggccgc agtcccaccg aacgctcaga cagggctatc caaaagtgac caaaagattg     33360
     ttgaggatct gttggagcga gaaaccttta atcgccagca aaagcgtcag caggttctca     33420
     atgggaaaaa gcagcaggga aaaccaaaag ggaatcaacg gcctgcctcc gtttcaccgc     33480
     aaaacaccgt atctgctcca cgggtcatct atcgggcaag gcccatacaa cagcgctctc     33540
     atgcctctta tcagcaggat aggaatagac agtttttggt gcaacgtccg gttgcagttc     33600
     aacccataga gcagccgatt gatgatccta atgctggatt ctttactgcc cctgtcgctg     33660
     cttctagctc ccccgctaga acgggcaagc gcaagctgct gaagctttcc aaatctgatg     33720
     aatttaagtc gaataaatcg ccaataaaac ggtttactcc tccggtccag gttgctagta     33780
     ctgctcagac tattccccag cccagtaaac agtttggaaa tctttctggt aacctccaaa     33840
     atccatatat gaatcagatt gtggcaacgg ctagccaagc ggtgattcct gtggatacgg     33900
     ccattagcgc tcaagtggtc aaccgagtct catggatacc agaaaatcca ggtttagcaa     33960
     aggggaaggt cgtgcgctta aagcttcagg atgatctgaa ggatggcgca ggggatgtcg     34020
     ttgcgagtcg aggcaccatt gcccttggta ttgtcaccca ggccacagag caagggttga     34080
     tttcagtgaa tctcaccaag attggatcta agtttgttca gtcaggagcc gttgaaatcc     34140
     atcaagacgg agatccgacg atgattgcca aactggagac gaagggaggg aataacggtt     34200
     ttatcaagac ggctctggat attggtattg gtggggtcca gacctgggca agtaacctca     34260
     ataatcccac gagtcaaacc gcgatcagta atggtaatca gacgttcctt tccacgaaca     34320
     acaacaatcg caataacact gctgcatttg tggaaggggc tacagggcgg attggggaac     34380
     gtcttagaca gtctgttaat ggcccaacgc aaaccaaaat tggtgtgttt cggtttggcg     34440
     gtaaaaaagt acagctctat ttcgtgcgag aggtgcgtct gtgaaccaat tgatagttgc     34500
     gctgttattc ctggtgagct ggtcaacggt cgcctcagca cagcaagtga gagagttgaa     34560
     cctcaaagga acaaccaata tgcggcccat tgccgttgat ccatccgggg tgattgtcca     34620
     cctcaacaat ggcgacaaga tacagggttt gagtctccag ccaccgaatc aaattgagct     34680
     gtatccattg gatggtcagc tctgctctgg agtgaaacag tgccaaggtc aggctccttc     34740
     catgctgcaa ttgacgaggg ttaaacccaa aaatattaag gggaagatat caaattctga     34800
     tggctcctcg atgttggtga ttgtgacgaa ctctggagcc aagcatgttc tgtttgtggt     34860
     gcctacgagt cgggccaagt atcaagtcgt caatattcag taattttttg caaatgaaga     34920
     aataaaaagt aaataactta tccataaaga atagagaaca ttaacttgtt ctaaagccga     34980
     ttaatcaaga ttattgaggt aaatatgata tagttcgcaa atactaatag tgcgatggtt     35040
     ttattgcacc cgtatcccga tctagcctga aattttaggg ttcctagaag gatattcaat     35100
     gaaaaaacag ttttacagta atcttttact tgatctttgg attgccgttt gtggttacga     35160
     ttacaggata tttttacatt gaattaaagc atgttgggcc accgactctc gaacaatcac     35220
     gggtgcagta tccgacatgt gatcagcgcc agaggttcgt gacggtctgt gtgaaagtaa     35280
     gcaactagtt taggtgaatg gtggcagcga aataaagctg gagttgagga cattttagaa     35340
     gatcaagata agtgggtact tgcgtaaatg acatatagat ataaagaaga taagccagaa     35400
     aattggattg atagggagca tgaactacct gaagataata ctttatggaa gcaatatgaa     35460
     atctatattg atatttttaa gttctatttg gacaccactt ggaaagtagt aacttggttt     35520
     tacgcaatta ctggtgcaat tctcgtctat tatttcgacc atgcagataa caataatcct     35580
     tatcttagat attctttagt gctaccagca cttttgagta ttggattctt tattattttt     35640
     ggaaaaggtg ctcaaaaaaa taagaaactt aatgaatggc ttgattatat tcgatcagaa     35700
     ctaggtattc ctggtagacc tcatacggaa atacttttaa tattcttaga gcaaagcagg     35760
     aacttatttg ctgctgtctt tttaggttta acaattttat ttgtttctag cttcttctgg     35820
     taatcatgtt agtatgctac ttcgttagat taatcgagtt caaaagaatc tatcttgcag     35880
     tactattgca agcttttttt ggaagcagat gagatcctca tgttgtatag ctttaacaat     35940
     gtctatcttt atctaaaatt gctatgtaag tgatgctctg ttttagatat tgattggact     36000
     tttctaatct ttactagcat caattccagt cgttttttcg tatttgaggg aggtatatag     36060
     cttctgagta taatcaacca aaagtgtcca atacatcgct atttgcacag atgtacaaaa     36120
     ttagtgctca gcctataaaa cgctgaatct attgctgtta agtagttttc ggtaattctt     36180
     tctctgattt tctattcaac agatgtaaat aattagatgc atcgatgcca ttaatttggg     36240
     ttgagcaatg tacagcatta tttgcacacc tatcaacgcc aattgttaga tccatgactc     36300
     cagaacggaa taactgaatc tcaaatcaag ctgaagactc gtgtaatttc atggcttacc     36360
     ccagataatt taacgatatc tgccataaaa acagccatga ctgaatctgt aaccctaaca     36420
     gccacagtaa ttgctaatct tgcctttcaa gaattcctaa aaaccagtgc tggtgaagca     36480
     gcaaaacagt tcactgctga tgccctttcc ttgatgggga aactccgtca gaagatttgg     36540
     gataggctac gcggtaaaca tggcgcagca gaacaggcat taacccaggc agagacaggt     36600
     gatcagaaag caattgaaac tgttgctact ctgctagatg tggaaatgct agatgaaact     36660
     tttgctggag aactacgaca gatagcccaa gaaatcaata ttcatatcag caaggacaac     36720
     gacacccaag ttcaaaataa ctacggtgga accaacttcc aaaacagtat ttcaggtgga     36780
     gaagtctatc aaggcgataa catcaccatc aataagacca tttgactaga gtcgcctgac     36840
     caggaccggg caaagttaaa tcctcctatt ggcattccct ctaaccttcc ccgaagtggg     36900
     gttaaggagt ttgttggtcg taaccaaaaa cttcaagacc tccatgagca attacaaaac     36960
     agccaacgta ttgcaattac agctatagct gggatggggg gcattggcaa aacagagctg     37020
     gcattgcaat acgccatagc tcaattagaa caggagcaat accccggagg aatttgttgg     37080
     ctaagagcca ggggccaaga gatagcaacc cagatagtga cctttgctca gactaaactg     37140
     ggtcttactt tccctgatgg attagatgaa aaagggcagg tcgattattg ttggggacat     37200
     tggcgagagg gagatgtact ggttgttctc gatgatgtaa ctgagtttga tgcagttgaa     37260
     ccctatctgc ctccctcaga tcctaagttc aaagtattgc tgacaactcg tttgaactta     37320
     ggcagctctg tgcagtcact gtccattgaa gaactagatg aggagagtgc attggctcta     37380
     cttgaaacgc tagtgggacc agaccggatt caatcacaat tggaggatgc taaaacctta     37440
     tgtggttggg tcggtaactt accgttagga ctagagctgt tgggacggtt tctagcgaga     37500
     aaattagact ggtcctttga aaaattgatt gggcgtcttg agtccaagaa attagcagcg     37560
     aaagctctta taaccaaaga atcaggaatg acggctcagt taggggtagc tgctgcattg     37620
     gagttaagct gggtagatct aagtgaggca gaacaagaac ttgcctgttt attaggcgtg     37680
     tttgcagttg ctccgattcc ttggcatctg gttgaagaat gtctatctga tcgggataaa     37740
     gacgatctgg aggacattag ggatgaaggt ttaagagata aaaatttact caaacgagtt     37800
     gaagagagaa cctaccaact ccatcaaatt gtgaaggagt tctttcggat taagttgcaa     37860
     gaatcttctg gtaatgggga gtcgctgaag cagtcatttt gtaaagcaat ggtgggaatt     37920
     gctcagggta ttggaaacaa tccaacgatt gatgtaattg cagggatgag tgccagcatt     37980
     ccccatctag aggaacttgt cagacaatgg atagacattc tgagtgatga tgacttaacc     38040
     tggccctatg tcggcatcgg tcgattttat gaagggcaag ggaactatgg attagctctg     38100
     cctttgtatc aagaatgcct ggaacagaca aaaaaaagat tcgacagcga acacccctct     38160
     gtcgctcaaa gcctcaataa cctggcatta ctctacgaca accaaggacg gtacacagaa     38220
     gcagaacccc tctatgtcca agccttggag atgagacaga atctcttggg taccgaacac     38280
     cccgatgccg caacgagcct caataacctg gcagtactct actacgacca agggcggtac     38340
     acagaagccg aaccgctcta tttgcaagcc ttggagatga gaaagaagct cttgggcagc     38400
     gaacaccccg gtgtcgctct tagcctcaat aacctggcag cactctacac aaaccaaggg     38460
     cggtacacag aagccgaacc gctctatttg caagccttgg agatgagaaa gaagcttttg     38520
     ggcagcgaac accccgatgt cgcaactagc ctcaataacc tggcagcact ctacacaaac     38580
     caagggtggt acacagaagc cgaacccctc tatttgcaag ccttggagat gcaaaagaag     38640
     ctcttgggca gcgaacaccc cgatgtcgct caaagcctca ataacctggc agcactctac     38700
     gacaaccaag ggcggtacac agaagccgaa ccgctctatg tgcaagcctt ggagatgaga     38760
     aagaagctct tgggcagcga acaccccggt gtcgctctta gcctcaataa cctggcagca     38820
     ctctacacaa accaagggcg gtacacagaa gccgaaccgc tctatgtgca agccttggag     38880
     atgagaaaga agctcttggg cagcgaacac cccgatgtcg ctcaaagcct caataacctg     38940
     gcagcactct acgacaacca agggcggtac agcgaggcag aacccctcta tttgcaagcc     39000
     ttggagattt accagaagct cttgggcgat gaacacccaa acacagttaa agttcagagt     39060
     aattttgacg attgccgccg aagaataaag gagtcgaata cttagctatt tgttgattaa     39120
     tagctttagg tgtgcagtaa ttatgtataa tcggcatttt taaatttatt caattgccaa     39180
     aaattgaaac ccagtaaaat cgtcaatctg agcactaatt ttgtacatct gtgcaaatag     39240
     cgatgtactg tacaaaaagc tttcatgtcc attatttctt taaacgcaca agaatgagcg     39300
     atttatagaa ttagctgcac aactttgaat cgctacaaac taaattcaga ggctgatctg     39360
     ctgatttata ggcaatgata ctcaagaagt ggaattaaag ttttagctgc actttttctg     39420
     agaaaaaaat aaattcttta aggaattagt tgcattattt cttccaatca gtcgattctc     39480
     tattggtctg aatctcaaat ttcgttgaag ggtcgcgtaa atttatagct ttgcccagat     39540
     aatttaacga tgtctgccaa aaaaagccat gactgaacct attaccttgt cagccgcagt     39600
     aatcgctaat cttgcctttc aagaaatcct aaaatctagt gcaggtgagg ttacaaaaaa     39660
     gttcactgct gatgcaatag ctaagatgag cgagcttcgt caaaagattt gggccagact     39720
     aaggggtaag tctcaaaaag ttgatgatgc tttaaagaat actgagcaag gagattcttc     39780
     agctctatca actattgcca agaatttaga tgtagtgatg gatgaggacg ctgagtttgc     39840
     atctcaagtt caggccatag ctcaaactat caatgctggc aaaattcttg accagagcaa     39900
     tatgacacag aatctttcag ataatgccaa gggttggcag accaaagtgg aagggggagt     39960
     ggcgtatatt ggagaaattc atcagcagtt tactggagat ccaatactta aatacgagcc     40020
     tccaaccatc aattctataa gaggctttca taacggcatg cagtctttgg ttttggaaga     40080
     cattggaaat gtacccgtta caataactaa ggaaaaacac gaaggaatta atggtgaatg     40140
     tgattacaca attgaatttg agatttttaa taaaagtaga gcggatctga aaataaaagc     40200
     catacttgtc gaagtcttgt ctgtagaacc gattgaatcg atcattgact acataccctt     40260
     atgtgggttg ggtgaagctc gactgtattc ttgccgagtt gatggacgac caggaatata     40320
     tcgatcgaac ttgttagaaa gtacatttag tggatatata tttcttcaga gcggtgagca     40380
     agaaactatc caaattgcta ttaataccaa ggatgaaggg aaatacacgc tacgttcttt     40440
     attggaatta tcaagtgttg atggactgaa gacaatatca gttggtgagt ttaacaatgt     40500
     acgatttctc aaactttcga gataggctcg atcatgagaa tgctttagcg acaagaatag     40560
     aataaaaact atagcgcgca ggtgcatcaa agtatctgtg aaaaatgaag gtccagtttc     40620
     actactttcc agtgcccatg tgtttcacaa atgttcgtgt tcacatgcaa gtagttgtcc     40680
     gcttctactc ggacttgtct gagtgtggtg gtaaggtcgc accttatgcc gggagcaatg     40740
     ttcttaaact aggccaccgc gtctagtttg agaatacagg ataaacctgt cgtggcagct     40800
     actaaattgc ccccgagcaa gggggaaccc tagaatctca aggccaactc aaattctgat     40860
     ttctttagat tgacttggtg cattcctcaa aaccctctat gattaaaaac tttggtgatt     40920
     agcctcttat ctttttggat gcttctttgc caaggtgatt caatatgatt gtgatccgcg     40980
     atttaattgc tcaaagtcat gccaggacta ggctaattag aaggtgggtt gcaatgacat     41040
     ttgagggttg gtaggggttg aaagtcagat cggctctagg ccatcgtctt tttcaaaacg     41100
     ttgcaatgac atttgagagt tagttggggt tgaaagaacg tcggcttccc aaattctttt     41160
     gtaatccagt tttctaaaag atttttgtgc atgtaaaact ttaaaactgg aggtttttat     41220
     tttctttatc tgctaactat tgaaaaaacg caaattcgta aattttgcag ctaattcctt     41280
     aaagctgtgc gtttaaagaa ataatggaca tttcaatttt ttttagatca accaattctg     41340
     attcctaaat tctgggtaag tttcaacaga ccatcacgca actctgttga tcatgcctcg     41400
     atatcccaga agaatactca gcctactccc cgctgctgca ctggcactgc aatcgtttcc     41460
     cgcagtggct cagatcatca accaacaaac cctagaagca gccaaccata acacccaaac     41520
     ccaggaagag ggaacgatac ccggactcta ctatgaccca tctggtgttg tggctccaac     41580
     ctttgccaat agtcaagcct cagagacagc ggggagtatt cgcttacccg caggttccca     41640
     agctccttca ttccttaacg gtgcatggcc cgcgaatgcc agctcagatc aagttctcaa     41700
     gatcggtcac ctgaaagatc atccgcagtt taagcagttt acggaattga atatcaatga     41760
     ggtcttaaaa gccagtggca aagacccttc aaccgtaacc ctgtctgagg tgccaatcgc     41820
     atcaacaatg acagtgggag agtatctgca aattaatcct ggtgctgctg agcagtcctt     41880
     agaagacgct cccgcagtgg tgcaatctgc atttgggtac tacgaggatg aacccctact     41940
     gcacgaaccc attgatcaaa cagacattgt ttttatagaa cagaaagcat ccaacccaga     42000
     gatatctgat atccccgctg aagatttact acagggagac tggggtgaag ccttcaccca     42060
     agaggaacag agtcagctat cgaagaccct cagcaaggtt aatgaacgtc tgcgaaaact     42120
     acccttaaaa cagcttattc ctttagctca agggattgtc agtggcgatt gggatacagt     42180
     caaaaagcag gccaaagatc tagcaatcaa ggaaggttct aaagttctga tcaaagagct     42240
     gatgaagaat cccaaaatcg ccaaagctat caaggattta cccttgggaa ccttacccct     42300
     agataagctg ggattggctg atgcgccagg ggtgggagag acagcgataa aggatatccc     42360
     aggttctgaa gataagaccc ttaatcaagt ccctggtctt aaagatgtgc ctcttgacca     42420
     gattgattta gcgttggcgt tgagcttcac tcgactggat ttgctggggc gaattgacac     42480
     gactgatgct gccgcagtgg tcgataacat cgactatgtg atcagtggtg ggaccaaaga     42540
     ccaaattcca aaacctgcac cctgtaaaat cgatgggaaa gataccaaga actgtcgtca     42600
     ctttgagtta gataacgttg atgggggtgg cgaacccacg aagttatcag ggcaagcctg     42660
     gattcaaggg cctgatcaga tggtgcccgg tgggcaaggc tggttgagaa ttatagccaa     42720
     tggcaaggaa gtcacgggga ttaagccttg ggtggcaggc aatgtcaagc tgtacctgga     42780
     agacatgagg gaagggtcag gggatgaggt gggatctgcc cggttgtcca cggcatggca     42840
     gtttggctat tcagatccaa ttactggaag tcattacacc cctcatttca tcaggattcc     42900
     aaccccctgg cgcattaaag aaggtggaat catgttgctt ctagctcgat ctgggggcat     42960
     tcctgatgca atccgtaatc tccagcccag tcaacagcag ttttgcaggg aacctacatt     43020
     ggttgcctca gcacaaacga acaatgccac cgattcaaat cagacgactg gtggtgctga     43080
     tggcagctca cccccccata gtgaacaaca tcatataaat cagtatttgg cccgcattgc     43140
     ttatggtgaa tctactggag gtactgatat tgggcctcat cccgatactg gtgcatatgg     43200
     tgagtaccag tttatacaga agagtcgaga tacgctttat accaggacgg gtattgatgc     43260
     ttggtctgaa agtaaagaag aacgtgatcg tgctgcatta gcttggattg atatttatgg     43320
     tcaggaagtc ggccatgaca tcatcagcta tattcgttca ggaaattttg aggctgctga     43380
     ttatttgttg gggcgtaatc agttcaccag tctccctgga ggagctgaag atgtgaagtg     43440
     gaatgatcca gttgcccttg aagtctatgg tcctaatggc aatgctccag ttacacctac     43500
     aggtgcaagt gcatcttccg gggttccatt ctgtcaacca accaatggct cagctacttt     43560
     tgcccaaggt ccagcaccgg aagcagggca ggtaaatgca agtatttatc aagctgcaag     43620
     acaaatgtat gggtttgata cttcaagcgg gcctgaagga ggaagtcaag catgtgcttg     43680
     ggctgttgat catgtcctgg ctaaggcagg tatcgaaccg atgcgtacag ataatgtctt     43740
     aaacgtcttg gataagatga aatcaggaag aggtactaga attaattctg gacaagctca     43800
     accaggggac attattctct cgaaggggta tgaccatatt ggaatatgca tgacggctgg     43860
     ttgcactgaa gtactatcaa actcatccag taaagcttca ttctcttggc gatctgatgg     43920
     aactttcgat ggatggtatg atcgctcacg ttttttacat gaggcaccta cggaagaaat     43980
     ttggagaatc caacgatgag aaagttatta tttgtaactg cgttaactgt cctaactatc     44040
     tttagcggta ttcaaactgc tctagctaat gaggaacagc agatagctaa tgctcttatt     44100
     cagtcactcc ctaaacctgc tgaagtagaa aaggttgttg tttcaggttc ttatgcctta     44160
     gttaagtggg taggtggccc tactggaggt atggcaactt tgatcaacac cgataacggg     44220
     tggcaggtga tgtcgcaaac tactcgtggc tggccgtcta tcgaaatctt tgctaaagaa     44280
     cgtggaatga ctattgaaga ggcagaggaa ttacttgacg cctatgatcc tagttggcgt     44340
     cagtggtaac gataaactta ctaatttacc ttcaacactc tctaattctg ggtaatgttc     44400
     tggtagtttc ccaaaactgc catgagtcac catactgaac aacctataca accccctcag     44460
     caacctagtc cccagattga ctttcaggtg tatgtgctgg gtggtctttt ccttgtcatc     44520
     ctcgtcctcg tcgccatcac caaaggagaa ataggacaca agaagcaaaa gcttggagat     44580
     gcccgcacgg caaaagataa tgagatgagg aaggctcaac atctcgccta tgatgctctt     44640
     gagaaacgtg agcggaacaa gattacgctg tgggcagggg aacctaaagg gctgacgatt     44700
     gataacgaga atcgtgagat attcataccc cgcgatctga attcctggat cttctcctac     44760
     cttgaggagc attttctaac ctttggttct agtggttgcg gtaagacctt ctcccttatg     44820
     gcccccctgc aacgagccat gattaagtta gggttacccc tgtgtgtttt cgatgccaaa     44880
     ggccatgaag agaccgagga tcaggcttgc ccatcttcag agattgcggg ctatgccaga     44940
     cttcatggct acaaggtgaa gatcatcgct cctggcgata aagattctga tgtctttaac     45000
     atcttcgaca tgatggaggc taaggatgat agacctgcct acgaagacaa agataacgcc     45060
     tatgtgattt ctgatgttct caatgagaac atgcagatga acaatgcaga ttcaggtgat     45120
     cagttcttcc ccttggcctc gaaacaactg atgcaggcca tgtttatgtg ggccaagatg     45180
     cttgatccag atggggatga attaatcctc gcctactatc tcctcaagcg ggtggctcaa     45240
     gttggtgcgg ctgggattgc tgccttagat cttccccctt atgttcaaat tgcgtttgac     45300
     caatttctcg tcagtgcggg aagtcctgag acagcagcca gtattgcggg tacagctttg     45360
     atcttgtttg ggcgaatgat taccccagcg accacagcaa cattctgtgg caagtccacg     45420
     gtggatttga atgtcactgg caagacactg gttatcttca gattgaatcc caagatgaaa     45480
     gctgctacgg gtccaatgtt ggcaaccact attcagtgtt tccttctctc gaactgctat     45540
     acagctcgta aacaaccctt ggcctttttc ttagatgagt tccagatgat caagatctgt     45600
     gaaattcaaa agattctgac cgttgctcga tccaatggtg tgagcctcct ctttgccaca     45660
     cagggaatga gctttattga agagacttat ggtgaaaaga gagccattgg cattgtggaa     45720
     gggtgtaaaa cccaagtcct aggccagctc aacgggaaca aagtcgctga atactacggt     45780
     aagcagttgg gcaaatcaga ggttgtcact cgcagtaaat caaaatcaac tgggaaatcc     45840
     tcgtcaactt ctaggaatga tagtcctcat gccaaagatt tagtttcaat gggtgaatta     45900
     atgggattgc cccaaggctc cttctacgtg ctgagtcgag cgattggtaa taagaggctg     45960
     gctcgtattc ccatgagacg gaacttcgtt attcctaagt gggaaacgga tgatgccaag     46020
     cgaggggtta aagaatggtt caaatatcga aaggttgccc gcaagcgtag caaggccaag     46080
     tcgatgtcaa acgaggagat gatccggtat cgagaaatgt ccgttgcgat attgccagat     46140
     cctaaagatg atgacgacga tgatggaggc gataccttag caaagggaat ttcatcactg     46200
     tgaattctgg gtaatgttca aacatagaat tcaaaatcta aatctatgac tgaaccaaca     46260
     gaatcacaat tacagttcac ggaattacaa ttacaagccc ttcaatccct tgggctgagt     46320
     actccagact tatacgctca atatcccaac tctcatcaca atgccattga aaccattgag     46380
     caacggggta ctgaagtatt gccgaaagat actgtcatca atgaaatgca gatctactac     46440
     ggtgatgtcg cctatgttgc ggcagtgacc tatcggggtg ggaagctggt cggctttgat     46500
     cccgtcgcct acgctcaacc tgctgacaac gaatgtgtga gctatcgaat caatggtgtg     46560
     tgggcttaca tccaggttgc agggcaaacc ctcctagacc tgattggaga gattgagctt     46620
     ccaccgatgc ccacggagca agaccttttg gcattggttg cagcctaaat cctcatttct     46680
     ttattcaaaa cattgtggag ataaataatc atggcggacg ttttagataa tggtggtaac     46740
     gcccaagaag gccaacagat caacgaaacc ttgatcaacg gtactgccga gcggttgcag     46800
     cagctcattc agcttgcctg ggcaatccta caaaaaggtg atcagtgggc gcgtggtttg     46860
     gagttgggta ataagcagct actcccggaa actacgaccc tgaacgatct ggatgcagcc     46920
     gagaaagcgg tacaagatcc caaaaataca gcagtggagg tgaatgcagt tgagtgacaa     46980
     ttacgtagac agaggttgtc aattgcatag tcttctctag gaatcaggat ctagttcaat     47040
     ccagagatca catctgcaga gagagcatca gtcactttcg attttttata tccccataca     47100
     ggaaagacac tagggtttgt actcctacgc aattaggaac ctctagtgcc agctcctatt     47160
     aaacctcaac aggttcatct ttatatgcag acaaaacaat ccggctcttc tcaagaaaca     47220
     gcagctgcta aagctggcat ttctacccgc acagcccacc gcattgatag tggtactcat     47280
     cgtccccaac gcggccgccc tcatgactgg aaaacccgtg aagatccgct ggatggatta     47340
     tgggaattag aacttgagcc gatgttagag cgtgagcctc gattagaagc gactactcta     47400
     tttgagacct tacaagagaa ccatcctggg caatatgatg acaagatcag aaccgtgcaa     47460
     cgccgaaccg ctaaatggaa ggcagctcat ggcaagccca aagaagtgat gttcaaaatt     47520
     caacatcatc ctggggagat gggacagtca gacttcgctc agctcaaagg tttcagtgtg     47580
     acggttcagg gtgaagcctt tcaccatatc ttgtatcact atcgactgag ctatagcggc     47640
     tggcagtacg tgcaggtgat tcaaggcgga gaaagtttta tcggcttatc ccaagggcta     47700
     caaaatgctc taaccgcctg tggtggcgtg cccaagattc atcgtaccga tagtctgagt     47760
     gcggcttatc gcaatactgg cggccgcaat ccccagctga cccagttgta ttcgactctg     47820
     tgtgaccatt accggatgca gccaacacgc aacaatctgg gtgtctctca tgagaatggc     47880
     ggaatagagg ggtctcatgg ctatttcaaa cgacgcctgt gccaagccct gtatcgtcga     47940
     ggcagctttg actttgactc ggtagctgag tatcagcagt tcatcgagca agtcatcgcc     48000
     aagctgaatg ccaagtgcca aaaaaaggtt tgcactggag ctgcccacct tacagccctt     48060
     gcccagatac cgaactcctg attatgaagt gcgcagtgcc aaagtcagct gcaatagcac     48120
     gattgccgtc cgctgtgtcc tttacacagt cccctctcgc ttaattggcc accgcttgaa     48180
     attacaccta taccatgacc gccttgtcgg tttcttaggc accactcccg tagtggaatt     48240
     ggcgcgggtc catgtccatg gctctgagaa gaaaagacgc gctcgcagca tcgattacaa     48300
     gcatgtggca gaaagtctca ggagaaagcc aaacgcgttt ctctactgcc aatggcaatc     48360
     agagctactg cccaatcttc agtggcatca gctgtgggaa tcactcaaag ctaattttga     48420
     gcaggaccag gccgcacgat taatcaccga agccctctat atcgctgcaa ctcaagatca     48480
     agaatctcag gtggctgact acctacaaac tcaactggaa cagtccaccc tgaccttgag     48540
     cagattaaaa caagcctttg aattcaagct ctcgactgag caatatcctg acgtcacctc     48600
     acaacagcac gatttatctg actatgatca actcctccac agcagacccg gacaacccat     48660
     accagttgct gatgacaacc ctaaaacagt tgcggttgag gcatttcctc gacgagtggc     48720
     agagcatcga gcatcaagcg actcaggaga attggtccta cgcccagttt ctgttggctt     48780
     tagctcaagg cgaagccagc cgtcgggagc agaatcggat ttcacgcgct ctaaccgaag     48840
     cgcagctgcc ttacggaaag tcctggacca attttgagtt tgcccatgtt cccaccctta     48900
     atccagctgc tctcatggag tttgcccaaa cgactcactg gctagagtcc ggtagcaaca     48960
     ttctaatttt tgggccgagc ggaacaggga aaacacacgt cagctctgca ttaggagctt     49020
     ctattattga gttgggtaag cgagtaaaat ttgtcacagc cacaaccctg gtgcaacaac     49080
     tacagctggc caaacttcaa ttggaattgc agagtctctt gtccaaactt gaccgctatg     49140
     atctgcttat cattgatgat ctcggttatg tccaaaagtc cgatgttgaa acctcggtac     49200
     tgtttgagtt gattgctcac cggtatgagc gaaagagcct actcatcacg gctaatcaac     49260
     ctttcagtca atgggacagc atctttccta actcaatgat gaccgtggct gccattgatc     49320
     gcttaattca ccacgccacc attttcgaga tgcaagcaga aagcttccgc aaacaagaag     49380
     cggccaaaca cacagccaag tctcaaaaga ctgacagctg atctctagtc agaataaaac     49440
     ctctgtaccc cactattaat agagttgctt acttataagc aactctatta atagtggctt     49500
     tattgataat tgtcattttg tccatggcgc gatcacctga ggtaaaaacc atgattttcg     49560
     atggtctccg accgctcttc gggcatctca agatgatatt gcaaagatct aaatcgactc     49620
     acgagccgct attaaaagta tgaagttaga accaaaaagt ttggcctatc taattgacat     49680
     taaacagaat gctatcgaat ccaaggatca gggtgaagtg gttcgtgcaa ccgtcgctga     49740
     tccttgggat attgaacctg accaagtggt tgatcaagcc cttgataaat tagagccact     49800
     agaatcagaa gctattgaag tagatgcagt cgtagtcgaa cctgagcaac taccctccca     49860
     agcccaatcg aatgagcgcc ctctcgtgaa tgagttcatt gagaaagcag gggagaatat     49920
     caagcagggt gcaaatgact ttgttgccca agccaatgcg ttccttgcag agaacattca     49980
     ggtggagtac cagcctatcc ctcaacagga tggcactgta gctttggctg tggatacccc     50040
     ttcactactc actcagatgc agttagcggg tggggaatat gctcaagcag ctaaagaaaa     50100
     aatgcaaagt cttgcaccac agcaatatga gcgggtttcc gaggcagtca aaaacaccca     50160
     agagcgtgtg aagagtgcct tagaatcggt gtctgatacc gtgcaaggaa gattgaagga     50220
     accctcatta ggtcaacgta ttggggagct tgagcacagc gtaggtctac ggcttgacag     50280
     catggggcta ggaattgagg atctattcca aaaagttttt gatattgagc tagataagca     50340
     tgggactgag tttgcactca cacgagagat tggggagttt aaggttgaaa tcgaagcatt     50400
     gcgctctcag gttggtggac tagaaggcca aatctcggcc atgcagcagc aacaagtgaa     50460
     atcccaggag atgattgcag cactgcaatc ccccaaaccg cagctcaata atcctcgtct     50520
     cagtcaatgg cagtctaact ttgtatccac catgaaagac cgattccagg cagtcaaaca     50580
     gtacattggc gagaagatca atcaggtcaa ggctaaagtg tcagatttgg tagagtcctt     50640
     caaacacaaa atggttgagc gttttcagcc cattgctgac cgtctaagac cagtttatga     50700
     acaggctcaa gatctgaagc agaaaacagg tgagcaaatc aatcaagtca aggccactgt     50760
     tggcgagaag gtcgatcacg ctaaacagtt cgtgggtgag aaggcgatgg actggcaggc     50820
     tcaagctcta gctgccactg caacctatgt actcgctcag caaggcaagc aaaccccaca     50880
     gggcaccacc atctatgaag ggcagcattt tgactttcac aggaaccagg gtaactcttt     50940
     gctgattgtc gataaggcaa ctcaacagcc tgtttataaa aatggtgagt tcaaccagaa     51000
     tgcccccaag gatgtgaagg acaagcttgt caaagcagct caaacgactc aaaaagggat     51060
     agagcaaaag caagctcaca aacaagctaa ggaacaagca cagactcaga agccaaagcc     51120
     aaaagtggca gcagccgcta ggcgctaagc ttcctgttct tctgcgctcg ttgaatgggc     51180
     ttgaccttag cctgtttgac ggtggattta aacaacttaa ttacccctgg tcgggccgat     51240
     actctcgtga gtcggcccat ttttgtctga aggagtatgc gacccgtatc agtgtccctc     51300
     actgtcagcc cacgcttacc cgtagcaatc agccatttat ctacccggta ctggtaggta     51360
     tggcggtact tggtgccttt tgtcttggct aattcttcaa ggatggggac aacggtagtt     51420
     gctgcattgc gtttcttgtc ttggtgctgg agagcagctt tcatcagttc ttcccggttc     51480
     aaatctgggt ttatggcctc gatggtttta taggcatcct ccgtcgttcc tctggtatac     51540
     gcctcaataa agatttccag gttcatcacc ttgcggggga gttcgccatc gcgtctaacc     51600
     acaaactcat atagcttttg atactcatat tcgtagtgct tggcagttgc tactgctaaa     51660
     ggttgagcgg catcgatggc aagctccagc atttcggggc tagctccaac gatcagatca     51720
     tcagctccct tgtagaggct actccactta ctgaatttaa ccgtgcagcc cttgtcctct     51780
     aacagcattc ccgtgcgaac catgtcacgc ctaacatttg ccacggtcga tggtttggtg     51840
     tcctggtcgt acataaatgt aatctctcga cctggcacgg caaagatagc gaggtcaggg     51900
     tttaaccttc gctctggcaa tttgatgccc tcgtcatcct tggaccgata cccggcattc     51960
     acaccaggca gaccaatgac gacatggcct tgagaggtaa tggatagggt tttcttgccc     52020
     ccctcagtaa tcttgatggg gatttgggga ttgtctcgaa ttattttcca aaagtgatcg     52080
     ccaggtgctg aagtggtgtc gtatttctta cagatatatt ctttgaacca gtctggaacc     52140
     tcagttagga aaatccctct gcttctgccc tggggatgct cgtatttctg aaagcgctct     52200
     ctactgctgt catagcgggg atgatctggt ttgaagctgc cccaggtgga aagtattgga     52260
     tcatccaggc tttgggcatc aacccctgcc ccgatccaaa acccgccgtc ccagcaatgc     52320
     tctatcttgg ctctcaattt ctgctgttgt tcgacccaga cctgacctgc tccaagttct     52380
     gcaattttgt cctctagcag atactcataa actgaatcac cctttaagct gtggcaattt     52440
     agctcaatca gatccgggtg aatccccgag ccttcaatta gctcctccca gtgatgagcc     52500
     gcaatacctg acttgggtgg ctcggccatt gccgtttgtg gtgtccagaa tgctgtggga     52560
     gtgaattctg gtagctctag ttccctatct agccccagca actctctggg attgagttga     52620
     gcggctgaac actggacctg acgacacatt ccttcgtagt tctcagtgaa gatatacagc     52680
     tcatgctttt gtcggctgat ggcaacgtag aaaggttctc ttgatgaggt ggggtcaatc     52740
     gtgccactga agatgactcg atagtaggtc tgaccttggg ctgcgtgagt ggtggaggtg     52800
     attgagtaat ccagctccaa gggtttggat gtgtctatcc atttcttgtg attgatttgg     52860
     atcctgtgac cttcgacggc tgtcaccttg aactgatcgc cattgttgcc atgtagattg     52920
     ttcctcgtcc accgcaactg gtcccccact gcgacattga ttttctgagc ggtaaagacg     52980
     gttttattct ccagcttggc tgggtcgaaa ctggagtatt gccccccttg agagacgaca     53040
     cggacgaccc cagaggcttc atcaacgccg actactttgt agagctttcc tttctggagc     53100
     cgactagaga aattctcatt gggaatgaca taatcgtcag ttttgtaata cctcagatga     53160
     cgggtctgct ctgtagttaa ccgtttgtcc accaattgcc gaagcgcctg gtcttccccc     53220
     ttaattacac cttcggcacg tagcccttct ctaatcagaa tcgtgattgc ctttctctct     53280
     cggtgggtgc ccgtgacgat tagagtctgc ttgcgctcct tgggtttcag gcttagatat     53340
     ttctcagcga cttgagcggc ccgagttctg tgatctgcga cctcagtgac gtgaccatac     53400
     tcattgagta gcttcaaggc ttccaagggc ttgccaatgc tgaccagctc gactgcccgc     53460
     cgctggacaa tgcgcttttg tctgaggatt gttttgatgt ggtaggtttc agctcctgcc     53520
     ttcatcagtg aacgctgagg tgaccccgca ttgacagagc tgttctggtt gatgtccccg     53580
     actaacaaca cacgagcatt aaccgcctca gcccgcttca ggacttcaag cccctgctcc     53640
     gctgatttca tccccgcttc atcaatgatc caccattgat ttgggctggt gtctaacttg     53700
     cgggtgatta agccagagac ggtggtggtt tcaatcccta actcttcggc taaaacccct     53760
     gctgctttag tggtgggact gtagccttta atctggatat ccgggttgat ggcttcgatg     53820
     tgtttttgga gttcgctgag ggtcgtggtc ttgcccactc cagacaggcc atgccaaatg     53880
     atcaaccgat tgctgctagc gagggtgttg cggactgcat tacgctgatc tgcgttcagc     53940
     atcttattga actcaatctt acccgtggtg atgggggtga atttatgctg accagcggcc     54000
     cagagctgcc gtgtcttttc ttccctatct aaagcgtact gagtggtata ggtgtcattc     54060
     ttcgtgcgga tcagttgcgg gtgattggca atctcagtct gcaactcttc ataggtgaag     54120
     ggcgggcgct gatcaaagac ccattgctca attagctcat ggcaaaactc agcattgcgc     54180
     tcctgtaggt gggcaatggc actatctacg tattcacggg ttaattcagg ccgatggacc     54240
     caggtggatt tcttagcagg cttgggaagc gtgaacccat tgatgatcag ttcctcaacc     54300
     catcccttca tcttttcagg gatattggtg ttgtcttctt ttttattgcg ggttctcagg     54360
     actgcattct ggcggttttc ctgggtatct tctagaccgt acttcttcag ataccgctct     54420
     acttcctgag ttcttttctt gaaatgccaa accgtttcag ggctaagtcc ctcaatggtg     54480
     ccatcaggcc gcacggtata ccccagttcc gctagaccct tatcaataaa gtggcggtag     54540
     atggagccaa gagacagaga tttaaatatc gcctcattcg atagcgattg ccatttcccg     54600
     ttgatctggg tagcattcat caccacgata tgggtatgca gcgctgggtc tgaataggtt     54660
     ttgccgtcaa tggtgacagg ccgggcagta gcgtgattga tgaaagcccc gatcagggaa     54720
     tttgtattga ccaaggagcg ctgcccattc ccatgtctga cacgggtttg agtataccgg     54780
     gactggaaga tatcgaagac tttctgcaag gcttgctcat gcagctcgat aatcctgcgg     54840
     tccccaccga ccaaggcgag gatcgaggct tctttgccag gtccaaaggt gagatctatc     54900
     cctaaccgct cttggccgtt cgtgggtttc ttgcgtaggc gtttgcctgt ttgagggtgg     54960
     tgtccataga acagcttctt gaagaccttc tgattgatga cacctttgag gttcagactg     55020
     tctgcgccgt ttccatacca cttgcaaggc gatactactg gatctttgcc cggtgcgtag     55080
     tactcgtcct cactgttctt tagtgcttcg tcttctgtgt agtactcctc aatcgcagca     55140
     ttgcctttgt tgatgagcgt tggcctgaac atttttaata tcgtctttga gtatctatcg     55200
     ctgcaccaag cctaagcggt agtaaaagtg atttgacaag taacctgcgt attggtccaa     55260
     ttagcataca aacggtcatt agaaagacga aatcccactt aagcaagccg ataggtgagt     55320
     tgatgccagc ggggatggtt acaccaggaa tacccgtctc gataggtggc acctcgactt     55380
     gatatggttc acctggtcta caaactggct cttgaccagg aaatgttggc ttgcattcca     55440
     acttgtattt tgttacgtat tgttttccca ttttcttcga cctcgttgaa aggttcgtgt     55500
     cgttgttgat ccactttttc aaaaaagatc aacactccaa cattaccccg aatttttggt     55560
     tttcggcctt ttctgagatg cccaaaaagg tgggcgtagt gcatatatta aaattttttc     55620
     cgacgatccg cagttttcat ccgctgtaat ccactcctag aatgcatttg aggggtgttt     55680
     ttccaggatt ttttggagtg agccagaggg tgttttttag gaacatattt ccacattaat     55740
     tggctattat ttatcattct ttggctatta aaagtcatgt cttgactatg gctggctatg     55800
     gttggctatg gttggctatt tgttgccaaa aaaaggctat tgcagtcggc tcaacttttt     55860
     ttattctggg taatgttgtg acgtgaaaga tttttgaaac ttttggagcg tcacaatgaa     55920
     tttttctcag ggtgcaatat tgcatctcaa cattgatact gggtcatcat caacccgtgg     55980
     atttttcttg gctgactttg atggaggaac ctatgaggga tttatccatc aacctcctaa     56040
     cgttggcttc ttgatgcaga gcaactatga aaacgataag aggagaagta caaccaaaac     56100
     gtcacgggtg accttcaggc agggtagtga ttgggtcttc cgcattgtgg gcgagatacc     56160
     aggccatgcc gggacgaaga ctgacccaaa catgagtaag gccgatctgc tggtccccaa     56220
     ggtgcttgct ttcgtaggtt tggccctgga tcgagtccca gagctatccc cagatcgggt     56280
     caagctcgtc atcaacttta tgctaccgat cagtgagtgg actgagtatg cagacttgga     56340
     gagtgacctc ctctcatgtc tgctgggtgg gtttgggtac aacggtcgcc atattgattt     56400
     tgcagctgta gatgccaagg ggtatatgga gggggcaggg atggcaacga tacccccacc     56460
     ggatatcaca gcttatgtcg gagtctgcgg tcataaggat gccaacttta ttgccgtgga     56520
     ggatggccga ccactggctt acccgaagtc caaaaccttt gaagggttgg ggatgtcttc     56580
     gatagtgaat tcagtgatgc actttacgga tgatgtgcag ggggcaaaag ccgtcttccg     56640
     gtttctggca ttgatggata aacccaacaa gcaggaccag gccagaaaag aattagccgc     56700
     actcatcaag ccccaccgct tagagcagaa attgactcag acaagggaag ggttcaacaa     56760
     aaactggggt gagattaagc aacgtattga tagcgaccgg gggataaagc aggcccaagc     56820
     gttttacttg gtgggtggga atgcccccat ctacaaaagc cgattcaagg ccctgtttgg     56880
     tagtgcgttt aaacccctca atggggctat caagcagcta tcggatgagt ttgaagagat     56940
     taatacccag tgggcctata gagccatcga tgtttggatg ttgcatctac acgtaaccgg     57000
     gcgcacctgg acacccaaag gagtaaaaga atatgtcgga gcaaagtaga acaaatatta     57060
     ggattcggcg gcaaccaata gtaggttcca gagaagccct tgtgatgaaa tctgctagag     57120
     ctttttacgg ggggaagttc agtgaaaaag ctgggctggt gttagtggat gtatttgagc     57180
     cgttgcacat tgctatgacc actggttctg agcaggaagt aaaagatgcg attgcccact     57240
     cattggatga aatacgaggt tggcaccgag aagccctgaa ccaatgccaa aaaaatgggt     57300
     atgtttctgc tagccaggtg gtgcaagcaa caacctctgc tgatatgtcc cctcaaaatt     57360
     gtgacccaga cgaagatgaa cctgaattgg agtttgacta gaaaatgagt aatcaaagtt     57420
     ttagcaagac cctcaagacc ctacagatca gcaaagaaga cctcattgaa cttcgcggta     57480
