Dbfetch

ID   CP000839; SV 1; circular; genomic DNA; STD; PRO; 356087 BP.
XX
AC   CP000839;
XX
PR   Project:PRJNA12997;
XX
DT   29-OCT-2007 (Rel. 93, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Acaryochloris marina MBIC11017 plasmid pREB2, complete sequence.
XX
KW   .
XX
OS   Acaryochloris marina MBIC11017
OC   Bacteria; Cyanobacteria; Synechococcales; Acaryochloridaceae;
OC   Acaryochloris.
OG   Plasmid pREB2
XX
RN   [1]
RP   1-356087
RX   DOI; 10.1073/pnas.0709772105.
RX   PUBMED; 18252824.
RA   Swingley W.D., Chen M., Cheung P.C., Conrad A.L., Dejesa L.C., Hao J.,
RA   Honchak B.M., Karbach L.E., Kurdoglu A., Lahiri S., Mastrian S.D.,
RA   Miyashita H., Page L., Ramakrishna P., Satoh S., Sattley W.M., Shimada Y.,
RA   Taylor H.L., Tomo T., Tsuchiya T., Wang Z.T., Raymond J., Mimuro M.,
RA   Blankenship R.E., Touchman J.W.;
RT   "Niche adaptation and genome expansion in the chlorophyll d-producing
RT   cyanobacterium Acaryochloris marina";
RL   Proc. Natl. Acad. Sci. U.S.A. 105(6):2005-2010(2008).
XX
RN   [2]
RP   1-356087
RA   Touchman J.;
RT   ;
RL   Submitted (25-SEP-2007) to the INSDC.
RL   Translational Genomics Research Institute, 13208 E Shea Blvd, Scottsdale,
RL   AZ 85004, USA
XX
DR   MD5; 4148acb719c6a0b45229eb58a301259a.
DR   BioSample; SAMN02604308.
DR   EnsemblGenomes-Gn; EBG00001236569.
DR   EnsemblGenomes-Tr; EBT00001581808.
DR   EuropePMC; PMC2538872; 18252824.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF01482; AdoCbl_riboswitch.
DR   StrainInfo; 373281; 0.
DR   PubMed; 18252824.
XX
CC   Source bacteria from Marine Biotechnology Institute Culture
CC   Collection, Marine Biotechnology Institute, 3-75-1 Heita, Kamaishi,
CC   Iwate 026-0001, Japan.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..356087
FT                   /organism="Acaryochloris marina MBIC11017"
FT                   /plasmid="pREB2"
FT                   /strain="MBIC11017"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Acaryochloris marina"
FT                   /db_xref="taxon:329726"
FT   gene            66..1211
FT                   /locus_tag="AM1_B0001"
FT   CDS             66..1211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0001"
FT                   /product="transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31728"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLV9"
FT                   /protein_id="ABW31728.1"
FT                   /translation="MDNSIRIPLNLPDIRVLELSKTERGDWLIKIESTLQGTTCHQCGR
FT                   EITDLHCHDQPFRIRHLPLFEVPVYLEIRPKRYRCKYCDDHPTTTQHLEWHEPRSPNTK
FT                   AYERWLLRILINSTVSDVARKLGVSEDIVSGIIDRWIAAQVDWSEYADLKVMGMDEISL
FT                   KRGHRDFVVLITIPTTDGVDILAVLADRKQQTVANFLQSIPIDLRQTIERVCTDMYQGF
FT                   VSAVREQLPQAKIVIDRFHVTKAYRNCADTVRKREVKRLRRELSKQEYDSIKGAMWPFR
FT                   KRPENLKESEQQLLERLFAYSPQLKQAYNLREKLTQIFEGRYTKHGAKCAIRAWCKQVL
FT                   KSDIKEFDCFLTTINNWMDEMTNYFLEGWTSGFVEYWMSTP"
FT   gene            complement(1369..2100)
FT                   /locus_tag="AM1_B0002"
FT   CDS             complement(1369..2100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0002"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31729"
FT                   /db_xref="GOA:A8ZLR9"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLR9"
FT                   /protein_id="ABW31729.1"
FT                   /translation="MLTHWESIESQAMQENWSYAEFLLALCETEAQRREQARLKRALTE
FT                   ARLPNAKSFTNFDFSHCPQLNPAPLMQLAADPGWLERAENCLILGPSGVGKTHLATGVS
FT                   KKMLEFGKRVKFFAANALVQQLQQAKLQLQLHPMLKKLDRYDLLILDDLGYCKKSEAET