     tctgtgggct aggagagata gaggaattct ctgaatcaga tattgagatg ttgaaggagg     57540
     tggtgcagca caagcaaagc ggagcaatca cctataccga agcatggcag caaatgcagg     57600
     cagaggtggt gcccgttgaa gctgagccag ttgctgaaaa attagatggc acagaccata     57660
     tcttggaacg cgccgagaaa atcgcggatg aggatgggga acgggtacta cggtctctgg     57720
     atggatatgg cgatgacttg caaaccgatg ttacgggagc ttacatgaat cgactcaatc     57780
     acctctttca aaatgcccgt gtgcagaaag cagtcgtgga ggaaccagac gagttagcaa     57840
     aaaagcctgg gccgttcacc tccaggctaa gagagcggct agcagctcaa gccaaacaaa     57900
     cagcactacc agcttcgacg acctcatcta ccgagacatc gcccaccgaa tgagagcgat     57960
     tgcccaagaa gaggtattta tcatccaagc cagggagttg aagcttcagg ggcatgagcg     58020
     aacgatcaac aaaattaacc ggggtctatc cctgatggcg aactcgtcgg caatccttgt     58080
     cctcttggtt gtgttcctag ctggctctgg cctgatcgtg ggagtgaacc tccccaagta     58140
     cgccatctgc gacaaccaac tcaatccttg ctggtggctg cggttcgggg gttcggagcg     58200
     caaggtgctg accaatgaca aggccgcagg tttgtgagtg ttttggtatt ggagttgcgg     58260
     gatacaaatt gcgatcgcaa ctccaatacc aagccctgat atcacaccta aaaaatacag     58320
     ctgtacattg catggataaa tgacgcagag taacaattac tgtcgcaagg ttatcaagct     58380
     tgtatccctt ctcaggcaat tctactaggc tttagagacg tattcccgtt ccagggtggg     58440
     cttgtatagt taggtgtcat ttttttactg cgtactgtct gtctctgcac agctatgtct     58500
     ggaattctca caaactttta ccagattcag ccacacacca atcacagatg aaattacagc     58560
     aaattcagta aaactacact ctgaatattg attgagcttc aatgatactg gtagggaaga     58620
     taacgacccc gttcacctgc cgcagataac ctcgaactgc aaccgacaat ctttcaacgg     58680
     tcggtgtgca acgggattgt tatgctaatg gtctcaggac aaataaggat gaaccgctga     58740
     ggactcgaac ctcaatcacc cccttcgtca aggcactact cagaatacac tgatggagga     58800
     gggtgcttta ccgattaagc tagcagctcg gattgaatca tccgtataat tggactggac     58860
     tctagtttat ctaagccata aagtttccgc aagagtgttt caagacaatt ctttactcgg     58920
     tctggattac acttgagttg ttttagcttc tgaagcgata acggagagtt ctcagattga     58980
     atgattttga atacagtatc agcaagctgg cgatctgaag gtctactagc ttgacatagc     59040
     ttgaaagcaa gctgtttgac aacacgagta aatagaataa aatcatcaaa cgacatatcc     59100
     gaatatttat tcggggcatt taatttaccg taactgctgt gcgctttaac ttcttcttga     59160
     agatgcaaaa ctttggaatc tatttttgat acatcaatgt caacatgaac aaatcgattt     59220
     cgcaccattc tatagtgatc aaataattca acttctaaag aaccaacaag tctttttgct     59280
     gcttgataat cttgacaaat attcttgaga atgcttttga gcagatcatc ttttttctca     59340
     tatcgccaat ccgttgagag aggatgctca tctcgaaaac cttctaagaa ttcttctgcc     59400
     tgtgcataaa cactaataat atagagttgt gagatatggc tcctcagaaa gggcatctca     59460
     gaatcatcca ctctaatact atgtttggct gataattcct gaatatactg atgagcgctt     59520
     gttgctcttg aggaattcac aatgaactct cggatagaaa gctcagtaca ttcaactatt     59580
     gcatcagact tccctaaagt ctttttgagg cgtaacgtac aaggcagtcg aaatgaagtt     59640
     ggatttgaca cgagtacttt atggcatgaa ttttctgtac tactattcct gaaatcagca     59700
     taactatagt tatacgacag actgacgcat aactccccta tgcagaatat tagatgtcaa     59760
     gtgtcgtcta acacccctga tttggacaga aaagcgacac gatgtcgtct aacactccta     59820
     tgtaagaccc tattacgtca agctttcaac aatagctctt tgaatgctga gaatttgtat     59880
     gggtgttttt ggacactaag tgtgcaaaac ggaaaatagc tgtgcaatgt acatgtgtgt     59940
     agaagttgtt tatattgcac agcccacact cacttgttgt gtgtaatccg cccgctagga     60000
     ccggagcatc caaggtattg ccagtcattt aaagctagaa aaaacgaaca agttttgtaa     60060
     ctctgatgag ctttcagtcg gtcttttgcg atcgcaacta cgataccaat catctgaaga     60120
     aatatttgag atttatttgt tccgagagct aagaaatctg gggagagttg ttactagaag     60180
     cactggaaaa gttgctcaac gacttaaatc aatctagagg acaactcatg aatccatctc     60240
     agacttcaaa cctagccaca gaaaaaaaac ctcaagggat gagactgagg gacagattga     60300
     ttttatttgg attgcaagag ggttactacg acgtgtcttc gctgaccgct ttctataacc     60360
     tcaatcgtcc cagcatgacg gctcagtatg gagagcaaat tcccggagag cggtattgct     60420
     atcgaatcac tgaactgggg attatctggt gccagatttg gcgttcgaaa cctctgatac     60480
     ccatccccag aacttacacc tgaaactact ttatggaggt tatctaatga aaggctgtct     60540
     gatagttctt ctgatcctga ttaccccctt actgctcctc gcaggcccca tcggttgggt     60600
     cttagggatt atcgcttgga ttttgctcct gaagtgaggt gctagatttt ttagttttgc     60660
     accaattccg acttcacacc tgaaatcacc ccacttttca gattccatct ggaaactgaa     60720
     ctcttaagct atgaccgaca acccgccaga accaactgag gttaaccctt ccgggcagac     60780
     tgctagcccc acagagaagc gggttctgga ggcatttgca ggcatgatgc ggagttgcga     60840
     tcgtatccgc gataccgtcc gaacgaccag agagcgagta aataaggaaa cgacaaattt     60900
     atagattctc taaggaatct gtattaccta atcatttcag tctccgcgtg gaatctgagt     60960
     tacctagccc atagagtgcc aacttactaa ttttcagaat ccacagagat tctgtattac     61020
     ttaactgctg gagtaaaaac tatgactgca acaaaagacg aaacactgac cattgttcct     61080
     ggctggagcg aggataattc gagcgatacc ccagacgcat tgaaggcatt cctagacacc     61140
     aagccgatta atcgcagtac ctatatctct gcccctggat attcgtttga tttggaagtc     61200
     catcactggg gtgatcgttt tacgattaca gctcgaatgg gcgaggatgc ctggaacatt     61260
     tacagctccc acacttttga cttcagcgac caggaaagct ctacagatag ttggtatcga     61320
     tcagatgata ttcagatgac tccacagcat tacgaagctg tgaccaagct tattggcgat     61380
     attggcattg aagggccaac tatacctaca gagttgagcg gctgggtgag tcaggaccga     61440
     agtgagtcaa ggcatttaaa ttttcggttc gaggataaag ggaacaggca ttacctggga     61500
     ctcgacctgg ttaggcatgg cgacccagat aagattgaca gactgattcg tgatcatcgt     61560
     tttgatgagc tggttgctct ggcaactggt gagacaaatg cccacctgaa ttatccccac     61620
     catgcaaatt taaccaattt gagtcctcga cagattgagg atttcattct agctgaggct     61680
     gcttgcttag ccccagagta tgagctagag cctcaccaga tgcaaaatat cctccaagac     61740
     atgtcagctt cagtactgaa ctctcgggga tacaagccag actatgggta tcagattgca     61800
     gcaggtaatt cagtcgagcc tcggactaat gacttcagat catcggttac gtgcaggggg     61860
     gagtgggcac tggaatttaa ttgggaagat gactatcact cgatgccact tggtggtgaa     61920
     ccgggtgata ccttccaatc agacgaggat cgggccgcag tcgtcacgga ttatgggaac     61980
     ctgggcgcga ttgagaagat gattcaagat tctcgctttc gtgaactggc aactgcttca     62040
     gtcagcgccc ctgctcacta ccattactac cctgaactga acaatatgca aggggtatat     62100
     ccagaggtag ccaaggaaag aatagaatcc cacctgcttc ttgtcgctac tgaatatggc     62160
     ctcgcggaac gaggggttcg gttgcttgag gatatgcgat tgaaggtgat ggaggatcgg     62220
     ggagaccaca agaaccactc ctacgatgga ttattgggaa ttgatcgtgt accccaagat     62280
     gagttgcagc aaaccttgcc agagctggat gtgaaagcat ctggtgttga gctgctgcct     62340
     aatattcagg aaatacccca atcaaaccaa cagccaaaca tcgatcttta tcaatcctta     62400
     tacggagctg ctgatcaata tggagacttc gatgttggtt ttactgagct ggcattgggt     62460
     aatgggtact ctgtgacaac caccgatcaa agcttgaata ttttcaaaga tgatgagcga     62520
     atcattcacg ttgtcgctga aaaccccagc ccttatgatg gatttttgca agagcctttg     62580
     caaatagagg acaagactac tccaggacag agagaagagc ttcaggttga gctacatgag     62640
     ctaaagcagt gggcagagag agattttgaa aaaaaccttc aggaaacacc aatcgcggaa     62700
     ggtgctatta ccttagagca gttagcgaat aacactcagc agattaaagg gctagctgac     62760
     actcaagtaa ctaaaacgcc ttctgttccc atcatcaaat ccactcaaaa cgttttctgg     62820
     atcacccatg aggctagcta ccttaaaagt aatctgacct gtgtcaaaac aaccagaacc     62880
     catacccaag caaagcttga tgcctactac ataatcaatg aaggctatga tcattacgag     62940
     attaatgata ttgagccact gccagaatct gtctgtcact tactggtcaa attctttggc     63000
     tatgagattt gtgagtatga tgattcagcg atagagatag acctgctgta catctggcaa     63060
     gggccaagag atcctgatat taaggtagga aataagagct ggtatctgtg gctgaatctg     63120
     tcaagattcc gctgggggtt ttatcccgag ctaatggcaa tcatggaagg tcgcctcaac     63180
     gttaataggt tgccccagta tccttggaat tctcagcatg agtcagtgac tggctgggat     63240
     tgtggtgatt atgtcattga agtagcgttt aatttgttca acagccaatc agaggctgaa     63300
     gagtttgggg agtcctgcta tgcccttgct ctctatgagg aatattgcaa ccttctcaag     63360
     ctcctctaca tcgatccata tggtgatgaa cagcgtaccc ctatccgcaa ggatgaggtt     63420
     aaggtctttc tcagttcatc cgtttttgat atcaggtctg gagatctgcg tgatcgcgat     63480
     gaatgggagc ttgtcccaat agatgaatgg gacaccccta gtctagttat tggcgctcaa     63540
     ctttactgcc aaggtcggga tgctaaagca ataatagcgt tagaaattca ggagctgggt     63600
     gagaaggcgc atgacaaaga ggaggtggta actgagtcat tcaacgaaga ccagtctcct     63660
     gagtgtattc aagaggatct ggaaaatcat ctaactgtgg agttgatcga cggtgaaggc     63720
     gaaacccaaa ttcggcaact cagaatgacg attcgagatg tggttgttgg tgtgaaaatt     63780
     ggttttgaat cctatcgagg tgggtttaag tcatactatg aagttgattt atccgttgtc     63840
     gagtcgattg caaaagatcc acgtttcaag gagctggttg ctatctcatc tgggatgatc     63900
     gattacccct atgtaaaata cccggatttt agtaatgtcc aatgtttgga ctctggagat     63960
     gatttgaagc gattcgtcga aagtcgggca tataaacttg gcgaagagta tggtgattca     64020
     tcaattgctg ggaagctgat cgacgaggta aatcattgct atgccctgga agtagatgtt     64080
     tctagatata agatccgcaa cgacgcagta aagggtattc ctttcaagcc gtcaaaattt     64140
     agaggtggca agatcgacca aagcggtcgc cttcctgaat cctatgtcag tgtgggcaag     64200
     gtttacaccg acgaccagac aaaaaatcta gaattgccga tcaggattgg ctctgaagag     64260
     tttactgtga ccgtgggtgt cgaaacccag aatggcacga gctacagcta tggcgattca     64320
     ttagagcctg ttcagggtat tacccaggac caaagattca atgagctggt ggcagcgact     64380
     gctgggatta aagagtatcc ctatacccat aatttggatt ttcgacatcc agacaaacta     64440
     acggttgaag aggtgcaatc taccattaat cgacgtgctg agatccttgg ggaggagtat     64500
     ggagtaagga ttatggggga gtctttggtg gcttgcattg gcactactta tgctgcatta     64560
     cgaggaacca ccagagaagc tttattgcag agctttgttg atcccagtca agaaattgag     64620
     ctagaggcga attgccaatg cgaaaacagt agatcgtccg atcaggttct cacgagtagt     64680
     taaccccagc taaggtgcaa gctttcacct ggccttgtac cttgggcatc tgtgtcaagc     64740
     aagcggttgc tggagaaacc aatcacctgc actagggcaa agaccttgca gcaagaactg     64800
     gataaacatc gtcagatcaa taaagagccg cttgcccaag tttcaaaaat tgtagatctt     64860
     gaggatgagg ttgaattact acgttctcag aatcgagagt tgctggctgc gcggaaagta     64920
     actcaagaaa aggtggtcaa cttaccaatt agaaaccagc ctgtgcacaa aagtgatgtt     64980
     agaaaggata acttttctgt gcagattaaa actgagctag aaacacttgg gattaaatta     65040
     acgaatacgc tacgcaagac aatggaagtt gcgcatgaag aaactgttgt cgaggccatt     65100
     gaagccttga taacagctct agaaacaagt gatatcaaga gtcctggtgg gttggcttaa     65160
     aaaagctatc gaaggtggtt ggagtcacaa tgaaaggctc cagaaacaaa agaaggttct     65220
     gtatcctgaa ggatttaaaa agtggcatga acaagcagta aaggttaact ttgttctaga     65280
     tattcctata gaatatctaa accttgatga acggaatgaa gcaaaagtga agataaataa     65340
     gccaggaatc tttggtgcac cttataggga tctgcattgg aaggaagcta aaatagagat     65400
     gctaaatttt cataattaga atacatttat attatgaaaa tttagcatct cttctgagga     65460
     atgagttaat ttatttttat gagaaatttg gaaaaatatt cttgcaaatc ctcttgatgc     65520
     tgccatagag taaaatttaa tcataaatga gaaataatca taaaaagaaa aaattcaaaa     65580
     aacagaaaga caataaccct ctagacacaa aacaaataga tttagagatc cgtcttgatg     65640
     caattctaaa aagtagatgc gggggagcat ataatattaa tggtattaga taccaaatcc     65700
     tatattctat acttagagga ttagaactct ataatacaca atgctcattt agctccatta     65760
     gattagaagg tattgaagat ttagattgtc taaaaatcaa cttaaataat gagtatatac     65820
     aaattaaaac atctaaaaac tcatggaatt gggcgaagct aaaagaacca gttaaaaact     65880
     tcttaatagt tctaagtgaa agtcctaatt cgcttttttc aatagtttta aactctacat     65940
     ttaaatcgga tgttttgaag ttatccaaga aagataaact taactctaat gaatatgaag     66000
     gaatcaagaa taaattcata aaattatgtt ctgatgttgg agcttcaaga aatgaggctg     66060
     aattactttt tgaaaaaata ggtattaaga atttaccaga gaaagaaatt tatgaggaga     66120
     taaaaatagg gctaacgaac gattttcaat taggtagcaa tctagtagac acatacttag     66180
     ctgttctagt tagtaagttt ctttactggg cacaagaaag agtaactatt tcaaaaaaag     66240
     atatagagtt aatcagagta tcaattggtg accatattgc aagtgaagaa catcaagctt     66300
     atggaagagg attgattgac aggatatctt ggaatataga tgataaacag tcagattttt     66360
     ttgaaggcaa aggtacaaga cctggtcaaa tatcagctgg tgttgatgta aggagaatac     66420
     gctggctgga aaaaattgac actgcaatat ataaaactaa aatttgtgta ctcaaatctt     66480
     ccagtggtca aggaaaatct gcactacttt acaggtatgc ttacgaatac tggaggcatg     66540
     aagagattta tattctaaga gttgctgaaa ctgatgaaca agcagaggca gtatgtaaat     66600
     atattagatt tatagatagc ttaggcttac caattctctt gcttattgat gatgctgggt     66660
     ttcgagccag aaaatggcct caaatagttc gagaatgtgt atcactgggc atatatgttc     66720
     taatgtcggt tagacatgaa gattggttta gatttgctag aagggatata acgaactggg     66780
     aagtcattga gccaacttta gatttagcag aagcaaagca gatatattcg acattaaaag     66840
     cagagaatta tgtacattca aacgctacgt ctcctgaatg ggcatatgaa aaaattggta     66900
     cacctaaact tctaattgaa tatacatatc tacttactca tgggcgcatg attgaagaca     66960
     ggctcagaga tcaaattcag cagattcaag accataaaga agaccctgca aaaattgaaa     67020
     ttctaagaag agttgcactg gccgatactc tcggaacgcc tgtagttgca agtagattaa     67080
     tcaaggacat ttccctaagc tcagaccctc aacaacttct taaatcactg gttgatgagt     67140
     atatagcact agaagagaca ggaatactaa gaggtttaca ctgggttcgt tcaaatcact     67200
     tgacttcgat tcttcacgaa ggatatccaa atatagtaga caccttacta aagacaataa     67260
     actcagtctt agatattgat cgtaaaagat atattgcaaa atcattatgc ataaatgatc     67320
     ttaatctgaa tgagtttatt actggattat cacaattagt ctcaaatgaa gacttaatga     67380
     cttttcttgg cgttgctcaa tgacgggatg actcacgcag gaataggtac ttccccaaac     67440
     ttgagatagt ggatcaatag tcgaattgaa tgcttgagca tgtccaccga ctttgaataa     67500
     cataaagtct tgcgatggag ccgtgccaag taatgtcgta aacgagtatt ttctccctct     67560
     actcgtgtca tgtaggtctt gctaacaatc tggtcaccct ctgggataaa gcctggatag     67620
     acgggattgc catcactgac ccagaaaaaa cattgccaac agacgattgc ttgccataac     67680
     ggtcgaaagg tctcagcact atggtcaccc acaacccagc ctagaatgcc ggggtgaaaa     67740
     tgatccacca cagtccaaat ccagacctta ttgcgttttt tgcccacaaa ggtttcgagt     67800
     tcatctaatt ctccgacctg tgggatatcg tcggggtcat aagcatcggg taatagaact     67860
     ccaacttgtt gaacccaatg aatcacagtg gtatgagcaa cgcctatgac tcgttcgata     67920
     cccttcaacc ccattccatt gacatacatt ctcaggcaga gtcgtttcgt ccaatcactg     67980
     tagccacgct ttgagtaagt tgaaagaaac tgtcgtccac aggtcacaca gatatgattt     68040
     tgtttacctc gacgatgccc attcttatgg atatgttgac caccacactc aggacacttc     68100
     atacagattc ctcatgatgt ttgaaatagt catgaggtta tcctgacgca atccaattaa     68160
     ttcatcccgt cattgagcaa cgcccttttc ttgagtattt agagggaatt tatgaaggtg     68220
     gagaaagact atgttttcag aaaaataaac atctttttga gcaatcatat gaattacaag     68280
     gaacaagagg tccacaattt ctagtcatat attcatcacc aattatcaaa aatgaaaagc     68340
     tagataattc tttagatagc ttagctaata atatagctgc cttagaagat attcagtcta     68400
     tctcgtcaaa ctttgataac tcattaagag gtatagagtt atgcagagaa ttcttgcagc     68460
     aaattcaaga taaaatttca attacaggtg ctcaaaataa ttttgcccag ttaggtaaga     68520
     ttttagactg gtcagcatta gcagaagtta cattacttaa ttggcatgaa ttattatcaa     68580
     atatttcatc gacacaaata atttttgaat tatcaataga tgaattttgt atattttctc     68640
     aaggatttta tcgctatgat tccaaaaaat attgtgattg gtttaatcag aattatgact     68700
     ctattattgg atatttgaag cttaatcttg actgtttatc gcttgaatta tttgatgatg     68760
     aattatattt cgaattctta gttgatttga attctgatga tccgagtggg tatgaagaaa     68820
     caaattcacg actaaggaga tttcgttcag caattccttt ttgtaaacaa tatcaatcac     68880
     atggaatctg gttgtcgata aaaacaccat tatttaatga tacagataaa aatgtgaata     68940
     aggatttact accttatagt tcagatggta ctaaagttaa tacttggcat gaagttgcct     69000
     attcaaactt catacccgat agttattatg attttcaaaa ggcatggaat ctcatcagaa     69060
     ccgatgcaat tgaatttgtc aagtatttat caaaattttt tcgtagtctt cttactcatg     69120
     gctcggatcc aaaaataaaa aatcatacct caaatataga agtttttata actttagata     69180
     aagcactcga taactttcca tctagctatg atgatagttc cgagataatt agttcattac     69240
     taccatgttc cttacaaact atcttgaaaa aagatagtta tacaaataag ttatatcaaa     69300
     gttttcatac atttttttat aaaatgcgtg actctttatt aaatccagaa agtataaata     69360
     acacaaaaga tattatatta aattcattcc tatttgctaa ttattattta ccaaagctac     69420
     accatgaatt tgatacgcta tttgaatctt gtcctgatta cttcaatata aaatcgttga     69480
     actcaattga gaagtctgct tatagtactc tagaagattt gttgcaggca tgtttttcat     69540
     ttaaaatttt tctaattaat gaaatagaaa aagaattaca aaaatcaaga gaatatcaag     69600
     ttcagatttt aactaataaa acaactgaag tatctaattt cttaaaagat attggtatcg     69660
     atacagtttt atcatcagat gtatataatc tgtatgatga aaaacatgat tacataaata     69720
     ggtatttctc tcttgctttc tctgtccata atccattgaa ttatcttgaa gttctcagat     69780
     cagtactcga agctatttta aaaataagta atattgcaga tttcttctgc ctaattcctg     69840
     tttacaaaga aaaattgttt ttaccaccaa gaaatggata tcatattagc tccctttcac     69900
     tacttaatat tctaggtagt ggtgaagatc taaatttact tgaattagta agtattaccc     69960
     attctttgac cattcaagaa ctaccagaat ctactttttc atatctgcca gaactagagt     70020
     atgaagaata tctcccttta acactaaaag gtgaagctgt agcactatat acattagtaa     70080
     tatcacttgt aaaatacgct cgagctattc acagacttat ggcaacaaga aatgattatg     70140
     aagttaagct ttatgaacaa catcttagta aaatctatgc ttttaacagg aatattctca     70200
     ataaaattca tgagttaaaa gataaatttg cttcatactc aaaccagcaa attattgaca     70260
     tgaatttact tagttttcaa caattcattt ataaagcatc tgaaaactta gaaacaccat     70320
     caattgataa tattttatct attgatatat cttctgattc tattgattta tcctaactga     70380
     attcaaagca aaatggtttg aaattttaag aaaggctatc agattaaatg agcgtcattg     70440
     tttatcttta cttataaatt tctttggatg aggtaactca aaaaacttat gacttatcgt     70500
     ttatttgaat gctcaagctg aaaagctttt cactgaaggc attataagaa taaccaatag     70560
     taaactgtcc ttccgagagg gtggaaatag aaagcactcg tcaaggtctg ctgctgattt     70620
     agttgtcacc agcatgtctg tcccagacct ttcgttagca ggggagctgt cgggtgaata     70680
     tgggttgctg catagctctg attgatctac ttagtgtggg gaagatatag ttgaacctcg     70740
     tctaattctc tttcaaggtg gcagcaaatc gttttcgtag caagtcatgg acaaagcggt     70800
     atcgaccacc agtccgctga atgaatcgtt ggttttcggc atggtcgagg aatcttgcgt     70860
     agttccaagg agcgacccct gagtgataaa gggctattcg caaagatagg tgtttacatg     70920
     ctgcatttaa gccgaaaatc aaccctccag tcagccctcc agtcagccct acaatcaacc     70980
     ctccagtcag ctcgttaaat agcccgccaa ctaccccact aatcagcccg aaaattagcc     71040
     aaacaatcag tccattgctg atagagtctt taatcccttg attagcattt gttttatccc     71100
     gagcatcaat ttgagaagct gttattccgc taattagccc aaaaatcagc ccacaactca     71160
     acccgccgaa aagcccgcta cttaatccgc tactcaaccc gccaaatagt ccgaaaatca     71220
     gcacgctgcc cagtccgctt cgatagaaag caccccaaga gaagctgagc ttttctgatg     71280
     ttgtgatatg agtcagtccg ccaaatagtc cgaaaatcag cccgctactc agcccgaaaa     71340
     tcagaccgct actcagcccg ctactcaact tgtgaatcag cccataaatc aacccgccaa     71400
     tcaacccacc aatcagtctg aacatccagc aatactgatt ataagctttg gaagtatcca     71460
     accatgaagg ttgcaatttc tcaattagaa actctgctga tccttcaaaa tctagtttgc     71520
     ttgctaacca acttagatag tgatgtgttt gctttggagt gggagccttt cctttggggt     71580
     atgctcctcg aaggttcaaa tcatagagtt gtttatggat atattcatct agtaattctt     71640
     ctgtactact tatgttttgc cctttatacg caaccactaa aataagtaga aataatggtg     71700
     aatgagctag tttcatgagt tcaggctggc tttgaagtgc ttcccataat gaatctcgct     71760
     ttcgttccgg gagctttagc ttatggagat agtcatgaat ctgatcatct tctagtgcct     71820
     gtaagtaaat tgctccattc aattgcttta gatattcccc ttgttgttca agtgcttcat     71880
     attccttgcg ccgacaacac acaaccaggg gtaaagcgaa tctagttaga aaggcattga     71940
     tttcccgtac gcattgaatc tgttttgcta tccattgttg gtctagaact tcaggtgtga     72000
     tctcatcact cgctactgca cgaatttgac ggtttttatg gaagaaaatt tgaaacgacg     72060
     caaatacctt cctaactgct gagggaatcc aaaattgctg gtgtctgaaa cccctaatta     72120
     aggatttcat ttttgtttgc tcgtaacctt caaatttatg cacatctacc cttctcagtt     72180
     cgtctaagcc atccagcaat ggaagtaact gatgatgtct catccagtgc ttcgaaacaa     72240
     cgaaagggac actatacttc tcaaacaatt gctgagctag ccaatcagca aaatcctgtt     72300
     ctgctttcca ttcggatagt tgaaagatta cgggaatagg tttatcaagt gattgctgtg     72360
     cttggctcag taaatctcta gctagagcta acagttcatt tgtcttacca gaccccggtt     72420
     ctcctaagat caacaaacgt cctttaatac tctcctgttt atagagttct tgagtagatt     72480
     tgctggtact tacagctttg ggtggtgtgg attctaggaa acgctggaat gtgcgtctga     72540
     taaaatttac ggttatttgt tcagtttctt cttcttgagc aggtattaaa tttccctgcc     72600
     caacccgttg ccgttgctct tccctcttaa tgtcaatacg aattttgttg tagagagagt     72660
     cttccaaacg ctcaacaact tgcttgagca agatctcaat tagttcttct cgtacttttt     72720
     gtcgttgcgc ttctgtgatt tcaggtttct tgcgaacgag gtacttttga gcaaagacga     72780
     tgattgtatc tagattgcct gtccaaatag cgatagctgt tgtagccaca gctataacag     72840
     caaatcctgc aacgccccac ctaatcgttg gatttttgtt tagtaaatct attactggat     72900
     tattttgtga gttatccact tgttggacta tgatgttcgc tagtatcctc agcaaatgaa     72960
     ttgtacgtag gctgcccaat tcagaaatta caaacatacc ccaaaagtct tgtgaatata     73020
     acttttttat tgcattgtag ttttaaaagt cataatatag cttcgttttt ctggtgctta     73080
     cccttgagct tcaataggaa aataatttta gatcctaata taaaaattag atccctcaaa     73140
     ctgcctagct taacacttca tcccagtaat ttgaatgata ttgtacaatc taaacttgat     73200
     cgtaagagat agtaaaatta ataatgaatt tataaatgta tctgacaaaa aaattaaaat     73260
     agaaaacttc gaaatatgtt gataggtaaa ataactaaaa ttcactataa atatgaagta     73320
     tggtgcctaa aatacgctgc tttaacatta gcaatgatga gatgatagaa tactccttaa     73380
     acatattttt taaagtaatt aatcatttga tatgttattc aaaattagac tctttgttgc     73440
     aggattaatg ggagcaatta taacatttat aggattttac atattattag ttttgaccga     73500
     cttaattgtt ccttacacta gtcgattata ctttctgcat ataaatacta ttttgcagat     73560
     attaattggg ataatccaaa tgtttgcttt aattggtcta ggtgatattg ttggtagatt     73620
     tgtatcattt tttgcaaaaa atagatcaag taatttgaca agaaaggtag caagtttttc     73680
     ctatctattt ggctgctcta ttgtagtaat tttctacttt tctaatttaa aatcagaaaa     73740
     tttatctagg aatatatttt tcaaggccgt taatataata ctgtctctta ttccttccat     73800
     aatacttacc ttgaggacag gaagagtaga gcctttatat acatggattt tgataattcc     73860
     tagagtaatt ggtatgtatg caggtagtac ccaagcctac gaacaagcaa gctaattgat     73920
     cgtagctatt gacttattga tgccttagct tacgagatgt taacttttga ttttgttagg     73980
     ttaattttct ttattcgcta atgaattatc ctaacaccta cttattcttt aagttcactc     74040
     ccataattaa ttcaatacta ccaatagtct cctataaatc tgtcaggatt agttagccag     74100
     atttcatgaa ttagccattc cctcctcaaa ctttctgatt tttagtgagt aaggcaatac     74160
     atgtcaaacc cctgaccatt gcagccagag gttttccttg tattctctgt tacttacgcc     74220
     accatcccca gcggatcggc tggcagctca atcacctgac ccttccgact ggccttgcag     74280
     cccgctagca actcctccca agccttccgg gtgctgagct tgtcgtggga aattccccag     74340
     tccttcagct tggccttgag tgcattggta tcgcttacct catagtgagc aagaacttcg     74400
     gttttgatat cactgagctt ggtcttggtg gccttggcat ccttccaggg ttgattgtcg     74460
     atgtcgaagt aggttgccag tccaagccag tagccacggg tacgggcatc gttggtatca     74520
     tcgggccact tagcggaaac ggcctttcgt aattgggcag aggtggcaaa ctcgccttca     74580
     aaacctggct tgctagaggc agtagctgcg gcaagaactg cactctttag agcggatagt     74640
     gtgtatctca ttgtttaata ctccattttt gtagtgttgc ggatggtccg cattcgggcc     74700
     tcgtctaacg ctctgagggg cgggcgttta tcgagatgcc ttctcgctga tttcaagggt     74760
     tatcaggaac cttttcgatg taattagtat aaatcccctg atattgggaa tcaaggactt     74820
     cacactagga atttcttatc gattctcttg gttgaataag caaatgctag tgtgctagtg     74880
     gttgcaacat acttgagact tttatctctt caaagatatc ttggtatggc cttgggtaca     74940
     ctatgtatat ggctaaacct tttttgagaa ggtcaattag cttcgttcga ccgaaaaaac     75000
     gatgcctagt cccactgaaa gaccaaatac agattatacg aagcgaaaca atattcgtag     75060
     aattgtcaaa attgcatgtg ctcctttact ttataaggtt ttagttgaga agagagacct     75120
     tgcgggtgag ttggtcagag atgcacaagg gaaaaaggtt cttgaagaga taccgctaca     75180
     ggatgccact agcgctcagc tttttaatca ctatcgccac aatgttacta attacgagga     75240
     ggctatagat ttaattaaac agtctcagaa tggctatatt agcgataagc aggtcaagtg     75300
     gtgctctgct gcttctgctg aagtggttat ggctgtttta aggactgagc atgagatcac     75360
     gttagagaaa tactttgagc tggagagtga ttttcaagat attattgaag ccgctcagac     75420
     caataaccta tttgatatta ttcaactgat cagacagtca gtcggtaacg ctgtggagtc     75480
     tactcttcaa aagtcattaa tcagagcgaa taatagtaga aacacgtatc gtaatgagaa     75540
     taacttacag cgttgcaagc tctacctgat tgatgacact gttaaccatg aagatgatct     75600
     tagtgtcatc agagaacggg taaacatagt tctaaaacag cgagggacaa acaaattagc     75660
     tgaggcttgg gcgaaattaa ctgactggga aagttctgag gttattgagc ttttcaagcg     75720
     tgaaggactt attcgagacc taaaaaaatt ggaataagtc tatgaagaaa atcaaagaat     75780
     tgaagtcaga ggtttttgtc ttactgaatg ttacttctac aattcaatta aagaaagaat     75840
     ataaatcaat agccagtggt aaggatttcc gcttcaagaa aacgtggatt gaattactag     75900
     agagtcttac taaatgtatc gacttgaagg catcggctaa ggtaattaaa cagagtatgc     75960
     atcgagttgg ccgggctgtc ggcaactcct atcaacagac agaagagcag atagcaacta     76020
     taaaagagcg cgtacggctc aaaaaaattg ctcaagggaa agatcgtctt gttggtgggg     76080
     gaatatgaga tttacaacgg cgaagtcttt aatcaacctt gatcctctac ctgaaatctg     76140
     cggtatatat tttgttgtga ctgcggaaga tgaaattata tatgtcggcc aaacaacgaa     76200
     tctcaaaaat agatggaaag atgggcataa ggttctcaag cgtatgcttg cagaaggtat     76260
     agacccaact aaagcaagat tagagtggca aaaatttcca aagcgcctgt tgaacagagt     76320
     tgaaaactgt gcagtaaggg ttcatcaacc acgtcttaat gaaaaatctc cacctgtttt     76380
     ataaatcttc cacaggatac tttagattta ttttagtaga gaatgtattt gtcggattct     76440
     ctaagaaata aatatgtata cctataataa cttagatttt tggcctgggt gaagctgtta     76500
     aaccctttgg ttattctagg ctcaataagt ttcaaaatat atttaaagtt gaagtaatcc     76560
     ctgggaaata cttgatgaac tcactaatgc tttaatctca aatgttatga ataatccgtt     76620
     aatttactta ctagaagttg ctaataacct taatagtctt gcgtttggat actatagtca     76680
     aggacggtat gaggaagcaa gccctctcta tcaacaagcc ctggagatat accagcagct     76740
     agattataaa catcttgatg ttgctagtaa tcttgacaat ttagcaagaa tcaaaatgta     76800
     tcagtttgga aatcttgaag aaacagagtc tctatatctt caagcgttgg agatgaggca     76860
     gaagctcttg ggtacaaatc atcttgatgt tatagcaagc ctcagtaggc ttgctgactt     76920
     ttacttcaag gtaacaaggt atgaggatgc agaaccattc tacctacaag cacttaaaac     76980
     aagtgagaag ctacaaagta atgaaactac tgatattgca gatttccaga gtgccttggc     77040
     actaaattac tcaatactag aacgttatga ggaggcggaa tctttctatg tgcaagcctt     77100
     ggagatgagg cagaagctct tgggaaccga acatcctgat gtcgcgacca gcttcgaaga     77160
     tctggcaggc ttctacaaat atcaaggacg ttgtgaggag gctgaaaccc tttatatgca     77220
     agccttagag ataaatcaga atttttttgg ctatgagcat ctcaaagttg cagcaagcct     77280
     cagtagtcta gcaggcttct atttctacca aagacgttat gagaaggcag aatatttcta     77340
     tgtgcagtcc cttgagatac aagagaagct agattctgaa gatttttgtg acatatgtga     77400
     tcttcagaat ctagcgcaac tctactatga ccaaggaaaa tatgaggcag cagagcattt     77460
     ttatgccaag cttcttgtat attttcaaga actaaatgga tatgaagatg atagtgcagt     77520
     tacagctcaa agaaatttag atgactgccg tcacaaaata atggagttaa atacttagtt     77580
     gtctgttaaa tttaatttag atgttcagct attcagtata gctgaaactc tttatcatga     77640
     taaatacgct agtacaaaaa tatgtatttt agtgcaatgt tttagttgct acacatctca     77700
     aaaaatagag atttataaca ttaaaagcta gaggttttta tattgacatc agattgataa     77760
     gttgatgacg cagctataga ttagggcttt cagtcccttc tttaacctct agacttcaag     77820
     tctagagtag ttaagttttt aaaaaaaatt ataaagtaca ttttactctg tttccaactc     77880
     cccatatttc ggactccacc accgtccctt gctggcaaaa taaacggcat tcttatgctt     77940
     tttattagtc cttgcctttg ggtcagaaca cctgagcatt tgcttgggct gactatcctt     78000
     ctcgtaccta taaatctcca gcttcgcctt gcaaactggg catgggtaat ccgtcagttc     78060
     tgctggtgcg gtgggctggt cagatttggc ttttggtaat tgccagctct tgtcccggtc     78120
     agaccagaac atcaccagac cccgaccatc atcagccgtg cagccgtcct cacacttgag     78180
     gaaatgcccc tttttgacct tcttgctggg cactttgccc ataggctggc tacatttagg     78240
     gcacttggtt ctggacttct gcaaagcctt ccccccatta ctgccgtaag aggtgggttc     78300
     gggtaaacct tgcttagcct tagccagggc tggagcaaag tagctccgat tccagccgat     78360
     caaatagtct tgccattcct gattcccttc tgagatcgca tccaaggaac tctccatctg     78420
     agccgtgaat tcagcctcta ataactcagg gagcgcccca cccatgaact ggtcaacctc     78480
     aaggcccata gaagtcggtt ggagtctgcc tttgataagc gtcacatagc cacggctttt     78540
     gatggtcttg atcgtggggg cataggtgga tggtcggcca atccctttct tctccatcag     78600
     ttgcaccaac ttcggttcac tgtaccgaga ggggggctgg gtctgcttct gctgagaatc     78660
     ggcctgggcc agggtgaggg gctgttgctc ctgaagagtg ggcagctcag tatcggcctt     78720
     gatgtctttc cagtatttcg agtagccctt gaattccacg agattcccct tagctttcca     78780
     ttgaatctcg ccagattgac tgatgacaat ggtctttcgg atctgagcgg gtttgcattg     78840
     ggaggctaaa gcccgtgtcc aaatcaatac atacagcttg aactgatcgt cgggtagcgc     78900
     ttgcttcagt tctgcggagg gtttgaagat gtccgtgggt cgaatagcct cgtgcccttc     78960
     ctgggcttgc tttgagacct tctgcttgga tactttcttg gggacattat cagcgtcatt     79020
     ctgctccagc catcgcttgg ccgctaagca gtagtctggg gacagcgcga cagaatcggt     79080
     tctcatatag gtaattaagc cagcctcata aagcttttga gcaacctgca tggtctgctc     79140
     tggactgaac ttgagacgtg aacctgcggc ctgctgtaag gctgaggtgg tgaagggagc     79200
     agggggcttc ttgggtgtga ttttgccctc gatagagatg acctgatgag ggttgctacg     79260
     tgcgatcgca accaaggaat cggcctcagc ctgggaaagc actcgtgtgg attcttcggt     79320
     tttggtctct gaaccagaat catcaatgct gtgttcgtcc tggccgtttg cttgggtgct     79380
     tccgtgatag taagccctga agccctcggc gtaatccacg aagaccgacc aataatcctg     79440
     gggaacaaag gcttgtatct cccgctctcg ctggcaaact aaatgaaggg tcgctgattg     79500
     gactcggcct actgatttgg ccccattgtt cagtcgccag actaagggag agccacgata     79560
     ccccacgagt ttatcgaggc agtctctgca acgaccagcc tcaactaaat ccatgtctag     79620
     cgattttggg ttagagatgg cctgtctaac ggctcgttct gtgatttcct gatagacaac     79680
     ccgcttgggc tgcttgagac ctagcacctg ggcaacatgc caaccgataa cctcgccttc     79740
     ccggtcgggg tcggaggcaa tgaaaatctc gtcggcttgc tgggctgcgg ccttgagatt     79800
     ggctatggtc tttttcgccc ggtcatctct gggttcgtag cggcatttaa ttttgccgtt     79860
     ttcagcaaca aaaccaagat tgtcggtgcc ttcatttgcc aattgccgta tatgtccaac     79920
     cgatgcctgg acattccagc ctggaccgag gatggagcgc agtttcttga ttttgccggg     79980
     ggactcaacg attaaaaggc gagacatgat cattcctctt tgatgctttt tggaaacata     80040
     cccagaaaat catcgcttca gttttggcac ttaccgtttt gatgatgact tcaggcagat     80100
     actgcatatc tctccagctt cttcattatt ttgttgagga ttaatcgtat agcttcatgg     80160
     ctcaatccaa tctgttggcc gatggctttc atcgacttgg gttgattatc ttccaagcca     80220
     tatctctggc tgagtacaaa tcgttctcgt tcatcgagat tcgccattac ctgagacagt     80280
     tcttcgtcaa gttgcagtga ctccatatac tgagtaggct gatcatctcc agccagtaaa     80340
     tcgaggagag aatctttttg ttcaggacca acgggctgat cgagggacga taccttttgg     80400
     aataattgca gggtacgatt aatggttttc ggcttgatat cggtggcttc cgataattct     80460
     gagagggatg gttttcgacc tagtgtttga ttgagttctc gatagtgctt cttgattttg     80520
     ttggccttat cccaatgatt atgaggtagg tagatgggac gtgatttttc tcgcagtgca     80580
     gccgtaatcc cttgtcgaat ccaccagtag gcataggtgc tgaaacgaca accttgggca     80640
     aggtcaaact tgtctacagc agtacttaat ccaatgctgc cttcttggat cagatccagc     80700
     agtggtagtc ctcggttctg atgtttcttg gcaatagaga caactaagcg caggttgcat     80760
     tcgatcatcc tttgcttagc ccggaggctc cccgcttttg cttgtctagc cagctcaatt     80820
     tcttcttcat gggaaaggag aggatatcga gccatttctt tgaggtagaa atgaagactg     80880
     tcatgtttgg tagccatcat tgaacctggg aaacatcact ggtagagaat taccctgaat     80940
     tgcctggtat gggaaggata attgatgttt cttaaggtga aggcacccat aaggaagctg     81000
     acagaatcat agcaatatct gccagcttgg ttgagtagga ttcgagtgat tgaatttgac     81060
     gtagttttag tctatcagcc cttaacctta tctttgaagt ccttacccgc actgaatgca     81120
     gggactttca ttgctgggtt tttcatggct aaccaaaaac tccccagcat aagaccttgc     81180
     tggggagttt gttgcatcag tatttcaatg gactaagcaa ccttggtcaa atgaatgtgt     81240
     ttgcgaccga cagcaatttc aaattcatct ccaggttcaa gttccaaggc ttgggtatat     81300
     gtacggccca ccaaaatatt gccattggat tgaacgctga ctttataact ggctttgcgc     81360
     ccactattgc cgtttccgtt aggagattgg ctatctaaat cgatgccttc cgcatccaat     81420
     agagcattga gaaacgcgat agttttaatt cgctcagagc catctttatc attagaaaca     81480
     tatccgcaag ctttcgcttt ttcttcacga gtgtaatcac tcagttgttt tactttggct     81540
     actaagtctt ttcctgttaa gggtttagct tgctttttct ttctcggcat gggttaaaaa     81600
     atctctctag cagtatcacg atgaccacta aatgattgca tatagtttta gatttatggt     81660
     tagcggataa ccgatccaat tagtcaggat ggcattggat atcgaatttt tacataagaa     81720
     gcttcaactg aaataagatg agcgattctg ttagtaactc agctctaaat cttcgataat     81780
     tccttggttt taaccgtaga cccagaattt tgcccttgag tagcatcctg tttgtaaaag     81840
     tccaagtcca gagccgaacc aatgacctgc ccgttcgcag atatctcata ccaacgactc     81900
     gtaaaaatat tctgggcaat cgttgcatga gacatcccac accgagatat gccttctggt     81960
     ttttctttca gaggaatacc tctaattgga tcacgagtgc tgggcatttg gaatatcttg     82020
     tcagttgtct cctttagtgg ctgagcattt atctgctccc agatactgcc ttacactatg     82080
     ggcgaagaga aatctaaaga agatcataga tttcccttcg cttaaattag agacttgaat     82140
     acaaagatga acgactagtg tcagttgttt taggagttgt ggctagcctc tagtgcagcc     82200
     tgtgatgttt cccccttgtt tagaaggttg actttgacaa ctttgttctg ctcctcttca     82260
     actttaggta gcctaagggt aagaagacct tgctcaaaag atgcctcaac tttggtgttt     82320
     tgaatagcaa caggcagttt gctggctcga cgaaagtgac cataattgat gtcagagaat     82380
     aaccgcttgg ttccttcctg caggtcttca gggtgacgtt ctccagcgat agaaatagat     82440
     tcacgagtgg cttgaatatc taagctgtcc gcattaactc caggtagaaa ggctttgaga     82500
     atcagggcat cacccgtgtc ccatagctct acggcaggtg cccaactcgg ataatttgaa     82560
     gatttgcctg tatcgatggc atcctcaaaa aggtgatcga gttgtctgcg aacggtatca     82620
     atttcttcaa ttgggttcca gtaattaatc atcatatgat ttttacctca cagttacttg     82680
     caatcgaata gcgaaaacaa tcgctttctt tgtgttgcat ctaatatgca atatctggcc     82740
     ttcgttgaga atcttgagaa ccccactttt catgtcgaga aaaccctaca tatttggcaa     82800
     tgactataag acaataactt tcgggagagt tgattattgg agtgagttta tttcgagttg     82860
     acttaattca gtgtcaatgg ccgggtttga tcattcatca tgccaaacca tgatctcaac     82920
     cccaatactt cacacctaac ttcccctaaa actcccacca cctgaacaat tactgggaaa     82980
     acttaggtct gatgatgttc tagaagtgaa cccaagaagc tccaatgaat aatccgaggg     83040
     ttaagctgag gataattgcg ctttttcggg tcatagattg ctcacccgtg tattttttaa     83100
     gcagcagttg aactctgaga gctgaatagg agtagatcta aaatgtgtct tagaattagc     83160
     tttctgtaac ctctccaagc tagtgatagg ttaggtttcc tccatgcttg gggacggcac     83220
     ttgaagcgat aaagctctga attgtcctgt cttgattgat gcgattagca gcctaatctt     83280
     taaccatcat tgagatctct gattgcgctt gcactaaatt taaccagcaa tgatcgggtg     83340
     cttgctctag gtcattaatg atctcctcag aatacttacc cgttaatata aatgctgttt     83400
     gaaatcccat ggcctttccg ccccctaaat cagagatagg atcgtcgctg attaacaaga     83460
     tctcttctgg actcaggtcc cagtctaggg ttgctttcgt aaaatactca ggactaggtt     83520
     ttcctagggt tttggctttt ctacccgttg aatattccaa tccagtaacg atacatccaa     83580
     catcaggtcg agtaatgcca tttgcatctt tgaacactcg atttttatgc aagcagagga     83640
     aacggctttt ttcatgggca attgctgaat atgctgcatc aatattgtga ttgttaatgc     83700
     tatatccgcc accacaaatc acagcattaa cgttaggggt gtcgtctacc tcaacatcat     83760
     gctcttgtat gaaagttttg agcgttgggc taccgattac gagagctgtg tcgatattca     83820
     gtagttcgct cgataagaat tgaagaggtg tgagcagttg atttgcctca atagaaagct     83880
     ctctttcatt gagaagagtg attagagtct caggacgttt aacagtgtta tttgaaataa     83940
     ccccaaaggg tagttgattg agacgacaaa aatctattag ttctactgct cctattagca     84000
     cttcatgagt cttagcttta agcagtacac cttcgaggtc gaataatatg ccagatacac     84060
     gcatgttatc tcatacccat aaatgatgag ccaggtcgtc tatctgacta ctatcaagct     84120
     ttgtcgttaa atctaaagct ttacttcgtt attcttcata tctatctaat gaggagcaag     84180
     aggcttcaga tccttctgta taaccagtat cgatctcagt aaagcaacct acctagcaaa     84240
     tcattcacgg aagtctgcca tagttcaaaa tcatctgaat tcttccacaa ctttttgagt     84300
     tcagactttt ctgaaatggc ctcggcaaca tatctcgctt gagatatcat cgttgcgggt     84360
     ggggctggcc gtccttcaac ccatacctcc acctcctctg ggcaatcttc agtaggctca     84420
     cccatccaag ctgccacaac ctccaccgct gcaagggcaa ccgcacaatc tggggcttct     84480
     ggggactcat ctgcttggtc gatgacggtg tttagagcat caatgatcgg attgtcgtca     84540
     tctgaatcgg ccagttccgc catccagtct aatgcgtcgt cattctcgaa gctgcctggt     84600
     ccccatatgc tcatcgctta tcccctggtg agttccaggg acaatttacc gtgaggacag     84660
     aggataagcc aaggaatgcc gtcttggata cagtgagagt ggggcaagag ttctcttggg     84720
     aatggtcagt gatgtcatca gcaatcttga taaagctgaa tgggttgata ttcagaaact     84780
     aagagagact caaaaatcaa gcaatgccaa gcatcgggtt gccaatatcc agtaattgag     84840
     gaggcacgaa tatgaagaaa ctcagcgatt atgcaattgg agtcttcttg atagttattg     84900
     ctcccctggt aatcgtggtt gcaggattcc tttacatcga ctttgggcat gttggaccgc     84960
     ccacggtcga acagttgctg gttaaatatc ctacgtgtga acagcgagga gaatttgtag     85020
     caacacacat caaagaaagt cagacaacgc caacggcatt gatcaacaga ccagccagag     85080
     acctggatgg tctatggcag cgatatcgag ctaaggtcga gaacattctt gaggatcgag     85140
     atgaacgtat atttgcccat actctttaca agctaggtag cggctgttgg cacgattgaa     85200
     cttcgcgttt agttgagtct gggtagggtt gaatctagaa agggtacatc tccgctgctt     85260
     gcagcgaatt actgggctta ccatccaaat cgacggttta ggagtgaaag atctttgata     85320
     cctcgtccgc ttgtggaaag gtggttaatt tgatcttaga ggtctatgct gttcgcctct     85380
     atgcgccacc catactattg gcttgtatac tcagcgttgc tcgaaaggtt attgcacttc     85440
     ctagtgggtg cttgccaaat cgatctcaat cgctgtaacc cctttgggtt gatatggatc     85500
     ttgtcttcta tcagtttcaa ttcgccatta gcaaaggtcg aaccagccgc ccagagaata     85560
     ctcgtaaagt cgtcacgttt aagagacgag ggagcgtata tcactagacc ttcatcggat     85620
     aatatttcat atattttctg catggtagct ggatactaag tgtctagtgc tcggatatag     85680
     agtgagagca agggcatggg attattcgtc ccgaaaatgg cataacagat gtaggtagaa     85740
     gtagtcacca tccaagtcgc tatcttatgc ggatcggtgg tacggtcacg agccatctct     85800
     aacacgagat cgaccatatt ttgcctgaaa ggagcatcaa gacgagtctc tatgtttttc     85860
     cagagggcta ggttaattgg atccatataa gtctaatctt tttaattaat atttctaagc     85920
     tctaatcttg ttgtagctcc ttcagtagat catcaaggtc aatatcatct agctcgtcaa     85980
     tctctgacaa gatatcggtt tcatctatag gaagattttc tgtttctaac ggtgacatag     86040
     ttgttaattg ctatatatac ttatctattt atttccctat agtaaataag ctcttgtgga     86100
     ttctgtatcc gaaagttcac ggaaatccag tgatacaaga tgggtcagat ccacatcatt     86160
     ctctggcaac acggcttgct cgaccttgag caactggggc aaaattttga gtggcgaatg     86220
     agcaaacagg tggagtcggc taagcaaaag tgtccagtcg gtaaaaactt ggtggcgaaa     86280
     aacaggtaaa cgccaggtta ggcataggta tgaattaatg ctggattggg aaaaatgcag     86340
     cgggagatac tttaaaaaac tctgccaatt cctgtatatg ccttgctgtt agctgtcttc     86400
     gttacttaaa gacatctgag acaattgact ctgccttaaa gataggcact agatctttct     86460
     gccttagccc tctctcctcc actagaacct tcagcaactc gaccccatta atgtcaggaa     86520
     taggttctaa ggtctgctcg tattcccaaa ccagtgttcc caagatgtcc aggtagtcag     86580
     attcatctga agtgagttca cgctctaaat caataagagc atcaattcta ttttgagcag     86640
     cttgtagctg gctatcgtta tggatgggtc gaggtgggaa ttcctgtatt aatccttcat     86700
     agctaggtgc atcattgatt ccaaggatca tttttccatc tgcctttgtc atattcggca     86760
     tggggtaaaa cgtcaggatg aaaacgaaca accccaaaga tgttaaacgc tggtctcata     86820
     tcttagaaga tgcttcttct atgggtttga aatcgattga aaggcccact gcattcaaga     86880
     ccgctgccaa tgtctccaaa gttggattgc cattacctga taagagtcga tgaagatgtt     86940
     gtcgtgtgat gtcggcagcc gtagcaatat ccttaacttt gcccttggct tcgatcacat     87000
     tcttgagtgc caacaaaaat gcttctgtat tgccgtcctc aagggtttcg tccagagaaa     87060
     cctttagata tctcgcggca taatcggaat ccgagagtct aatcagtagg tcatcttgat     87120
     agctttttac gggcatcgtc taagctcctc cctgttcatc tttgtaagca gcccatagct     87180
     tttgtgccgt tttgatatcc ttattttgct gttttttgga cccacccagg agtaagagaa     87240
     tgatctgccc tttcatcttg ccaaaataga gtcggtagcc tggcccgaaa aagaatcgca     87300
     attcatagac cccttctcct agctgcttgt gatcaccaaa atttcctagc ctcagtcgat     87360
     ctagtcggac atcaattctt acttgggagt tgggatcaag gttgtcaaac cattcatcaa     87420
     aagggcattg accagcaacc gtgacatatt tttgaatgtc ccactgctgc tgattcatgc     87480
     tatctcctat ttataagtgt cgcataaatg tgacagtaat agccatcttc aatttttagg     87540
     ttgtgaacgt atccctgatg ccactacctc tcaaaattcc tcgatagcct agtgaagcgc     87600
     tagaggcaga ccccagaaat tcctaggata agtccaagga tagggctgta gtttctgatt     87660
     ccttttccca gtactttcta agaagttggg tttccccctc gacctatttc tccatctcta     87720
     gaaagaagat agtcaacggc acgtttaagt tgttttgctt cttcacgagt ctctagcatg     87780
     gcttcagata acacacccat ttgagcttgt aatcccagtt gcccttccat gagacgttca     87840
     aaggcagatt gttgcttttc ctgcacttgg agaacacttt caatggaacg ttgctgattg     87900
     tcttgaatat tgaccaagcg ttcaagcatt tgttcaatgc gatccagtcg atccggttgg     87960
     ctagcagtca tatttgaaca ccctcaacgt catcaggttc ccagtcaatt tcaaccaagt     88020
     cagcaattgt tttcagtcca aagtatttgc aaagctgggt gacggtatgg ttatcaatcc     88080
     ggtcaaaatg tccgcgatag atttttccaa ccgtagtcgg actaagcccg gttcgagcag     88140
     agagggtttt ttgatcaatc cccacctgtt ccattaattc tggcaattta gtaatcactt     88200
     tcataactcc atcgtactat ccaacgataa cacgatatca gtttcatgtt gacatgatat     88260
     tagtatcgta gtattatcag ggcataccga aggaaaagga aagcgcctca agaaaggctt     88320
     ccaccacaac taaagaccgg gcgacagcga ccttccccca accgctagca accacctgaa     88380
     gctggtgccg cgaccgtaag gcgatgccct ctaaggctaa aaactagaga cgattcaaaa     88440
     aactttcatt gacgagagcc gctgggattc cgaccaagaa aaaacagcgg ctctcctagc     88500
     aaacctacta agaggtatta gccaatgtta accgatacat taacccaagc ttggcaaccc     88560
     tggactgacg ctgagctttc agagcgtaat aagctaactc ctaagaaatg gctccaagtc     88620
     cctatccaga atggctatca gcaccagcct tgggaatctg gagactctcg tcatttcacc     88680
     tctgacacac atccagaaga cacctggaac taactccagg tcaagcaagg ggcatttatt     88740
     gcccctgctt cattacagga aaatcagagg acataattat ggcaactatt gaaacaaccg     88800
     cactatcccc cattgcccaa cttaatgacc gatttcgcca aggcgactac accctaggcc     88860
     aggtcttcac cactcaaggt gtccaggctc tttcatcagt cgttcaacag gaactctttc     88920
     gactggtccg cacgttcgat gagtttaccc caggaaatga cccgtatggt gagcacaatt     88980
     ttgggtgcat aaaattgaat ggcgaagtct tcaacttcaa aattgattac tttgccccgg     89040
     atctgattca tggttcagaa gacccagggg atttatccaa gacaaccagg gttctgaccc     89100
     tcatgcactc cagcgagtac taactccgca tttcctcttg tatcctggct tccgggctgg     89160
     ggtgcttctc attctcggtt gatacaatga caataaccaa ggagcctctg atgacagtat     89220
     caaaccctga tcaccttgac cgcattgaag agttactgac tggctttggt gaggatctaa     89280
     atgcccttaa agagcaaact attaaaacta atgaaagggt ggaaatctat cagaaagcta     89340
     gccaacaggt tgtgaatctg gcctttggcc tcatccttac tgctgcgctt gcaatcatca     89400
     ttccggttat caccaacagc tagctcttat cccgtcaccc caatatttgc aacgccctgg     89460
     ctctttctgc cggggtattt tgccatgtcc ttttctgaag ctggacccat gtctcctgaa     89520
     atcacatatg cctttgtctg ggttgaggac caaatcagga ttccccgctc ccacggcttg     89580
     ataccagctt ttctttcccc tgattggtta agaccttgat taatatgtac ccaaatttac     89640
     aacttgattg ggtctataaa tgtagtctaa aacctaacaa taattagcat tatctagtat     89700
     ttaagcctca atacttcatt tttgagtttc ttctctcacc gattgggttt gtcactcgat     89760
     cttcggttac tctctaaaac cccggcatct cctgtccggg gttttccctt ttaaatcatt     89820
     ggagggatat ctccaagcct tgcaacccaa ttaaaagtac ccccttcccc aaaaccttct     89880
     ctttgatttc ttatctttac taatcagctc cttggtatcc cccatcaagg ggcctttttc     89940
     atgatgcccg gaggcaattc catgaaaatc catgttgctc aaatcctgac ctggaatggc     90000
     cgcacgttct aggtgattga tttgcatcag gcccaaaccc aggaaaacct tgggtcggtc     90060
     atcagggagt acgtggctgc gatgggggtg cggttagttt actggagtaa ggtattgtaa     90120
     tcctggtctc agcggatgcg atcactggcg gttcatttgc aatcgcatcc acctacaagc     90180
     tagctcaaat catttccctt gcttcacacc tattaattac ccctggctta ttcgctgggg     90240
     gtttcgcgta tctggagaaa aaataatatg accgtttcag taccaccacc cacattgacc     90300
     tctgagtctc caagactttc tcattcttca ttcaaccgac cgctaggctt aggtccaagc     90360
     cctagtggat tggcaatatt ctgtaatcgg gccaacacaa aaacttggta taccctcgat     90420
     gctaataccc agccacaaga actggaatac ccagctctaa cagggtactt ggtgagtata     90480
     gaatttcctc caaaagaata tagaggcgaa aagagtcata agcttcgatt caagatgcag     90540
     gctgatcggt tgtataccct ggaggcaggt tataagtcgg tgttcgctaa gggattcctg     90600
     agtgagatcg caatgcttac cccagagcaa ctccgacaac ccatcactat tgaagcaacc     90660
     ccttccgatc aagaggaaaa agtgttgttt tgttctgtgt ggttgggttc tgagaaagtc     90720
     tacttccatt gggatgacca aacaaattgg aaggcgattg ctcaaagagc tatggctaat     90780
     gtggccggga taagcggtta acgactctca tcagagatat ggaaaagggc gaccaggagt     90840
     gtagtgtgtc gccctaaaag agattgctgt tcacaatcgc atcagaattt accacgacgg     90900
     caaaataatc cgtgtgatgt tcacaaatct tttgctgtcg aaccaataga ccaataaaaa     90960
     ggcgattccc tgttaaaaga ctcgccttca gttgaagcaa ttaattgctt ctgtttccta     91020
     gggagaatct atcatgccaa ccgaaactag aatcccaacc cgaatcaggc ttggagattg     91080
     gaacgtgcag aagaaagcag gggcttatgt cttgaagact ccactcatga cgcactgctg     91140
     gagatgcaag caataccacc ttgcgatcgc agctctgcca gtaagtaatc ccaagcaaac     91200
     gcaattcaag tggttctgcc aagaatgcgc tcgtaatctg ggtatccaac ccagtcaaga     91260
     actgctgaag aagttaccga caatgcacac cttacatatt caacatcgca agactcagat     91320
     caagcgattg cagaatatca ggtgggctgg ggttgatttg gaaaaatgcc atcaggctgc     91380
     aatcgaaaat cgaactgatg ctgtgttctg atgctttact ctgcctcata ctttgaacct     91440
     cataaccatc atggtttgtt ggtatccatt tcgcgatctc atcctcgatc cttccaggtt     91500
     gataccaagc tacccttcct ggctccgtcc caagcactgc ttgatgattg gaagcatcac     91560
     cagctcaccg aggcaggata tatcgaccga tatcgtcagg aactccagca ggcatggccc     91620
     caggtaaatt cttggttagc ctcccttacc ccagagggag attgcaccct attgtgctgg     91680
     gaaaagacgg gcgagttctg tcaccgaaac ctggcaatga aggtggttcg caagcatcga     91740
     cccgattgct acggtggccg cgatatctcc gctgatccag ggctgcaatg ctctaactgc     91800
     caatctctaa tcattcccgg tgttgatcag agttattgcc ctcgctgtgg cgagtggatt     91860
     cctacaccga tataaatatt agactcagct acacctcgaa tatcaagggc aacccacggc     91920
     aagaaagttg ccctactaca acgcatcagt ttccgctaag tgaaatttac cacgtctact     91980
     cacagctaca tgcggctccc ctgctggtaa agcgatagcc actacagcag aatcacgacc     92040
     tcaacagaag ggtggcaact ccatcctttt gtttgcttat gaatagaaat aggagacagt     92100
     cccatgatcg aagtactgga attgtgggaa gtgggctgtg attggatcgg tggcttgcaa     92160
     ggctgctatg ccctcggtca ttttgatcca gccacttttg ctcaggctgt cgatccagat     92220
     tgccctgctg aagcacatca ggtccgtcat gagtactgga tggagtactt cctagaacca     92280
     gacggtgatt gcatctgctt taggaagtgc aatgcagata ttgagggtgc gtttgccgtc     92340
     acctatctcg aaattgaagg gtaatcacaa cccaaattaa ccaattgaat attggaggaa     92400
     aatcccatga gcaagttagt gtactcgcct cagcatcacc tggtgtactt cctcggaacg     92460
     ctcaggagac aaaacggcac ccgtctcaag gtgttctcaa cagtctccag acagcatgtt     92520
     ctgatgattt ccaaggacaa atccgggaag tggagcaaga acttcaccac ggtcaaaatc     92580
     acggatttac gccctgctgt ccgactcagg ttgtgttgtt aggggcagga tcatgagcgc     92640
     tactcagatg gccttgcccc tccaggtgcc tggcgcctcg acgctccctg atttgtccac     92700
     ctatgaccat atcttggttg ccttctctgg tggtaaggac tctatctgct gtctgctgcg     92760
     actactggaa ctgggtgtac ccgcatatgc ctatttgttc attggctgcg cccactggtt     92820
     tattcccgta gagtttgcat agaaactttt cagcgtattc cagacgggca aggtcaatgc     92880
     ttgtccgggt tgggtgaggg attagcgagg ttctacactt gtttctatct agctcctttc     92940
     gagaattgat tcggcggctc cgctcaccca atgctcaaat ccaaaacatt gttcacaata     93000
     gaagtgagga tatcaattca ggcgaaagaa tcctcctaga attctgagga gagagccatg     93060
     agcgagtatg gcgattttaa taatcatatt cctacacccc agcttgatcc gcttctgatg     93120
     ggagaggtta tgggtgcgga tgccttttca gaaggagatt gggtattgct tcgttccgag     93180
     gggaacaagc ctacgaaagt gacctgttgt catcatgact tgatttttgt agatcaagga     93240
     atgggagaga attttggaga ttctctggtt aacttttacc cagaagagct agggtatcct     93300
     ctggatcatc gcttttggag cagtcatcag aagcgatgct atctccgttg ttatattgat     93360
     ccacaactaa acacacgatg gaaagcactg tcatcaacac cattagagca agaaaagaca     93420
     aagcaattat gcttcctggg gcttttcttg agtttgatag ccttactttc taaggtgtgt     93480
     gattacattg ccagagttta ctcagtctca acgttggttg ggctaagtca ttgaatccat     93540
     ccatcagact aaatccccaa caccagttgc acttgccgcg catccctcgt cccctccggt     93600
     aacggttctg gcttcttgga cttcgcagga cagtacttct gataaccaca gtggttgcag     93660
     tgcccaccaa cttccggttt ccactcatca tctgctctga gctttaccgc gatgtccccg     93720
     atcaactctc gtacctgctg gtgatgatca ggcgtcacat caaacgaaac tttctggcct     93780
     tgccgtagat aaatcaaact cagcgtgtca agagcctctg ggtagatctg ctccagaatc     93840
     aaaaagtaca acccaagctg tagatcaata ccgtcagacg ggccaatcgt cttgctcgtt     93900
     ttataatcaa tcagctccag gccattatcg gtatagtcta agcggtcata acggcctgtg     93960
     atggaaaact cgatattgtt cacctggaag ctagccttga tcttcccctc gacgccaatc     94020
     ggtttgcgga tctgaggaag tggggcaacg tatttctcgt aatagagctg caatgccatc     94080
     cacccctcat gaatctgggc tggtttcagc tctccagtgt ggtgctgcca gcacatggca     94140
     aaccagtcga gggaagggag ggggtaatcg tagttccaat ctttgtagat atctgcgaga     94200
     gttttgtgaa gggcaatccc aaaggcaggt gacccaaagg cagagggtga agagagtccc     94260
     cgctcatatc tgaagttgta ggctttgggg cactgctggt aagtgatgag tttggtggct     94320
     gagagggtat aagccatcga tttgcgctgg gggtatattt caatcgtagt tcaagacgct     94380
     ctgacaccct ttagcgatga cttattagtg gatggtctca ttaacttcaa tattgtgatt     94440
     tctgatgaaa taccgggtgt ttaaaaatag gcgaatctca atggatctgt tgatacttca     94500
     gttgagaaat ttctcaactg ggaatatgcg agataacccc gacgccttca cgagagaatt     94560
     gttagtatac gtaggatata ggttttagcg gtcatagctc aatgttcagt ttgaacttga     94620
     acatggctct gaagaaaagc aattatatct ctattgagaa tgactcttaa tttagattta     94680
     acctcaacgt tgagattttt gagtaagggc cagctctcag gacgcaccaa tgtcacaaac     94740
     acagatttca ccagcactct cctctttcca ttggtcacag ttacttgaag aggtttatca     94800
     aggacgacaa acctatgatt acaagagggg tttcaacatc gttttgcatt cctacgatat     94860
     ttggatcgtg tgtcgaggaa tcgttcaact acatacatcg gatggtgagg ggaatgaagc     94920
     aatcttggga ttggcttgtc cagaaatgcc ctttggtttg cccttgactc aagtttatcc     94980
     ttatacagca actgcgttaa cggatgtcgt actcatgcgt atcagtcagc aagagttgga     95040
     gcagtcgcct attctggcac aagggattca agttcaattg aatcgacgac tccagcaaac     95100
     tgaggcttta ttagctctaa atcttcatcg tcgtgtgagc gaacgctttc aggaattact     95160
     gttattgctg gcaagggaaa taggggaaca ggtcccaaat ggctgtcgga ttggtgctcg     95220
     attaactcat caacaaattg caggtctgat aggggctact cgtgttacgg ctactcgcat     95280
     ccttggtgaa ctgcgtaagg aaggatggct atcgatcgat aaaactcgcc atatcatcct     95340
     ccatggctct tctattgtgg atttccagta attgtcatca cctgcacact aagcataagc     95400
     attgcctagt atcctccctc caccgatcag aaactctaat cccccaatcc ttgtagcacc     95460
     aagctatcca cgctacccta gtggctaggc agtggggtat acccacccaa agtattttct     95520
     ccaaatccac ctcatgacgg ctccaaatcg agcctgattt ttcccgaggg tatattctca     95580
     cgcgaggcca aaacaacccc ttgcattttc tcaatatcca catggccgac tcggttgcac     95640
     atgccagtcg tgccctatcc actattcatt attcaaagga caacactcat gaaactgatt     95700
     acttctgtca aaatccaaca agccgaccac accgaggtca tagacaccgc cgctacccaa     95760
     gtgggtctag ctgcaaacaa agccttcctg ttcgttatcc gcaaggaaat ccagggctgg     95820
     aaaaacttca ctgctctctg ctcctggggc ctgtccaaag taagccagaa gcatagcccc     95880
     atctttgagg aggtcaagga acgtactgtg gctgtctacc gcaaaggctg tcagcaagag     95940
     acggcattcg tccaagcgct catcaagtcc cagctcacgg accgggtcga tgcccactgg     96000
     gaactgcatg ataaggctat cgactggttc aaggaccaga ctcatgcatt cctggccgac     96060
     agtccgactg atgatatttc tgaggtcgag gctgaggatc tggctcctga catttcggaa     96120
     gacctggagg aggctgtaac tgtggctgaa gaatccatga ctatccttga tgaggctccg     96180
     gttccggtcc ttgatccgcc tgttgatcct gacccgttgg atgatgagtt ggccgttcct     96240
     caagacccga ctcctgctgt ggttagtggt gaggggaagc gtcggactgg aagcaagagg     96300
     gtgaccctag ctgatgtgat gaagcaagaa gctgctaaat cctcctaatc atactcatac     96360
     caatcaccca gcctttagaa gaatctagag gctgggtgat tgggagcttg gtatcgtgtc     96420
     aggcatccaa aatgggacaa cctcaccaat ggcataaggg ctactattca gttcattgct     96480
     tatagaacag aacgaacggc ttttagaaaa tcttcacggg tatagggctt agtgacatat     96540
     tcatctgctc cttgcttttt accccagagc ttatctaaat cctgattctt tgtcgtgcag     96600
     ataatcacag gtaattgctg agtcgcttca ctcttcttta gagttcggca caactcaaac     96660
     ccactcattt ctggcataac cacatcagta atgacaagat caggcttttg agtttcagct     96720
     tttgtcacag cttctttggc atcatctgtg ctaataacaa gatagccagc ttcttttaaa     96780
     tatagacaca ttagctttag ttcagccgga ctatcatcta cgactaaaac agttttcatt     96840
     tacttttttc tcccgtaaca catagaggta agaacaaaaa aatggctcca cccaatacat     96900
     ttaagatgcc cttctttaat ctaagatgtt ctatttttta cgtcggaaat ccgcttccag     96960
     caatggatgt gtatgtggtg gcataggcgc aaaccttaga aggtggagcg agatggtgct     97020
     actatccttc tagcgcggat taatcaaatg gtttgtatcc caactctttc cctcaagcaa     97080
     ttagcgattt tgagacttgc caaagagtct tctggtaaga ctattaaact gcattgtgaa     97140
     atgccaatca tcaatagtgg cgaacctcca gcagggtata cagcacttat ccagaaactg     97200
     attgacttgg gcttaatcgc agttcagttc aaacagatgc gttgtgattt ttcaaggtat     97260
     cagagaaggt cttgggctaa attcagcgca gagctggagt atccctctat cttggcctgg     97320
     gaaatatggc gggataaatt tatcgctagg caaaagggaa caaatcgtgc tgccatacct     97380
     ggggaagaat ttgaggatta tagctatgta tggattcaag agataggagt tcaggcaatt     97440
     caacctaacg aagactcaat actccaataa tgcagcatcc ctaagtaaag atagagtttt     97500
     gtgaggtgac cttgcggaac tggggtgcgc taagctcttt cttgtttcgg gggcagctgc     97560
     tctggcatca aatcgggtca gtcctcggag taaatttata acttatctag aagttgcttc     97620
     aattctttga atcttgtgcg ctgagtctta ttcaatttaa tagcgcttag acttcttatg     97680
     actttttcaa ggtcatttag agagcgatca gcctttgtag tttttgcttt tttggtggga     97740
     gactttcgtt gttgttcgtg ccagctaata gcttttctta gttgtgaaaa tgatacgtca     97800
     tgaacctcaa cgatattctc ctctaaaggc agtttccccg ctagcaagcc agtgagagcc     97860
     ataggttctg gtaagcgata aacttgctcc aatttggata ctcctagttc gagtacacca     97920
     gttatacttt cagtatagga attcagaaaa gtctctacta tatcctgatt gacccttgat     97980
     cctaagtttg caaggtgttc ctttagctca gttgatatag gttctccatc gcgaattgct     98040
     tctgcaatct gtagaaattc atttaaacct ctggttactc tacgatatgc ccaaacctgg     98100
     cgagtagtta tcgagtcacc gcttgggcgg cgtacttcac cactctttat gaatgcggtg     98160
     agattgttgt accctttttc tttaaagagt tcttgctctt cgataacatc tagccgagtg     98220
     ccaattgcaa aagcataaat agtgctttga gcttgagccg tttggagagc ttggtcaatc     98280
     tgaccttgat atgtttcaat ttcttgaagc agtgactgta gtgtttgatt ctttcttgcc     98340
     ttacaaatat caatagcccg gagccaattc tcacgatcta caagattgat cctttcaaga     98400
     ttaactacct cgtctgttgg gtttttaggt acgatggcta acttgcgagg taagtttgat     98460
     ttattggtaa cagactttac tcttgaaaaa ttttttttag gcattgacct ctacctcata     98520
     tttttcatgc atattgctgc tagatgttat ttcttcaaga tgctcagcta ttgcaataaa     98580
     aggtgtgcga tgttctggct taactcccgt ataggtataa agggattgtc cttgggctga     98640
     taattctgca tagacagtta aatcccggac aggtggtgca atccatgatg gttcagactg     98700
     atgtgggagt tgtgagcgca catcccactc aataagttgc tgatagatac ttttgtgcaa     98760
     acttgttggc ttcatcctat tggggacaat catcgaaaca atcatttcag gattcacacg     98820
     atcagcaatt tcgctgacta gattaagtag ttctggtatg ttcttgagcg caaaatactc     98880
     tgtttgtaca ggaactatca cattagtaca ggctactaaa gcattttttg tgaaaagccc     98940
     ttctcccttt ggagtatcta acaatacgta atcataattt tcataaacct cattgaaggc     99000
     atctagtgca tctttcaatc ggctttcact agacaaacct ttctcaatct ctaattgata     99060
     ggccccaagg ttactacctg atgtaataac atgaattcct ccctcaacct cgattatgcc     99120
     ttcttctagt aactttgctt gctctcttct tggcgcaaat agaatctgac ctatgtcagg     99180
     tttagatgcg tccttttcga tacccactgc cgaagagaga tcaccttggt gatctaagtc     99240
     aatacataaa acttttttgc ctatgtgggc caaggttgct gctagacaaa aagcaagggt     99300
     tgttttgcct actccacctt taattgctgc gattgcaata atcatggttg tttcctgcaa     99360
     ctgcacgatt tcacaattga tacaatacac cataaattcg tttatgcatc tttaattgtg     99420
     aaatcgtgca tccaagtgca gacgtctgca cttggaaagt ataagtggat agacgctact     99480
     gtctccctat gagcacacca actatcctcg gcatcgctgg tggcagtggt gcaggaaaac     99540
     taccctggct taagctttaa taaaacgcta tgatggccgc gcgctcctca tcagccacga     99600
     ccgatactat cgctaaatgc cctgtgggag ctacgactta ccagaagctc tggagacaga     99660
     tctgatgatc gacgatttag agcagcttat ttgctaggaa tgatacacct atcgcttcga     99720
     ttgaattgtc taagtatctg gttatcctag aaagtcgaac ttaccaagtt cagccccaga     99780
     gtgcctgagg atgttgtagg cagtcgttac atgaaagtaa acgttgggtt taacaaaagt     99840
     gagtaggtag ggtaagccag agaatttata gatttcacct ctgatgggaa gggatatgag     99900
     tttatcctta gtaccatcaa tttgatccgg tgtaaaagta tttaggtaat ctactgttgt     99960
     gcttgaccga gtgattagtt ccggaaatta tgcttcattg tcttcaatag aaggcgcatc    100020
     catccctgca agtctagcta ccccttttct agctacagct gatgcaattt gaacttgttt    100080
     tgataaggga aacgtgtcag gaaggagccg gaagttgatc agggcactag gatcaatacc    100140
     ttgactctca gcatgggcag ctcccttctc caatatccca gctagattat tgagacaccg    100200
     aattagcgga ggtaccgaag cggtatacat cgacatcgcc atagcgtttc tatgctcatt    100260
     attactagaa ccattctttc acttgcatta tccccaacct taagcaggtt tgctctaggt    100320
     tcctttttat atgcttgaat tttcgatact attagtacga ctggctgctt tggggagaac    100380
     caaacaaaag gtttgtagac tacatactcc ctgcagatct atggagatat gggtttcgag    100440
     accatcaaga gcttcggtta agacctccat gtcggtcaga gcaggcgttg taggtagtgg    100500
     ggtaacgata attctcgatc gttttgatca actgagcctg aatgtgttaa ttcaccagtt    100560
     cactagtgca cgctatagcc agtgtcgttc tatttggact catggcttta cgctttatcc    100620
     tattcagtct cttgattatg ggtgggtaca ccagcaatag ctttgcccaa ttatcaactc    100680
     agaagactct agatatttac cgctaccatg ggctaaaacc cgcaattggt caagcgtcta    100740
     aagatggcat ctttcaagac ttcaagttgc aatcagacaa cctagccaaa atttgggctg    100800
     atccagacgc tgaacaacat gaaggcttag acaacagctg ggttaagagc ttcattgacc    100860
     gtcaagggac tttgccccat ctcagcattc agttctcccg agaagggtat ggagccaata    100920
     tcagtattgc gcctaaagga ctcattccag agcggcttcc caagcagggt cttcttacct    100980
     ttgaagcccg ctcctcagat ccagtctgta ttggccttcg cctgatggaa cgcgacggtg    101040
     aggtgtgggg atatggtaac cctggactcg aatatcaacc gctttgtgtc tctcctaatc    101100
     aggagtggac ccctttaaaa gtaccactga gtgcccgaca tccaggttgg ttccacttta    101160
     ctcacagtgg caatgttgat ctaggcaacc aaactttaga cgcagatatc ttggctttag    101220
     tgacgttaga actgggtctt aagggagaag gacacttgat acctggccaa gctgttctcg    101280
     atattcggga tatacgcgtt caaccagatt ctccgtaatt gctgtaccaa cctacctccc    101340
     gcatctataa ttgacacgct catacatatt cgggcactgg gaccacattc acaacaatgc    101400
     gtgaacgtgg tgcaatacgt aggcaatagc gttcatctgt ttggtcccct tgggtgtcag    101460
     gattgcggat actgcgtagg actgagtcaa gagcggagta tgtgcggtta ccatcgacca    101520
     cgagcaccat ttggacgtta cgtccagcag caaacatctg tggattaaca gtgccgatat    101580
     caaactgtac ctggccattg cgaatatctt gccaaatgac gtaagtccgc tttaagggcg    101640
     gataggcccg agaaccaatg ccgatggtca agatgagcag gatgccgaag aagacaatgg    101700
     ggggcgcagc ggatgggcta ctgctagcgg ataggatggc gatggcggca gcgatccaga    101760
     gagcgatgaa aatcgcacca ccaactgcat tccaaaaggc acgacgctgc agttgacttt    101820
     tttcagattg ggtcattaca ggattttctt gcaaagctgt tttcatcaat tctgagcgcg    101880
     tcattgtttt attccacctt agttagttct ctaatcccca cgcttgtaca aatggattct    101940
     tttgacgagg ttaatttata tgctctttct agataaagag catataaagg ggtgaaagta    102000
     ttgtaaattt gttgatttgc ttcaaagggg gacatgcaga tcggacttat tgagagaata    102060
     tcaaaatatt gagaatggag aagatctgat cttagtgttc gtcaacggct gtttccatac    102120
     ccaaagaaac atgtaccgaa aaatattcac caaatcagtc agtagctaca gcactgcttc    102180
     cgtcaaacca atgcaggagt aaggaaacat ggcaaaattt acatgtggta ttaggcttac    102240
     aagctaagat ttcaggttat ttttgataaa aacccgaaat cacttgactg atactcatgc    102300
     acctcggtta tgagatactg catggatagt gaggagtttt aatatcagta ggttctgatt    102360
     gtgcaactta gctggtagag attttaaccc aaccagttga tttgattaag aaggaaagac    102420
     aaatccaact gtcgtctcag taaaccttgg gaatctcaag gagcagcaga atatggcaga    102480
     gcgaaaaatg tctggcagtc aaagcttcaa accctcagag agagtaactg agctaaatac    102540
     ctcctcaacc caaattccga aaatgggcgg tgggatgccc ctcgtcaggt attgggttga    102600
     taagatggca tcccccaagg gtgttcaaat ttggaaaaaa ctgatgcaca agagtgcatg    102660
     tctatcttgt gcctggggca caggtgggca aaaaggcgct ttcatgaacg agcttgagga    102720
     gcccttacag cgatgtgtga aaagcttgga ggccatcgcc tcggaactcc aaccgggggt    102780
     gaaaccccac ttctttgaag aataccctct ataccatctg cagacactca cctcaatgga    102840
     gtgtgaccgc ttgggtcggc tgagttttcc agtgatttat cgagccggaa agtcacactt    102900
     tgaacctatc tcatgggatg agatttatca gatcgctgag acagcattta aatatccacc    102960
     gcatcgggtt gcgtcctata gctctggtcg ctcctctaat gaagctgcct atctgttgca    103020
     attaatgatc cgagccttag ggtcaaataa cctcgcggac tgctctgact tatgccatgc    103080
     cccttcatcc gtcagcctaa gcactgtctt tgggacgggt acttccttgg tgagtttgga    103140
     gagtttacag caagctgatg gcattgtttt agtggggtct aatgctcctg caaaccatcc    103200
     ccggttaatg aatgagttga tcaagctaaa tgagcgcggg gggacggtga ttgtaatcaa    103260
     tcccctacga gaagtgggtt taatgaaatt tggctctccc gcctttccgc tatcatctct    103320
     cgtccagggg tcaaagattt cctccttatt cctacagcct gttcctggta gtgatttagc    103380
     tctattcatg ggcattcaga aagtactgct agagcgagaa tggattcaat tagactttct    103440
     ccagtctcat acagataatt ggcaagaagt tgttgagcaa gtcaaggcaa cggattgggc    103500
     taccctgacc aacatctgtt gtatttccaa agaagaaatt gaaacagcta ctgagatgat    103560
     ccatcagtgt gatcgcgttg tctttgcctg ggctatgggc gtcacccaac agactaacag    103620
     tgtagatacc atcttcagta ttgccaacac tgccttgatg acggggaatg taggtaagtt    103680
     aggggctgga ttgatgccga ttcgcggtca ttctaacgtc caggggtttg ggtcgatggg    103740
     ggtgaccgtt cgtttgaaaa aggaaattcg ggaagcctta gagaaactat tgggacaatc    103800
     cctgaaacga gaacccggct atgatgcccg tgcgttgatt gaagctgcag atacaggcca    103860
     agtggatgcc ctactgtgtt taggtgggaa tctttatgcc gcgaatcctg atttaacaca    103920
     agcgaaacga gccttgggcc agatcgatac catcatttac ttggccacta agcctaattt    103980
     aggtcatttt catgggcttg ccgacaagaa taccctaatt attccggtct atgcccgatt    104040
     tgagaatcct cacaaaacca ccaccgaatc tgggaataac ttcgtcagac tcaacgatga    104100
     aggtaggaca catctaaaga atgctgacct cacttcagaa gtcgaatttt taacagagct    104160
     ggctcatcgg ttgcatggca gctctcccgt ggattggcga aggctacaag agacccgcta    104220
     tgttcggcaa ctgatcgccc aaaccattcc cggatacgaa aaaataggtg agattgatca    104280
     gacccaagaa gaattcacca tttcaggacg tattttccta gaacccaaat ttcccactcg    104340
     aactggcaag gctcaaatgc aggtaacgcc tttaccaacc ttgtcactac caaccaggca    104400
     agagtttgga atagcacata acacaccatc gattgttgtg gccttgatga ctggacgtag    104460
     ctattctcaa cacaatacgg tggtctacaa agagggtgat cgatacagag gcgtcccgca    104520
     tcgttactgt attttaatga atctcttaga tgtgcagcaa cggggttggg tagaacatca    104580
     acgagttaac gtgcgcggag atgcgggcca gctaaacaat attgaaatta tcatcggtga    104640
     tgttcgggaa ggggcagcat tgatgtttta tcctgaagcc aacctcctta tgaaagcaag    104700
     tattgagcca cgctcgggta cgcctgctta taaaagagta ccagttgtag ttttttctga    104760
     aatgagttcc ggttattccg atgatcccct agcatcacag gagcactctg atggatcttc    104820
     tgattgatat ctagacgtat gaaaaaaatt acagaatttc ttgaacccct ccagcaagtg    104880
     ctggctaatc ccgtaatcgc cagtatcttg gaggtcgttc taggtgtcat tgtcattgca    104940
     atagatttcc gcatcgccag tgcttcatta ccgcgttatg ttcgagactc agatcggcgc    105000
     tatcgcattc gtaaaacatt caatttcatc agctatattt tgattttatt gtttgccgcg    105060
     agtgtgctga gtgatagcct aggccaactc acggtaatct tcggagtgac gggtgcgggg    105120
     attgcctttg ctctccaaga agtaattgcg agtctagtgg gttgggcagc gatttcattg    105180
     ggccaattct ataagccagg ggaccgggtt cagcttggcg gtatcgtcgg tgacgtgatt    105240
     gacatcagca ttctacgaac gacgctaatg gaatgcggag actggttctc cttcagggat    105300
     acgttcttct tcctttaacc gctcaacagc agggggatac gctggatttt tatccacatt    105360
     gatcacccga ggttcatggg tatgaaccgc attgagtgct ttggccagaa agcgctttgc    105420
     agcctttgca tcccgctttg ctgtgagtaa aaagtcgagc gtgtagccat cagaatcaac    105480
     cgctcaatta aggtatcgcc actttttgcg gattttgatg taaaattcat cgactctcca    105540
     ggagccattg gtaggcttga gatgtctgcg acagcacttg tccagctcag gggaatattt    105600
     gagaacccac cgattgatgc tgctgtgatc aacctctaat cctcgctcaa acatcatctc    105660
     ttctaaatct cgatagctga ggggaaaacg gcaatacaag cggacattaa gcaggatgat    105720
     ctcagattgg gattggtatt gacgctattt aaataggtca gcagttttca tcgataggag    105780
     agaaaagaag tacagcctac tagattacga ttggttctca gctcagactc tatttttgcg    105840