FT                   SVLFELIAHRYERKSLLITANQPFSQWDDIFTDSMMAVAAIDRLIHHGLIIEIQADSYR
FT                   RKSATQRTAQTQSQPQKSQSK"
FT   gene            complement(1928..3664)
FT                   /locus_tag="AM1_B0003"
FT   CDS             complement(1928..3664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0003"
FT                   /product="transposase, putative"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31730"
FT                   /db_xref="GOA:A8ZLS0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLS0"
FT                   /protein_id="ABW31730.1"
FT                   /translation="MPNKRIDSYHTRVYMNGRDLGLKQADAAYIAEISTRTGQRIEAGT
FT                   HQPNRGRLQDQRTVPDPLADVWEDELEPMLRRDPRLKPMTLYEYLQDKYPGQYPQVLRT
FT                   LQRRVRTWKALHGPSPEVMFELRHEPGVQGFSDFTELKGITITIAGKPFEHLIYHYRLG
FT                   YSGWRYAQIIEGGESFVALSEGLQNAFAACGGVPTQHRTDSLSAAYRNMGGRRSKNLTR
FT                   LYDELCDHYRLEPTRNNKGVAHENGSIESPHGHLKNRIKQAIYLRGSADFTSVAEYQAL
FT                   IDAQVAKLNQQCQTKYEQEKDHLQPLPKYRTPDYEVLTAKVSKRSTIDVRCILYTVPSR
FT                   LIGRQLELHLYHDRIVGYLERHPVVELPRKRVSGKGKRRDRCINYRHVIGSMRLKPRAF
FT                   IYCTWQSDLLPNPEYRQIWEQLKAQFDLEQAAKIIVEALYIAAVQDKEQAVAVYLQQQL
FT                   RSSSLTLNRLKKQFEPPQMKQVPELSIEQHSLELYDKLLPSCSVPAEPLPAPEPLFKKA
FT                   QALPHVDPLGIYRIPSHAGKLVLCGILTSLVRNGGPTKRTSSSKTCPHRSQAPKRKKFY
FT                   QL"
FT   gene            3860..3985
FT                   /locus_tag="AM1_B0004"
FT   CDS             3860..3985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31731"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLW2"
FT                   /protein_id="ABW31731.1"
FT                   /translation="MEGFNNRVKVLKRRCYGIFDIERLFQRISLDLNGYQTFAVT"
FT   gene            4089..4343
FT                   /locus_tag="AM1_B0005"
FT                   /note="fragment; similar to C-terminus of transposase"
FT   gene            4356..5213
FT                   /locus_tag="AM1_B0006"
FT   CDS             4356..5213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0006"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31732"
FT                   /db_xref="GOA:A8ZLW3"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLW3"
FT                   /protein_id="ABW31732.1"
FT                   /translation="MQAMIEQLQHMKLTGLLEAWREQQALPTYHDLSFDERLALMVERE
FT                   YIRRQNQRMQRRLRQARLPVHATLDAVDFDVPRGLKKIQFLEFAQGHWLQENLSLIFLG
FT                   PTGVGKSFLAAVLAHHLCKQGHTVRYIKTADLLLELKLTKADGSYPKLRKQLAAYDLLV
FT                   LDEWLRDPLSLYEAREILDVLDERFRKASCLFATQIPVEQWHPQIQDPTLADAILDRIV
FT                   HDAMKVSLRGESMRKLTSKLIPQKENDNPALSTKQQENKTDAKPKNETSAKSKAKGLQE
FT                   TTDD"
FT   gene            complement(5229..5342)
FT                   /locus_tag="AM1_B0007"
FT   CDS             complement(5229..5342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31733"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLW4"
FT                   /protein_id="ABW31733.1"
FT                   /translation="MLRHLPIKKYRHLELAGQKVSLYLNQMALELPKSFIT"
FT   gene            complement(5430..7103)
FT                   /locus_tag="AM1_B0008"
FT   CDS             complement(5430..7103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0008"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31734"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLP4"
FT                   /protein_id="ABW31734.1"
FT                   /translation="MELFQQFLPCQDTLHLDSWDLDSTNHQMTFHVSSTQALACCPVCH
FT                   QTSHRVHSRYERTLRDLPCVEFCLTILLQVCKFFCSNKTCKRRIFTERLPQVAVPWARR