     acacaactgc ttgatgagtg tcttaatgcg ctttcgtagt gctatatcgc aatatccttt    105900
     gttttcgaat aaagaagtga ggtgttctca ccaaacttcc aaaaagtgaa aaagaaaaag    105960
     tgaataggtc aatcattaaa cacttttctt gagaacttag ttttacttga aacgtaaatt    106020
     aactatcctg cttaagcctc cggtttaacc ggaggactcg taaggtttaa cctttaccgc    106080
     ggtcatagcc tcatccgaaa atttgggtgt tgcaaacccc acaagcttta gccttacagt    106140
     acgacttcag tgtgacaaca gcgtgttatg gagatgtgct gccgtcaata tcaaaagtga    106200
     gagtttatga tcagtgatta aaatcccctt taaagggttc ttccaaccct ccggttttac    106260
     cggaggtgtt tgactatcca ctttttcaag taaagaatat ttttctgaat aatcatttac    106320
     ttatacctcc tcataaagtt ctcacaatat ttccacacta ttaagtagca agtcaaagaa    106380
     gttcgagcat gaaggctctt cacagattcc ctcaagctta gaggactatt aaaacataca    106440
     aaactgtatt cgctaaatat ctgctatctc tatacatcag ataaaggagc aaggattatg    106500
     aagcactttc gtaaacagtt gttagttttt ggtctagtga tactgacatg tatgggaatg    106560
     acatttagtt ttcaagtacc tgtttacgca ggagaaatat tagaacagcc gattaattct    106620
     gttcaagtct cagacccaca gtcaatacca agcaaagaat cctgtatacc cattggtgaa    106680
     aaaattgatt taaacaacgc aaacgcatta gcctttaagg attgcccagg ctattatcca    106740
     acgcttgcta aaaagataat taacaatgga ccctttgaga ctgttgacga agtcctcaat    106800
     atccgaggtt taaatttaaa gcagaaacaa ctccttgaag ataagctgga cttttttacc    106860
     gtatctgaac ctaaaactga tctcgctact cgaatgccac ctcgtcccat gatgcgttag    106920
     ctgacttgta agcagggtag ttaagaacaa ggacatgaag gcgtaaaaac tgacgtcatt    106980
     gaattgttct agctaaatat cttaaacatt ctgagaacta cccatttcga tttctgacga    107040
     taacaatcac aactcaatct tttcctatga actatgcact atctccccca gataaatggt    107100
     tcacgaccac cccccaacca ctttttgact cctggtggaa aactcttaaa gctttacgtc    107160
     ctctgaataa cgctcttggg atagatctgg gaacttccaa tactttgatt tatagcccca    107220
     tcgaaggggt tgtactcaat gaagcctcaa ttattgccat caatcaattg actcaaactc    107280
     cagtttctgt gggcaatact gctagacagt tgttaggacg tactagcaca ccagtagcag    107340
     tattacgtcc cgtcagaaat ggggttatag cagacctcaa actgacccag atcatgttgc    107400
     aatccttcat tcgcaaagct caacagggaa cccgaatctt tcgccctcgc ctcgtccttg    107460
     gctgttcttg tggtgcaaca agtgtagagc gcgaagcttt gactgaagca gctttggaag    107520
     caggcgcaag agacgttgtt ctgattgatg aacccattgc tgcagctttg gggataggac    107580
     tgccaattac gaaaccaaaa ggtaacctca tcattgatat tggtggtggt actacagaga    107640
     tggcggttat atgctcttct caagtcattg atagtcaagt catttccata gcaggagata    107700
     gttttaatca agccaccgtt gactatctca gacaaacctt ccaggtccat attggggaat    107760
     tgacagccga aagtctcaaa attcaatttg gttctgcttc ggactcggcc tgtaatgata    107820
     cgccaatgga aattttaggg gttaatgtgg ggtcgggatt accccaacga ctagaaatca    107880
     atagtggtga attgcgggat gccatatcca ttccgttgca taagatatcg gtagctctac    107940
     tcaactttct ggaaaggacc catcctgagt tagttagcga tattgctgag cgaggaatca    108000
     tggtaacggg aggtggggct ttactctccg gcattgatac gttttttcaa gatttgaccc    108060
     atctacctgt tcatatctcc cccaatccat taaacagcgt tgttttggga acaggcaaga    108120
     ttcttgaata tgagcatcaa tccagctaca gcttcgctta agcagattga atcaagctat    108180
     ttgatagggg ttatatccca atacagttga actatttgaa ttaaggactg attgctaact    108240
     caggtcatct tcagtcttat caatcgtcca caacatgcac agctttatgg agtgctcttt    108300
     ataccaatgg gtgatgggat ttcttcatac tatcctcaaa ctcaatgctt agtttataga    108360
     gcggtttatc ctgcatcgat atcgctggta accgttagat cgttccacct tgcaggaggc    108420
     taacagatgg atttaagtac gacgtattta gggacgagac tccgttctcc ccttgtggtt    108480
     ggggcctgtg cgccattatc agaaaagatt gatcatctac gtcatatgga agatgcaggc    108540
     gctgccgcta tcgttttgca ctcactgttt gaagaacaat tacgtcaaga tcggcttggg    108600
     tttcatcatc atctcaccca cggcaccgaa agttttgcag aagccctctc ctattgtcca    108660
     gaacctgacg tctttcatgt ggggccagag cagtatcttg agcatatcca tcaagccaaa    108720
     gccatcgttg atactcccat cattgctagt ctgaatgggg cgactatcgg gggatggaca    108780
     aactacgcta aaaaaataga ggaagctggt gccgatgccc ttgaattaaa tatttacacc    108840
     gtccccactg agatggcgat tgcaggggca gaaatcgagc aaagctatat tgatatcgtt    108900
     cataccgtta cttccacagt taatattcca gtagctatta agctcagccc tttctttagc    108960
     aatctagctt atatggcaaa acggttaacg gatgcagggg tgaatggcct tgtccttttt    109020
     aatcgttttt atcagccaga tatcgatata gaaaccctag aagtcaggcc caatctactg    109080
     ctcagtacac cacaggatat aagattaccg ctacgttgga tcgccattct ctacggaacg    109140
     ctgcctgtgg actttgccgc tacgagcggt attcatacag cagcagatgt cttgaaaatg    109200
     atgatggttg gagccaacgc cacgatgctg gtgagcgtct taatccggca cggcatcgat    109260
     catcttcgca cgcttgagca tgccctatgc cagtggttaa aggagcatga gtatgagtcg    109320
     atccagcaac ttcaggggag tatgagccag gttaattgtc cagaccccag cgcatttgaa    109380
     cgtgttcaat atattgaagc tttgcaaact tatcattcct taggattgat gccgatgagg    109440
     gtctaaagct ttcaaagaga cactcaagct aaacgatcta aatcttgatt gagacggtca    109500
     actgaccctt caaaattcat ccctttctga tcagtctgtt cttgttttga agccattgtt    109560
     tcatccattt ctatgcacca agttaaacgg atcggtatcc tcaccagtgg tggtgattgt    109620
     cctgggctta atgccattat tcgggcagtt attaaatgtg cgactcacaa agggtgggag    109680
     gtgtttggca ttccctatgg cacccaaggc tttattaatc ttgaattagg acactgtact    109740
     cctgaggacc tgaggttaaa agagcatgga tatgatgtcc caggattgtt agggggatta    109800
     gatattttgc aattcctcag tggcagtatc ttgggggcat taaacaaagg caatccgagt    109860
     gatccagcga tctcacaaga aattttgcag ggttttcaac gattgaatct tgacgcactg    109920
     attgccattg gtggggatgg gagtttggat attattgacg accttgccca gaaagggcag    109980
     tggcggtggg tggcaatacc aaaaaccatc gataatgatg tgccctttac tgaaatttca    110040
     ttgggttttg atactgccgt taataccgtt acaagatcac tctacgatct cacattcacg    110100
     gcagcgagcc acgatcgaat catggtcgtt caagtgatgg gacgtgatgc cggacatttg    110160
     gcactccatt caggaatcgc agggggcgca gatgtaattt taattccaga gctaacccca    110220
     agcttgaacc cgtccgtgat tgatcaagtg tgtcgtcaaa ttgccgtgct tcgacaaggt    110280
     ggccgccgtt ttgctttagt cgtgattgct gaaggtgtgc gcagaccaga tggtcaaaaa    110340
     gtcgcaagca tttgtgactt tttagctcaa cagattcagg ttcaaagtca gacgttatgt    110400
     tcgtcaggta atcctaagtt ctgtagtctt caagaagtgg attctcgggc aatcattttg    110460
     gggcatatcc agcgaagcgg ggtgcctaca gcctttgatc gtttattggc agctcgcttt    110520
     ggtagggaag ccgttgatct tatctctcaa catcattaca accgtctcgt ggtttgggag    110580
     aacggcgaag ttgcgagtaa acccttaacg gaagttatcc ccaaaatcaa ggattgtcat    110640
     cgagagaaaa aatgtccaga tccagttgat ccacaagggg gattggtgca gacggctaag    110700
     gaattaggga tttatgttgg aacatcatga agtttgtcga tgagtatcga gatcctgact    110760
     tgatcaagta ttgggtacgc gagattgatc atctggtaac acagccttgg accattatgg    110820
     aaatttgtgg tgggcaaact catacgattg tgaagcatgg aattgatcaa cttttaccaa    110880
     aagcgatcac cttgattcat gggccaggat gtcccgtctg cgtgacacca gtagcattaa    110940
     ttgatgatgc aattacacta gccaaaaccc ctggagtgat gctctgttct tttggggata    111000
     tgttgcgagt acccggaact aagggggatc tgttatctgc aaaggcacaa ggcggagtgg    111060
     tacggatagt gtattcatcc ttagatgccc tgaagttagc tcaagccaat ccagaccaac    111120
     aaattgtgtt ctttgcggtg gggtttgaga caacggtacc agcaacagcg atggcggtat    111180
     atcaagccca tcagctaggg atatctaatt tttcagtcct cgtagcccac gtcttggtcc    111240
     caccagcgat ggaagcaatt ttgtctgcac caaactgttt agtacaggga tttctagcag    111300
     ctgggcatgt gtgtacggtg atggggtata cagcctatga ggcgatcgca actcaatatc    111360
     acaccccaat tgtagtgacg ggatttgagc ccgttgacat tctgcaaggt atctaccgct    111420
     gcatccatca actggaagtc ggcaaagcag tggtggagaa tcaatattct cgtgtggttc    111480
     aatccaacgg aaattctgaa gcgcaacgac tgatggcgga tgtatttgtg actagtgatc    111540
     gtcaatggcg aggtctaacg agcattccca atagtggtct aaagttacgc cccaggtatg    111600
     cctatctgga tgcccaggca cttttacccg caaattccag tacttcagat tgtgttgctc    111660
     ctgcccctga gagcgattgc atcagcggca agattcttca aggggttcta aagccacctg    111720
     attgtcctgc ctttggtcat caatgtacac cagagcaccc gcttggtgcc cccatggtgt    111780
     cctctgaagg cgcttgtgcg gcctactatc gatatcgtca atttagggtt taaggcagtt    111840
     atcttcactg caacactaga ctcataagat cttcagcatt gcttcatatt ctgaagttag    111900
     agagaatctc agctttttag attgtagttg agagcacata ttcaatgttg aaggatgttg    111960
     ctgcttctat caagggggga cacataccct caactacagg aggtgttgat aatgataccg    112020
     acagaaaagc catccaattc aaaacgggca aacgctaaat ccaagaaatc gaagcatcga    112080
     cgacgtaaag aaatataccg acaaaagtta gtcagtcttg gcgtacctca aaagccattg    112140
     caatctcgtt taccagaatc cactcatgaa aaattgagtg attgggaagc agcatcttaa    112200
     agagtgactt accaaaatct ttagtcactc aggctattca agagatattt cctgcatctt    112260
     cgggtaccta gtactcattc tattgttcga ggctgatggg aagctggcct gcatctgaaa    112320
     catgaattta cgggagtggc aacagttccc gtgggtaatc ggtagaaaat agcactgtga    112380
     tcgcatctcg agaaaggaga tacgatcaca gcctcacgaa acagcaatag attgtctagc    112440
     taacttccac ttttacagac tttttcatat cctcttcaga cttcgataag gtgagactca    112500
     agaccccatt gttgtattct gcttgaacgt tatcggtctt aataggacta ggcatgggga    112560
     taacgcgttc aaattttcca tagtggaatt cagatcgaac ggtcccttct gactctgctt    112620
     caatttcagt cttgcgttct cctcggatat aaacggcatc tttggtgact tcaatatcaa    112680
     gatccttagc atcaagacca ggaagttcaa atttgagatg gatttcttga tcagtttcgt    112740
     ccatttctgc ggatggcata aaggtaagac tcttttctcc atcgctctta gaaattggca    112800
     ttaaccgtcc aaacatccga tccatctctc gtcgccagct ttctagttcc tggaaaggtt    112860
     cccaacctaa tggatacatg cgctcaaaac tacggaacgg atcacgaagg acaatagaca    112920
     tcattacgcc tcctcgctat tacgactgtt ttgggggctc cccacagaag ttttataaag    112980
     caccgttatg tttgaaacga ttggggagtc atctccttct actttgaatt taaaaaataa    113040
     acttgatgaa tttgtgaagg tttccctgca tcaacagtat tgagagatat acatctagcc    113100
     ttaaaggaat cagcaatgcg agcaatgcaa ctagatgccc ctggtcaact tcttaggttg    113160
     gtagaacgcc ccatccccac ccctaatcct caccaacttc tattgcggat tcatatttgt    113220
     ggggtttgtc gaaccgattt acatattgtt gatggcgagc tgccagaccc aaaactaccg    113280
     cttattttgg gacatcagat tgtgggtact gtgattgaac tgggtgaaca agtgacagga    113340
     ttcaaacaag gcgatcgcat tggtgttccc tggttgggac gaacctgtaa ctgctgccga    113400
     tactgccttt caggccggga gaatctttgc gatcaagccc ggtttatggg ctataaccta    113460
     gacggtggtt ttgctgaata tgcagtggcc gatgcccagt tctgctttcc cattcctgaa    113520
     gagtatcctg atcaacaggc agccccacta ctctgcgcag gtctcattgg ctatcgatcc    113580
     tatcgcatgg tgggcaaggc cgaacggatt ggtttctatg gctttggcgc agcggcccat    113640
     atcttaattc aggtggccaa ttatcaagga cgtcagatct atgcttttac ccgacctggg    113700
     gatatgcaag cacagcagtt tgcccgtgaa cttggggcgg tatggtccgg gggatctgat    113760
     gaaagtccac cccaaagcct agatgctgcg attatttttg cccctgtcgg gtctttggtg    113820
     ccagcggcct tgacggctgt cactaaagca ggggtggtgg tttgtgccgg tattcatatg    113880
     agtgatattc ctagctttcc ttacaaaagt ttgtgggagg aacgttctat tcgctcagtg    113940
     gccaatctca cgcgccaaga tggggaagaa tttctgactt tagcccctca aattcccatt    114000
     caaacgcaag tccaggcttt tccgctgagt actgccaatg aggcactgtc ggcattgagg    114060
     aatggaaagg tgactggagc cgtagcttta gtaatgactg atgagtcagg tcaaaaggac    114120
     ttttagcgtt tgaggcttcc tcacgtccga gaacgctaat cctttgagaa agttgtgagt    114180
     gtccttgcta cttcacaact ttctcaagct tggaatctaa gttcaaacta atgtgccaaa    114240
     gagtttttac atgccgagcc agggatatta cggaaataag tcttgtcgtg acgatggttt    114300
     tagccatgtc tcagccttca caaatctcta acaacaaagg cagctccttg atgtctcttg    114360
     ccagtacaag tctttttaaa gtgagggggg tgactaaaac ctatgtcatg ggtgaggtga    114420
     cggttgaggc cctcagatcg gtggatttag aactttttgc aggtgaattc atcgttttac    114480
     taggtccttc cggtagtggg aaatctactc tactcaatat tctgggggga ctagatgtgc    114540
     cttccagtgg tcaggtgata tttcaggggc aagacttaac cgccgctaat gatcgcaccc    114600
     tcacccgctt tcgtcgccaa agtgtgggct ttgtttttca gttctataac cttattccta    114660
     gtctcactgc tcgagagaat gtcgctctcg ttaccgagat agccccccag cccatgcatc    114720
     ctcgcgaagc attagaactg gttcatctcg gtgatcgtgt caatcacttt ccagctcaac    114780
     tatccggggg agaacagcag cgggttgcga tcgcacgagc gattgccaaa cgcccccaag    114840
     tgctgctctg tgatgaaccc acgggagctt tggactttca aaccggtaag ctcgtcctgg    114900
     aagccctcgc ccaagtcaat cgggagttag ggacaacgac agccgtcatt acccacaatg    114960
     ctgggattgc cgccatggcc gatcgggtga ttaccatgcg gagtggcgag atagtggctg    115020
     ttcgagagaa tgaacacaaa gtgaaaccgg gagagttgga gtggtagccc ttgaccaaaa    115080
     actccttcga gatctccgtc atctccgagg acaggtgatt gcgattgcct taatcgtcgc    115140
     ctgtggaatt gcttgtttgg tgaccatgct gagcgcctac gactccttgc agctctcaca    115200
     acagacctac tatgatcgct atcaatttgc ggatgtattt gctcagctga agcgggcacc    115260
     ggattccctt atagagcgaa ttgcggaact accaggtgtg cagcaggtgc agacgcgggt    115320
     ggtcgtggat gtgaatttgg atgtgccttc cttaccggaa cctgcaactg gacggttgat    115380
     tgccattcct gagcagcaga ccccgatgtt aaatgatctg ttcattcgtc aaggccaata    115440
     tattgaaccc ggacgacgag atcaggtttt agtcagtgag gtgtttgccc aagcgaatca    115500
     tttagagctg ggggatacct tgggcgccgt gatcaatgaa cggtggcagc aattgcggat    115560
     tgtcgggatt gccttatcac cagaatatgt ttatgaaatt aggggagtgg agctgttccc    115620
     agacaatcag cgctttgggg tgatctggat ggggcgcgag gcgttgggaa cagcctttga    115680
     tatggatgga gcgtttaatg atgtcgccct atccttgatg ccaagcgcta atccggccag    115740
     tgttattttc cggcttgatc agttattgaa accctacgga gggctggggg cttacgaacg    115800
     agctgatcag atttcccatc agtttatcaa cagcgaaatc gagagcttgg cagctaccgc    115860
     agtcatggtg ccctttgtgt ttttggggat tgctgcgttc ttgctgaatc tggttcttgc    115920
     gcggctagtg agtacccagc gagatcaaat tgccgttttg aaagcttttg gctacgacaa    115980
     tctcgctgtg ggttggcatt acttaaagct cgtcttggtg attaccctgc ttggagccgg    116040
     gttagggaca attgttggta ttggtttggg ggccgttatt actgagaact atgcccgctt    116100
     ctatcacttt ccggtgctgc ggtatcgagc gggccttcag attatgatca ctgccattgt    116160
     tgtgagtgga ggggcggctg tcctcgggac attcacggca gtgaaacagg ctgtatcttt    116220
     accccccgca gaggccatgc ggcccgagcc tccagcatcc tttcgacgca cgattattga    116280
     gcggatggga atgcaacagt ttatccctcc agtggggcaa attattctgc ggaacctaga    116340
     acggcgatcg ttgcaggcga gtctttcaat tctggggatt gctgctgcag tagccatcct    116400
     cgtcattggt cgctatttcg aggatgccac caactacatg atcgaagccc agtttcggca    116460
     ggtgcagcga gaagatgtaa ccctggtatt taatgaaccg ctgtccagtc gcgcccgtta    116520
     tgaattaacc catttaccgg gagtaatgca agctgagccc ttccgggccg ttccagctcg    116580
     tctacgattt cagcatcaaa cccacctgag tggcttgaca ggattggagc ctcaaggaga    116640
     attacggcgt ctattagacc aagacttcta ccccgtacct ctccctgatc agggggtggt    116700
     cttaaccaca aagttggctg aaatcttagg cgtaacgccc ggtgatccac tgacagtgga    116760
     agttttagag ggagaacgcc ctacccggac agtgccagtg gtgggattcg tcgatgaatt    116820
     gattggtttg ggggcttata tggatattca tgccctcaat cgattaatgc gagaagggcc    116880
     aaccctatca ggagcctacc tgaccgtgga tgctcaccac ttggagcagc tctataccca    116940
     actaaaacaa acccctgctg tggctagcgt ggccttgcgg gagcgggtga ttactgagtt    117000
     tgaaaagacc attggtggca gttttgcgat tttcacgacc gtgttggtta ttttttcaag    117060
     tgtgattgcc tttggggtag tctataacgt tgcccggatt gcgctttcag agcgcgaccg    117120
     tgaactcgca accttgcgta ttattgggtt tacccaagga gaaattgccg tcatcttgct    117180
     cggtgagcaa gccatcgtca ccgttgtggc gattcccttc ggctttgcct tgggatttgg    117240
     cttagcggct ctgattactc gggcctacga ttgggaattg tttcgattcc ccttaattgt    117300
     cacgcccgct agctacgcct ttgcctttgt gattattttt ctagtagctc tgggttctgg    117360
     aggattaatt cgtcgtcagc tcaaccattt ggatttaatt gccgtgctca aaacccgcga    117420
     atgaggagga agttccgatg caacacaaac aacatcgccc cttaatcccg tggttgcgca    117480
     ggccgcaaca gaagcccacg gtgccctcct ccccttaccc gccaggcgaa gggtattctc    117540
     ccccttcaac tcaacttaaa ccccaaaccc caaaccccaa aacgcgccta cctccctgga    117600
     agcgcctccc ccgtcgtctt ccctattggc tgttaggatt gggcgttgcg accctcgtgg    117660
     cccttgcttt tcgacccacg ccaattgcag tggacttagg ccaagttcaa cgcggtccgc    117720
     tccaagtcac cgttgatgct gagggtaaaa cgagggtgcg aaatcgcttt acgattgcag    117780
     ccccagtggc aggacgtctg gcccgcattg acttggatcc aggcgatccg gttcaatcag    117840
     gagccgtcgt ggctcggata gatccccttc ctctgacaac caaggtcaaa gaagcccaag    117900
     ctcggttgca agaactgcgc gcccaactgg caggagtgga aacccagcgt cctaaatccg    117960
     cagccttggc tcaagcccaa gctcagattc gagtggcgat cgccgctaaa caacaggcag    118020
     aggctcggct agcggatgct aaagcggcct tggctcaggc cactcgagat cgcaaacgtg    118080
     cccaggattt ggaagtggca ggagcccaga ctcgaaaggt ccgtgaggat gctgagttag    118140
     cggcaaccca acgacagcaa gaattggaag tggctcaaaa acaggtccaa ggtgcgatct    118200
     caactgtcgc tgccgcccaa aaagcgtttt ctgtcctcaa ggccgaacag caagatcccg    118260
     actatttatt agaggtctat cgagcccaaa tttccagtac agaatccacc ttggttaatc    118320
     ttgcggatga agcacgtcga accgttgttc gagcccccgt tggaggcaaa gtctttcgag    118380
     tactgcaaga aagtgcgcgc tttataccag ctggtgaacc tctcctagag ttgggagatg    118440
     ccagacaatt ggaactggta attgacgtcc tctcaacgga tgccgttaag gtcaaacctg    118500
     gtgcttttat tcaagttgac cattggggtg gccctcacac cctccaagcc caagtgcgct    118560
     atgttgagcc ctcagccttt acagaagtgt ccgctttggg agtagaagaa cagcgcgtca    118620
     acattattgc tgactttatt ccccctcctc gatccttggg agatggctat cgggtcgaag    118680
     cgcgtattgt tgtctgggag gacaaggatg cactcaaggt acccgtgagt gcattattca    118740
     gatgtgagaa tcagaaatgg tgtgcctttg tggcagagca gggaaaggcc cagcgacgtc    118800
     aagtgatcat cagccaacgc agtcagcgag aagcagcggt gaagaaagga ctagaagtcg    118860
     gtgaaaaagt cattcttcat cccacggagc agatcaaggc gaaccaacgc attcacagta    118920
     gaagctagcg ttgccctcac gaattcctca agggaatttc atacctttga aatagagagc    118980
     ttcagcgttg ggttcaaccc tgaagagctg cattgtctag aaatcaatga agtcatggaa    119040
     tatctctact tctttgataa cgccagtctt acgatccggg tgatcgagta tctacagcaa    119100
     tgcagaggat tgtcgttaga cctggtaacc gttatttatt tgtctggtgg atggttgatg    119160
     cggattaagt tcaaagaatg gctcgccccc aaaacagcaa cgaacgttcg ggccgtcatg    119220
     gatgagtttg gatatgcttg tatgccttcc ccagcgatga tggccgcgtt gaaaagtctt    119280
     gtggatgggc aatcgccagc agctgtgatg cagcgctttc ggattgccgt cgttacccat    119340
     ggcccaccga gtcgagaaga gattgaagcc tttcaacagc agtttatcct acagtcaggc    119400
     gcttatccca aaagtctgcg gtagggacca tgagggaggt aacagtgtga tgatgaatat    119460
     taagctcaac caacacccag aaccattcca gccagtgacg gatccttggc agggtaccct    119520
     ggtgcaatcg attccccagc acccatctga gactcctacc gttccatgga acttacaggc    119580
     gatactgagt ccgactggca tccctgatgc accggcttta tcggctggcg ttcgtgagaa    119640
     aagccctacg gtacaatttt tacttcgatg gggtttgaaa ctttccccca ccgatcattc    119700
     ggtcgcagga ctcagagatg ccttggccct tctcctgtgg caggcatcca tctgccaact    119760
     ctctcaaata ctgattgaag aggagttgag actcaacgtg tttggccagg ataaactcaa    119820
     gacccaaatc gaaaaggcac tagctctcct cttttggctg ggacaaagtg atgcgatgat    119880
     gcccgcctaa actgttcctg caattattgg acatcgccca tgcccatcga ttctatctct    119940
     tgccctatcc ccatcgagca atatccccag gttttgttag ctcatggtgg agggggtaag    120000
     ctgatgcatc agctgattga gcagatgttc gggcgtctat tccaatcgga agatcgtcac    120060
     caccatgatg ctgcggtcct tggtgtccca ccgggacgac tcgcgttgac gaccgactcc    120120
     tatgtggtcc atcccctatt tttcccagga ggggatattg gttcgctagc tgtctacggc    120180
     actgtgaatg atctggcgat ggcaggggct cgtccccttt acctcagcac cagctttatt    120240
     ctggaagagg gactctctat gactaccctt tggcaagttg tgcaatccat gcaacaggcc    120300
     gcccaccaag ctgatgttca gatcgtcacg ggtgatacaa aagtggtgga acgaggaaaa    120360
     ggggatggtg tgttcattaa tacggcaggt gtggggataa ttgaacatca ccagaccatc    120420
     catcctcaat cgatccagcc aggtgatctg gtcatcctta atggtgacct aggccgtcat    120480
     ggtatggctg ttttggcgga acgggaaggg ttggaatttg agagtgaaat caagagcgat    120540
     tcagctcctc tgaatcatgt ggtgttagat ctgttcgccc atggtgtcga gctgcactgt    120600
     atgcgggatt taacacgggg aggattagcg agtgccttaa atgagatcgc tttggcaact    120660
     ggggttgcga tctcactgga tgaaacctgt attcctatcc gagaggacgt ccagggtgcc    120720
     tgtgaaattc taggatttga tcccttgtat gtagcgaatg aaggccgttt catcgccttt    120780
     gttccaccac aatctgtaga cttagccctt gccagactga atgccccact gtccttcccc    120840
     ttatctgggc agagcgatac ccatcctcaa atgagacatc agcatccggc acaggtgatt    120900
     ggtcaagtca caaccaccac atcccctcgg gttaccctaa ccaaccgact tggtgtggag    120960
     agaatcgttg atttcttaag tggggagcaa ctccctcgaa tttgctaagt gattgagtct    121020
     cgtcaacgta aatatacgag taggacaatg ccctgtttct ggtacttgga tgctcagaaa    121080
     atcctcacaa ttgaagcgct aactatagtt agcgccttaa aaattctgat gtaagtgata    121140
     gagcgccttt aattcacgca tttatctcaa accaaattcg agattcctgg agcttaaatt    121200
     catgattcac acagaacccc gccttttctc ggaaaccagc cgtaagcaag cattgatatt    121260
     aggtttcgat gaggtgggca ttgccgatat tcccctagtt ggcggcaaaa atgcctccct    121320
     aggtgaaatg attcagcacc tggttcctct aggcgtgaac gtccccaatg gctttgccac    121380
     taccgcctat gcctatcgat attttattca gcaagcaggg attgaagctc aactccggca    121440
     gatttttacc gatttagata tcgaagatgt cgataattta cgtcagcgag gacgacaggc    121500
     gcgcgctctg attctccaca ccccctttcc caaagatctg gagctagcga tttccacctc    121560
     ctattgccaa ttatgtgaac aatatggcgt gggcaatgtc gctgagagtc gagactccaa    121620
     aacccaagaa cgcctgcaag cctaccatta caacgttgat gtcgctgtcc gctctagtgc    121680
     tacagccgaa gacctacccg atgcgagctt tgctggacaa caggaaacct acctgaatgt    121740
     tcatggcgtt aagcaggttt tagaatcctg ccataaatgc tttgcttcca tcttcacaga    121800
     ccgggcgatt tcctatcgca ccctcaaagg ctttgatcat ttccaggtgg ccctatctgt    121860
     gggagtgcaa aagatggtgc gctcggatct agcgtcttca ggggtaatgt tctccatcga    121920
     taccgaaact ggatttaaga atgctgcatt agtcacctct gcctatggtc taggtgagaa    121980
     tgtggtccaa ggtgccgtca accctgatga atttttggtt ttcaaaccta ccctccagga    122040
     aggcttaagc cccattctga gcaagcgatt gggcagtaaa gaaatcaaaa tggtctatga    122100
     cctgggggga agtaaactca ccaaaaatat tgctgtccct caatctgacc gtgctgaatt    122160
     ctcggctaat gatgcggaaa ttctcacctt ggcacgttgg gtttgcatta ttgaagatca    122220
     ctattcccag gttcggggta tggatacccc catggatatt gaatgggcca aagatggcca    122280
     aacaggggag ttatttattg ttcaggctcg tccagaaacg gtgcagtctc aaaaggttgc    122340
     taatcgccta tcatcttatc ggatgacagt ggatactcga cccgctgccc tgattgaagg    122400
     tcgagccgta ggcgatcgca ttggccaagg tacagcccga gtgattgctt ctgtccaagg    122460
     catttccgaa tttcaggctg gagaggtctt ggtgaccaac cgcaccgatc ccgactggga    122520
     gccaattatg aaaaaggcca gtgccattgt tacaaaccag gggggcagga cctgccatgc    122580
     agccattatt gcccgtgaaa tgggtattcc ggctattgtc ggttgcggta cggctacaga    122640
     ggttctccaa acaggacagg acgtcacgat ctcctgtgct gaaggtgaag cgggacaagt    122700
     ttatccgggg ctccttccct ttgtcgttga ggaaacagct ttggatgaac tccctccgac    122760
     ccggacgcaa atcttgatga atgtgggcaa tcctgatgaa gcctttggat tggctgcgat    122820
     tccctgtgat ggggttggat tagctcggtt ggagtttatt attgcgaacc agatcaagat    122880
     ccatccctta gcacttttga ggtatgacga gttgactgac gtcgatgcca aactgatcat    122940
     cgcccaattg acgtcccact atgatcataa acctgactac tttgtggata aactggccca    123000
     aggggtggga atgattgcag ccgcttttta tcccaatcca gtgattgttc gcatgtccga    123060
     ctttaagagt aatgaatatg ccaacttaat cggcggacga cagtttgaac ccatggaaga    123120
     aaacccaatg attggttggc ggggggcttc tcgctattac gacccgaatt accgtcaagc    123180
     ctattcctta gaatgtcagg ctctgaagcg tgttcgtgat gagatgggac tgcggaacgt    123240
     gattcccatg attcccttct gccgtactcc tgaagaaggc cagcaggtct tgaaggaaat    123300
     ggcccagcat ggtctgcaac ggggtgaaaa cggtcttcag gtgtatgtga tgtgcgaagt    123360
     acccagcaat gtggtgctgg cagaggaatt tgcagaggtg tttgatggct tctccatcgg    123420
     ctccaatgac ttaacccaac tgaccctagg actagaccga gactctgccc tcgtcgccca    123480
     tatctttgat gaacgtaatg ccgctgtgaa gaatctggta cgccaggtga tctccgttgc    123540
     caaggcaaaa ggccgcaaaa ttggcatctg tgggcaggct cccagtgact atcctgagtt    123600
     tgcccagttc ttggtggagg aagggattga ttctattagc cttaacccag atacggtgct    123660
     taaaactcgg ctggccattg cccaagttga agcccaaacg acaactaccc actgacctta    123720
     aatgcgggct agcaccagac agtcagaagg tgatggcatg cggtgtcatg gagcgttgat    123780
     tccttccgga tgccctcaca ctttcctcaa gattcagcac taaaactcga atcaacggta    123840
     tctacatctt ctatgggaca cattgcagtt agcagattat gcttcagtct ccagcgatat    123900
     ctgtagcgac atcctattgt ccttgtcagg gaaaggttgt cgcgattagg ggtagcgtgg    123960
     ttgatgtaca cttctccgat gaagtgccac ccctccgcca tttattgaga gcaggtcccc    124020
     aggctcagat tgcaatagaa ggactcactt acttaagcgc caatctcata agagggattg    124080
     ccctcacacc tacccaggga ttagcaaggg gggcacgagt gattgatacg ggacagtcac    124140
     tccaggtgcc catcggagag catttgttgg gtcgtgcgtt taacgtcttt ggagacccca    124200
     tcgatggcct gggtccttta aagggcatga agcgatcgct tcatgggcag gccgtcccgc    124260
     tgcatcaacg caccacgggg accgatattt tggttactgg gataaaagca attgatctgc    124320
     tggcaccatt ggaacgaggg agtaaagcag ggttgtttgg tggggcaggt gtgggcaaaa    124380
     ccgtcttgat tactgaaatg attcataaca ttgtgagtcg ctatgacggg gtcagtattt    124440
     tttgtgggat tggtgaacgt tcccgagaag gagaagaact ttaccgcgag atgaaagctg    124500
     ctggcgtgct caacaacaca gtgatggtgt tcggccaaat gaatgaacct ccagggtctc    124560
     gcttccgggt tggccatgca gctctgacca tggccgagta ctttcgagac caagcccatc    124620
     gggatgttct cctgatgatt gataatgtct tccggttcat ccaagcaggt tcagaagtgt    124680
     ctggattgat gggacagtta ccctctcgag tcggttacca acccaccctc gcgactgaac    124740
     tagcagaatt agaagaacga atctgcagca cggctcatgg ggctattacc tctgtacagg    124800
     ctgtatatat tcctgctgat gacctaacag atcccgctgc cgtccatacg ttttctcatc    124860
     tatcggcatc tatcgttctc tctcgcaagc gaacgagtga gggattgtat ccagcagtcg    124920
     atccgctaca gtcagggtcc aaaatgttga cgccaagtgt tgtcggtcaa cgccattatc    124980
     aagttgcaca agcggtgcgt aagaccttgg cagaatatga agacctcaaa gacattattg    125040
     ccatgctggg cttggaggaa ctggcccaaa acgaacgcca aactgtttat cgggcgagac    125100
     ggttagagag atttctaacc cagccatttt tcacaacgga gcaattttct ggcattccag    125160
     ggaaaatggt cagcctggat cagactttaa cggggtgtga agccattttg gatgataaat    125220
     gttctggctt atccgaacaa gcgctgtaca tgattggtgc tgtcgatgag gcagagctag    125280
     agcaccaaga gagagaagca caggaggtgg aggaaattgg ccaatagtgg acgcctgcac    125340
     atcaggattt ttttacccca tgccatccta atggagcagc cagtgataaa ggtgacggcc    125400
     gagtctaagc agggtgtatt ttgtctatta ccccatcaca tcgactgctt agcaatccta    125460
     gtccctggaa ttgtctcctt aattacggag caggggaatg aatgttttgt ggctgtggat    125520
     gaaggcattc tagtgaagtg tggcccagag gtgaggattt cgactcgcaa tgctatccag    125580
     ggaaccgatt taggcagtct aaaacaacaa gttgatcagc aattccgtca aattgatgag    125640
     aaggaacgcc tcacgcgatc tgccctcgct cagctagaag caagcttggc gcgttacttc    125700
     agtagattgt aaaggcggag ttgcggatgg aaaatgcacg actagcgaag ggcatcaacc    125760
     aagtggacaa gcatggtttt caaaagcaag ttaaggataa agtcaaccgc aaactaaagg    125820
     ctcgacacga aaaaaagagc gtttggtttg gtctcggtct gttcgggtta gtggggtggt    125880
     cagtggctat tccaacacta ttggggattg ccatcgggag ttggctcgac aaccatgtcc    125940
     ccagccgcta ttcgtggacc ttaaccatgc tggtggtggg ggtgggctta gggtgtctta    126000
     acgcctggta ttggatcaaa aaggaaagtc accatgagtg aaacgatcct cctttattta    126060
     gttttactcg tagggacaac aattgttctt gccatccttt ttaaagcagg ggccgaacgg    126120
     ctaggcatcc ctcctttagt tggatattta ttgctaggtt ttgttttaca acttctggat    126180
     tttcgaggct ttctagcttc cgaagtggtg ttggaggtct atagtttttt agctgaatta    126240
     gggattattt ctctactgtt ccgtgtggga ttagaatgca atctcactgg attattgcgt    126300
     cagttacctc gagcttgctt gctcctcgtc ggtgatgtga tctgtagtgg ttcactaggt    126360
     tttatcacgg cctatttcct tttgaattta tctctggttg ccagcctatt tattggcatt    126420
     gccttggtcg caaccagtgt tgggatttca attagcgttt ggcaagattc ccaggccctt    126480
     aattccataa atggagagtt gttactagat attgcagaaa tggatgatat tgcggctatt    126540
     atcctgatgt ctttattgtt ctcccttgcg ccttcctggc agcatggaac tgaaatcaag    126600
     tttctgccgc ttttagaaac cattattggg cctttttgct taaaggtgat aatttttagc    126660
     accttctgct tgatcttttt tcgctatatt gagcagccct taactcaatt ttttgagcgc    126720
     atagaaccgg cccccgatcc gatgctgatg gttgccggaa caggctttgt tattgctgct    126780
     atagcagggc ttttaggttt ctcagttgcg gttggggcct tctttgccgg actggcattt    126840
     agccgagatc ctcacgcggt tagaatcgat gcatcttttg gcacactcta cgaatttttt    126900
     gtgccgtttt tctttatcaa tattggtcta caaattcaat ttacaggcct agcaaccaca    126960
     gttggtatca gcctagtcct gctcagtgct gccctgattg gcaaactgat gggagtcgga    127020
     ggattactac tcctgactca aggtgacctt tcgagcgcaa cactactcgg aatcagtatg    127080
     attcctcgag ccgaaattac gatggtgatc ctgcaacgag gacgtgactt gggcacttgg    127140
     gccgtctctg tccagatatt tgcgggtatg accttggttg cgatcgcaac ctgtattatc    127200
     gcgccgatgc tgttatatcc gttacttaag caatggcccc aactccagga ggtggaagca    127260
     tgaatagtca ttcccctgcc ctattcacct ccttaatttt ggggagtagc ttaggactcc    127320
     tttacttcgg tggactatgg atcacgattc tccgatttaa ccgcaccact caacccatcc    127380
     tgttgatgtg gagtagtttt ctactccgtc tgggcacggt tttaggggtg tttcacctta    127440
     tccttcagaa cggtatgagc gatcatctgc tggcccctct actgctgaca tttctgggat    127500
     ttctgggggc tcgaaatctc ttaatttcca gcattattcc tctgcctaaa aagatcaaga    127560
     agggcagaaa agacgttgtg aattatgact tataagctct aaatcaaaga attttctcaa    127620
     tactctgtat cgcaaagaag tttggccaaa agacttaaac atagctcttt caacacagca    127680
     tcagaattta tcgttgttat cacttttaaa gtttcttggt atggagccca aatgtaatgc    127740
     atctaacacc cgatcaaact attttttggc aatgggggtt gttctctctc aatgcgacgc    127800
     tgatcttcac ttggcttgtc atgggggtgt tggtggttgg ctcatggttc gtgacccgac    127860
     acctctctgc ctcgactcag atctcccggg gacaaaacct gttagaggtc attgtgttgg    127920
     gcattagaga tcagattcaa gaaatcattg accaacccgc agacccgtac ttaccgttta    127980
     tcggcacctt atttatcttt attgccctat caaatctgtt gagtgttatc cccggttacc    128040
     aaccaccgac ggggtcctta tccaccacaa cggctctggc actttgtgtc tttttcgcag    128100
     tccccctcta tggcgttcag aagaagggtg tgcggggtta cttacagcag tacttgcagc    128160
     ctaaccccat catgctgcca ttcaatatca ttggggattt ctccagaatt gtggccctag    128220
     ctgtccgcct gtttggcaat gtcatgagtg gaacgatgat cgtcggcatc ctactgtcgg    128280
     tagctccctt gtttttccca gtcatgatgc aggtcttggg gctcttaacg ggcgtgattc    128340
     aagcctatat tttcgccatt ttagccatgg ttttcattgc agcggcgagt caagtggatc    128400
     agcacaacta tcaaacagac agtgaggtct cccatggata atattgccct tgtgggcatg    128460
     gcttcgattg tgatctctgg actcaccatt gccattggct ccatcggtcc agccctaggg    128520
     gaaggtcgtg ccttatccca ggcactaagc gccctggcgc aacaacctga tgaagccaat    128580
     accatcacca gagtgctgtt tgtggggatg gcattggtcg aatcaacggc catttactgt    128640
     tttgtgatta cattgattct gatttttgcc aatccatttt ggacctatgt ggtggagcag    128700
     gccagcacca atggaggata accatgttga ttgatccact tactgtggtg gcccaaatca    128760
     tcaatttcct gattctagtg gccttactca ggcggtttct ctacaccccg atcactcaag    128820
     tgatgaaaaa gcgagaacgg ctgattgctc aacagttaca ggatgctgct catcagcaag    128880
     aagtcgctca gcaagaagct gaacggtggc gtcagatgca gcaatcttta gaacatcgcc    128940
     aagcctcgtt tttgacccaa gcgcaagacg cagcagacga acatcgacat cagttgttgc    129000
     agcaaattcg ggacgaagtg gatagtaccc aagctcaatg gagagaggcc gtcaagcgtg    129060
     agcagcacgt gtttctaagt gccctacagc agcgagcagg acagcagcta gctgcaaccc    129120
     ttcgatgtat tcttcaagac ttagcaagtg ccaatttaga gcaacaaatc ctggagactt    129180
     ttattactcg ccttagccat ttaccttttt cagagcaggg ggttctggaa acatccttat    129240
     ccaatgcaag gggagaggaa ctcgttatct ccagtacatt tccaatgccg gaggatcgca    129300
     aagcccaaat tcttgcggtc ctccatcagt atgctcctgc gatggaatcg agtgtttacc    129360
     agtttgtaac cattccagac ttgatttgtg ggattgaact caagattcct ggatataagc    129420
     tggcttggac gatcgagcaa tatcttgagc agttagaggt gaagttaaat caggtatggg    129480
     atggcatgga aaaatcatgg gttgagcagg ggtagaccat ggaggctccc aaactcgata    129540
     ttttgaaacc cgtactccaa cacatctttg cggcctttga tcaggtggaa ggtgagtatc    129600
     cattcgagtt gcagagtcag gaaattggca ttgtgacttc tttaggtcat ggtattgccc    129660
     gagcgactgg cctgttgcag gtgcaatcgg aggagttagt caaatttccc ggcgatcgga    129720
     tggggctagc cttcaactta gatccagatg aggtgggttt gattttgttg gatgatggac    129780
     attccctgaa ggcagggtgt gaggtccagc gcacaggccg ggttttggat gtccccgtag    129840
     gagagggttt actgggtcga gtcgtggatg caaccggtcg tccgttggat caacgaggat    129900
     tagtgactgc gcaagaacga cgccccgttg aacgggaggc tcctgccatc atggaccggg    129960
     ctcctgtaac cgtgcccctt cagacaggca ttaaggccat tgatgctctt attcctattg    130020
     gtcggggaca gcgggaactg attgttggtg atcggcaaac gggaaaaact gcgattgccg    130080
     tcgatactat cctcaaccaa aaagatcagg atgtgatttg tgtgtattgc gccattggtc    130140
     agcgcagttc tgccgtggcc aagctaattg ctgagcttcg caatcgtggg gcgatggact    130200
     actgcattgt cgtggtagcg gagggggaag cctcacccgg cctgcaatat atcaccccct    130260
     atgctgcgac cacgatggca gagtacttta tggaacaagg gcaagatgtg ttgattgttt    130320
     atgacgatct gattcaacat gcccgagcct atcgtgagct atcgcttcta ttgcgccgcc    130380
     cgccgggacg agaagccttt ccaggagata ttttttatat tcatgctcgg ctgctggagc    130440
     gggcgacgtg cctgcggcct gagttagggg gaggctctct aacggcgttg cccattgtcg    130500
     agacggaagc ccaaaatcta tcggcctata tccccacgaa cttagtctca attacagatg    130560
     gacaaatcta tctcacccct gatttgtttc aaaagggaat attccctgcc gttgatgtgg    130620
     gcaaatcggt ttcccgagtc ggaggcaaag cccagcttcc tgcttaccga gatgttgcgg    130680
     gcgatttacg actgtcctac acgcagtttg aagaattgga atcttttgct cggtttggaa    130740
     cccgtttaga agaatccact cggcaatctt tagagcgagg tcgtcgggtg cgtgaagtgc    130800
     tgcaacaacc tcaatttcag cctttacccg ttgcagagca aattgctgta atgctagcgg    130860
     tgactcaggg acagtttgat ctcgtgccca ttgagcaagt gtcccaagcc caacagctta    130920
     taggagaagc gatacgacgg gagctaccga atatttgcga tcgcatccag aatgcagggc    130980
     agttaagtga aacggatcgg gagacgttgc tgaactggat cgccaaccac atattaaagg    131040
     actcagacaa tgagttgtaa tgactaaatc taaaggcctg ctctatgccc tgaagcccat    131100
     ccattgatga tgtctgcaat aaccagtcaa cattcatacc cggccattaa catcatgcaa    131160
     accctagaaa cccttaagcg aaaaattgcc agcactcagg agttgcagac cgttgctaaa    131220
     acgatgaaag ctctagccgc cgccaatatc cgtcagtatg aacaggctgc caatgccctt    131280
     cagcactacc gccagacctt ggcgatggcg atacaaattc tccgaataaa ttatccggat    131340
     acgttaactc acctgagacc ccgtgcgcac cctcgtttgg gaatagtgat tttcggttcg    131400
     gatcagggga tgtgtggtcg cttcaatgag cagttgtcag agatggtgat tcagcaccta    131460
     gagcagcact cttctcaggg tgggcaaccc cttctgttag ggatgggagc ccgaatttgc    131520
     gatagcatca ttgatcaagg ttacgccatt gagcgatatc tttcggttcc agcctcagtt    131580
     gacggcatca catctaaggc ccaaacgatc gttgtccagc ttgaacaatg gcgtaaccaa    131640
     tgtcaggtag accaaatttg ggtgttccat aatcaaccca tccgtggtca taccagtacc    131700
     ccccaccgac aacagctctt tccccttgaa tctgaccgtg atcgctcctc ctcctggtcg    131760
     actcgctgtc gtccaatggt ctttctgagt cgagagagat tgttctcagc catatttcgg    131820
     cagcattttt ttgttgccct ataccaagcc tgcgctgagt ccctagccag tgaaaatgcc    131880
     agtcgcttga cctcaatgca gttagcgcaa accaatattg ctgaacattt gatggagcta    131940
     caagctgctt ttcaacagca acgccaaaca aaaatcacgg aagagttgct ggatatcgtg    132000
     tcaggctttg aggcccttaa ccaatcccac tagtggctca aggcaggggc cgcgagcggt    132060
     tcacaaagga tatctgcaca agttgccacc gtttgccact cttgcaccac ttgagtgggg    132120
     acttcaactt taatgaactt catccctttt gtcggaatca acaggtaaag agcagcgtct    132180
     aacttaggca caactggttg gagattatac tgggcaacat tggggccagg gaggagttca    132240
     gtatacaaag actctgggag attcttcact tttacagttt ttccttgaga cgtgaccagg    132300
     gtaagaggca gagaatgatc gatatctaca aagccagggc agccagctag catcaggtca    132360
     atcttagggg ggctagcaat gcccacatgc ttggatgcga cgactaacca atcattccct    132420
     tgttgatcga gtagatgttg tcgagattga tagagcatct gaccttgtgc ttctcttgtc    132480
     atgctcacgt ctgcgatcgc agatgaactg atcccattgc ccatattggt caagagcagc    132540
     agcactaagg tactgatcat taacaacaac aatagatttc tacgaatcca aactctcatt    132600
     tgtctattcc tcaatttata tggatgtaga gggttatgaa tgaggttgat agtggacctt    132660
     agaaaatctc acaagagtat tgccagcaac gctctaacaa catacgctgc tgttcaattt    132720
     cacatttcct gacatagcaa cgttccaaca gctctctgtc ataagtgtgg gaaaacatca    132780
     tgggatttag gatggattta ggcttaaata gaggctgatt caggtagagc caaaccatca    132840
     tcaccaacct cgtgaaggaa tgctttggtt tcatcggctt acgacctcca atgtttcatt    132900
     gtgctgaatg aagccaaatg agcttcagaa tccttaactc atagcagcat ggctgcgctc    132960
     ataagtcact cgaaagctcg ggtggacttt tccttgaata tgattccagt attttgaggg    133020
     atctacctta aggtgaatct ctgatgtcgc ccgaccgagc atactttgct ggcggtgctt    133080
     aataatccga tgatgatcca tcattaacca ccgggcttct tcagcgaccg acacccaatc    133140
     atctccaact gtctcagttt ggtttaccct ttgtgattga ggcatatcag tcggtgattc    133200
     accagcatga tacgccacac cacggtaggt gagatcagca ctgattgggg ggacaggggg    133260
     ctcctgcagc tctcggcgtc ggtaacttaa tccacgatat ttccctacgc cagcactgtg    133320
     gccatagtta accactggag gacgatagtc gtaatcaatg cctctatagg tcagtttcat    133380
     ggtcttttct cctttaagaa gttcccgata cctcttactt aaaatctatt gcgagggtct    133440
     gaggagcttg tgaagaatgg ttgacacctc aatcttcaca agctcctcaa attcggagag    133500
     ctggatcaat cggatggata aaggggttgg gcaaataccc ttcaataagt gttgttctcc    133560
     gaacggtggc tagtccgatt taccgttacc ctgaagaata aggactgaat ccgtcacctc    133620
     agctccctag gaggattaca gtgagaatcc tagttgtgga agatgatgag ttagttgctg    133680
     aagcgctgca aactttactc gtcgatttga attatgccgt tgagctggca acagatggcc    133740
     agaccgcggc agaattggtc gaagcattcg aatacgatct catcctttca gatgtaatgt    133800
     tgcctagact ggatggggtt ggtctttgcc aacagttgcg atcccaaggc tatcaaattc    133860
     cgatcttgct acttacgggc aaggatagca gccatgatcg cgcgattgga cttgacgctg    133920
     gggcagatga ctacgtcgtt aaaccgtttg atccagaaga attagcggct cgggtaaggg    133980
     ccttacttcg cagaggggaa gccatcaaac ccccaatctt aaaatgggaa aacttacagc    134040
     tagaccccag agcatgtgag gtcaaatatc aagatgttct cctcaagctc actcccaaag    134100
     aatatgccct cgtagagtta atgatgcgga atacccgccg tgtatttagt tgcggaatga    134160
     ttttagaaca tatatggaca tatgaggata cacctggcga agaagcagtc agaactcata    134220
     tcaagggcct ccgccaaaaa ttaaaagcat cgggagcacc cacggacttg attgaaaccg    134280
     tttatggcat tgggtatcgc ctgaaaccac tagcagaact aaaaaaaaat caagggacat    134340
     ctgttcaaac accagaagtc aaaattaagc agcaaaccat gagtgcgatt gctgatattt    134400
     ggattaagtt tcagccccgt atccaggaac agatcaatca attagataag gctgtagtag    134460
     cagtgactga gggttgcttg aataacgaat taaggcaatc ggctcaacaa gaagcccata    134520
     ccttagccgg tggattaggg acctttggtt tatcgaaagg gtcccagtta gcgcgtgaga    134580
     ttgaacatct attgcgatct cattcctccc tcgacgccaa gcaatccctg cagtttcaac    134640
     aggatgtcga ggcgctgagg cgggaaataa attatgctag ccaacctgcc actcaagtga    134700
     cctcagaccg tcaagatgaa ttggggcaat gggttgttct agtgatagat gctgataccc    134760
     cttcccgaga tgctctagcg acggaggctc gtcagcatca gattcgatat ctaacggcag    134820
     agagcattga cctggcacga gacctcattc aggaacagtc cccgcatctc atcctctttg    134880
     atcctgcagg ccagtctcca atccaaagcc taaccttttt agaggctcta ctgtatcttc    134940
     cactacccat tccagtcttg atctggacag ctgatgagga acggtatcaa gagatggcta    135000
     aagcctactc tagcggccaa cgaccaatct caaaatcttt accccttcaa caagtgtggg    135060
     atcgggttga acacaccctc caaagtaagg ggggcaaaga agcccggatc atgattgtgg    135120
     atgatgaccc acaaatcttg gaaaccgtag cggccctatg caaaccctgg gggcttgagg    135180
     tcattggact tgacgagccg actcagtttt gggaaacgct gaccaattct ccaccggatc    135240
     tgctgttact cgatgtagag atgcccgaaa ttggcgggat agatctgtgc agggttgttc    135300
     gcaatgatat tcagtgggag cagttgccca tcatttttct aactgcccac acggaggctg    135360
     atgtggtcaa ccaagtttat gcttcagggg cagatgattt catcagcaag cccattgtcg    135420
     gaccagaatt ggtggttcgt attctcaacc gtttagaacg gactcgatta cagcgccgtc    135480
     tttccaccat tgatcctttg gcccgagtgc tcagccgcca cgaatcgacc catgccctgg    135540
     aattgctgtt gagtgaggtg gcgcatcaac ctcgcagcat gtgtcttgtt attctggaaa    135600
     tagagcgtct tcagcagatt aatgattgct ttggttacgc ggtaggcgac agtatcctga    135660
     gacagtttgc tcaagcgttg ttagggttgg catctactga agatgtgatt gcccgtagag    135720
     gtggtaacca attcttagtg gggttgttag gagccaccaa agctgaggga ggtcaaagag    135780
     ttcaagactt cttgaatgtt gtccataaga ccccctattc aatacctgat ggcaccaaca    135840
     ttcagattac ctgtagtgca agtgtggttc attgtcctga ggacagtcaa gattttcaag    135900
     atctgtgcat tttggcagaa gagacgttga ctgaagccag agcattaggg tgggggcaag    135960
     ttcgcatagc caatcagtcc ctatccctcc cagccaaact gcatgccgag aaaggctagc    136020
     tagaatagag ataaaggagt ctgctaggtg tctggccgtg acaatgggtt ccgcgtaatt    136080
     tgacaaacaa aatgatccac acttgttgaa cgtcacagac tgctctgatc ccactgaaaa    136140
     tttcagagac tctagttgcc cgttcttgga tgagtaacta ttgcgctaga aatgtttagg    136200
     caaaatctac gagtcgatac cttcgaacgc cagcttgctg caatagttgg ggtaagttta    136260
     ctcatggcag cttattcctt cggaagtccg gtcaatttaa ccactccaag gggggaaaac    136320
     ctttctgtag agaagattac tgtatcgctg gatgagcgtt cttctagtat tcatgatgct    136380
     cagaccctca agctagcctc aaatgagccc ccttcaactt gttaccaatt cccgactcaa    136440
     tttcaaggac aaaccattta cggggtgcag cttccccgcc atcaaaaagc gatcgccctc    136500
     acgtttgatg atggtccctg gcctcataac acatcaactg tattgactat tctccagcaa    136560
     caccaagtca aagccacttt ttttgtattg ggtcgtaatg tagctcaata tccccactta    136620
     atccaacaga ttgcgacggc aggacatgcg attggcaatc actcttggag ccatggctat    136680
     caagatcaca gccttgaaat ggcacaggct gagattcagc aaacgactga tattgttaaa    136740
     cagcacactg gacataagac ggctctattt cgtccccctg gagggtttct ggacaatggt    136800
     ttagtagccc aagcgagttc tcaaaagatg gttactgtct tgtggacgat tgacgatacc    136860
     tatgaagggt ctgtggattt agccgtgcaa aacgtcattc aaaatgcaac acctggaggc    136920
     atcgtactga tgcatgatgg cgggggtaat cgcgaattaa tgattaaggc tctgccttta    136980
     gtgatctccg aactaaaaca gcaaggctac caactcgtta caatcccaca actgttaaat    137040
     ttggcagaca ctcaggtcag gtcggaggat gccattgatt gcatgtcgtc cgaccttacc    137100
     tgaggatact gactcccttt tgggtgaaga agagcgtgaa tgtgcgatca agttgtgatc    137160
     gcaggtatcc gttcagtcta ttcaaatgga gtcttctgaa acaaccgttt ctccttgaat    137220
     caccaagaca gaacaagggg catggtggac gatatggttg ctgacactcc caagaaaaag    137280
     ttccttgagt cccgtgcgac catggcgtcc cacgacaatc agatcagcgt gccagtcttt    137340
     agcccgttta caaatctgag gccctggatt acctaattca gtctcaaagg ttgtctttat    137400
     accttgatgc tctgctttta ggcaaaattc ttgcaaccat agtttggatt ccgcaatttg    137460
     tgcgtcccag gcttgccttg ccaactcgta atccacagca gatggagaaa ggtaacctga    137520
     ttctaaagga gtccctaccg gtgagatcgt tgaattaccc aaaggattaa tttctgcctc    137580
     tacactatga aacagcttta cctcagctgc atgtaatttt gcttctacca atgcctgttc    137640
     ataaactgca ggttgaagga aggaagtatc tagtgcaacc aaaatgcgat gatatctcat    137700
     caggattcct ccatagaaat aacaaccgtc ttgacagttc ccatcccccc ctatatctcc    137760
     atggtagagc tttattttca caagcagcga taaaagattt tgccgcagag ctggcaagta    137820
     attggaaata tggctttatt cttgtctcca gcggaggggt ttcgtcaacg ctcatcgatt    137880
     aggcgagggg ggacggggat agacaattgg caccctcaca aattgctcat ttagtatgcc    137940
     taggctcaaa gatagagatg gcaatatcag tcaaagttag tcctatagca gggggggact    138000
     tcacctgtga tgtgaggaca tcctggtgtc agaagcgaaa catcagccag catgtgcaaa    138060
     ggctaaggag tcagcattat ggcgactatc cagattgatg ccgaacgctg tcagaaatgt    138120
     ggaaaatgtg tgcagatttg tccaacgatc tttgcacaac ataccaaagg ggcaattcct    138180
     cacttgctag acactactcg atgtatcgaa tgtgggcatt gcgtcgccat ttgtcccagc    138240
     gaggcgattt ctcattcgag ttttccgtct ggcaccatcg ctccaatcca gccagaacaa    138300
     ctgcccgata cggcacaatt catggaacta ttgcgatcgc gccgttccat tcgtgaattc    138360
     agcaagaggc aagttgatcg ggcactgatt gaacaaatta ttgaggcagc ctgctttgcg    138420
     cccagttccc acaatgtcca aagtacagag tacatcgtcg tccaagaccc cgccatgcgc    138480
     cagcaaattg ttgaactgac catcgctcaa taccgacagt ggcgcaaact actcggcaat    138540
     ccaatcgcac gaaccctgac acggctggtg agaggctcaa ccgggcaagc cacgttagac    138600
     gaactacgcg aagcctttac aaacctaatc aaccagtacg gtcagggaag cgaccccatt    138660
     ctgcgagaag ctcctaccct gctgatcttc catggcgatc gtcacatcgg tttcgctggg    138720
     gttaacgcca accttgcctt gcaaaatgcc agtttagtgt gtgaaacctt gaagttgggt    138780
     gctttttata ctggctatgt cgttgctggc agtaatttta atcctcggct ggccagacta    138840
     ctgaaactcc caccaaatca caaaatctat gctggtttag caatcggtca tcctagattt    138900
     cactataaaa attggattga gcgcaaacct actcagattc aatggtttta agacctgaaa    138960
     tcgccagaca gttctgattc ttcagaataa cttaagcttg tgaagcatac tgaacggtta    139020
     gtgtaacccc ggttgaaatt ttcactagcc ataagcggct aaagctcatg ttttcctcat    139080
     tatgttgctc tataacccta agcagaaaag ccaagaatag atgtttgagt cagtcttccc    139140
     ttctggaagt tcgacggaaa tagaaatcat cagtaaaagc ttgactagag cggaatactt    139200
     taggaggttg tcatgttgaa aaaaattctg gtggctctag atcattcagc ctttagccag    139260
     aaaaccttta tgcaatctct ggttttagcc aaggcaaccc atgcaaagct gatgctgttt    139320
     catgtcatct catcgactga ggaaggatat cctccttatc ccttgatgcc aggtgtgttg    139380
     gaggagtttg acctgtcata tgctggagtc gcaaactctt atctcaatga cttagatgtc    139440
     ttcaaagcca gcagttttga gttactcaga tctcgagcca atcaggctaa agaaaagggt    139500
     ctgaccgttt tctaccaaca atccatggga gatccaggtc gagagatttg cgaaatctct    139560
     cgacaatgga aagcggatac gatcatcatc ggacgccgca gccgaaatct tcttagcaaa    139620
     gttctattgg gcagtgttag caactacgtc acacaccatg ctccttgttc agtgttgatt    139680
     gtccaccacc aggatgtgcc ggagttcatc cccaaacaat ctataaatac tttagaggcg    139740
     aataaactgt ctttcgaaga atggcgcgga aagttgtctt accgcagtat cttagtggcc    139800
     ttggatgggg gtgacattaa ccagcctatc gttaatagag caataaatct tgccaagaga    139860
     atgtccacag ctcggttgat gttgctgcat gtcttgcccc atgatgtggc aaaagttccc    139920
     attcctagtc cccctccaac cgcaattgct cagcaacggc tggataacta tcctagtttg    139980
     cgtgatgaca tcctctacag ccaacaacga caatggaatg cctatgatag tgattgctta    140040
     ccccaattgc gatcctatac tgcgatcgca agggaagcag gtattccaac tgaatttatt    140100
     caacaacctg gatctcccgg tgaagtcatt tgtgaatttg ctaagaacag atcatcagac    140160
     ttaattctag tgggtaatcg aggtcgttca ggacttagcg aaatgcttct tggaagtgtg    140220
     gggaaatatg ttgcgaacca tgcgtcctgt tccgtgatgg tcgttcgtcc tcagcaaccg    140280
     gcatgaagac aaaagatgtg ctcttagaac atcgcagagc gatccaataa ctgttgagtg    140340
     aagggagtca aactattgtg gatggcaaac ctcatcccag tggagatcag cgttttaggg    140400
     tgctagaggc aacgatgaaa cgtcatcaat atcagcccaa ttcactgatt gaagttttgc    140460
     ataaggctca ggaattgttc ggatatttag aacgcgacat cctattacac attgcccaca    140520
     gtttaaagtt accccctagt caagtctatg gtgtagccac cttctatcac tttttctcgc    140580
     taacaccttc tggacgccat acctgtgtgg tttgtatggg aacggcatgt tttgtcaaag    140640
     gggctgcatc actcctgtca acagtggaac agatcgctca cattcaagct ggggaaacta    140700
     ctcaagatgg aggcttgtca ctcagcactg ctcgttgcct gggggcctgt gggagtgctc    140760
     ctgctgtggt gttggatggt caagtggttg gctatcaaac ctcagaaaac ttaggtcagc    140820
     aagtcacgca aatgatggac catcctcaat ctaaggtcgc aacataaatg gatttacaag    140880
     agctacaaac ccttgctgag cgagaacaag agattctcga tgcgccttgc atccgctgct    140940
     gtacggtggg gggctgttta tctgctaatg ccttggcagt aaaagaacaa attgaagttg    141000
     agatcgcaac tcaagacctc aaccctccta tgcacgttcg gggggtgggc tgcatgggac    141060
     tgtgtagccg aggtccccta gtccgactag accccgcagg cattctctac gatcaagtaa    141120
     cccccgaaga cgcccctgaa ctggtccacg cctgccataa aaccctccaa ccccatctgc    141180
     ctaaagcctt atcaaatagt tctccgctcc aaccctcctc ttatcagccc cgacatcacc    141240
     ctttcttcac cctgcaacac cccatcgtcc tcgaaaacag tggtcatatt gaccctaagg    141300
     aaatcaagga ttatatggcc caaaaaggct atctagccct tacccaagcc ctttacgata    141360
     tgacccccag tgatgtaatt gatcagatta ctcaaagtgg tcttcgaggg cgaggcggcg    141420
     gcggataccc cacaggcttg aaatggtcaa cagtcgccaa aatgccccct ggacaaaagt    141480
     atgtgatttg caatggtgat gaaggtgacc caggtgcctt tatggatcgc agtgtcttag    141540
     aaagtgatcc ccatcgggtg ttagagggga tggcaattgc agcctacgct gtcggtgcca    141600
     accaaggcta catctatatt cgaggtgagt atcctctcgc catcaatcac ctcgaaacgg    141660
     ccctgcgtca agctcgcaag caaggtttac tcggtagtca aatttttgag tctccctttg    141720
     actttcggat cgatatccgt attggggcgg gggcctttgt ttgtggcgag gaaacagccc    141780
     taatggcctc catcgaaggg aagcgtggat tacctcaccc tcgaccacct taccctgctg    141840
     aatctggact ctggggttgt ccaacattga ttaataatgt ggaaactttt gccaatatcg    141900
     ctccgattat tcgcaatggg gctgaatggt ttgttgggat tggtacagac aagagcaaag    141960
     gaaccaaagt gttttcctta gcgggcaaga tccaaaatac cggattgatt gaagtcccca    142020
     tgggtacctc cctgcgccaa attgttgaac agatgggcgg gggtgtcctt gatggatcgg    142080
     ctaaagcagt gcaaacgggt ggcccctcag ggggatgtat tcctgcccat gcctttgata    142140
     cacccgtaga ttatgaatct ctgacccgtt tggggtccat tatggggtcc ggtggcatga    142200
     ttgtcatgga tcaggccacc aatatggtgg atgtcgctcg tttctttatg gaattttgca    142260
     tggaagagtc ctgtggtaag tgtgttccct gtagagcagg aacggttcag ctttaccagt    142320
     tactcacaaa aatctgtgat ggaaaagcaa gaaaagagga tttagagtct ctaaaccaac    142380
     tttgcgaaat ggtcaaggat actagcctat gtggccttgg aaaatctgcc cccaatccta    142440
     ttcttagtac cctacgtttt ttcaaagatg agtacttaac gctgatgcat aatgagggtt    142500
     ctggcgatta tcacccccca taagatagcg tcagacttgg gtttaagact gttgagtttt    142560
     gttagttcag aaacgattta acttaacatt acagaactca aaaaatgtcc tactttttct    142620
     ataaacttag tccgaataat tctgaagatg agcatgcaaa ggcactgttc atttaagaag    142680
     tgactgctag gatgattctg cagtatcagt ttcagagcaa tgcaatgcat ccattgtcaa    142740
     agtgagaacg tcgttaagaa cggaactaag acgctgaaaa cagctcaagt ggttcagtac    142800
     tttctgtgca aagactgtgg tcgtcgcttc aacgagcgta gtgggacgcc gatggcgaga    142860
     ttgagaacgc cagtggagac gatatcaatg gccatcaatg cccgcacgga aggcttaggg    142920
     attagagccg cagggagagt actcaggaaa tctcccaaca gtattatcct ttgggagaag    142980
     cgtttatccg cacaattatc aaatttctct cctccttctc caaaagaatc agaggtcaca    143040
     attgaaggcg atgaagtgta cacccgcgta ggtgagaatc tccccccccc tggcttagtg    143100
     aaggttggac cattcatttc atcgaccgtg agagtcgcta ttggttcgag gctcacgcgg    143160
     gtcttaagga tgaatcatta tttgagaaaa gtgtcaaagc tgcttgggat tgggctaaac    143220
     ccagttcatc gattcgttgg ttcacagatg gagaacgtcg atactccaag gtgttgtgga    143280
     agctagcgag tacttacttg cccaggagta ccacgaccca ggcctatcct tttcgcaaag    143340
     tatggcgagc gggtttagag gtggcgatga agatcaaagg ttcccaagga aaacctcggg    143400
     tagtgtgggt taatcgagag catccttata cggccattag ccccaagagc gatgttcatg    143460
     ccaatcatct tgaagccctc cacagttctt tgagacgacg ggctagcggt tatcgtagac    143520
     gccagaatca ctatgccaaa accgttgagg gattacaaag agccctgaac gtgcagcgat    143580
     tgattcacaa ttggtgtcgt actcactaca gccatggata ccagcgaacc ccagcaatgg    143640
     tgatgggatt tatccaaagg cccgttaaga ttggcgaagt gttgaccgtc agagctttta    143700
     attgcctcac ttcttaactg aacagtgccg catgcaaaat cctgttgaac caagccgctt    143760
     ccctcatccc ccagtaaagg tatgggggcg aggcgttagg ctgactttgc tgaccactct    143820
     ttgtagtctc ttcaccctag ctaaccctca gcttgtttcc gcagaaacgg tccttgaaaa    143880
     aatagaacgt accagcacag taaccgctgg aacgaacaag aatacccttc cctttgcctt    143940
     ccaagatgag caagggcaat tccaggggta ctcgattgaa atgctgaaac agatacaggc    144000
     ccaattatcg aaaaaacttg gtaaagagat taatctcgaa cttgttgcgc tgacccccaa    144060
     cgaacgaatt cctaaattag tcgcagggga agtagacatt gtctgtgatg cgagcagcta    144120
     tacctgggag cgggacaagg atatagactt ttccgtcagc tatggtttga caggcactcg    144180
     cttgttgatt aagcaaggga aaaaggcatg ggaacctgag atgttggtga atcagaaaat    144240
     agctgctgtg gcgggcacaa cgaatgagat tgcgattcgt cgagcgcagc ccaaagccca    144300
     aatcatcgtt ctcccagatc atactcaggg ttacaaagcg ctggagcagg gaacagttga    144360
     tgcatttgca gcagacggca ttttactcga aggttggcta caaaccagcc agaaccccga    144420
     ggacttcacc gttgtcgggt atttctcaag agagggcatt gcctgcatgg tgcctgagaa    144480
     taattctaaa tttgttaatc aagtgaatta ctcactcgtg cgttttatgg agggttactt    144540
     aaagggtaaa gaaccctatg tcaaaacgtt tgatcgttgg tttggccctg aggctaaagt    144600
     ccctctcact caagatctga gatctttagt cctagaaacc atgcagctag tgattgattt    144660
     taaagaagaa attcctgaaa gcgatcttta agattaccaa tcgtgaactg tttatttcag    144720
     gccgtcctct gatgaggcga aagtcgagca ctgccccaat cagtcggatt cgatagggga    144780
     tggattacgg tagaacaaga cttgcaaact gcggtgagat aaggtttgca atgtgcctgt    144840
     ttcaccttac cttgaccagc tatcactcac gttttcctca tattgtctat atagcctcaa    144900
     attaagaggt cagatgtcac attctctgag aactgacacc ttttcctcaa ctttgactgc    144960
     aaacagttta gttgtgaggg cattcgatta tggctacact caaggataaa tctctatcca    145020
     tccaatcctt aagcaaaaca gttcgacgct tcctgagcta tatcgctcaa ccgattctcc    145080
     gtatctttag tccctcccat gatgattatc caaaggtggg ggtccaaccc tttgaaggtg    145140
     atccagctga tccagattta aaccaggaag ggtcttggta aggattggat acacagcgga    145200
     aggaaaaggc tggtatgggc tatggatgtt aagaccctca agattgacga tcaactgatc    145260
     agtgctcggg gagatgaaac aatccttgag gccgctaccg catcagggat tcatattccg    145320
     acgctatgca acttgcaggg tgtttcctta tggggagcct gtcgactctg tttagtcgag    145380
     gttagtggaa gttctaagct attggccgct tgcgtcacac cagtggcaga ggggatgatc    145440
     gttcaaaccc aaaccaaacg gcttaaacat tatcggcgca tgatcgttga actgctattt    145500
     gcggaaggga atcatatctg ttcagtatgt gtttccaatc accactgcga attgcaggat    145560
     cttgctattg agatggggat tgatcatgtg cgctttacct atcaattccc agatcgctct    145620
     gttgatattt cccatcctca atttggcgtt gatcataatc gctgtgtttt atgtacacgt    145680
     tgtattcgag tttgtgatga gattgaaggg gctcatacct gggatatggc aggtcgaggc    145740
     cggaagtccc gagtgatcac agatttgaac cagccttggg gggaagccga gagctgtacc    145800
     gcttgtggaa agtgtgtcaa tgcctgtccc acaggagcca tctttcgacg tggttcaacg    145860
     gttgcggaga tggagcacga tcggagccaa cttgaattta tttctactgc gagaacgagg    145920
     cgagaatggg tgcaaaagtg agggataaat tccagacagt gcaaggaaat cagttttgag    145980
     gttggaatag tgagtttgaa tgcatctcgt gaaggtgttc gaacttagaa gtgcacaact    146040
     attttgggtt acggaggtag gatggcaaaa ctgaagttag cgactgtttg gctaggcgga    146100
     tgctcaggat gccatatgtc tttcctagac cttgacgagt ggttatttga gttggcccac    146160
     caagtcgatc tggtctacag cccttttatg gatgccaagc agtatccaca agaagtggat    146220
     gtggcactcg tcgaaggcgc aatagccaat accgatcatt gggagatgat tcatcaggtt    146280
     cgtgattgca ctcaatacct gattgccttt ggggattgtg ctgttacggg gaatgtcacc    146340
     gccttacgta atcttttggg tactgcggag ggggtacttg agcggtctta cataaacttg    146400
     gctgatctgg tgcctcagat tcctgcagag gaagcgattg tccccccttt attggattgg    146460
     gttaaacccg tacataccgt tgttcccgtc gatctctatt taccgggttg cccaccatca    146520
     ccttctcgaa tcaaatttgt attagaagcg ctactgcagg ggaagaggcc tcaactcgag    146580
     ggtcgagatc aaattaaatt cgggtgacaa agcctcaaac caatggtcaa gggcctctgc    146640
     tcagttccta tcaatcgtgg acgtatcaag gagtaccaag atgcttaaag ttagagacat    146700
     tatgacccaa gaggtgattg cgattcagga tactgcaaca gtggcacaag ccattgctct    146760
     aatgcaatac cataaagtcc gctccctcat tatcgagcac cctgaaggtc aaaccgctta    146820
     cgggatcatc actgagcgag atattgttta ccgagtcatg gctgttggca aagatcccca    146880
     tgaaattggc gttcaagagc ttgtccgcga accctgtatt acagcccatc ctgatctcac    146940
     tgtggaagaa atggctcaat tgtttgcagc agcaggcatt cagagagcgc cagtaattga    147000
     tggacagcag cttttaggca tcatttccgt cactgactta gtgatgaaaa cggatggaaa    147060
     gcagaactat caagccgatt ggctcgcgtt gcaagttgaa aatgcgttaa agcatgcccg    147120
     gattatttgt ggtgatccgc aaacccagat ttcaaaagaa tgctctgtag cctgggatgt    147180
     ggttgaagct tttgaagacc aagctgcctt aaacggagct atttagtcct tcagaacagg    147240
     ctactttatc actttcagtg taggtacctc agatgcacac taaatcatcg agacaatatt    147300
     ttagacaagt gctgttgttt ctaatggcct tggtcattac cccattgcta ttagcggttt    147360
     ctgcggttgg agcccccaat ttcgtgacgc aagatcagat caccgtgggg gcaacagagg    147420
     tcattcaagg taactattat gcaactgggg accgtataac ggttgacggg accttaaaag    147480
     ataatctgtt tgcagcagga gacaccattc aactatcggg caccgttgag aaggatgttt    147540
     acttagcggg tgatgaaata acgattgatg gcactgttaa aggcgatgct attctggccg    147600
     gcgctttggt tgccctcaat gggtctgttg aaggcgattt aatcgccgca gggcaagccg    147660
     tggtggtgaa cggaacggtt caagacgacg tgcggatagc aggagaggca ctgcttctca    147720
     aaaatcaggc tcgggtgaaa gatgacatga tcgccgcagg gctgagcctg gaaagtcaac    147780
     cccaaacgtc catcggtggc actctcacgg ttgcgagtgg tcaagcacta ctggcaggaa    147840
     cggttgatca ggatgttgtg gggggtatgg gaggactaac cttagagggg acagtgggtc    147900
     aagatgtggc cgttaccgtc ggtgataacc agacttggaa acctatattc ggacctagcc    147960
     ctcgccttaa gattcctgat gtgccggcag gattaaccct cacagattcg gcccaagtca    148020
     aaggtcggtt gacctacaaa tcaccaacta ctgcctccct aaaagatgga tcacaagtga    148080
     caggtaaaat cacgcatcaa ccgattccag aatgggaacc gacgccagtc aagccgacga    148140
     atatcgtgct agatcaactg cagcgcttgc tgacgattgg gttagtggga tgtgccatgc    148200
     tttgggcatt tccaaagtgg acagaaggat taacgcagaa tattcagact cgaccgttga    148260
     gaacgttggg ttggggcatt gtgaccagtg tgttggtggg agtagcaagt gttgtgatcg    148320
     cagttctgac catccttgca tttattgtgc ttatcttgac cctccaagga ttagcctggc    148380
     ccattctggg ggtcggaacc ctcgctaatc tggccctatg ggtcggtatt ggcagcttcg    148440
     tgagtttgat tgcccccgta ttaatcagca acctaggtgg acgctggctc tgcagccaat    148500
     tcaatttgaa taagaccgcg aaccgattta tcccattcct gatgggggta gtggttctga    148560
     tgttgattac cgctattccc ctgatcggcg gaatcatcag cattgtcatt attttcttga    148620
     gcttaggtgc actctggaat tggggaaggt cacggtgggc taagcccccc ttgcaagctc    148680
     aggaggcact agtgggttga gcggagatag gttctggcat aaccgatggg agaaatcgca    148740
     atgatgaaag ttgcagacat tatgactaca gaagtcatca aaattcggaa ttcggcgaag    148800
     gttgctgagg ccgtccgatt gatgcgacga catggaattc atgccctaat tgttgatcgg    148860
     aaccatgagc aagatgctta cggaattgtg accgccttcg atatcgttgc gaaggtaacg    148920
     gcctttggtc gtgatccacg gcaggtgaga gtctatgaaa ttatgacgaa accttgtttg    148980
     gtactcaatc cggaactcgg ggtcgaatat gccgcacgat tattgaccac taccggtata    149040
     catgccgcac ccattatcca gtggagtctg ctgggcattc tctcaatctc tgacattctc    149100
     gatcaagggg atttcttgga gaatcccttg gaggtggagc ttgctcaaaa aacacagcaa    149160
     ttaattgcgg acgctcatgc aatttgtaag caaaagggca ctaactccaa agcctgtaga    149220
     caagcttggc aagacgttga tgcagtccaa gcggaagcgg ctcatcaacg ggccgaaaag    149280
     ctcgaaaaaa cagcttttga agcgttttgt gaggagtacc cagaagcctt caaagatcga    149340
     gagtatgatg cctggtgtag tggatagcta gctcatgttt atcctaaaaa acagataact    149400
     tacaatgcct cagagaatca tcattgatcc agtcactcgg attgaaggcc atgccaaaat    149460
     ctcgatttac ttggatgacg caggtgaagt tacggatgct cgatttcatg tgacggagtt    149520
     tcgtggattt gagaagtttt gcgaaggccg acccttttgg gagatgccgg ggattacccc    149580
     gcgcatctgt gggatttgtc cagtcagcca cctactcgcg tcagcgaaag ctggagacca    149640
     gattcttgcc gtccacattc ctccagcggc tgagaaattg cgccgcttaa tgaacttagg    149700
     acagattatt cagtcccatg ccttgagttt ttttcatctg agtagtcctg acctactgtt    149760
     ggggtgggag agcgatccag ctcagcgaaa tgtatttggc ctgatggccg cagagccgga    149820
     tctggcccgc agcggtatcc gactacgcca gtttggtcag gaggtgattc agcatttagg    149880
     agggcagaaa attcacccgg cttgggctgt ccccggaggt gtgcgatcgg ctctaaccga    149940
     ccagggacgt gaacaaatcc gagcggggtt gctagaggta cgatcaacgg ccctttcaac    150000
     cctgaaacgg ttcaaagact tgttagaaga ccatgccagt gaggctcgaa tatttgggaa    150060
     tttccccagc ttatttatgg ggttaatcaa cccaaaggga ctctgggaac attaccaggg    150120
     ctgtttacgg tttgtggata gtgtcggcaa tatcattgcg gatcatcttg atccgagcca    150180
     attccagtcc tttattggcg aagcggttca gactgattct tatttgaagt ctccctacta    150240
     tcgtcccttg ggctatcctg atcagactcc aggtctgtgc cgtttagaga gtggcatgta    150300
     tcgggtggga ccgttagccc gactcaacgt ctgcgatcgc atgggcacac ccttagccga    150360
     tcaggaattg caagaattcc gccagcgggg caatgggacc gttacctctt ccttctacta    150420
     ccattacgct cgcttaattg agatcttggc ctgtattgaa cgcattgagc agcagataga    150480
     ggatccagga ctttgtcaac cgcccttaag agcccaggca gatgtcaatc aattagaggg    150540
     ggttggagtg agtgaagcac cacgggggac gctgtttcat cactatcaag tggatgcaac    150600
     ggggttactc caatccgtta atctgatcat cgccacgggg caaaataatc tggccatgaa    150660
     ccgcaccgtt gctcagattg ctcgtcacta cctccatgga cccgatattc ctgaatcgat    150720
     gctcaatcgg gtcgaagcag gtattcgggc ctttgatcct tgtttaagtt gctcgactca    150780
     tgcggcaggc cagatgccac ttcatatcca gtgcaaatca gcacatagtg gccaagtcct    150840
     aagtgaggta tggagaacct caacggggga atttcaagtt aaaggttgag aatatcagtg    150900
     cttttgtcaa tgattgtttc ccttagacag gtgggctgat attgtccaag agttgtaagg    150960
     tccgctcagc ttcttcaaca tcaataacgt tcaaagcaaa ccccacatgg acaatgacat    151020
     agtcacccac ctccgcatgg ggaacataag caaggctgac gtccttcaga acgcctccaa    151080
     aactcacttt ccccgcccgt aacagtgggt catcatgatc caagatgctg acaatctggc    151140
     cgggtaccgc taagcacatg gtgaatctgc ctcgacaaag ggctgttgtc tgtcaaaagt    151200
     ctcattgacc ttgggaaagc gtcccgcata gtggcgatgg gcagccatga tttgtccaag    151260
     ggcaatccct ccatcattag tagggacttg ctgatgccag taggggcgat actggttttc    151320
     ccgcaacctg tggatggctt tttcactcaa atattgattt tgaaaacatc cgcccgtgag    151380
     cacgatatat ggctcgccga tttgatgggc gatctggaca atgatttcaa ccaaagtatt    151440
     gtgaaactta gtggagatcc agctagtatc aacgccctgg tcaatatcgg ccagaatggc    151500
     tatcagcatc ggttcccaat ccatcacgaa gggcaatgaa gaggagagat ggaaaggata    151560
     gtcgtcttcc gttgcaaccc tgcccaagat agactctaag gccatcgctg cttgcccctc    151620
     aaaatgggtg gtttgcatca ggtccgtgag ggatgcgatc gcatcaaaga atcgccccac    151680
     acttgaggtc agaggggtat tcagagaccg atccagcatt gactgcaata cctgggcaga    151740
     cggctgggaa aaagccttca agggcgctaa gccttcccac tcaaaaatct cgcccccaaa    151800
     gcaggtatag agcagcccca tcgccgttcg tctgggctca cgagcggctt ggtcaccacc    151860
     gggtaagaaa aagggacgcc agtagccgac ccgctcaaac ccagttggtg tgatttgcag    151920
     aaattctccg ccccagacgg tctcatccaa tccataaccc gccccatccc aagcaattcc    151980
     cagaacagga gctgctaaat gctgctctgc catacaggcc aacacatggg catagtgatg    152040
     ttgcacagat aataagggaa cttgccattg ctgagctaaa gcttgggcag cttgggtgga    152100
     agcataatct ggatgagcat cacaggcgac caggttaggt tggcactcgt agagctgaag    152160
     taacgcctga agggtttgct gaaaacggtc gatggagggc acggtgtcca gatcccccag    152220
     atgttgactc ataaaaacgt gatcgtctaa ggagagggca atggtgttct ttagatgaga    152280
     acccaccgcg aggatcgtag ggcgttttgg gggtcgggta gattgtggcg ttgccgataa    152340
     gcctttgggg ctggaatgat gagacggaaa agtgacggat agagggagcg gcgcatatcc    152400
     tcgggcacgg cggcggagtt gagtttgccc attgataact tggacaactg agtcatctat    152460
     agggtgcaaa atagggcgat tctggatcag aaacagatcg gcgatagatt tgaggtcatc    152520
     caaggctttt tccccattga agctgatggg tgcaccgttg agattgccac tggtagcaac    152580
     gatggggaag tcgaggtcgg ccatcaggag atggtgaatc ggagtgtaag gtagcagtac    152640
     gcccaggtga gagcaacctg gggcgacttc atcggcaatt gggtctgcca gtgagaggtg    152700
     tcttcgctga agtaaaacaa tgggggcctt gggcgattgc agcagctccg cctccagttc    152760
     agatacttcg caggtgtgtt tgacccgttc caaagatggg tacatcaagg cgaagggttt    152820
     attggggcgc ttcttgcgcg ttcttagccg ctttactgca tccgaattgc gagcatcgac    152880
     taacaaatgg aagcccccca ctccttttac cgcgacgatc agaccctgac gaagggctac    152940
     agcagctaac ccgatagctc caagtccctc cgtcttttcc gctatcccct cctggttttg    153000
     ttgaacggcc tgtccctgaa gctgattgct aacccaacgt tccttctgcc aataccctac    153060
     ttcaacgatg gggccacagg taggacaggc aatcggttga gcatgaaatc ggcgagataa    153120
     gggattctga tactctgaca agcaatcggg acacatgtga aagctcgcca ttgcggtatt    153180
     accgcgatcg tagggtaagg ctcgaataat gctatacctc ggaccacagt gcgtacagtt    153240
     gataaacggg tagcggtatc tgcgatcgct agggttgaac agttcacgga gacaatcggc    153300
     acacgtagcg acatccggca gcaagagggt ggttttaggg ccgttttggc tgggacgaat    153360
     cgtaaaggtg tgctcaccca aaggtggaat acacttttgc ttgatagtct caatttcagc    153420
     gagaacaggg ggattggctt ggagttgagc gagaaactgg ttcaaccgtt cagggccacc    153480
     ttccacttca atcaccaccc cctgggtatc attcgacacc caacccctga gtttcaatcg    153540
     ggtcgctaaa cggaagataa atggccgaaa cccaacgcct tgaacggctc cttgaatcgt    153600
     tagttggagg cgctgatggg tcatcatcaa atatccattc cctcgatcat ccataaccag    153660
     gctgctttga ttgaggaggc taaaatttat agccaatttg gcgaagaaaa tcttgacgct    153720
     ccaagatgtc ttcttctcct tccactcctt tgggagagaa gccatcgatc acacctaata    153780
     ccccagcgcc ttggtccgtc ttggccagga tcacttctac aggattagcc gtcgcacagt    153840
     aaatggtgca gacttctggg gactgctgaa tcgcattcaa aacgctaatg ggaaaagcat    153900
     cttgcatcaa tagaataaaa ctatgacccg cggcgatttt cttagcatta ctgacagcga    153960
     tatcttggag tgaagggtcg ttgcccgcaa accggatcag acaaggccct gatgcttcgc    154020
     agaacgctag accaaatttt gcctgagggc aagttccgac cataatttca tataaatcct    154080
     ccactgtctt gatgaaatgg ctttggccca agattaaatt tgtatgttca gggacatgca    154140
     ggacaacggt ggtcacttcc atagtgcttc gcctcacaaa aaccgtcata tctttaagtc    154200
     agcaaaagcg ccaacaaacc acaaagggca attccgtcaa aaaccccggc gccgccaata    154260
     ctgaggacac cgccgctcat agctgttata tcccttagat gtaataaatc tgcaccgatt    154320
     aaggttccta tgatacctcc agcaaaagcc gtcgctggag catgatttat tcccaataac    154380
     attgccgtta atgccgcagt caaaggggcg agtaatgggt tcatcgtaat cccaattcca    154440
     gggacgatat gggcggcata gaaacaaaca acggtcacga tagatgtaat cagcaagatg    154500
     gctgctggat tagcctgtct aaattggtaa atggccagaa taatgggaat taagccaccc    154560
     cccacattca gggctacgac ctttgtttgt ctcattttga gcaatggaat cccccagaat    154620
     tgacgttggt agtacatcaa aaagttatcc atcgcgtaca caggtgagtc catgcgataa    154680
     agagggatat tgatcgtgct acccaaaata actaagacca atagtgcgag ggccacttga    154740
     ggcgtaaatc ctaactttgc agcggcaagt tgaacgacat caatcgtcaa taccaaccag    154800
     acgaagggta ggaacagtaa aaataagaga aacagcagta gagaaacggg taaatagatc    154860
     atatgaatca tccttaccgt tctaaacagt tttaactaac ccagctagac tggttagcaa    154920
     ctgttgtggg ttagtttgag gatagtctgc caatctgtaa aacttgtgag ttttgggggt    154980
     gaaacgaagg tctgcttagg tcttggcgac attgatccaa ataggcatac caagcatcca    155040
     tacccgctcc cgttcgagcc gatacctcaa atagggtagc ttgaggagcg atttgttgga    155100
     gcgaagagat cgcaaggtcc cgttgccatc ccacagcctc cgcaatatcc gttttattga    155160
     tcaaaacgac ctgagccgac ttgaacattg ctggatattt ttggggcttg tcttcgccct    155220
     cggtgacaga caagatgacg actctgattt gttctcctaa atcgaacgca gcgggacaaa    155280
     cgaggttgcc aacattttca atcacgagga gatcccaagg tttgggcggg agtttggata    155340
     aagcgtggct caccatcctg gcttctaagt ggcatgctgt ccccgttgta atttgaacgg    155400
     ctgatacccc agcatggcct aatcggtggg catcattatc cgtcgctaaa tcgccaacaa    155460
     tggctccaat ttgccaatca ttccgtttat cttgggcgag tcgctcaatc aaagctgttt    155520
     tccccgaacc cggcgaagat agcatattca ccgttaacca gccctggtgc tgaaacagga    155580
     ctctattttg attagcaatg cgatcattgt gttccagaat cttggcatga aggtcaaggt    155640
     ggcgaacgct gggagcctct atgcttgttc ctgcttggtt caattgaggg tcatggcctt    155700
     gatgaatctg gacagatcca gcactacagc cgcaatcttc acacatccta cgaaacctcc    155760
     attgctgtta gctccagttc tctgccctga cgcaaatcgg tagtgaactg atgacaagtg    155820
     ggacaaacat acacccagct agtgggctga aaatccagat cacaagctga acagtggcac    155880
     atcacgggca ccgtttctac ttcaagtcga gcattcgcag ccattgtgcc agccgtaacg    155940
     atttcaaagg cgagagtgag ggcttcagga atcacacccg acaattcccc gacccgcagc    156000
     ttaatccagt ggatatgctg agcaccttgt tgagctgcat ggtcgaaggc gatgtctaag    156060
     gtggtttgca ttaaactcac ttcatgcatg aggcttgatt gaactggaaa cagaatccag    156120
     ctgtaactga ataagttctt gaatggcgtc cagtgcttct gcaatgcctt cctctgccgt    156180
     ggtggacaga tgctcaccca cagcaaattc gatggctttg acttctaccc accaggcttg    156240
     gggatgatgc ccatagactg agtgggttaa agcgagtaat gagcgcggat cacaagtatg    156300
     ccccatggaa gggaccgtgc tacccgtggt ttccattccc ctaggggaaa tttgtgtaat    156360
     tctgaccgcc tgatcggggt ccatacggca ggcatcaata aagattacgg tttctgtgtt    156420
     cgccagttct gcagctagtt caggtgtgag ttgttgaacg gttaacgatc ttacctgagg    156480
     aagacgccaa atcgcgacct catctgcaat ccgagggcca atggcatcat cacaaagaag    156540
     ctggtttcca taaccaatca ctaagattga atggggttta gtgggttggg gaacggctgg    156600
     tgaagcgttc atgaagatgc atccttatac tcatcacctt gacgataggg cttaaagttg    156660
     aagagcttat gagggctgcc agggcttcaa ccacttccct tttgactcaa taaacggatc    156720
     aatattgagg aacttgtgag gatggaagtt caaactggcc gatcaaccgg ctaaaccagc    156780
     aaactcaatc gtcatagcgt cttcaagttt atggcatagg ctaaaaatgt aactaaagct    156840
     gcattgctca tcccaatcat tgtggaggtg agaggatgtt tgcaataacc ctgctccaga    156900
     tattggcgat gatgggcatc cctttaatcg tcacgactgt ttcatcccct atgaatgtca    156960
     ctgagcatcc gtctgttcca accctggcca cttctcaaac ctggcgactg gaattactgg    157020
     cggatgggaa ctatcaagtt tgtagtctgc ccgaacctaa agatgggcgg gatggtaatg    157080
     gggtttgctt tacctttgct aagcggggcg aatacgtgga tggatattac ggtttccccc    157140
     attctggaac ctatatctgt gttcaaggta aagcagaaca gaaccgggtg agagggcagg    157200
     ggttggcatt gtcttggcca ggtcaccctt ggcctccaat cacaacgtca caatacacct    157260
     ggcgattaga tcagcactta accctgcaaa atggctatgt tgttcgcagc gtcagagaac    157320
     agtccggaag agtcaattgg cttcgatttg atgaagtgaa gttggatatg gacggattcc    157380
     atcaatatcc aaccgtgaaa atgcgttctc ctactcaact ctgtgattgg cagacaccaa    157440
     cagagttctg agccgaaaga cttacaccca ccaagacata cctagagaac gtcaacgcta    157500
     aattcggagg tgaatgatgg ttacccttcc ctcctctccc aaacaattta attttcctaa    157560
     cctggttcag ggggtcgctc aactctgccg tcccacactc agtgttctag cggctatggc    157620
     gagctgtctc tcagtatttg tgctacaacc tcagacatca gtttgggtct atctacagac    157680
     agccacagta ttgatatgta tgacggctgg agcctttgcc atcaatgatt tcgatgatat    157740
     tgaaaaagat cgtatcaacc atcctgaacg cccccttccc tctggcactc tgctacctca    157800
     tcatgcgtgg tggattgcag tgatgctatt ctgtattgct ttaggcgcag caatccctct    157860
     tggtctatcg tgctggattg tagtggctat cagtgctctg ctgctttgga attatgcccc    157920
     tatattgaat atcagcggaa ttctaggcaa cggtgttgta tcaatgattg ttgcggcttt    157980
     aatcttcttc gctagcctag ttgcggaacg cccttgggca atgctctatc cgagtatctt    158040
     tttgtttttc tatattttgg ctaaagaaat tgtttgggat attcacgatg cagagggaga    158100
     tcaacaacgg ggggtaaata ccattgcaaa tctatgggga ctaacaccgg cattttcaat    158160
     cgcttgggga ttaatagggc tactgctcat ttcgattccc ctagccatcg cacgactcac    158220
     catggcccat ccggccttgt ttggatgttg tgccattttg atgttgttaa gctatgccct    158280
     cgcgctctgg cggtatcaga tcattcagac ttcccagacc tatacaaacc taattgtgct    158340
     gggacgcata ggaatgattc ttggcttatt cgggctattt ggaacggtcc cctctctcta    158400
     gaagtacaag agcttaagga ctgatcactg ttgcgatctc atctcgacta ggacaaggta    158460
     gccgttcctt ctccaaggct gttctagacc atacggtggc attgccggat tgaacatcac    158520
     caatctcgca acagggaata ccagatgtgt ttaaggtccg gcaaattgat ggtgcatccc    158580
     gttggggagc tgtgagtaaa agcgctccag aagcaatcgc agccaatgga tcaatcttga    158640
     aaacacggca aatatgggcc gagaggtctg atattggcac tttctcaagg tcgattacca    158700
     attgacagtt actggcctgg gctagctccc aaagagctgc tagcaacccc ccttcagtcg    158760
     ggtcatgcat cgccgagact tgtccagctt ggtttgcaag ttgggcatca cggagcacac    158820
     taataccagg cttatagaga taacccctcg cctgagtcag ctcatcggaa gttaacgcct    158880
     gactgatttg ttcagaatat tcgcgagcta agattgccgt agcttcaatg ggtacacttt    158940
     tagtcaacaa aatgcgatca ccaggcttag caccgcgagg agtaataagg ctatctcgcg    159000
     ccacttcacc aatcagtgtt ccgacaacga tgggtcggtc tatgccatag gtgatttcag    159060
     tatgcccccc aattaaagag acattgatct cctgacaagc cgtgtaaatt tgctgatgaa    159120
     tgcgttcagc caaagttgca gtggtcctct gctcggggag aagaatagtg gccatcaacc    159180
     agcggggagt agctcctgtt gtggcaatat cattagcatt aatctggacg acataccagc    159240
     caatgtcatc tgtaacaaag gtaatgggat cagatttaat gacccataac tttgctcctc    159300
     catcgacgac agcacaatca tgcccaatgc ctggccccaa taagacttga ggatcatgaa    159360
     tgggagtttg agagagaagg tgggccaata gatgtgaggg taatttacca accggcagag    159420
     gatcctgtgt caccttaacc tcctcatcta aaaatatctt ctagtcactt ttattagcag    159480
     aagcttcggt ctctgtatcc tgtgattttt cttgcaggat attctgtaac attctgagca    159540
     aggtatccga agaaaaaggt ttctgaagaa aggctttaac acactgtcca agggataaag    159600
     caaatgtctc atcaactaag aggccactgg tcacgatgac tttaagctga ggattgattt    159660
     ttcgcagtgt ttgaatggta gtttctccac tgagtgttgg catctgcata tccatcaata    159720
     caacatcaat ctctgtatga tgttgagcat actgagcaat ggcatcaata ccatcagctg    159780
     caaccatgac ctgatagttg tgctttacca acatactctg ggccacttct cgaatcggag    159840
     cttcatcatc aacgactaaa acgacctcgc cctgcccgtt aggacactct aattcttctt    159900
     cctctagact gctgactgat tcaatagcag ggaggtagac tttgaattga gtcccttgac    159960
     caacttcact gtagacggtg ataaatccat gatggctttg aataatcttg ttgaccgtcg    160020
     agagccccaa tccggttcct ccctcaggtt ccttggtagt aaagaagggc tcgaaaatct    160080
     gttcctgtag ttcaggagga attccaattc cagtatctgt aacggtgatc aagatgtacg    160140
     gtccagcttg ggcgttgaga aaatctgctg caagggcttc atctagggga aagttcattg    160200
     catggatgga caaagaaccg ccctctggca tagcatcacg agcattgacg agtagattca    160260
     taaagacttg atgtacctgg gtcgcatcgg catgaatcga ccaaagatcg tcagggatat    160320
     gcgtagatac ttcaatcgat ttaggaaacg tttttagggt aaagtctctc agctcactca    160380
     gtaagggttt aatgtaaaga attgcgcgtt caccatctgc gcccctggaa aatgagagca    160440
     cctgggtaat cagttttgac ccccgttgtg cacaggtttg taaaatctca aactggtgct    160500
     gaatttgttc actggcattg ggaagttgca aaggtaaaag ctgggctact ccatagatag    160560
     gcgtcagaat gttattgagg tcatgagcaa ttccgctagc aagtgcccca atactctcca    160620
     gtcgttgagc ccgtaaaaat tgtttttcga gttttttagc ctgagtgaca tcggtattga    160680
     caatgagtat ggctttggga ttccctaaac tatctttgac caacgtccat cggctcatca    160740
     ccgtgatcgc atcccctgat ttagtcacct gttgctgttc gccttgccac tttccatgtt    160800
     gcctcacata ttgttcaatt tctgctgctt tctcgtcggt tacttctagt aactggccaa    160860
     cttcttgact aagcgcttcc ccctgagtcc agccataaag agcagatgca cctttgctcc    160920
     agtattgaat ccgaccatca agtccctgga ccagaatggc atcggtggcg acattcaata    160980
     gcgctgctag ttctgaaatt tgttcttgtg attgcttgcg ttctgtaata tctgtcgcca    161040
     cgccatccaa tcgcaggact ctctcttcgg catctttgat caccctgccc cgatctaata    161100
     gccaccgaat cgacccatcc ggccggacaa tgcgatattc tacttcttgg ctacccgtct    161160
     ccaggatacg ttcagaaaaa ccgctaactt ttgcccgatc atcgggatgc atagcttgta    161220
     accagagttg tgaattatct ataaatgctg aaatagggcg tccatatatc tcttcagcgg    161280
     ctggactaag gtacaacaac tcaaatgaat ctgcctttac ggaccaaacg atatcttgca    161340
     gggattctag aatattgttg agacgctgtt gactttcttg gtgtgcaact tcggccagct    161400
     taccttcagt gacatcaaaa attacgccat ctatatggag aggttgacca ttttgagccg    161460
     gaataggttg tcctttttcc caaaagtacc gaatttgatc ctgtttatcc tgtattcgat    161520
     actccacttg aaatggcatc agagaagaga cagcctcctg tacggttgta accacttggg    161580
     gccgatcttc tggcacaatc atcggatcaa tggagcaaac ttctccgact gaaaggtcga    161640
     tggaatcatt acctgttaat gttttgcact gatcattcag aaacaccatt ctattgtgat    161700
     cttcaggaaa gacccgataa acgatccctg gtagattttc tgccaatgtt cgatattctt    161760
     gttcgctttg tctcaaagtt tgatcgattt ggtgccgatc taaggcttgc gctaacaaat    161820
     tggccactga ctggagaaag tcaatatcat tctcattaaa tagacgatgg tggccggtat    161880
     gagcaccgat taccccgtac gtttgatgtt gcccttgaag aatgacactc atcccactaa    161940
     cgaccttatg atccagtaac aatggcggac cgctaaatcg agtttctgtc tccaagttgt    162000
     caacaatgac tggcctagaa ctccgcaatg tataaccagc ttgggactct tgctcagtcc    162060
     caatgatggc ctgacccacc agtccaggtt gccaacccac cccggccttc agcaataacg    162120
     attcaccatc gggacgtaac tgaagtactt tgcaatattc cacctccaaa gtctgagaga    162180
     cgactctgac aatttcattc atcaaaccat cgatatctcg acttgctaag gctaatgccc    162240
     ctaattgagc cactgaagtc tgttgtctgg ctctcaaggc taaggtctgc tcgattattt    162300
     tttgcttagt gatatcactg gcgcttgcat aaatctgttg ctgctgaagg tatggtgtgg    162360
     cggaccagag aaaccagcgg taggagccat catggcagcg atatcgattc tcaaaggcaa    162420
     tagtattagt gcccattgcc aactgctcta attctctgac agtggcatcc cgatcctcgg    162480
     ggtgaacaaa gttaaggaaa ggctgagcca agagttcttt gattgaatag cctaaagtgc    162540
     taataaaagc aggattgacg gttttaaagt aaccgtcaaa gcccgcaata cagtgcaggt    162600
     ccaaagaaac tgaaaggaac cgattacggt cagtttctgc ggtttggcgc tcaagctctg    162660
     ctgtggtttt ctgggccaga atcgtcagca cctcttctat aaacgccaga tcgtcaaggg    162720
     gctgtcggca taaaacaaca attaatccca ctacttgctt agcactagag atgaggggaa    162780
     tccccaaata cccttctatg cttaagtccc tgagcatctg atcatgagga aaaaccgctt    162840
     ggacgccctg atgatacata caggattgtt gttcaatgac ttcctcacag ggagtcccag    162900
     ctagagcata ttcaaagttg gattggagct gtcctgcctt tgccaccgca agggtgcgaa    162960
     tcgttgcttg gccctctata ttgacaagct gaccaatatg agcgaaatct gcagggagta    163020
     cttgattcag atgtgtcaca agggattgga agaaatcctc accagtagat gttgccagac    163080
     ctttagccag atggtgtcgc ataagatctc ggcgctctaa tttcgatgtt cgatcttgca    163140
     ccagctgctc cagttcttgg ttgcgttttt ggagtagttg atgattttgg gtctccagtt    163200
     gcgtgatttg ctgctggagt agttccacga cctcataaat ttcagcaggg tctacgggta    163260
     gcaagttcct ctgggtgaca atgccccgca aggttccatg tccatcagcg acgactaatc    163320
     gacggacttt ttgctgctgc attttctgat ggacggtcca cagggaatca tctggagtaa    163380
     cgagggaaag aggggtactc atcacctctt gtgcttgagt ctgggcgaaa tccagctcca    163440
     atcgctgaaa ttggacaata tctctttctg taataatccc gattgggcag tgattttctg    163500
     tgagatcatc ggcaggttca accataacga tacagctcac tccctgcaga ttcatgcact    163560
     gggtaatctg caacagtgag ttagtaggta aagcttgaac cacatctggg gtcattacct    163620
     cccttacccg acgaatttta agtaaatcag acggttgcag cagattccga attcggcgag    163680
     gggtcagtag tcctttcacc tgtccttgtt gatccagcac aggtaaatga cgaatgtgct    163740
     gtcgattcat ccgctctaat gcggtgaata cagttgaatg cccatcatca accaacgtta    163800
     cgacgggttg ggacatcact gctgcagcgg tgagttcacc caacgagcga ttctcagcaa    163860
     ttaagcgaac aatgtcgcgt tcagtgagaa taccaaccat ttgagtatct tcctcaaaca    163920
     gtacacaacc cgtttgttcg attcccaatt gggggagagt gggctggtta acctcatctg    163980
     ccatcaaatg gcaatgaagg gcggaccgac tcgtaagacc aatgacttct gttaatggag    164040
     tatcaggcgc agctatgagg ggttgcaaat ctagggctgc ttcaagtggg aacgtcatga    164100
     attgctgcat catcgaaccc acttgcccac aattactttc atttgattgt aaatgcagct    164160
     cgattttatt ttgcaaaaga agcataaaac tcaatcaatg agtggtctaa cgtatcgtat    164220
     tgacccatat ttgcgggagg cggaatgact caatcttgag ggattgaata tattctcgtc    164280
     acaatttctt caactttctc acttattgtt ttggcattct tagccgtgtg aaaacaacag    164340
     attccaacgt cccgcccgtt caattatttt taggtggagt gtggagagaa tcgtgtattg    164400
     ctgtctacga acaaacctac gattgcaatc tatttcggtc tctatacttt ggcacgcaag    164460
     gttcatgggc atcgttttac tcaaggtatt gtcttgtcta gatattgaag gaatccatta    164520
     gcccagacca gtctgtacca aagaagtttt attgtcgtta tgccgtcaat tgttcatgaa    164580
     taaaccatct gagcaacgct cgcttaatag agcgcagaac tcctttcgtc tttcggaact    164640
     ctctccagag catattactg aaatttatga ttcatttcat attgaggacg accgaacggg    164700
     attgagttct gaaacgctac agcgtgcgat cgcagataat ctctattaca tccagggtaa    164760
     attcccagaa attgccaccc tatatgacta ctacatggct gtcgcctata cggtgcgcga    164820
     tcgattactg catcgctgga tcaacaccgt caaaacctac cgtgaacagg atgtcaaggt    164880
     ggtttgttat ctctctgctg aatatttacc aggccctcac ttagaaaata acctggttaa    164940
     tctcggtatc tatgatcaag tccaacaagc ggtggaatcc tcgggattag atctgagatc    165000
     cattttggcg caagaagaag aaccgggatt ggggaatggg ggactcggtc gtttagccgc    165060
     ctgctatatg gactccctag ctaccctgga aattccagcg attggctatg gcattcggta    165120
     tgagtacgga atctttgacc aggaaatccg agagggttgg caggttgaaa ttacggataa    165180
     atggttacgt ctgggtaacc cctgggaaat acctcgtcca gagaacgctg tagaggtcaa    165240
     gtttgggggc tatacagaac cctataccga tgatcaaggc gactaccgag tacgctggat    165300
     acctcaccaa gtggtgaatg gaatacccta tgacacccct atttccggtt atcgcgtaaa    165360
     caccacgagc acgatgcggc tttggaaggc agaagctcca gagtctttcg attttcaagc    165420
     ctttaacgtc ggggactatt acggagccgt cgatgccaaa attatttccg aaaatctgac    165480
     caaagttctc tatcccaatg atgaacccat ccaagggaag caactgcgtc ttgaacaaca    165540
     atacttcttc gtttcttgtt ccctccaaaa tctactaaaa attcatctgt tgcggggtga    165600
     cccgatcgag acctttcatg agaaatttgt gattcaactc aacgatacac accccgcgat    165660
     cggggttgcg gaactcatgc ggttgttggt agatgagtat ctgcttcatt ggcagaaggc    165720
     ttgggacata acccaacaag ccttcgctta caccaatcac accctcctgc ctgaagcgtt    165780
     ggagacctgg cctttgaatc tgtttggcag tctcttacct cgacatttag aaattattta    165840
     tgaaattaat cagcgttttc tcgatcaggt gcggctgaaa tacctaggta acccagataa    165900
     actcgcccgc ttatccttga ttgaagaagg cgggagcaaa cgaattcgca tggctcatct    165960
     ggcctgtgtg gggagtcacg ccatcaatgg ggtggcagca ttgcatacag aactcctgaa    166020
     agaaggggtc ctgaaagatt tctatgactt gtggccccat aagttcacca atataaccaa    166080
     cggggtaact ccgcgtcggt ggatggtatt aattaaccct aggctaaccc aattgattac    166140
     ccgcgagatt ggtgaaactt ggatcacaca acttgaggat ttcaaacggt tagaatcttt    166200
     agccgaggat ccagcgttcc gccaagaatg gcgacgggtc aaacgagccg tgaaacagga    166260
     tctagcagac tatattcaag ctcaccaagg actgactctt aatcccgatt cgatttttga    166320
     tatccaggcc aagcgcattc atgaatataa gcgccaacat ctcaatgtgc ttcatatcat    166380
     tacgctctat aaccgtatca aacacaatcc ccgactcgcg gttccacctc gcacttttat    166440
     ctttggaggc aaagctgccc ctggctatca gatggccaag ctgatcatta agctgatcac    166500
     gtcggtggga gaagtcgtaa atcatgatcc tgacatctgc gatctcatca aagtagtctt    166560
     cctacctgac ttcaatgtca ccaacagtca gcgaatttat cccgccgctg atttatcgga    166620
     gcagatttcc acggcaggga aggaagcctc cggcacgggc aatatgaagt tctcaatgaa    166680
     tggcgcttta accattggca ccctcgacgg tgccaatatt gaaattcgcg aggcagtgga    166740
     ggctgacaac tttttcctat ttgggcatac cagtgaagat attgttgacc ttaaggcaca    166800
     agggtacgtc ccaaagacct tctataatac caatccagcc ctgaaagaag cgatcgacct    166860
     cattgcctca ggatattttt cccatgggaa tcgggcgcta tttcaacccc tagtggatca    166920
     acttctgcaa gcagatccct attgcttact ggcagactat cagtcatata ttgactgcca    166980
     agatcaggtg ggacaggcat ttcaagatca agacacctgg accaaaacgg ccattctcaa    167040
     tgttgctcgg attgggcggt tctcttcaga tcgagccatt cgggaatatt gccgagagat    167100
     ttggtgggtt aatccggtct ccattcattt ggaggaatat cagcaggcca aagccagctt    167160
     ggcaggagaa cactgtctgg atgcagatgc atgtcccttt tgagtcctct atgccgccat    167220
     aaagtcctgt agattacccg attggagtaa cttcgatttt gcagtctgtt cgagttttct    167280
     cacccattcc cgactgatgc ccatttgttg actgactcgg tagagagagc gttctcgccc    167340
     atcttccaga ccatagcgga ggataagaac agtgcgctca ttgtcattga gctgagctag    167400
     agccgaccat aaagcatttc gcaagaaatc ttgttccacc acttcattag gactgggcat    167460
     ttgcaaatct tctaacaaat cacctaactc catctcttga tccttcccta ctcggatatt    167520
     cagggattca ggattggata tctgggcggc ttgtaaggtc ttctgcagct gttccaatgt    167580
     aatgcctaat tcggcaacca tttcctggtg agtgggggtg cgtccaaggg tttgggatag    167640
     ctctcgacgc actcgtttga tgcggttgag cttttccgtc atatgcacag ggatgcgaat    167700
     ggtatgggac tgcattgcga tcgcacgggt gatagattgg cgaatccacc agtatgcata    167760
     ggtgctaaat cgatatccct tagcaggatc aaacttctct accgctcgct ctagccccaa    167820
     actcccttct tggatgagat caattaaatc cattccccgt ttttgatatt tcttagcaat    167880
     cgtgaccact aatcgcagat tgccacaaat catcctgtgt tttgcccgct tcccccgttt    167940
     ctgtatctgg tctaattcag cttgggaaat cccttgcggt gggtttagag ctgattggat    168000
     ttgttgccct aatgacactt cttctgcatg ggtcaacagc gagtatccac ccatacgggt    168060
     caaataagcc ccaagagcgt ctttattcga tctcatgatt gtaaacatat cgatcacctg    168120
     ttcgcgttac tgacttaagc tggtttgaaa gcgtcggatt atacgatcga gcgtccgccc    168180
     atgactaatg tggatctagg aagtctgatt ctgactcact tcgaccaagc attatggcaa    168240
     agctcaacaa taagaacaac gccatcaata accagctcaa taccgtgacc cattctggat    168300
     agacagggtg aaaaaatagt tttaaatcgg aggggattcg catatatcac actcctattc    168360
     ttctaataaa atccgataaa ctggcaaaaa agattgcctc acagcgagat tcgccgttta    168420
     tcctcatttc tacagtagaa aatagtcttg atattcttgt gaggtcgata atccaatctc    168480
     tgactcacct tcaggccacg acagaggttc tatacatcag taaaaggcag atccctcagc    168540
     ccatctaaac taaagattgc gaatagctgg ctgaagtatc tgccatgcca catctaaacc    168600
     aagtacttca accaaggttc aaggctgaac aaagatcggc tcaaacttca gcttggaaca    168660
     gtgattaatt gcctggatcc gtctcaagat gggtaatgcg tccccgccaa taggtaaagg    168720
     gtccatcttc caattgccag ctcacctgac caaaggtcgg catatcgtac ccacccaatg    168780
     tcctatactc ggacaccaca caactccagg gggtttcaac ggcttgtcct gcaaccattc    168840
     tgggtcgatt cggtgcagtg atactaacga ggtcaccatt aggatcaaaa ttgtaatgga    168900
     ctcctacgtc tggttcactt gtaaccttta cggtgaactc attcagtttg tgccaatgta    168960
     acgctgaatt attcagaaac gcagctggga aaaagatcaa ttctgccagg taccgcatta    169020
     gctccccttt atctgtactc ggtcctgcca cccttaaaaa gggaattgaa cccaacagcc    169080
     ttccttccag cctcccttta ccttggacat agctgtccac tacttcgata tgaataaagg    169140
     gggcaagtcg aaaaatggct cgccacacaa accccggttg tcgaatcgca aagtcttggg    169200
     tggccgtaaa cggtagccac cttccctgct cggataaacg catttcaccc gtttggtgaa    169260
     tctgaatagt ggtgggacta tcctgagatg gcccttggtc tgagtctgaa cgatgcgatc    169320
     gcattgccaa tgcacaaatc aacctggggg gttgaaggac ctgttcatca ttggtcagca    169380
     ttctcagagc ctggacttgt tgctcaattg agcgatgaaa ctgccaagtg gacccaaaat    169440
     gcagaatgaa caagagggct agagccaata aaattgcgag cctaaggggc acaacaacct    169500
     cccaaaccat aaaaaataat catgttcaga ggttctaaac catcggaaaa ccgactttaa    169560
     cctcgagcag atgggtgatc aacaggcgag gatttcctct ctggcttgga tgaattcgcc    169620
     cggaaagttt catcacacag taagactaac tgacctctca ctgcagcgtg atccagtaag    169680
     ttatgggcca ccgctgcatc tgctaagggt aggcgatcgg caatgatagg ttgaatagag    169740
     ccatccgcca gtagatccag aaggctcgtt aaatcgtctc ggaaccaatt gggttgacgc    169800
     cgcttcaaat cagtaatgtt gtaaaaaaca gcgctacgac gatccggcca gatgcttaac    169860
     agagtcagaa ggcccatact ctccccgact ttcaacagcc ttccccaatg tgctgatagc    169920
     gctgaggaaa acccatagct aatgagttgt cccccaggcg ctaaagtttg gtatgacccc    169980
     agtaaatgac gccccccaat ggcatcaaag accacatcca ttccattggg agtgagacga    170040
     cgaatctgcg gctggaaatt ttccggcaga taatctatcg gagtggcacc caaattggca    170100
     atgagatcat gtttcgttgt ggaatcagta ccatacatct ttaagcctgc gaggtgacct    170160
     aactccagga gcgcagttcc aacaccgccc gcagcaccgt gaatcaagat gcgatcgccg    170220
     gattgaacct tagcaattcg gtgcagtaac tgataggctg tcacgtactg caaaactaga    170280
     ccgacggcct cggcaacatc cacctcaggt ggtaccagaa cacattcatg ggcgggtaaa    170340
     caaacgtact cactatatcc ccccaccaca gtcagggccg caatccgctg accgatatcc    170400
     agccccgcga ccccagaacc gagctgatca acaatcccaa ctatttcata gcctggggta    170460
     aagggcactt tgggtaatcc cagatagagt ccctcgcgga tcaaaacgtc tgtaaaagcc    170520
     acaccagttg ctaatacccg tactcccact tctcccgccc gaggttcagg tcgttcatcc    170580
     ataactatct ctaaaacatc cggtccgccg tggcgggaaa taatcacatg tcggtagcgc    170640
     atactaacac ctatgtttga gggctaaatg ctttacagtt gagggcatct agcctccaat    170700
     ctagagtggg atattgtgaa aattgtgagg gctgtaagca cccaatagcg acgatctaat    170760
     cccctcacat tgtcttcaac ttttcgcttt agtctcatgg ctagagagga tctgaattgc    170820
     ccctcaagat taatccttcc ccctcttcct gagcacatga cgcttgactt caagcgtttt    170880
     ctcgccatta agttatggga atgaaggata tcttgattga taaagaatct tctcacaggc    170940
     ttccaacagg gaaagcggtc agagatgtta ataattacca tcgaacgagc acaacatcgc    171000
     tgaaacatta catgtgctca ttactgaacg gtcgtggaga cacccatgtt caatatcatc    171060
     cgttacagtc aaatggtcgg attaactgca attgggaaca ccactaattc ccacctagga    171120
     aacgtggaag agatctggct tgacgagtct ggatatgtca catatctatc cagtcgccag    171180
     cggtattggt ctcttcgtca agttgcgagt gtgggcaaag agaccgtgtc ggttgatcgt    171240
     cccctcatag tgtcaacccc accccatctc catcatggat atcaactccc agtccgatct    171300
     agggtcggag aaacgttggg ctgggtagaa gattttctgt tcgattggca tacaggggaa    171360
     atcgtcgctt atatcttggc aggagagatt gccagttacc taggagaacg cgcaatcctc    171420
     ttccctgggg atatcgagaa atacacacct gaagccctcc tgattccaga aggagcaaaa    171480
     aatctactca aaccggagtc agaagggtca aaggatttta tttgcgaaaa atctaccgag    171540
     gttaaatttg ttatccagga gatgacggat cgcttacagc gtttattcaa cctaaatgac    171600
     ggaccatacg agattcagat caagattcag caagttagcg aagctcttgc ttccacgaat    171660
     aagtatgatc agcgccattt ggctgaagct actgagtttc ttcaaggtca atgggctagt    171720
     ttgcagcatg gaattagtcg taacctcaat ctagcccaaa ctgctctaga aaaagcttgg    171780
     caagaaattg tgagtcagaa caagctttaa aggttgatca cgatctggat gcctatctat    171840
     ttttggtgtg ctgctcaccc acccaaatga actgacccct ttaatttatg gaggattgga    171900
     tatgtccact ctaaccctca acgtttctac tgttagccct ctcggcgacc gtgtctttct    171960
     gaaggtaaat agggctgaag aaaaaaccgc aggtggcatc ttaatgcccg atacagctca    172020
     agagaaatct caagtgggaa aggtggttag tgttgggcct ggtttgaggt ctgggaatgg    172080
     ctcctatgcc cccatcgacg ttcaagtcgg cgatcaggtg ctatatgcca aatacagtgg    172140
     aacggatatc aaactgggta atgaagatta tgtgctgacc aaagctcaag atattctcgc    172200
     gattgtcaca tagggaatca acgtgttgga ggtaaggaat gatggctaag tcaattcaat    172260
     acgatacagc ggctcgccat gccttagagc aagggatcga tctgctgact gaagcagtgg    172320
     cagtgacctt aggacctaga ggccgcaatg tcgtccttga gcaaaaattt ggtcccccgc    172380
     aaattgtgaa tgatggcatc accattgcca aggaaattga actagacaac cctttagcca    172440
     atacaggcgt agccttgttg cgccaagttg cagccaaaac caatgatgcg gcaggggatg    172500
     gcaccaccac agccgttgtt ttaagccatg caatggtaaa ggaagggttg cgcaatatcg    172560
     cagcgggagc caatccaatg gcaatacgac ggggcatcga ccaggccacc caatttttgt    172620
     tggatcagat tgctgaacat gcactacctg tgaaagattc caatgcgatc tcacaggttg    172680
     ggaccattgc tgcgggcaat gatgaaactg tggggcaaat gattgctgct gccatggcaa    172740
     aggtgggtca gcaaggggtg atttctttgg aagaaggcca atcaatgcag accgaagtcg    172800
     aagtcacgga agggatgcgg tttgacaagg ggtatatttc accttacttc gtaacggatg    172860
     ccgagcgaat ggtgacgact ctggatgatg cctacctatt actaacggat aaaaagatca    172920
     ccttagtgaa tgccttactg cccattctgg agaacgttac acaaacgggt aaacctcttg    172980
     tgataattgc tgaagatatt gaaaaagaag ccttagcaac ccttgtccta aatcaattac    173040
     gaggtactgt cagggtggct ggggttaagg cacctggatt tggcgatcgc cgcaaggatc    173100
     tgttagctga tatagcagta ctcactggag gacaagtcat cagcgaagat actgggctga    173160
     ccttagaaaa cgccacccta gaaatgatgg gccgtgctcg ccaagtggtc atcactaagg    173220
     accataccac cctcatttcg gaaagcaatg aagctgctgt caaagcgcgt tgtgagcaaa    173280
     ttcatcgcct gatagatgag acagactcat cctttgaaaa ggaaaaactg catgagcgtc    173340
     tagctcagct ttctggtggg gtagctgtaa tcaaggttgg ggccgccact gaaacggaaa    173400
     tgaaggaccg taagttaaaa ctagaagacg cgattaacgc aactcaagcc gctgttgagg    173460
     aaggcattgt tccaggtggt ggtacaaccc tcgtgcatct tgcccctcaa cttgaggact    173520
     ggtctgctga acatttggtt ggtgatgaac tgatcggagc catgattcta gtccgttccc    173580
     tctctgctcc attgagacag attgtggaga acgcgggtct gaatggtggg gtggttgtag    173640
     agcaggttaa gactttaccg ttcaacacgg gctatgatgc cttgaacaac cagtatgtgg    173700
     atatgtttac tgccgggatt gtcgatccag ctaaggtgac tagtgctggg ttgcgaaatg    173760
     ccgcttccat tgcgggtatg gttctgacca cagagtgcat tattgcggag caatctcagg    173820
     ccacaacaaa ggatttagcg aatgctggtt gagaaaggaa agggtccggt gactgattct    173880
     ttgatctgat gctacgacat taggattccc ttcaatgtcc gatttggcct gtattcgttg    173940
     gctgatcttc atggttttca cataattatt ccttaatctt tggaatattg gtaatcatcc    174000
     atgagatgga acggaaggaa aaagtgccca catagatgga gtgagtcatc atgtcatccg    174060
     catcaactgg cgtactagat aggtgtcctg atattacaga actgcctgag aaagtgatgt    174120
     gtcgttatgt caatgagatg cagcgaaccc aaattatccg aattgtcaat attccccagg    174180
     acttcctcga gcgaactgta ttaccaggtg atcacttagt ttttgaaacc tatcccgacg    174240
     ctgagttgga ggttcatacc tatgaaatgg ccagtgctac tttgacggcg aagattatat    174300
     gagatcgctt ggccattcca acagtatcgg aaacaactag gatgtgtgct ttatataaag    174360
     agttgaatgg gggataaaag gtcccctcag gcctttaaac gcaaatgatt cttgttccca    174420
     ctctaataac ctttgccact tagaactagg tatgctttgg atctattccc aaaaacaggc    174480
     ccccttttgg tggattgaaa ttgtgacgct agaaccacaa agcaccctct actatggccc    174540
     tttcaaaact tcgacagaag ctgcaagtta tcaatcaaac attattaaag acatgaaggc    174600
     aatgcctcaa agaattactg tcacaatccg cacatgtcaa ccagaaatct tagccatcac    174660
     caatattgaa gacccgaata gagaaccccc tttcctaccc gaacgatagc tccaaaaacg    174720
     accactaata cttcaacgag aagtatggat actcaacatc taaaattcat ccctcagagc    174780
     aacgttttta agctgctatg ggtcttattc ttatcttttc taattggatt ggagcgagaa    174840
     ggacatcata ctcaaacagg tcgctatgct tttggtggag ttcgtaccta cccaatgatt    174900
     ggattagtag ggtactgcat cgcctttctg acgaacggtc aaagtatcgc attgggaatg    174960
     ggttttctag ccattgctgg tctgatggct ctttcgtatt ggcataagtt gcaaacagta    175020
     gaaaatgcag gggtaacttc agaaattgct tgcttagcaa cctatttggt gggtgctctt    175080
     gtctactttg gtcactactg ggaagccgca accttagcga ttaccagttt atttttattg    175140
     gaattaaagt ctgttttaga aaagttggct acccaatttt cttcagaaga tattcttaca    175200
     ttaaccaagt ttttactact gacatttgtg atcttgccag ttctgcccaa tcaagcctat    175260
     ggcgagtttc aactcaatcc ctttaagact tggttagtcg tcattgctgt aagcggcatc    175320
     tcctatgcca gctatctgtt gcagcgtgca tttcagggga gagggactct gattattatt    175380
     gcgttgattg gtggagctta ttcttcaacc gttacaaccg tggcccttgc caaacaatcc    175440
     acctcagatc ctctgccaag aaggtatgca ggagcaattc tcatcgcctc agggatgatg    175500
     tattgccgct tgatcgtttt aacgggtatc ttcaataagt ctcttgcagc cctcctatgg    175560
     ggacctatga gtctcgtggc aagcatcgct attttaggag gtggaatatg gttaatattt    175620
     acaggtcgct cagctaaggt ttactcagtc cgagcaacat ctcaaaatcc acttgagcta    175680
     agatttgcat tactctttgc aggggtattt gtgatgttgc tagttttgac acactacgca    175740
     attgaggttt tgggtcaagc gggcatctac accctagctg gtattttggg gttcgcggat    175800
     gtagatcctt tcgtcatggg tatcacccaa tctgctggtc agtctactgc gctaaacatt    175860
     agtgcgatcg ctattttaat agccgcagct agtaatagta tcgcgaaagg tatatacaca    175920
     ttgggtattg gtgattggaa agtagggaaa tcaagcctta ttttacaaag tattctagct    175980
     ttgatcagct tacttcctat tttatatttg aggtagaaaa tgcgaggtta ctaaaactat    176040
     taacgccact attttgattg aaagtcttga cagtttagtg catcgcttgt taggaccctt    176100
     cctgggtgaa cagcacaact aaggtatgca tttcgattgt aaaacttaca ctttagacaa    176160
     tgattacaac tatcttttcg caaatatact aaagatctgc gaaagagctt aataaagttt    176220
     ggggaacagc aaatcaagat caccactaaa atcgctatta ctattcctaa attaatagaa    176280
     gaactgacat gattatcaga tacttctcta ggattaggaa tatcaagctg gttcactaaa    176340
     ataattttcc tagatatttg ctcttgttca accagtattt taatcaaatc tattgtgtat    176400
     accatgatta catcctgcta tttacttaga gaaattatct tttcagtaac tagtattctt    176460
     ctgaaatagt taacaataac tttcttgcgt cctcggcata aaccagacag ttacgataag    176520
     catcactttc tgcctgttat aagttagaca ttgataataa aaatatattt gtaaaatttg    176580
     aagtatttgt gagaaagcaa gaatgaagtg agcactgata aagatataga tagtgcgtct    176640
     cttggctgat gatttatagc tataggaata aaaggaactt tagctttctt ctcgaattat    176700
     tagatgacac cgatatattt ctcatcaata tttggaggat taaatactat atttaatttt    176760
     aataaatata attatactgt tgaataatat ttttagtggc ggcagatttc tactatgtct    176820
     cacaaaacct ccaagttctt agaatagact aggtactaat caattcaaag attatgtgta    176880
     attagctaag cacgtctaac cgaaaagaat tgtttaggga ttcagagtta tgaatactaa    176940
     tgatcttgca taggatcctt agcccaaaat aatagttatc ctccgttata gagataaaat    177000
     tctttcttga catgtgtacg ttggtttttt tcttcctcct atttctatgt ttcaacttat    177060
     tctccatggc accttttgag cctatataag aattggaatt caagctttac ttaaccaagg    177120
     gataagcaaa aaaatatcct atgcatctat gacaaatacc taggttatat atatgtatat    177180
     ttctataatt caatactatt ggaaattaag aaatattttc tggatatcta aaagcagatg    177240
     atggtctttt ttaaagaaac aatcactagc tatgaaagaa accaaccaaa atcatctaat    177300
     atcagccagc actgagcaaa agatgctaag taatcaaaga aagatttcct ttggcacttc    177360
     agtcgaaatc ctgaaaggac ctttgcgtgg atgtaaaggt aaaatcatag gaagtactaa    177420
     tgatggtgtg ttttttatct taaaagattt tgactcagtt caaaaagaca acagccagtt    177480
     tgtagagggt ccttacttag gatgtgaact taagattttg agttaaatga atagttaaac    177540
     tatcagcagg taatttcata aacactttga cattcaccga tcaatcaacg gcaggtgaat    177600
     aatcagttcc gcaatttgtt agtctttttc caagcgtata aattaaaatt gaagcctacc    177660
     aaaataaaaa gttacttagg aatgaaactt aagtcaatag ctctacagaa tttgagccag    177720
     taggatcatt tcactcacaa gatcttcaaa ctatatcagt aatttgaagg tgaggtgaaa    177780
     aggtaatact atcttctacc ttccaccact taaacagatg gaggtaatga tgaataagag    177840
     aatcttgatc gccatggatg attctgattc cagtgagttt gtattcgaac aagcatttct    177900
     catcgcacaa gaacataagt ctagtctcaa actactccat gttctaaatt ctcaagatca    177960
     aaatttacct tccaacaaga cacttagtga ccaattacaa tctactcaga aaaattcaaa    178020
     tgtaatgcct gttcaaaagt ctaatttccc taaatccaat tctgagggga ggattttaag    178080
     gcgtctagtt ggttgtgtag agagagccaa ggctgcccgt atagatgcgg actatatctg    178140
     cataattgga gaaccgggac aattaatttg tgacttagcg ctatcttggc gtgcagactt    178200
     aattcttttg ggtggagaag aaccagctag tgatagtaca ccttctcaca atagtgtcag    178260
     aaactatgtt acacaccatg caccttgttc agttgaagtt gcacgacttt caaggaatca    178320
     acagccatca aactcactag aaaatgaggt tctttattca catctttctg gttggcaata    178380
     attttaggta cccagaaaat cgaaaaataa attcagttcc ataagggagg gattacgatg    178440
     ctatatcctt tatattccag cggagcgact tacttcgtag ttaaactggg tgttctttgt    178500
     ttagccattt tcgtttgggg ctgggcacat cacaccccta agatttctaa ggaaatttaa    178560
     aaactctgta ctttaggtgc agaggaaact catggcactg gtctattaat aggtacacac    178620
     ttaaactctt tttagtgagg agttctagtg tgctcaacgg acgagaacaa aatctcatct    178680
     ccattgctag tgtggtctgc ttactgagtc cccaatgggg tctaactttt gaatcaggcg    178740
     tcgtacgtct agcactctct gtaaccccgg ccgcttcttc gcatagagat tctgccgtct    178800
     tcgataagca ctacatcgtc tcctcaaggc agcattgtga gcctcattat gattggcata    178860
     gacctcagac cctgtactca tagcggtaaa gggatgctct gctttcaccc actctactcg    178920
     ccgattcccc tgagaccctt taactttcat cgcgacttct aacccttctc gctaaacctt    178980
     gcgatgccca tagtcagggt gacactcctc accgttgaga tagacactgg cgagcttcca    179040
     aagctcttgt ccataaagcc tttcacctaa gccttcggca cgctactcga acggtaaacc    179100
     atcgaatccc atcacaggct ttcacccact cccaagccta gtaaacgcca tttgcaaaaa    179160
     gttgtgtatc cttgaggtca gcttgtgctg tcaaccaata gcggctttcg cgttcaagaa    179220
     cgtggatgtt ccagccctgg gactaactgg ggggaagatt tttgcctaca cgagtgtata    179280
     cttcatcccc tcctaccgtc acatcagggc ctgctggaga ggggggtgcc ccgttctttg    179340
     cttggtctgc taggcgtttt tctcaacgca taatgatggt gtgagattta ccgaaaatcc    179400
     cacctgtagc acgaacgctc attccttcgg tgcgagcatt gatggcacag ctcaccactg    179460
     aactagaggt gcgtaagcga gccattgggg tatcggtgcg ttcattgaaa caccgattgc    179520
     aatccttaca cggaaattaa tcgaatttca tgacaaacaa gcaatttatg tctgaaatat    179580
     tagtttctct aaatgggcgt agctagtgga tcggggatgc cttagatttc ggaatggtca    179640
     cccctgggaa tagggagtca aaccgttcat tgacccaagt aagccgaaga atgagtagat    179700
     gattgaaacc atcctcactc cagcgcatgc caaccccctt aaagcgctgt tgaatcagcc    179760
     acttacaagc actttcgacc attcctgacc ccagcggcat ctgttgttgt tcaaagtggc    179820
     gatatcggat gtgtcggtga tggcgctgga aataagcctg tacctggagc aacgtcgtaa    179880
     aagacttgcc cgtaaacaat tgtgagtgaa tcaacatcgt caaggaccgc aatacggggt    179940
     atgacaacga ttcgtacaaa aactgatcat agagctgaaa gctatatctg atagctattt    180000
     cagacaacgg ttttgtattt tgaggtgagg tagaagttca tatcgttgtt ttggacccgt    180060
     ttttaaactc actgtttgat tgcagagtag tttcaatact ctgagagatc tccaatatgt    180120
     tcggcaagat ggtcaattct gagctaccca tgtcatcatc ttgagaacat cttattgaac    180180
     tgcattttcc aaatattgaa atgctctttg cgctgcccct tttgcttgtt cagatgtgac    180240
     agtctgatat cgaagggtgg tctggatatg ctggtgcccc attaacgctc tgagttcctc    180300
     caaccccatt agtcccactc gctctgtcgc aaaagtatga cgcagatcgt gcaaccttat    180360
     cccttggagt tgtggatagc cttgaatcga ttgatgccag tgatgatggg ctgttctgta    180420
     actcagacgg gtcacttgac tcgtaggggt ctttctagcc gtgaacaatg ctggcgaagg    180480
     cgtatagcga tagtgctgaa tataggtctg caaggctgca gctgcatttt cactataaaa    180540
     gcaccaacgg gttttgttgc ctttacccac gacctgaaat tgccgttgct ccagatcgac    180600
     ttctgccaaa tccaaggcca aaatttctga gatgcgggcc ccactgtgat gcaatagctt    180660
     caccagtgca tacaagcgtg catcgttata aacagcttga tacaaggtcg tcaattgctc    180720
     gggtttcaaa aaccgaatgg gctgatcact tagatgctct cccttggctt tatccggtga    180780
     acgatgctct aactgggcaa tgggattgct gcgaatatac cgttggcgca cagcaaagtt    180840
     gagtaaggcc ttgagggtgg cttgatgccg atggtgagtc gtgtaagaca ggtgcgtcag    180900
     gctattgaga tactcagaca ggatgtcagc atctaataat tccactgacc agctgccata    180960
     tcgcttcagt aacggcatca aggtcagttc ataggagcgg gctgtgctcg tagccagatg    181020
     ggggcgatct aaaaactggg ttgccacggt ggctaaaggc tgattcatct ggagctttgc    181080
     ttaaatctaa agactcactt cgcctcatgc actatacctc tggggaagaa atatccagtg    181140
     ataaatccat gcaaccttta gaatccgatt ccctccccct tgccgatgaa tccttggctg    181200
     agtatcttcg ccgtctacga gtcagactcg gtctcaccca gaaggaagtc gctctcaagg    181260
     ccaatattca tgcccaaagc ttgggtaagc tggagcgcgg caaaacgttg tccctcaatc    181320
     ataaaactcg tcagggctta gcttgtgcct tacaaattcc acctgattac ttggattcca    181380
     tcagccgagg tcgagccatc caagccacgc aaactttgaa attctgcccc cagtgttggc    181440
     gcataggcag tgctccagag ccgctgtgga tggacctcag atctaaacac tgttttgctt    181500
     gcggcactcg actacaagat cgctgtatca gctgccaaga acccattacc tccctcaagc    181560
     atcgtttttg cccctattgc ggaaccccct atcaaaccca gcagcagatc caaggagttt    181620
     gaggtcgtgg ccagtgtaca tgaaaccgcc tatccacgtt tgaaacggaa tccttcagat    181680
     caagaccttt cagctatcta cactcccact aaagaggaaa tggcgctagc gcagcacctc    181740
     acccgtagtc ctcaaactca attggggttt ttggtgatgc tcaaaaccta ccagcgcttg    181800
     ggctatgcca tcaagaccag tgatgtgccc gctgctgctg tgcgtcacat cgccactata    181860
     gttggcctac acggtttcca actggatctg acgacttatg atcgctcccc cacacgctac    181920
     cggcacctga atattattcg ggggtatcta caaatcacca agtatggtcc tcaagccaaa    181980
     gcggtcattg aggcgtccat ggaaaaggcc gcagtgacga aacatgaact cgctgacctc    182040
     atcaatgtgg ccattgaaga attggtccgc catcgactgg aattacccgc ttttattgcc    182100
     ctagatcgcg cagcccgtca ggtcagacaa gccgtatcta ctcagctgta aaacaagtca    182160
     gtcaggcctt aaagcggacg gagcgggtga agctgaatcg gttgtttttg tcggcttctc    182220
     tagcagagaa atcgttatgg aaccgcttga aggaagaccc cggcaaaccc ttgctctcgc    182280
     ggctgcaaga gtggattgag cgattggaat ggttggctga tctgcagatc ccaacttccg    182340
     gtttggagga tattcccgcc gtcaagatca aggccctcgc cgcagaagcc cagtctttag    182400
     atgccgctcg catgaaagaa atgagcgatg ctaaacgcta taccttagcc ctggccttgc    182460
     tatcgactca atatgccaac accctggatg atctcgcgga gatgtttatc aaacgggtcc    182520
     gccagctcca tcacaagggg gcagaagccc tgagtgacta tcgtcgcagg acgcaagctc    182580
     gcacggatga actcatcgat atcttcttgc atgttctatt ggcctatgac tggtcgtgca    182640
     tcaaaaaaga gtgggtttgt taaacctata gggagttgag ttttcctatc cgctgatgca    182700
     atgtcctcta tgtgatcatc caacaaccca caaacacggt aaaaccagta aaggcagcca    182760
     acgttaccgt tgcccccact gtcaccaaac cttcagtgag acctttgata ccctttatta    182820
     tcgccgtcag atctcttctg aaaccatcca ggccatcctt caatctcatg ctgaaggcag    182880
     tagcctgagg ggcctatccc gtatcacagg tgtggcttac aacacctgtg tgagtgtgat    182940
     tcgttcagcg agccaaaaag cccaaatgat tcataaccaa gaagttcagg ccgtttcgac    183000
     tgacgtcatc aatgcggatg agttgtggtc ctttgtcaaa aaaagcaaaa gcactgtgaa    183060
     ccggaagagt tgagcgtcgg cgattgctgg atagccttga gtctcgccaa agacagtggc    183120
     ctggtgctca gtggccgtat tggcaaacat accgacgaac tcgctcaaaa attaattgag    183180
     aataccgagg gcaagaccgt ctgtcaccat tggcaaaccg atggctggga agggtattca    183240
     cgacaattag ccgatgaggt gatccatcac gtgagtaaag ctctgacaca gcgcttagag    183300
     cggaccaatg gcatactacg tcaacagact ggtcgctggc atcggcgtca gaacaagttt    183360
     ggtaaagtct ggcaacagag tgcagtgacc ttaagactgg tgctgactta tttcaattgg    183420
     atctggtgcc actctcgatt caagaacacg gctgcccaac gggctggact gacggagcat    183480
     ccttggggat ggcaagactt agccacctac cccacactgt attgatgcac aatcctatga    183540
     ctctgaaggc cggatcacca cacgcttcaa gtcgatgaaa attgtgattg gggatgatcc    183600
     acaaccgctc attgacgatt gccaagagca cttagcctac gtgggcaaca actacttctc    183660
     ttttttgact cgtttctatc gtagccatcg agccgtattc ttccgactcc tagagcaact    183720
     tcccttgtgc tctagcaccc aggaccagtc tttaatcaac gcgattgaat ttatcaaagc    183780
     ccatgggtcc aaacgcagta aatgggtgcc gatgacccag atcgtcaatc agggtccccc    183840
     tgatgaagcg gttgtcccgt tgctggatct cagttgggtg cctaacaagt ggcggtcgtt    183900
     gatcactgac ccgcaacaga ctacgcccac taaaattcat cgcctctact ttgagttgtg    183960
     cgtgttctct catatcagtc tggaactgca gtcgggggat ctgtatatcc ctggcagtaa    184020
     tgaattcggt gactattaca gccagttgat ttcatgggaa gaataccagg actcagctga    184080
     agagtatggc aagatgatca atctgccaac ggagggtaag gcctttgttc aagagatgaa    184140
     gcagcggttg cgagcggcgg ccaagacggc agatcaggcc tttcccacca atgctcactt    184200
     gagtttcaaa aaagaccgtc tggtgatcca taaacgccaa cgtcaattac ctgaaggatt    184260
     ggcggaagtg aaggcactca ttgaacggaa gatcaaaccc gtctctattc tggatgtgct    184320
     gtgtgacacc gagaaatggc tcaactggac ccagtgcttc gggcccctat ctggctttga    184380
     taccaagatc atagatccgg tcgaacgcta tatcaccacg acattttgct atggctgcaa    184440
     cattggcccc aaccagctgg cacggtcact ccctggaact gaccgtcgcc aaatttggtg    184500
     gattcatcat cgccatatca gtgaagagaa aatacaacag gccattactg ggattatcga    184560
     ttcctacaat cgcttttcgc ttcccaaggt ttgggggtcc ggcaaacagg cttcagtgga    184620
     tggtaccaag tgggatatgt atgagcagaa tctattggcg gaatatcaca tccgctatgg    184680
     cgggtatggc ggcattggct attaccacat cagtgatacc tacattgctc tgttcagtca    184740
     ctttattccc tgtggtgtct gggaagccgt ttacatcctc gatggattgc tcaagaatac    184800
     ttccgagatc caaccggaca cgattcatgg tgatactcaa tcccaaagct gtacggtgtt    184860
     tgctttagcg tttctattgg gcattacgct aatgccccgc attcgaggct ggcagagctt    184920
     agcgttctat cgaccgtctc ggggcacccg ctacaagcat ttggacagct tgttcaccga    184980
     agtgacggac tgggatctga ttgagacaca cctgccggac atgttgcggg tggcgttgtc    185040
     cattaaggac gggaaagttc aagcctctac tctgttgaga aagttgggaa ccaatagccg    185100
     taagaataag ctatttcaag cctttcatga acttggaggt gtcttgagaa ctatcttttt    185160
     actgcagtac atcaatgatc ctcaaatgca ggaaacgatc catgctgaaa ccaacaagtg    185220
     cgaggcattt aatcgcttta ttaagtggct cgcttttggc ggtgaaaacc aagtcctctc    185280
     tagcaacaac cgggctgaac tccgaaagcg catcaaatac aatcacctgg tggccaactg    185340
     tctgattttc tacaacgttt cagagatgag tcgcattctc aatgaggaag ctcaaaatgg    185400
     ccgcacgtat gatgcagagg tattggcgtt actgagtcct tattggatgg accatctcaa    185460
     tcggttcgga atattcttct tagatgaaca gcgaaatcca ccaccgatca atttcgaaat    185520
     tccaattgct caaaaagaac aagaggcaga gcctatgttg gtgtagccgg tggctaaaac    185580
     tatatttgtc agttggcaag agagtttaag aataggacat cagtaccgaa attgacttcg    185640
     tattttgcca aagccctaaa atcgtcgcct gaaatagtta tcagatatag ctttcagccc    185700
     tatgatcagt ttctacatga atcgttgtcg gaccccaata ctagtaggtg ttgcccatgt    185760
     cgcaattggt gtcgccagcg ccggaaccag acttgggctt gagcagagcg ggcatcccca    185820
     aacatcactt ttgttgctcg tgcaagatgg cctgctgcat gaaaaaaatc gagaactgcc    185880
     acagcacagt gagagaacaa ggtgcggtag actcgccaga agcctcgccc cccatcactt    185940
     aaccagatga cgcttggggc cgattcaaag tcttgtttgt gggcttcgag ttgcagtaag    186000
     gggatgaact ggtcgatatc gcccaattat tagacgacaa tcgagctgac ggattaatga    186060
     cgatgtcacg tcggctatag ctatgaagaa accaggcatc ccctgagaag gataaaacta    186120
     gatctcaatt ccctagaaat gatgtgtgag atcgcgtttc tagaattcaa tctcaagaaa    186180
     aaagacactt tttacatccc taatcaatag agggctgtac aagtgcctaa caaaagaatt    186240
     gattcctatc atactcgtgt ttatatgaac ggaagagacc tcggcttaaa acaagctgat    186300
     gcagcttaca ttgccgaaat atctacaaga accggacaac gaattgaggc cggcacccat    186360
     caacctaatc gcggccgcct tcaggaccaa cgcaccgttc ccgacccctt agctgatgtg    186420
     tgggaagacg agctagaacc aatgctgcgt cgagacccac gcctcaaacc catgaccctg    186480
     tatgagtacc tgcaggataa gtatccaggc cagtatcccc aagtcctgcg gaccctacaa    186540
     cgtcgggtga gaacgtggaa agccttacat ggaccaagcc ctgaagtgat gtttgaattg    186600
     cgtcatgaac caggggtaca agggttctcc gattttacag aactcaaagg catcacgatt    186660
     accattgccg gcaaaccctt tgagcacctg atttaccatt accgtctggg atatagcggc    186720
     tggcgatatg cccagatcat ccaaggaggc gaaagctttg ttgccctctc agaaggattg    186780
     caaaatgcct ttgcagcctg tggaggtgtt cctacacagc atcgtactga tagtttgagt    186840
     gcagcctatc gcaacatggg cggccgccgg tccaaaaacc tcacgcgttt gtacgacgaa    186900
     ctgtgtgacc actatcggct agaacccact cgtaacaaca aaggtgtagc ccatgagaat    186960
     ggctccattg aatctcccca tggccatctc aaaaaccgaa ttaagcaggc gatctatctg    187020
     cgcggcagtg cagattttac gagcgttgct gagtatcaag ccttaattga tgcacaggtt    187080
     gccaagttga atcagcagtg ccaaaccaag tatgagcaag agaaagacca tctacaacca    187140
     ctgcccaaat atcgaacccc tgactatgaa gtgctcacgg ctaaagtcag caaacgcagc    187200
     accatcgatg ttcgctgcat tctatacacc gtcccttctc gactgattgg tcgtcaattg    187260
     gaactgcatc tataccatga ccggattgtc ggctatctgg agcgacaccc ggtggtggaa    187320
     ttgccgagga agcgcgtcag tggcaaaggc aaacgtcgcg accgttgcat caactatcgc    187380
     catgttattg gttcaatgcg attgaagcct cgtgctttta tctattgcac ctggcaatca    187440
     gacctacttc ccaatcctga ataccgccaa atctgggaac agctcaaagc ccaatttgac    187500
     ctggagcagg ctgccaagat catcgtggaa gccctgtata ttgctgcggt tcaagataaa    187560
     gaacaggccg tagcagtgta cttacagcag cagcttcgct catccagcct taccctcaat    187620
     cgcctgaaaa aacagtttga gccgcctcag atgaagcagg ttcctgaact cagcattgaa    187680
     caacattcac ttgaacttta tgacaaactc ctcccctcct gctcagtccc cgctgagccc    187740
     ctaccagcac ctgagcctct atttaaaaaa gctcaggctc tcccacatgt tgacccattg    187800
     ggaatctatc gaatcccaag ccatgcagga aaactggtct tatgcggaat tcttactagc    187860
     cttgtgcgaa acggaggccc aacgaagaga acaagctcgt ctaaaacgtg ccctcaccga    187920
     agccaggctc ccaaacgcaa aaagttttac caactttgac tttagccatt gtccccagct    187980
     caatccagct cccttgatgc aattagccgc agatccgggt tggttggagc gcgccgagaa    188040
     ttgccttatt ctggggccct cgggtgttgg aaaaacacat ctggccactg gggtgtccaa    188100
     aaagatgctg gaattcggta agcgggtgaa gttctttgca gccaacgcat tggtccagca    188160
     actgcaacag gcgaagctcc aactgcagct gcatccaatg ctcaaaaaac tggaccgcta    188220
     tgatctgttg atcttggatg acttgggcta ttgcaaaaag tcggaagcgg aaacgtccgt    188280
     tctgtttgaa ttaattgcgc atcgctatga acgaaaaagt ttgttgatta cagcgaatca    188340
     acccttcagc caatgggatg acattttcac tgattcgatg atggcggtgg ctgccattga    188400
     tcgcttaatt catcatggct tgattatcga aattcaagcc gatagttatc ggcgcaaatc    188460
     agcgactcag agaacggctc aaactcagtc tcaacctcaa aaatcccagt ccaaataatc    188520
     gagcgatcac tggttgtcat ttcgatcacg ggttgtcgtt ttgttctgaa ggtatcgtat    188580
     gaggtctgaa aaagagctaa cgcaaaggga gtgtacgcca aataatacgg ttcaaatttg    188640
     ggggttgatc cgccttgtgg ttgtcgcgac atcgcctatg gggttgacat ccaataccca    188700
     atactgctac cagtcttcga cgcagtagtt gggggacact cttcttagct cgggtgaccc    188760
     gtgttcccag gcgggctaag atagcgactt tgacttctcg ccactggatt tttcccttgg    188820
     gtgttttcgg ggtggggcga aagggcacca ttacaccgtc agcagcaacg gccaaaggca    188880
     gagcagacaa caactctgaa atcgcttcac aaggagcctg gtcacctgat gcttgagctt    188940
     tgagttgagt ctctagcgcc tgataagctt tgttgcccat gacttgcacc caattccaca    189000
     agcttgatga actgacggat aaaccactcc actgactcag catccaacta gccagttcat    189060
     agggcataaa tagactgaac aagcagccta gacgcaccag ttcttcactg ctgtgctgat    189120
     aagaggtaat cccaatggat tgatctagag gagctgatag actacctgga caccctttcg    189180
     gacaacgacc tacccgtcgc tttcagtaaa tatttcccac cagtgtctgc atctgacgag    189240
     attcccatcc ctttgagtgc aagcgggttc cgcaggtggg acacctaggc cattcaaata    189300
     ctgtttttgc tcgccgtgag agttcatcct ccagaagcca tcgagccaaa aacaaaccca    189360
     tgtgcagaac gatataaacc atctgactca ggctggttgc ttctttgagt gctttggcct    189420
     gtactagaac atcgtgatgg tctagtacgg ctggcaattg cgatggtagg ctcatgacaa    189480
     gtttttgatt cgggtacagg atctattgtc cttgacccgt ttttctttga gacatgcatc    189540
     cccgattctg tgcttacgcc cctctaaatc taatcatcaa tcattattta gagaaatatt    189600
     tatcttccaa attatagata gcccatctat aaattaaaat ttcaaggata agaatagaaa    189660
     tttttaccca gaaatctaca gagttcaagt attgtaaagt agattgcaac ataattacct    189720
     ctaaaaaatt aaaattgagt agattaagac taggtgattt gaatagctct ctatagtttt    189780
     aatttataaa atctatctgt gaataatgtg agtgtattaa gtaaagcaat taatactcat    189840
     ttcagtctag atataaatcc cttactgaat ttgaataata tattgaatat catggtctta    189900
     attctctcct ataaagctat atagaactaa tctattgatt aaaataatag gattacttgc    189960
     gacaaggaaa actttgtttc tttcaagctt ttttatcttt tagatataag gttgtaagtg    190020
     ttccttcaca agtttctcat cctgtttggt tatagtcaga atgagttgat catcctttac    190080
     attaagaatg cgatcaataa aattaaatca cttagtgatt tttatttatt cacaaaggta    190140
     tctctagata agccttatta gtgtattgca tttgatttag cagggtgatt ttcaatacaa    190200
     cccatctgct attcgtctgg aggctaatat gattaagaag attttggtcg ccatggatca    190260
     ctcaataaat gctattcaag cttttgaagt tgcaatggaa atagcagaat cttgccatgc    190320
     tcgacttatg ctgctacatg ttctatccat cgaaggagag ggctatcaag cacatcctgt    190380
     ttttcctgga acctatctct atccagcttt ttctgacata ccgttgaatc gctttcaaca    190440
     agaatggaac aagtataaag aaaaagagtt acatcgatta gcaatactgt ctgagcaagc    190500
     aaagtcagtt ggaattacta ctgagattac acaaaaattt ggtaatcctc ggcaagagat    190560
     ctgcgatttt gctaaggaat ggaacgctga tttaatttta atgggaagtc gaggtcattc    190620
     tgggttaaaa gaattagtgt taggtagtat tagcaactat gttgtacatc acgccctatg    190680
     ttcagtcatg gttgtacgaa caccgaatca attagcagta cagccctcca ccaattcatc    190740
     ggcagaacag cttcgtttta tgatttcaac atgatcacat aatcaactta ataaattaac    190800
     catttatcgt tggaataata gacctcttgc aatattcatt tcttgatgtg ttaataactc    190860
     agttgatgct gcaatatgac ttagattttt aggccactac tatgtcgtta gctgaattat    190920
     gcaagaggtc taatgacgtt gcttgctatt cagtatattg ataatcatta agaatatatt    190980
     tatcctcaat aattacagag agtcacttgc caaagtttca atagatttgt actaggtgaa    191040
     gacacagatg attgtcctta cgagcttctc ctccactctc atatacatct aaagaaagta    191100
     aatagtctat tatattgagt gaatatttaa tattttgttc tttgtatgag gtggagaaaa    191160
     tcataaattt tatcttcaaa tttaaagaga tctttactag tgatatgata gcgggaaata    191220
     gtattgactt cgtctctata ctctgatgga aagagttcgc aaacttttaa ttcagagaca    191280
     gcttttggtg gatatccagt gagatctgta agttgattag taattctttc tttttgtcca    191340
     gggcggtcga aaccgcagaa tgatatgaaa gaataattat tcaatgaatt cttcttacgc    191400
     ttgatcaatg ttttcaaggg attagctatc ttagaatccc agatcggtgc aaccaagatg    191460
     gtgtgatcgt agtttgagat cggggtttca attgcctcga ttttggggct tcttttgaag    191520
     atcatatcca aaacaatcgt taacattgtc cgcctctttt tttcaataat ggggcagata    191580
     tcgcactgaa tttctttggc tagatactca gcaagtcgcc gattattacc tgaaaaggaa    191640
     aaatagataa tcaagattct cacagacgtg ctccttatgc aagagtacaa aaagggagac    191700
     tcattcagca gtatagttat ggagacaaag gctgcaaaac tgcaaaacta ttgatctctt    191760
     gatctcctct atggcgcata aacaattatg attcggtaat atctatttca tatggatttg    191820
     atagatttcc ctatgactta attaattccg attagctgat gtgaatttag ggtagtttgg    191880
     atcaactctt ttccttgagg taacttacct gtctgtaacc attcatccat atcaggtggg    191940
     aattgaggtt gactcaacag cgaatgcaat tcttgacttt ctaaaacctc tttctctaaa    192000
     agatgacttg cagttaattg gagcatatct tgattgatgg atagaatact caatgccata    192060
     tggtgagccc catctaccac atccttaact gcttgatcaa ttgcttcaac gacttgggga    192120
     ccaacggtac ggcgtggatt aggcactcct tctagaaact gttgttgtgc cttttcatac    192180
     gcaatcggac caagttcatc actcataccg tagagggtga cataccgttc agctaaatcg    192240
     gttgcttttt ggatatcatc actggctcct gtagaaacaa ctccaaaaat caactcttca    192300
     gctgaacgtc ctcctagcaa agtcgctatc cggccccgca attcacttgc tgtgatcaag    192360
     aagcggtctt cttcaggaag ttgcagagta tagcccagtg caccaatgcc gcggggaatg    192420
     accgaaattt tctcaaccgt ccctgcacct ggcattaaac tgcccacaat agcgtgccct    192480
     acttcgtgat aagcaacagt ctttttctct aaatcattga gaacgcgcga ctttttctcc    192540
     agtcctgcga caactcgctc aatcgcttca ttaaaatcgg acatgactac tgcatcacgg    192600
     ctctgacgag ctgctagtag ggctgcttca ttcaccaaat tggccaaatc tgccccagaa    192660
     aatccgggtg tccttactgc taacttggtc aagttaatat cttcagccag tttcactcct    192720
     ctaacatgga ccttcaagat tgcctcccga cccatcttgt cagggcgatc tactactatt    192780
     tgccgatcaa atcgaccagg acggagcagt gccgggtcaa gtacctctgg acggttggta    192840
     gctgctaaca gaataacccc aacatttgga tcaaacccat ccatctccga aagtagttga    192900
     ttaagcgttt gttctcgctc atcatttcct ccagtgaatc caccgggtcc tccccgtgcc    192960
     ttgcctaggg catctaattc atcgataaat acaatacaag gagcttgttg ctttgcttgt    193020
     tcaaacaaat cgcgaactcg ggctgcgcca ataccgacaa atagctcaat aaactctgat    193080
     cctgaaatac tgaaaaacgg cacctttgct tctccggcaa tagctttagc gagcaaagtt    193140
     ttacctgttc ccggtgggcc aactaacaag acacctttgg gtattttggc tcccaagcgg    193200
     gtgtatttgt cggcatgagc tagaaaatct acaatttcta gcaattcagt ttttgcctct    193260
     tcaactccag caacatcgtc aaatgttaca cctgtacttc cttctgagta aatgcgtgcc    193320
     ttgctttggc ccaccgttag ggcagcaggg cctgcccctt gatttcgatt gatcaaccaa    193380
     ctccaaatgc caaagaaaat taacggtggt acaacccacc ctaaaagtgt cggcaaccag    193440
     cttaaggagc ttggaggtgg agcaaagtac tgaacatcat gctctcgcaa aaacttgggt    193500
     aattctaaat caatcccaac aggcactgta tcgaatactg cagcagtctc agtcccctca    193560
     ttaaatccat actgatcgct tttcaagata tatcgaatgc gatctggccg aacctccacc    193620
     cgttcaacct gccccgcctc tacttgagta ataaaatcac tgtaggcagt tatcgggaac    193680
     cgcggtcctc gcaaaacaaa tagatttaga aataataata atgtaaacag aatgaataaa    193740
     ctgccaccaa accgcttggg ctcaaaattt tttcgagtgc gattaggctc tgtttcaata    193800
     ggcatagttg cttctcctga ataggttgat tttgtctgtt attcattcaa agctgcattg    193860
     ttcaagtcaa taagatatag catctgagaa tttgaataac aaatgtttca gtaccctcct    193920
     tcagacaaat aatgaattta atttcacttc atcctgaagt tagaggaaga gtttgagtaa    193980
     tttgtgaggc ataaagtgaa gtggttctca aagtttggat aattgtgaag gacagctcaa    194040
     agatatatac tttgtttccc aatatcgctt gcaggcataa tatctcttga tagtattcct    194100
     acctttaaga ttggggttca ctactcaatc tttttgtgat ttcacaagat tctcaattta    194160
     tctttctagc cttaaggtag ttacctttct gaatagtgcg actagaaaaa tcagcgactc    194220
     gttatagaac aaaacgctga tatctcacta tctaacagat aaatacaatg ggttaagcaa    194280
     tttccagagc ttgattgatc agtgagcaac ttgagataaa cagcaaaatt attgcgggag    194340
     atcaagtatg agtaatcaac atccaaaagt tttggtagca ggagccacag gatatattgg    194400
     tggtggtgta ttagaggttt tacatcaaca aggtttttgg gtccgtgcct tatgtcgcga    194460
     tcaaaaccgc ctgaggaatg ccaattggtg cgatgacatt ttcataggcc atgctactca    194520
     accagacact ttgaaagatc tttgtgaaga tatagacgtt gttttctcat ccataggtat    194580
     tcattcattc aaccgtcacc ccactttttg ggatgtggac tatcaagcca acctgaatat    194640
     tcttgaagcg gctaaagctg caggtgtcaa acatttcatc tttgtttctg tgttacgtgc    194700
     ctctgaaatg gcacgtctat cgcccctggc caaagcaagg gatcaggtcg ctcaagcgat    194760
     catggcctca gggatggatt acaacatctt tgcgcccact ggattcttta atgatgcaca    194820
     agagttctta gtcgcagcga aacggaaggg tgtaattcat ctgttcggag atggttctag    194880
     tatttataat cccttgagtg cgctcgattt tggtgaagaa gtggctaggg tgatcaagga    194940
     gccattgctt agaaatacag ttagaccagt tggaggatgt gagaaatata gcaatcgaca    195000
     aatggccgaa ttagtttttg aaattcttga tcaagaacct aacatcaaat caatccctac    195060
     ttgggtaata gccttatggg cattagctct tcgtcctttt aactacaatg cttatgcgtt    195120
     ggtcaaattc ttcgagttca ctgctcgtac cccagatatg acaggcgagg cgattggtca    195180
     cagacatgtt ggggattttt tgagaaatct tgccaaaggc atgtctttgg tagaggcaga    195240
     tagggctttg ggcttatgga atgagtcgcg attgcctgtg gatgccaaga ggtaagggcc    195300
     atatcactgt taatcgataa aacggttggc ctagtgttca ataacatccg attggtgtag    195360
     aacgacgttt cccaatacct ccttggaaga ccctcagttt aaggttggaa ttggtgaaat    195420
     cgagcgttta tgcagctgaa tttatcgaat gtcttgctgc tctttttcgg agtttgttca    195480
     tgagtacgat ttctaatcag cctcacaact ctgcacatga agttgaacta tcctcaactg    195540
     ctgaacaacc ccttgggcaa tggctgttgc caggtggaga agatccctcc caattcacat    195600
     ggcaagacgc ttggcatccc attgcctatg tgaaggattt agatccatct caattgtcaa    195660
     cgttcacgct gttagaacaa gatttggtca tttggtggga tcaatcggca gaaacttgga    195720
     gggtctttgc tgatcaatgc cctcatcggc tggctcccct atctgaaggt cgccttactg    195780
     cagatggttt gctggaatgc ccgtatcacg gttgggcgtt ctccggttta ggtcaatgct    195840
     gtcggattcc tcagcaggtt ggtggccaat cagtggagca atcccgacgg gcttgtgttc    195900
     aatctttgcc aacaacagtg agacagggga tgttgtttgt ttatccgggg caatccgaac    195960
     gcgcagctca catccccatc ccattagtgg caccgttaga agaagcacca aataaatgga    196020
     ttgtcttgga tggggtgcgc gatctacctt tcgatgtgct cacactgttg gaaaatgtct    196080
     tggatccgag tcatttaccc tttgctcatc accgttccgt tggcgatcgc agtgtggctg    196140
     gccccatgga cctagtgctc gaccacactg aattggatag gtaagctagc aacaatctag    196200
     ctgtttttag ccaactaatc atgcctgaca aatatattgt gacgctaacg cctgaagaac    196260
     gcagtgagct gatacaactc acccgacgta gaaccctgtc agcgcgaaaa atgaaacgag    196320
     cccagatttt gatgttggca gatgagggac acaaagacga taccattact caaatgctca    196380
     atgcaggcat ctctaccgtg catcgtactc gccagaaatt tgttgaaggt ggtgtggaat    196440
     ttgccctcaa tgagcgtccc agaccaggag ggcaaaagaa gctcgatagc aaagcagagg    196500
     ccttgctaat tgcgacagct tgtagcgacc caccaaccgg ttgttgccgg tggaccatgc    196560
     agctattggc agaacggctg gttgaactta aagtcgtcga aagcctatcg gatgaaactg    196620
     tgcgacgtac gctcgaaaaa aacagcttaa gccttggcta aaagagcagt ggtgtttttc    196680
     tactgtaggc gcagactttg tttggcggat ggagaacgtt ctagattggt atgcccaacc    196740
     ctacgatcct gatgagcctg ttgtttgttt tgatgaacgg ccttgccaac tgattggcga    196800
     aacccgggtg ccccgtccac cgaagcccgg tcgtcctcaa cgctacgacc atgaatatga    196860
     gcggaagggc acttgtaata tatttggctt ttttcaaccg ctcaaaagtt ggcgacattt    196920
     gaaggtgact gagcatcgca aaagcgaaga ttttgcactt tgcatgcaat atctagtgga    196980
     tggtctgttt ccccaggctg acaagctaca tgttgttttg gacaatctca atacccattc    197040
     tcccgcagca ctttacaaaa ccttcaatcc agatgaagcc ttgcggattc tcaagcgtat    197100
     tcagtttcac tacaccccaa aacatggcag ttggctcaat atgattgagt ttgagttctc    197160
     tgccctttcg aggcaatgct taaatcggcg gattcctgat attgaacaac tccggtacga    197220
     ggtcactgca tgggaaaaaa ggcggaacca tgataaggca acggttaatt ggttgtttac    197280
     ggtggatgat gcacgaacta aactcagccg actctatccc caaactatcc tgtcataatc    197340
     actgtggcga agcactagag attaaccacg cggatagaca gggatttcaa ggaatttgga    197400
     aaacggctgt tggtcctaaa aaaggccaat tcggaactca attgactacc ttcatcgccc    197460
     ccaatctgat gtggcatgat ttgaccactc aggaaaagaa tcgtactctg accgttgcct    197520
     actgcacacc tattcgcaag ggagaatgcc gcctgtttgc tcgcttcccc tttcaattcg    197580
     cctctccttt gccagcgggg ttgatgcgct acacccccag ttgggtcttt cacttgctgc    197640
     aaaattctat tctagaagat gaccaaattt tcttgtacct tcaggagcgt catctcaccc    197700
     agcagaagca ggggataccg attgcgcaat cctactatat gccaacccga gcggatcggt    197760
     ttgtagtggc attacaccag tggctgcaac gctacactgc ggatcccttc cccaataagc    197820
     cgttgccccc agcgataggg cgagaacagg tgatcgaacg ctatcactct catactgttc    197880
     actgtgctag ttgtcggact acgctgagcc gaatcaagag aggacgacaa gggatggtta    197940
     tgggggcact tgtggcttgg ataacggtgc aactttatct cttagattgg ggaggaaccg    198000
     ccaagttagc ccgagttgcc agcattagct tcatcgtttg caccatcatc tggctcagtt    198060
     tagggtggct tgagcgcaag ttttacgagg gccgctccat cccacttcgc aatgtctcag    198120
     agaaatagga cttttcacca aaagtctttt gggtgaaata ccgaagattc aactgtgcgg    198180
     tgatcaaaaa actgattagt aggaatgaga tagacgcata actttgctca acatcgaaga    198240
     ggacgcaata tgtacaatcg attgctggct tgggggatgg cgagagccaa taccgttccc    198300
     gaagaaaaca tcaagctaaa tgaatgtcag cagtttgcaa ccatggctca actaaaacac    198360
     tggctgtttg ctgatctcca cggtactgtt ttagaactgg gtccaggggc agggattaat    198420
     ttgtcctact atcctccaga cattaattgg attggaattg aactgaatcc atttctgcat    198480
     ccgtatatta ggcaagaggc tgaccgccag ggattgtcat cgattaacgt gtttaaggga    198540
     actgctgagc aattgcccgt agctgacaat agtattgata ctgtcgtgag tacctatgtt    198600
     ttgtgttcag tcacacaact tgaggaatgc ctatctgaaa ttcaacgtgt tctgaaacct    198660
     ggcggtctgt ttgtctttct agaacatgtt gcagcgaaac cgatgacttt ggagcgtaga    198720
     atccaagaag ctgttaaacc tttatggaaa acccttttgc ataattgtca tccaaatcgt    198780
     gagacctgga aaactttaga aaaggctggt tttgaatggg tgcattatca gcactttcgg    198840
     ctgtcgttac ccgtggttag cccccaaatt gtgggaaagg ccagaaaatc gttagaaact    198900
     actctcccaa aggcattagc gctaacttct ggcaattaat tcttgtagac ttcggagcac    198960
     aatagctgta caggatcatc tcaacgagtt tgatagtcta agattcaggt tcgagtggct    199020
     caatcagata atcctcaacg ttatgctaga gaggagccga gacctagcat tcgcaacgtc    199080
     ttccacttga atatagcgtt ttcagattgg atcaaggatt agttggattg ttacctaaaa    199140
     tgtttcgttt aaatactgct gagcaggttc tcatagagaa tcatcagttt tcactaatgg    199200
     ttatagatca ggcttctctg cggatcttga actggaacat tgctaagaat aaccatcgtc    199260
     atgaatggct gcaagatttt tctaaacttg tggaatggta tcccccagat ctaatcttct    199320
     tgcaggaatt ccgattcgat tccaccctca aaaagccgtt ttactgtgat gcgatgagtt    199380
     ggcaattcgc cccaaatatg agcaacccat atactgatca acattttgga gttctgactg    199440
     cttcaaaagt taaacatcag tctgggaagt catttttaac tcaagcttgc gagccttttc    199500
     tcaacacccc caaagtatcc ctcattacgg aatattcttt agctggctca aaacagactt    199560
     tattggccgt gaatattcat gggatcaatt ttgtcagtac tcgaaaattt caatcacaat    199620
     tgcaacaact ggaagcacaa ctgacgattc atccaggacc aatcattcta tcaggggatt    199680
     tcaatacttg gaacgaatat cggatgaagg ttctacagac aatggtccgt cgactcgatt    199740
     taagacaagt gacattttct tctgcccact acaaaaattt gaaacaattt tttgactatc    199800
     ctttggacca tattttctat cgtggcttca cacaatgtct agggagtgaa atagtgttgg    199860
     gagaattatc ttcttcagat cacagccccc tggtcgtcga attgatgctt cactaatcgc    199920
     tataattggc cgataatttc cctactaatg accttcatcg ccatagagca ccccaatcat    199980
     tttctctctg ctcacggtat gacggtccct agtgtactgt tgctattggt ttacgcctta    200040
     ggtgtattga acgcagctca tgcagtcatg aatgtgcgat cttcacaaag tgcgatcgca    200100
     tggagtttgt ctctcattac cttcccaggg attgctctac ccctatattg gatcttggga    200160
     cgagtagaat tccacggata tacccaggct tatcatcaag cttacgctca aaatcacgat    200220
     cttgcccata acacctattt agaaatcctg tcctataagg cagttcttcc tacacaactt    200280
     gcctcccttc agagggtagc aggagcatta actgaatttc cgtttaccca tagtaattcg    200340
     gttcagttgc tgattaatgc agagcaaact tactcagcga tgcaagaagc gatcttaaat    200400
     tctaaggaat atattctgct ccaatcgtac attctcaatg atgatcacgt cggggacatt    200460
     tttcaaaaaa tcttgatgca aaaggctcaa gaggggattc gtatttatat cctgtatgac    200520
     gaaattggct ctaaaaactt gtcaaaaaac tacatcaacg tcctgcagaa aggaggaatt    200580
     caagtctcag cttttaatag tgctcaagga tgggggaatc aatttcaact caacttccgc    200640
     aatcatcgaa agatcctggt agtggacggt caagttgctt ttgtgggtgg cattaacatt    200700
     ggggatgagt atttgggaca aaatgctcat gttggtcttt ggcgggatac tcatctgaag    200760
     gtgaaaggtc cagcagtcca gtgtttacaa cttccctttc tcaaagattg gttttgggcc    200820
     gttagggaaa ttcctgaagc atgctgggaa gttcaccctg accgaggaaa gaaccaaacg    200880
     gtgttcattt tttcacccgg tcctaccgat cctcaaaatg attgcaccct cttttttggc    200940
     agtatcatca acctcgccca acatcgcttg tggatcgcaa gcccctattt tgttccagat    201000
     gaccccgtac tcacgtcatt aaaaatggct gccttgagag gggtggatgt acgtattctc    201060
     ttacctgatc gaccagacca ttggcttgtg tatctttgtt cttattctta ctacaccgaa    201120
     atggatgcta caggcattaa actgtatcgc tataaccatg gatttatgca tcaaaaggtg    201180
     atgttggtgg atggttgcct cgcaggagtg ggaacagtca atctagacaa tcggtctttt    201240
     catctcaatt ttgaggtcat gacctttgtt agcgatgttg agttcgctcg caacgttgaa    201300
     cagatgttat gtgatgattt tgagcattcg atggagatta atctgtctga atatgagcta    201360
     aaacctaact ggttcaagct gattgtcaga gtgtcacgat tgttggcccc cttgcaatag    201420
     ccgatgtttt atccactccc tatgtaaagg tacgaatcca ttccttggtc tttccaaaaa    201480
     aaagatggat ttcaacgtcc acaagtgatt cttgatggga atttaatgag agagtagtcc    201540
     tgttaatagc agcgggatta aaaatagcag cacacaaacc cataggagag tagctggatc    201600
     aacattaagg gtgatgggtg gcttcggttg atttttcatt gttcattgtc cttctgaaat    201660
     tcatcagctt aagtgactgc agcgatcgtt gtgggcatag ggggcttgat atgatcccca    201720
     gatctagccc ggtatagatc tgccaatcgt tgttcatgat tggctagatc atgttccact    201780
     tcttctaaaa ttgatacggt ttgagggtca gtcagttgat tacataagtg atgaacatca    201840
     atcaccccag tttgaatatc gccaagggca cgccgtaaaa tcgatgtatc attactcgat    201900
     tgcagccaac tttgcagagc ggcataagct tcactaccca cggcccgcca agtggcccgt    201960
     tctccaaaca catcataaag gtgagcttct agccgctcca catgatagtg cttagttgaa    202020
     ctaataccct gtaagaacaa tcgcaaatct tgatgggaaa cgcgatgact atactgccta    202080
     aaagcttcta gggtataccg ttccccgaca atggttgtat tgagggcttt aacaatctcc    202140
     tgtttactag agccacccca ggcttcccct aacttccacc aattaaaggt ggagtcagta    202200
     aactctggca gcctagttcc tttaatcgtc aagtttagac acttgagtag catggtggtg    202260
     aacattggca gatcgctagg ttgtctggct gtgatcagat ttccgtcaac gacaacaggt    202320
     tcattgacgt atattgcacc agcatttagg agatctttat gaatcgatcg agcactcgtt    202380
     gtatgcttat cgcgaagtcg gtctgcttcg atcagtatct gaggaccata gcccacagcc    202440
     gctacccaga taccctggtc tattgattga gaaaccaacc ggaccatatt agggttggca    202500
     cgaatgtggc ccccaggaat aacgatggca tcaaaatccc cagccctcac ctcagttgac    202560
     gtagcaatcg gtttgactgt aaccgaaccc tgtttgtctt ggtacccctc attcatgcgg    202620
     gaaccgataa ccgagacagt accccctgct tttcgcaatg cagtacttgg aacttgatat    202680
     gcagagcctt caaactggtt ctccagtaaa atagcaattc gttttctcgg cgttggatgt    202740
     tgtgacatga gagtaacctc tgattcgcca tttgataact aactcaaacg caagatcgtc    202800
     tgagtaccgt tgtgatccac aatatctatt gcaactactt gtccagagat atctttggca    202860
     acccatacgg ccttgggcgc attgactgta tgtgcatagt tcacctgatc acctccaatc    202920
     gcaatcatca aatcgttccc cttcgcgggt ggatcgtaag tgatggacgc taagggtgac    202980
     tgttgaacga gattttcatc tccaatgtct tcgtcagtca cttcaattgc aagggaacat    203040
     cccttataat tctttgtaag gtgatcaaaa aaagctaacc actgctcttg agggatttgc    203100
     tgggtttctt gaatcgtttg ttcagtcata aaccgctccc taggagtcta aagctcccca    203160
     ccatcaagaa ctacctttca acttagaaaa taaaattgag aaatttgtga aggcattgcc    203220
     agagaccaaa cgctgcccgg tatgtgttca cagatatttc aatgctggga ctatatcctt    203280
     gccccaatcc cataagccat tcattgaaca agggggctct gaatattact agtgaaatcc    203340
     ccttgaaagc attagcagta accccaaaag tgcttacctc ataagttctt caatatttgt    203400
     ctttactgtt ccaggtgtct ggctcatctg aagaacattt gaggggactc gataactgca    203460
     gattacttaa ccgccggaaa tggcttatct tctctattgt tcgcagtatt gatggctaac    203520
     gctggcaaaa aagtcagaat cttagaatct caagagcacc acacttcact gtatacggtc    203580
     gagtcatttc actatcgtga tgaagtggtg gagagcaatg gagagaacaa cacttaccac    203640
     gtaggtgctt atctagaaga tggattgcac gaaggggcaa ttacctcagc cctaagggtt    203700
     gctcagcaga ttggcttgaa gttggtttgc gtcagttaca atttcctctc cctatattat    203760
     gtggatgggg ataacaatca caccccccat gtctctatgt tgttgaaagc taacggccat    203820
     gctgctcctc tggggtggtc cctcgaatat cgtgatccga aggtgatcga acaattgatg    203880
     ccacttttga gctggctata tcatcattac ttccatgtcc aaaccagtgg ttggcaccat    203940
     gtcccatccg atgcccccat tttgatggtt ggttcccata acggtggact gtctgcacct    204000
     gatatgtata tgagcatgta tgactggtgt agacagtttg gggctgaacg gcctatttat    204060
     ggactgctac atcctgggat ttggcaggcg tttcagcaaa catgtcctcc tttagcccga    204120
     ctggcggggc agattggcag tattatggct caccctaaga tggcgatcaa cgctctaagg    204180
     caaggagcta gcgttctagt ttatcccggt ggggcacagg atgtgtttcg tccttattgt    204240
     caacgccacc aaattcatct ggctgggcgc aaggggttta ttaagttagc gttggaggaa    204300
     aaagttccaa ttgttccttt gatctcaaat ggtgctcacg agacgctgat tgtgctagct    204360
     gatttttacc aggcgatcca gcagcttcac gactggggaa ttccctggct tggtggaatt    204420
     gatccagatg tttttcctgt ctatcttggc ctcccttggg ggctagcttt tggtccccta    204480
     cccaatattc cactacctgt tcccatccaa acgcaagtct gtccaccgat agtgtttgag    204540
     cattatgggg cagaagcagc gcgcgatcgc acctacgtaa ctgcctgtta cgaacaggtc    204600
     caagcccaaa tgcaacaaga tttagatgca ttagtggact caaatccata attgttagag    204660
     tagaggcatc tttgctaatc cccaatatat gggttgtgca gctcaatgaa gatcctctta    204720
     gttcatggcc tgggtaggac accgatgtcc atgatgggcc tcgcatattc tctcgatcag    204780
     tctggctatc aaacagaatt ttttagctac actgcctttg ctgaatctta cgagcagatc    204840
     gtaacgcgtt tacgaaatcg attccagatg ttgtcaaata aaggcccata cggaattgta    204900
     gctcattctc tcggtgggat attgacccgc tcagccctat ctctatctag aagtttcccc    204960
     cgccatattg tgatgctagg cacgcccaat caacccccac gcttagcaaa aatagcttgg    205020
     aatctatggc ccttccaatg gttctcggga accagtggtg ccaatctcgc cagctcagaa    205080
     ttttatgcat ctctgcccca tttgcacgcc tcctatacca tcattgcggg taccagcggt    205140
     cctcgtggtc cctggagccc ctttgggatg gagttgaacg atgggcttgt ggctctgaat    205200
     gaaactcgtc tcctggaatc cgatcaaccc ataacctttc cagggatcca tggctttatg    205260
     atgaatcaag caaccgttca gacagcggta gctcaagtct ttcgacacac ttcatctaaa    205320
     taaataatgg ccatggccct agacagttta gggatttggg ttagggactt ttggagagcg    205380
     atttattcgc tgagttgtaa tccagtggta aaacaatgat ccaaacatga gcgaaatgat    205440
     aaacaagaat ggattccaaa ttcctaaaac taaggcgact agaccaggac cagggcagta    205500
     acctgccatt ccccaaccaa tgccaaagat agctgagccg ataagtaact gcaaatcgat    205560
     agcttgttta ctgatacctc cccacacgta aaggcggggg gttctattgt cctttgcagc    205620
     tctctctagc tctcggttat gacctataac atctagagtc ttactgcttg aagtagaact    205680
     acttcgagcg atcctctctg aggctaaatt aaccttgtaa acccgtgggt gtgggttggg    205740
     gagccaaaac atattcgtaa agagcccccc cgataaatag tcctaagata aaggtccaac    205800
     gccagcgttc gtggggagta agcttgatcg caccgttaac cataccgctc acaccagcaa    205860
     tgcgaccatt gaagagtaga aagattgccg cactgagacc gattaggata cctcctaaca    205920
     aagccctaac ccagtaaaag gtacccattt ttctccttat tcaattacag cccagcgcta    205980
     gcatagcctg atgagtgctt agaaagatgc gttctcgacc cagcttttcc acaaaatctg    206040
     tcttctctag ctgatccatc actggaccct taacttcagc taaatagacc ctcacgccag    206100
     cagagttcaa atcagcaaac agtgcttcaa gcgtttccaa tgcgctcgca tcaatgaagt    206160
     ttatggcact acagatcagt acaagatgtt gcaaatcaga tatgtgagac acagcatgca    206220
     gcacatagtc ttccaaagct tttatattgg caaaatagag actttcatcc acacgaattg    206280
     ctaacacatg tgggtaggtt tttacaggat tccgtagcac attcctaaaa tgctcagagc    206340
     cctcaattcg accaacaact gctaaatggg gatggctggt ccgccataaa tacaggcata    206400
     gagaggccag aacccctacg agaattccag cttcaatccc taaccccaac acagcaccaa    206460
     atgtgatcag taatgaagcc gcatctgcac gattgtattg ccacatgcgt tgaagtgacg    206520
     tgaaatctat caaattcaaa acagcaacga taatgatcgc tgccaacaca gcctgaggca    206580
     aaaaataaaa taagggtgtg aaaaatagaa ccgttaaggc aatgagcaaa gctgtgatga    206640
     tggatgctaa acctgtgttg gccccagcac taaaattaac catggttcga cttaatcccc    206700
     cagtgactgg atatccacca gtgaaggctg cgctcaggtt tgcagctcct agaccgatca    206760
     actcttggtt ggcatcaatt ttttgccgac gtttactagc cagggactta gccacagaaa    206820
     tactttccat aaatcccaca agactaattg caacggcagt aggcataaga gcttgccaac    206880
     tcttcaagtc aaaggtgggc agcgtcaagg gcggcaaacc cgctcgaatc tcaccaataa    206940
     tcttgacctg cgccacttca tggagttgga gtctccacac caaaacagta ttaacgagca    207000
     ccagcagcaa tggtccacct ctggtcaagg ggagaatcaa attttgaggc atccctagct    207060
     tcttcagtag tggctgcaat tgatggttga agaccagcaa cacaactagg ctagtgagac    207120
     caaggatcag ggtaatgcta ttcctctgag gcaggtgctg ccaaatctcc tgtagtaatt    207180
     ctggaaagga ctcggtcttt ggaagctgca atccaaaaag gtgtttaagc tggctaaaac    207240
     caataatgat ggcagctgca ctcgtgaagc cagaaattac ggcatgactg agaaagttca    207300
     ccagaaaacc gagtcgaacc actcccatca gcatttgtag gatgcctact aaaagggcca    207360
     acatcatagc caaagttagg tattcagacg tattgggttg agcgagttgt cctacccctg    207420
     tggccactaa cagcgaaacg atggcgacgg gacccacagc caaagttctg cttgtcccca    207480
     aaagcgcata cagtatcagt ggcatgatgc tggcatagag gccaatctga gggggtaaac    207540
     cagccagcaa tgcataggcc atgccttgag gaaccagcat gatcgctact attactcctg    207600
     ccattaaatc gccaataagg tgctgagaac ggtattccag aaaccatttt agaaagggta    207660
     gatagcgact taagtgagtg agtctatgaa gaggcataca ctttgaatca gcctaaaatc    207720
     gggtctaatc tgctccctgt gaggaaggcg tcgagaactt tcaatcgttg cttaccccta    207780
     tcaagacaag actacccccc acaacaatac tgaatagtac aaaccaagga gatagcgttg    207840
     accccaaact agtcccaagg agaacacaag agcccgttaa aatttgggct aaacgaagta    207900
     tgtttatgga tcgcttgccc tgagtgggat atccagcagc cttccaagca gctaaaccgc    207960
     cttgaagatg atgaacatgg ctaaatcctg cctgcaacat ttgatgtgca gcttgggtcg    208020
     aacggtcacc agattgacac tgaaggacaa tcctttgccc ctgaagacga gggactgtgg    208080
     cggggtcaaa cttgtcgatc ggtatcagtt ttgctccagg aatatgactt ttttcaaact    208140
     cctggggttt gctgacatca atcaataaca cctcattccg atccatccat tgcttgagcg    208200
     tgagggcatc aatttctttt agattgtgca ttgcaaatgt cattgtcttc cctctttgaa    208260
     atgagcccat taggctgatg ggattggtaa agaactgatc ttttggagtt agcaatccag    208320
     tattccaagc atcattaagc agtaatcact tgaccacatc gttcattagc tgggaccgct    208380
     tccatgatct tttgtggatt aggaagatcc aaagcgttca taaactcaat aaaagtgttg    208440
     cgatctcttc ctttaaaccg gggattccat tgcttctctt caccaatcga ggagagggta    208500
     agtcctcgat agtcatgccc cggaaagacc agaatctcct ccgacagcgt aaataatttc    208560
     tgggtgactg agtcataaag tgttcctgca tctccgcttt ggaagtctgt acgaccgcaa    208620
     ccgcgaatga acaaagcatc tcccgttagt acacgatctc cattgaccaa ataggcgtta    208680
     tgactatctg tgtgaccggg cgtcgcaatg gcttggatag ggatagtccc caaggttatt    208740
     gtttccccat cttgtaagta acgatcagca caggcggcat gagcatgctc tggcacgatc    208800
     ccctgacacc ctgtttttgc ccgtaatgct tcagttcccg taatgtgatc agcatggatg    208860
     tgggtttcta gacagaactg gagttttaag cccaattcgt gtatcagttt taaatctcgg    208920
     tctacttgct ctaaaacagg atccactaac agtgctgctt tggtctcagg atcagctatc    208980
     aggtaggtat aggtgttaga ttgctggtcg aaaagctgtc taaataacca tatttcacta    209040
     tgtgaatgtc ttgccatcat cactatgctc cctatcagat tatcttcagc tacttgcttt    209100
     agggacatgc gccccaatta ctccaaaccg gaataccctc ttgatcgcga agctttaggg    209160
     tcacatcggc tttggtaact gcagctgcaa tcacagctgg ctgattatca acctccactc    209220
     ttgaacccgt gagggtaatc ttatccccct gttgaatgat gaaattttgc tcctcaaaga    209280
     accaagtggg tcctagacgg atttcaacat tatctgcgtc agacctaagc tgaagatgaa    209340
     cccctgtgga cattccccaa cgaggggtaa ccgtatctac ttgtatgacc tgcccctgaa    209400
     tagtctcaac tgtgcttgga ttgtagagtc tgctgtattg accataattt tgtcttctat    209460
     ggcgtctctg ccatcttggc ggcgagttaa ggcactctga ttctgaggca ggggaagcat    209520
     tggtttgggc attactttgt gcagggaatt gctcaaagct agattccata gactgttgac    209580
     aggcagtcag gagcagcaag agtaaccccg tcaaaagaac cgtaacaacg gccttagcat    209640
     agttagattt catgattttc cctcctggcg tgattcgatc aatctcaaag gagtctgctc    209700
     aaagcaggat caagactggg accgttgggg tctagctgct aaatattggt agagaagcca    209760
     acgggtattc acgtcttgct gagcttcttg caagagttgt tgagccgtct ctggctggct    209820
     acgggttagc atcttgaatc gattctcggc atacatggat gggttgatgg gaaccttggg    209880
     agcatgcgaa tctaatacca aaggattttg gccttgggtc actcgtcgag gatcatgacg    209940
     atacaagagc caacgcccag catctaccaa ggatttttga tggtgcatgg ctgaagacat    210000
     ctcaatccca tgagcaatgc aatgggcata ggcaatgatt agggaggggc cttcatagga    210060
     ttcagcttcg ataaaagctt taagggtatg ttcatcccgt gcccccatag caacactagc    210120
     cacatagaca ttgccgtagg tcatcgccat taaacccaga tctttcttcg gggttggctt    210180
     gcctcctgcg gcaaatttgg caacggcagc tcttggagtg gactttgaca tctgtccacc    210240
     cgtattggaa taaacttcgg tatccagcac aaggatattg acgttgcgcc cactggccaa    210300
     gacgtgatct aggccgccat aaccgatatc gtaggcccaa ccatctccac caataatcca    210360
     gacactcttt ttaacgaaat agtcagccag ggccttgagc tgactcattt tttcgatcag    210420
     cgagttatcc cgtctgtcgt ttttatggga ctccagatga atttcctgct ccgttagcca    210480
     ttgtttcaat agaacaactt cttgacggat ctcagcaata tcagcttcgt catcttgctt    210540
     ggctgctaag agtcgctcag ctagaaactg gatataatca tgctcgtctt ctatggtatt    210600
     gactacctcc tcaagaagtt tacgagcaag ttctttttgc tgatcaatcg cgactcggaa    210660
     acccaaacca aactcagcat tatcctcaaa tagggagtta gaccaagcag gacctcggcc    210720
     gtcagcgttt acggtccaag gtgttgtggg taggttgcca ccgtaaatag aagaacaacc    210780
     tgtggcatta gcaacgacca tgcgatcgcc aaatagttgt gttatcagtt tgatgtaagg    210840
     tgtttctcca caccccgcac aagccccaga aaactcaaat aagggttgtt gcatttgttg    210900
     atgactaatt ttatggagat tgagcgattg acgttgggga tggggcaggg ttaagaaata    210960
     atcccaattc tgaacctcag tttctctcaa aggacgttgg ggttccatgt tgagggcttt    211020
     cagtcggggt tttgacttat ttttcgctgg gcaaacatcc acacagatgc cgcatcccgt    211080
     gcagtcttcc ggtgccactt gaatggaaaa tttaagatca ctccaagcat gatcacgggc    211140
     cgctgtactc ttaaaggttg ttggtgcttt ttcagtgtgt tcagggtcgt agactttact    211200
     ccgaatgaca ctgtggggac aaaccatgac acatttccca cactgtatac agacctctgg    211260
     atcccaaaca ggaataaact gagcaatatt ccttttttcc catttggctg tgcccgtggg    211320
     ataggtacca tcagcgggta acgcactaac cgggagcata tctccctggc gctgaatcat    211380
     ataattgagc acttcacgga caaacttggg agcagtttcc ggcatcgttg aggcttgact    211440
     attgtttacc tttaactggc cgattgaatc atccataggg actttgtaga gttgttctag    211500
     agccgcatct actgccttaa ggttcatgcg gacaatttcc tcgcccttct tgccataggt    211560
     ttgatgaatc gattccttaa tacatgcaac tcccacatca cggggcaaga tatctgaaag    211620
     gacaaaaaag cacacctgca tcacggtatt gatgcgtccc cccataccta cagcctgagc    211680
     tatttggttg gcattaatgc catagagctt aagatgtttc tgaagtactt gttgctgcac    211740
     atgagcaggt aagcgttccc aaatctctgt agctgggtat ggactattta gcaggacaat    211800
     agccttgggt tgggcagctt tcaggacatc aattttgtct aggaagtccc aatgatgaca    211860
     ggcaataaag ttggcttgtt caattaaata ggttgaccga atggggtctg gtccaaatcg    211920
     gagatgagaa actgtgactg acccagattt tttggaatcg tagacgaagt agccttgggc    211980
     atagtgatca gtatgctcgc caatgatctt gatcgagttc ttattggcac cgacagtgcc    212040
     atcagcccct aggccataga agatagctct cattccctga tctgaatccg tggaaaaaga    212100
     agaatcatag ggtaggcttg tcagcgtgac atcatcgttg ataccaatag tgaagtgatt    212160
     tttggggttg gtagtcgcga gatggtcaaa gattcctttg accatggctg gggtaaactc    212220
     tttagaggac agaccatagc gccccccaac aaccttttga acagaaagat gagaggaatg    212280
     ttcgctaagc gtggcaagga catccaggta aagtggttca ccgagactac caggctcttt    212340
     agtccgatct aaaacagcta tggattgggt cgaagggggt aaagcggtta taaatcgctg    212400
     cgcatcccaa ggacgataaa ggcgtacttt gatcactcca acttgatccc cttgtcggtt    212460
     caaagcatcc accgtttcat ggactgtttc gcaaccggag cccatcagaa cgatgatccg    212520
     ttccgcctct ggatggccat ggtattcaaa tagctggtat tgtcgacctg ttaattgagc    212580
     aaagtcgttc atcactgttt gtgtaaccgt ggagcaatcc agatagtaag gattgactgt    212640
     ttctcgagct tggaagtaga tatcaggatt ttgagcggtg ccacgcaaga cgggatgatc    212700
     aggactgagg gcacgcgcac ggtgggccat aacggactta tcctggatta attccttgag    212760
     ggtagcgatg gacagtagtt ctactttctg gatctcatgg gaagttcgaa aaccatcaaa    212820
     gaaatggagg aagggaattc gggtttctag ggttgcagcg gttgcgatcg cggcaaaatc    212880
     ctgggcttcc tgaacagaag cagcactcaa cattgcaaag cctgtccccc tcgctgccat    212940
     tacatcactg tggtctccaa aaattgacaa ggcttgggct gcaacagagc gtgcagcaat    213000
     atgaaatacc gtagaggtca gttctcccgc aatcttaaat aggttgggaa tcattaacag    213060
     caatccctga gatgcagtaa aagtagtcgt cagtgccccc atttgaaggg ctccatggac    213120
     tgcccctgcg acacctgctt cactttgcat ttcaacgacc agaggaacta caccccataa    213180
     atttttgtta ttagcttctg tccatgtatc agcccattca gccatcggtg atactggagt    213240
     tatggggtaa atagcaatca actcattcag aaaaaaggct atcctcgcaa cagcttcatt    213300
     tccatcaagg gttgtgcagg tactattctt cattagtcga tactcctggg cttgccatgc    213360
     aatgacgaca gctacatccg cttctcgcta tgctcaagca aaccctagga aaagagtttg    213420
     agaaaaatat gaagatcgaa tcactatggc ttgaaattct taccatgtgg agattgatta    213480
     aaaacgggga aaactttgat ataccagtac attgagggaa ggaatagacc ttatcggaaa    213540
     taaaatgggt gagaataact tcaaacgtct atgtcgtaag tctttgaggc cgatttttct    213600
     ccaaaaataa aacgctttac cagtaaggct ttcagctatt tccgataagg tctaatgagt    213660
     cgtcattcct attttcttac ctctgatgat tcatcagaat tcttctgcca agaaatcgtc    213720
     tccgccaatt tcgcagaagc cttcttctga agctgtttgc gattgtcatc atagaacttg    213780
     agcgtattca gattggcgtg tcgggaatac gcctgtgctc cgcgcaagtc cccacccgtc    213840
     atctctaaat aggtggttgt cccactatgg cggactttgt gaggtccaaa gttctcactt    213900
     acccccgcct tcttcgccaa tgcccgaaca attcgatata ccgatgtccc tgacaaccgc    213960
     gacccccaat tcgcccgatc caacgagata aacaacggct ccgtgaggcc ataaacttct    214020
     cgcagttcca gccactctga aatcgctagt accccacttt ccgtcaaatc aatccactct    214080
     ctttcgttcc ttcctttccc caaaatcgac aaccgttttt gctccgaatc aaaatgacgg    214140
     acatcacagc ctaccagctc agaccgtcgc aatcccgcct cccagagtag cgtcaacatg    214200
     gcgaaatccc gagacccagc cagggaaaac cgattgacga acaccatcat cagtcgaaat    214260
     tgagaggctg taattccccg agtatcccga taaggtttta ctgttaggcc atctacttcc    214320
     gccaaagtcc aatcacacat ttccaaacgt ctggccatcc gcaccatgga cttcactgcg    214380
     gacaaccgcc gattgatggt atttgcctgc aaccctcgct gcatcataca ttcccgatac    214440
     cgagcggcta attccaaagc cttcaatcgg ccaatcccca caaaggactg actcagccgg    214500
     gatagttcca ccttcacctg cgcctttatc tcacttttgc gcttcggtcc ctcaactcca    214560
     tagaccattt ccccttgggt cacgaataaa aagaagtcca ccagatcctt ggtataccct    214620
     tcccgcgtgg agggtttggt tttctccacc aagactgctc taagcaaatc gacatcaact    214680
     gccgactcat cgatttctag gcgaactaac cctgattctg ccattgcgat ggtctccgac    214740
     cgaccttcgg tcatcgccga tctgatccac gtccatttta gtgtacgtca atggcaattt    214800
     ccgtacacta acgccaaaat cttattattt ggactttgac taaactttga ctaataagca    214860
     tggtaagcta tgggggtatt tgccgaaaaa gagcaaatcc ttggccaaaa cccatcccct    214920
     acctacggtt taagacgatg gcccgtgcaa tcgcagaaaa atgcaggcgg tgttccaagc    214980
     tacccgtgga ccaagcaaag ttaaaggagt gctgggtggg ccagcgttgc catgtccgtc    215040
     gttcctcgta taaacaccgc gatcgctata accgaaacaa gaaacggaaa tatcaactac    215100
     agacggggaa gctgattcct gaagttacgg tggatgtccc cgtccaacct gcggccattc    215160
     gacggatgta tcgagcgaga agggatgcgc cccttcatgc catgtcagcg gagctgtgga    215220
     taggtcaaaa gcgggttgcg ttcgttgagc ctgttcatac cctgggatgg actaactctg    215280
     atgtgacgaa atactcaagg agtatactca accgcttctc tgagcatcta gacggaaaag    215340
     tacttcatca gtttgattca caagtcgaag tggatccaag tcaatgcccg attcgtccct    215400
     gccccttgtt cccgtaggag gttgttcacg atggcattgc aactggaact cgatctttgg    215460
     cagcagctga atcaagcaga agcggttcca gtagagagtg acctccaaca gttgcaggag    215520
     cgattggact tagtagtcgc ccagttgcca ttagaggaga agttatccac ggcagggact    215580
     gccctattgc agatggcgga aatcttgagt cggcgagcgg aggtcttcct cagggactgg    215640
     cgagatgccc acaacgatga cggtcccatc cttgatttgg atgacgaaat ggggatggtt    215700
     cggcaatcca tggtgttaga cgatgatcta attgctgaac ccgacccggt gactcggcga    215760
     acattaccca aagaggagtg tgagtcgatc gttgtgctca aggacaaggc atcgttgctg    215820
     gaagagctgg agactgagtt aaggcttgag caacctgatg aagtcttgca agtcttggaa    215880
     gaagaggatg ttttggcatg ggtacaggcc atctcaacgt acttacaggg gacatctggg    215940
     atggtgcctt tggtcgagct aaaacaggag ctacagctgt cactggtacc tatctggcta    216000
     ggaatgctac tcggtggatt tcagtttgag cagcggggtg ggttttacga tcagaatgtc    216060
     tggattaaga cgggtgcctt gaacagccag ccttgaagac tatctccctt ttttcgaaga    216120
     ccgctgcaag aagccgtacc tggataactc ggatgagatg ccagtgatac actcaatcag    216180
     cgaatcgaat acgaatcacg gagcagcggg tgacacaaca ggagtccatt gaccatgatg    216240
     gtctgttcaa agaattgatc gagacgttct tttgggagtt cttagatttg tttttacctc    216300
     aagtcttaga ctatgtggag cgcggacccg tcacgttttt atcccaagag gtatacagca    216360
     gtattggtgc agaagagaag cgcatcatag acctgctggc tcgggttcaa tttcgagagc    216420
     aagaaagcta ttttctgttt catatagagc cgcagtcttc agtccaagcg gactttgaga    216480
     aacgcatgtt ctactacttc ggacgattgc aggagaaata tgatttgccc atttacccag    216540
     tggtgatttt ttcctatgac agtccccgaa aggaagcaga gagcaggtat accgttgagt    216600
     ttcctgattt tcaagtctta cagttcaatt tccgggccat tcaactcaac cgcttgcact    216660
     ggcgggacta cttgaggcag cacaatccag tagcgtcggc tttgatggct aagatgcaaa    216720
     ttgccaaaga agatcggcct caagtaaaga tggaatgcct gcggatgttg actaccttgc    216780
     agctagatcc agcgagaact gagtttattt ctcaatttgt cgatacctat ctcagattgg    216840
     aagcggacga ggaacaactc tttcaggcag aaattgatac attagaatta ggagaaaggg    216900
     acgcaatcat gcagacattg acgagttggg aagaaaaggg ccttgcacgc ggtcggcaag    216960
     aggagggagc aaccatagtt ctgcgtattc tcaaccgcaa attagggaat ctattacctg    217020
     aagttgaagc ccaaatccag tccttagaag ttgagaagct tgaggaactg agcgaagcac    217080
     ttttggaatt cgagagctta gaaaatttga acgcttggtt gcaaaatttt gagaattcct    217140
     aaattagctc tgggtaactg gttatgctat gtgtgtattg ccagtaacta aggcttcaca    217200
     cagttcaaga tacaatttcc tggttattac ttaattcaat agaatcgaga tatgacggca    217260
     acaggagcat ccccgacatt actcagcagt ttcaatcttc atgatttgcc actcgccaat    217320
     cggatagtca tggctcccat gacaagatcg cgagctgggg aagaaatgtt ggcgaatgca    217380
     atgatggctg aatattacgc tcaacgggca tcaacaggct tgattgttac agaaggaacc    217440
     tttatctcag accaagccat cggttggcag catgtccctg ggatctacac ccaagagcaa    217500
     acccaagctt ggcaagtagt aactaaagct gttcatgaaa aagggggtaa ggtttttctg    217560
     caactttggc attgtgggcg agcttctcac agcagctttc atcaggatca tcagcttcct    217620
     gtagccccct cagctatcaa acttgagggg gactcaattc ataccccaca aggcaagcag    217680
     ccctacgaaa ccccacgtgc tttaagtacc gatgagattc cactggttgt tgaagattat    217740
     cgaaatgcgg ctatcaatgc caaaacggct ggctttgacg gtgtggaaat tcacagtgcc    217800
     aacggttatc tgctcgatag cttcttgcag agtaaaacca atcaacgcca agatcgttac    217860
     ggtggaactt tggagaatcg ctatcgattt ctaaaggaag tcgtagaggc aatttcccaa    217920
     gtctggccaa ctcaccgcat cggtgtgcga ctttcgccga atggcgtctt taacgacatg    217980
     gggtcaccag actatcgtga aactttcttg tatgttgctc agcagttaaa tgcctttgat    218040
     ctagcttatc tccacatact agacggtctg gcctttggat tccatgagtt aggtgagccc    218100
     atgcaattat cagaattcag gtctgtctat aacggaacca tcattggcaa ttgtggttac    218160
     agtcaagagg atgcagacga tagaatttcg aacggtaacg ctgacttaat cgcttttggc    218220
     cgaccgttca tcagcaatcc agatctagtg gaacgtttca caaacggctg gcccttaaac    218280
     ccacctgcag agcagagtat ttggtattca ttcgagaggg aaggatacac agacttccca    218340
     atctattcag aatcccaagc ctaaaccacc taattcagga ttttctacaa ttgactgata    218400
     tcaatcgaga ttctctgttt tttgtttata aaaaaacgac tcaacaccat caaagcgcca    218460
     gggaactgcg atgtttgacg ggtctgtgac ttttgacaat ttcaaactta gcgctcccag    218520
     ccattaatca tcctggttat ttccgcgatc ttgaattcat tcccttgttc tgacttgtgc    218580
     cagagctcaa accgtgcttc gtatttgttg ctccaatctc cttcatagac cgttacctca    218640
     gcattgtatg gaaagaatgt ctcaccagaa tccgaccaac caacatagcg cgtcgagcga    218700
     gacgtcagtt gttcctcaga taagcgttgt ccggtttcta cgtcatagac ccttgtgtag    218760
     acatatccgg gagtggttgg gttaatagct ccgttgagca aatatattcc cggctgcatt    218820
     ccgtcggaaa ccttgaagtg tggggaattc gggcgcttac ctgggtaacg cgactcgaca    218880
     ggaattaaac ctgtcgtttt gatttcgtct tgatgtttca gaacatctgc taattcagcg    218940
     aatacctcac ctattgtttt ctttgtaaac tgtcgggcag tctcaggtgc ttggtcatag    219000
     atttcgaggt ataagcgatc accttcaata atgacgtagg atgtgttgcc gggggtacct    219060
     tcatgagctc cttcaacaat cacagccaca tcgtcagacc ctgcaattgc tcgcgttata    219120
     ttgccgcgat cccgtcctat tccgtatggc tcttcgaagg caattagcac acgggtctgg    219180
     tgcacggaat cgtcatcatc gttgctataa aagccatggc gtgtcgtttt atattcaccc    219240
     atgacctttt cccgccttac tgcatatttg attccacgtt cctgacgaat ctcccatctg    219300
     gagttgccag ctagataccg aaacaggatg gatctgggct cggcgtcaaa acttgccatt    219360
     ggttcggcag agatattaat gcgagcctcg tctggccgcg acagatgccc cccatagctg    219420
     gaaccgatca gactacaagc aggaagcaac gaaatcaaca aagcggtgaa gatggaaatg    219480
     ttgtgattca tctaactagc taagtttaag tagaccaaaa cttcccccta tcacgaaata    219540
     aagtggtagt ttgtctacct ctcaaatcca agccttttct acattagcat cacgatataa    219600
     agactcagta ttaatggaaa ttcatcaagt tagcgttctt aaggtctggg gtaaggcaac    219660
     ttaataagta ttatcttttt gctttttaat acctgccata gccaatcgct agaaagacta    219720
     aaaatctgta gattacagct tttatacgaa taatcgaact tcttgaaatt aataaatcaa    219780
     tatcaaatgg ctaaaacaat ttacatctat cccagaccga ataaacgctt acattttttt    219840
     ctaggctcaa acagagagag gtattttgga agaaccacca aaagtgacga gtcgggtaga    219900
     gaggacttga ctgacagcat gatccaagag cccaaccaag cgaaaagaaa caggtttctc    219960
     gctctctgga gcttgatcag tcctggctgt ctacttctaa cagtcggctt gtattatctt    220020
     ttggggattc attggaaccc aggcactctc gatgcatcgc tgttaatgat cacgatttac    220080
     gtcatttact gggggttgct aggaagtctt caaggggcat tgctcctcaa gtttcaatat    220140
     aagaccttgg catacaagtg gcttcgcaac accagtgcaa ctggctttct cattatgcta    220200
     gttcatgacc taactttgct gagcactggc atcaatatgg gtggacaagg ggtgcttatt    220260
     ctactcctaa gcctacccat tgtagctatc ttgggaggat gggtcttagg ctacgctcaa    220320
     tttttgctcc ttagaggtca tcatagcgtg gcatcacaga ccaatcgcct acccttcatg    220380
     tggtttgtag ccagttttat atcctggatc atgggtttta ttggtatttt ttttagtggc    220440
     agtatccccg ttttctttat cctctttgcc gcagttgggg gtgctattaa aggctgggct    220500
     gtgatgaagt atttaggtct gtagaaaaat tccacctgta aatttttccg cgttgcatta    220560
     cccagactca gttttggagt ttttacaatg gtctcatgta actcagaata agtagtatct    220620
     ccttatcaat taagccagat ttttacccta aaccccagat tgagcaagcg gttggacagt    220680
     ttcgcaatca ggttttgcct aaactagatc gccagcaaca taaatattcg acccatatct    220740
     tattttcact aaaacttaga caaaaaatta tcgctacctc gttcaaggat tgagatcacg    220800
     gatccatata tcttcttcaa tacaactctc tttagcccat tccaatagat gattctgaat    220860
     ctggtgttgt acttccaaag actgactggc tatgttggct cgtacactaa aataggcggt    220920
     gcctccctga ggaccatctg aattatgggt aatgcctgct aaatagacaa aattccctgc    220980
     actaaacgga ttgttgttat cgcgaggggt actaacgata ttcgaaattc tggcaataag    221040
     accttcttgg tctggcgtgt ttaaggcaag atgcatcatg taagcctgcg gccaatagag    221100
     ataggtgttt tgggcagcag agacaggctg caaaaattga ttagattgga tgcgaccttg    221160
     aatgcaggtc aaatcttcta gggctccttt ggcgagaatt tccatctcaa attggttttg    221220
     ttcgggcaaa atcagattaa actgaatggc ttccacatat aggtgctgga gttccaataa    221280
     cccagtaact ttggcgacta ctccagcacg atcttgccct cccacacgga ataataagga    221340
     acggttttgg atatctaagt ttttgactgt gacccaatct gtgaggacct tgttcatatt    221400
     tctaacccct tgaacagctt gagactattg tcttacccca ccttcacatt gaaacaaaag    221460
     gtctcaggct gatcaccccc aaaccctact cacccgctcc ctctccaacc actctccaac    221520
     catctcctcg atccgctcca tcgtctccgg tggcctcagc tcaatcactt ccccaatctc    221580
     aaagttttcc tcaatctcga cggtgcactc acggcagaat cccggtgtag caaacgattc    221640
     cttcacgaag ggtttccccg ttcccgccac agtaatccag taacatccga agccattctt    221700
     agaaacagcc agatactcca gctcccctcg tgtcctggct tgctctatct aatccttctg    221760
     tcgcagctcc agattacgat ccggcctgct accaattcct cgaactcacg cctagtacca    221820
     gtaaccgcag aatagtgctt gagattacat aaatcctgta ttagtcaaga aactgtaact    221880
     aaacataatt atttcattga cattttgtta cacttttgtt acattcagac acatcagacc    221940
     acaacacaca tgatttatcg gagtccaaag acatgaattc atctggcaat ttcttcggct    222000
     ttaacccttt tgctgaggct tggagtggtc gtctagcaat ggtcggtttt tatttagcta    222060
     ttgcaattga attagttact ggtaaaggtg ttctacattt ctggggtttg atgtaatccc    222120
     tcaaatatgt ctttcgttac tgaacatcta taaaccgctc atctggagat ttaactgtta    222180
     tgaattctca gtcttccttc acaggattta gcgccttttc cgaaacttgg aatggccgtc    222240
     ttgcaatgat tggtttcacc ctagccttga ttactgaagc acttactggg gaaggcatta    222300
     ttggtcaaat tatttcttgg tttactttct aaagactttt gtaattttat cctctcaatt    222360
     tagtcttact tacacatctg tataggtaaa tttgtctggc ccacttccaa agtttaactt    222420
     tgtcgggtcg gttaaggcga aacttatagc agtcagtaat attagggatt tgctagcagc    222480
     agtgcggtac aagtaatcgt tttagtgttt gctttcaaga ttgactggtt ttttctggtt    222540
     caattttcaa gcccatacac caattgctag atctctactc tacacacatt gataatttag    222600
     gatgagtatc atgtcgattt acgttggtaa cctctcttat gccgttacag agaaagatct    222660
     aaaaattgct tttgcacaat atggtgcggt aaaacaggtc aagctcccca ttgaccgcga    222720
     gacaggcaag aagcaaggct ttgcttttgt agaaatggat aatgatgctg aagaagccaa    222780
     agcaatcaaa aaactggacg gaggtgagtg gatgggaaag actctcacaa taaataaggc    222840
     ataacctcag gtaaatagaa tggatagtga taattttgtt gttggaaacc tctcctagag    222900
     acaatttaca ttaagaggat ctatctcata gctcaaacca atgggctatg agattacatg    222960
     atcagatttc tccacttcat ccacacccaa gatcatgaac ttcatttcct ccctctgtca    223020
     ttcatactga tagagctttt caccatctaa ctactgcatg tactaaaggg gaatacctct    223080
     agatttttac cactaccgag attctgagcc ttaaaaactc agtgatacac tcgaacagca    223140
     agggcagaat aaggtattcc tgatcataat gctccgcttt tataatcgat ctaaagctgg    223200
     ataaagaact cacgatacat ttacaaaact gtgctcaatt ttcagcgtca gtggttctag    223260
     cgctaccttg gagtgatgtt ctgctgacct aagaaactac ccaagcatta catcttcaac    223320
     gaataactaa ttctgagccc aagaaggtgg tggaagtggg tcagggtcca tcacagatag    223380
     atcaacttca aacacaactc ttaagccatt atcttctacc tgattaacct gaagctttcc    223440
     agaacgagta gcgactaaaa ggtttccctg caaatcccag tctgcccatt gatacgcatc    223500
     cagaatctca atgccttcat tggactgcat cgaataaaga accgacattc catctactgc    223560
     ttgatcttct ccaaactcac ccccagccaa acctaagctt tctaaataaa ggattcgatg    223620
     accttcaggt tgtattttat agagtcgtgc attccgatgt tcatcccaca agtcattggg    223680
     ttgccgcaat ggagaatcgg ctgtttccgt ccatccccga tgacgttcat tggcaaattg    223740
     caccactgga atggaactga gattgtaagg aaatggaacg tctatcttaa ggtgctcatc    223800
     actttgatca gggggtatga aatagtaacc gcgcgtccat gtaccgcaag taccaaaagc    223860
     atagatcgct cttagccaag gtaactttga aatcgcaatg taggtttcac catgttccca    223920
     ggttgcattg ggcttgtggg caaaataaca caggaatcga ccatcgggtg aaaggtcaga    223980
     gcgacgggga tagatgcgcc catgtaacca ggcacctggt tcatacgttt gctgggttag    224040
     atcccaccga ccgacatgga accatttgct aggcccgcgt cgaaatactg caatcacagg    224100
     cgcttcagaa gcagggatac agtagatacg gggtgaatcc attgccatca caccatcatt    224160
     cccgatatga tttcactcca cctccagcga atgttcaacc aggaagcgac ccgcagacaa    224220
     agccacaaaa ctactctcat agaactcacc gtcagtatgg acctgtcttt ctggggtaat    224280
     cacccaacat tgatatcccc actccaagga acatgagacg ccaacgagcc agccatctgg    224340
     gaatcctacc aaatcagtca gtgtctctat cgccatgaca accacgcggt gaggcggcaa    224400
     atcgtgaaaa aagtaccatg ttgacaccat cttagtacaa gattactata ttggtctagc    224460
     acccccatct tgatcttttg gagatcccct tatgagtgcc aaaacagaaa tgaccgagaa    224520
     gcaaaaagcc ctcgatttgg tgatgaaaaa cgtggaaaag acgtttggca aaggggcaat    224580
     catgcggctg ggagatgccg ctcggatgca gattgaaacc atctctacgg gtgctttacc    224640
     cctagatcta gccttgggcg gagggctccc caaaggtcgg gtcattgaag tgtatggccc    224700
     tgaaagttcc gggaaaacga cggtggccct ccatgcgatc gctgaaatcc aaaaatctgg    224760
     gggagtggca gcgtttgtgg acgcggaaca tgccttagat ccggtttatg ccgcggcttt    224820
     gggagtggat gtctctgagt tgctcgtgtg ccaaccggat tctggggaaa tggccctgga    224880
     agtggtggat cagctggtcc gctccagtgc cgtggattta gtggtcgtcg attccgtcgc    224940
     tgctctcact ccaagggctg agattgaagg ggatatgggc gactcccata tgggtttgca    225000
     agcacgtcta atgagccaag ctctgcgcaa gatcaccagc aacatttgca aatcgggtag    225060
     caccgtcatt ttcctcaacc aactccgtca aaagattggg gtcacttatg gcagtcccga    225120
     agtcaccact ggagggaacg ccctcaagtt ctatgcgtcc gttcgcttgg atattcgtcg    225180
     tgttcagacc ttgaagaaag gcacagagat gtatggtatc cgggcaaaag tgaaggtcgc    225240
     taagaacaag gtcgctcctc catttaagct agcggaattt gacattctat ttggtcaagg    225300
     gatttccacc gtaggatgct tagtagacat ggctgaggaa gcagaggtga tcgtccgcaa    225360
     aggggcttgg tatagctatg acggcagcaa catcggtcaa ggccgggaga atactattca    225420
     gtactttgga gatcatccag aattttctca gaagatagag cagcaagtcc gtcagaagct    225480
     tgagttaggg ggcgaagtat cggccaattc gaccactcct gtggaagtcg aagatgagga    225540
     ggcagcgtaa aaatattcca tgaatactca gggcaagaaa ctatacccat ttgtcccctc    225600
     tggaccaaat ttccaggagt cccttaagtt cttcgttgag cttggctttg agaagctttg    225660
     ggagaatgag aatgatgggt tggccgcatt acgttttggt gaagcacaat ttctcttatc    225720
     caatatcgat attcaggaat ggcaatcaaa tcaaattatt gtctatgagg tagatgatct    225780
     ggaggcatat tatctagaac ttcaggctaa ggacatcccc accaaatttc caggccggaa    225840
     gattggtccc ccgaccgatt atccttgggg acgcgaagtc caatttattg acccaggagg    225900
     ggtatgctgg catgtcaggc agtatgaagg gaattaggta aagttaattt cgtagcaatt    225960
     ggtcgatacg aatgccaacc tgtcaatcaa taaccattct cttctaatcc ccaatcaacc    226020
     ccaacaaacc ctccgcagcc ccccactttc gcttccttct ttgacacccc ctcaccaacc    226080
     ccttcaaggc catcacctac actgaacagc gaaatccttc tggtattgtc tcaaactcat    226140
     atctgggcaa cgatatttgc tgccgctggc ataactcctg caatgcccca atcggatttt    226200
     ctgtcacatc accagccaag ctcacggatt cctctgggtc ttcctcctgg tcctcggctt    226260
     ggtcctggtc taggtgtagg actctcactt gatgttctgc tctgcgaatg gctcggtttc    226320
     gggcgctatc aaggagcttg attagggcat cttctggatc ttcgttgggg tagagatagg    226380
     taaggaatcc aagctgtttc tccgttaatc aaactgtcag gctgatgagg ggctggagat    226440
     tgctcatcag caggcagtgg gtagttctct tctaaagaga ctatctaaat acacacgagt    226500
     tgtacggcga tctgttgtgc cattctgcat taggaataac gatagcgccg ctgaaagaac    226560
     ccgactctga tcccagtcag gatgggtgtc taaataacct cgcaaggcat catgtagctc    226620
     ttcagggata tcggccaata tgctaatcgt agtggacatg aagtggttac tcttctcaaa    226680
//