FT                   TVRFAEHLSSIGLALGGAAAARLSYQINYGSSRNTMLRALFKLPLPSVTTPKILGVDDF
FT                   ALRRGHEYGTILVDLEKHQPIVLLTDRKADTLADWLNEHPGVEVISRDRSKAYKSGASE
FT                   GAPDALQVADRFHLLQNLEEILENVFSSHSQVIKTVEYTLLKATLAEHQDTEAMSQPVV
FT                   KPQVDPNSRKAQNRARRLEKYEQTHALRKQGYLIKDIAHHLGIGKRTVYTYLAADTFQE
FT                   YKTHPRRGWSGLNPYKAYLLEQWNKGRQNSKQLLAEIQQQGFKGSYTMVVRYTHKLRQS
FT                   LPPQPPRDSLNELPGRGPVPEAQELIQKPLTVQRAAWLVMRKVENLTEEDETILEQLSS
FT                   QPELSKAIDLAQSLLFIVRKRLPQHLDPWLDRAKNSALKPFQSFAKGLLDDYEAVKAAL
FT                   TLEVSNGQVEGQNNRLKMVKRQMYGRAGLDLLNKRLVLMS"
FT   gene            complement(7195..7308)
FT                   /locus_tag="AM1_B0009"
FT   CDS             complement(7195..7308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31735"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLW6"
FT                   /protein_id="ABW31735.1"
FT                   /translation="MIESWRCIDIRNQVIIRRQIFNHPKYPAGKSLKSSPI"
FT   gene            complement(7423..7998)
FT                   /locus_tag="AM1_B0010"
FT   CDS             complement(7423..7998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31736"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLW7"
FT                   /protein_id="ABW31736.1"
FT                   /translation="MPNTSRTKRVMIMNQTVPQQPGPKERAKAGFGIVDEMLKAYNGGE
FT                   TYVKRFLTFVGIGGVITGTALGYRPHVSPQAPQAEPIIIQMTPPTSLPATSPAKPESSP
FT                   AKPAEPSTTQPVAEIQPEPSQKTPPSQPNVRPAPLPKPVIATQPVPSHVTVQKPSIVIT
FT                   PPILKRPAPSLPFEVDQSDQDDRFEIDD"
FT   gene            8279..10009
FT                   /locus_tag="AM1_B0012"
FT   CDS             8279..10009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0012"
FT                   /product="transposase, putative"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31738"
FT                   /db_xref="GOA:A8ZLW8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLW8"
FT                   /protein_id="ABW31738.1"
FT                   /translation="MPAPIKPQQVHLYMQTKQSGSSQETAAAKAGISTRTAHRIDSGTH
FT                   RPQRGRPHDWKTREDPLDGLWELELEPMLEREPRLEATTLFETLQENHPGQYDDKIRTV
FT                   QRRTAKWKAAHGKPKEVMFKIQHHPGEMGQSDFAQLKGFSVTVQGEAFHHILYHYRLSY
FT                   SGWQYVQVIQGGESFIGLSQGLQNALTACGGVPKIHRTDSLSAAYRNTGGRNPQLTQLY
FT                   STLCDHYRMQPTRNNLGVSHENGGIEGSHGYFKRRLCQALYRRGSFDFESVAAYQQFIE
FT                   QVIAKLNAKCQKKFALELPTLQPLPRYRTPDYEVRSAKVSCNSTIAVRCVLYTVPSRLI
FT                   GHRLKLHLYHDRIVGFLGTTPVVELARVHVHGSEKKRRARSIDYKHVAESLRRKPNAFL
FT                   YCQWQSELLPNLQWHQLWESLKASFERDQAARLITEALYIAATQDQESQVADYLQTQLD
FT                   QSTLTLSGLKQAFEFQLSTEQYPDVPSQQHNLSDYDQFLTLGSGQPIPVADDNPQTAPV
FT                   KTFPRRVAEHRASSNSGELVLRPVSIGFSSRRSQPPRTESDLPRAVRSATSLRKILDQF
FT                   "
FT   gene            9804..10553
FT                   /locus_tag="AM1_B0013"
FT   CDS             9804..10553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0013"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31739"
FT                   /db_xref="GOA:A8ZLW9"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLW9"
FT                   /protein_id="ABW31739.1"
FT                   /translation="MTTLKQLRLRHFLDEWQSIEHQATQENWSYAQFLLALAQGEASRR
FT                   EQNRISRALSEAQLPYGKSWTNFEFDHIPSLNPAALMEFSQTTHWLESGSNILIFGPSG
FT                   TGKTHVSSALGTSMIELGKRVKFLTATALVQQLQLAKLQLELQSLLSKLDRYDLLIIDD
FT                   LGYVQKSDVETSVLFELIAHRYERKSLLITANQPFSQWDKIFPNSMMTVAAIDRLIHHA
FT                   TIFEMQAESFRKQEAAKHTAKSQKTDR"
FT   gene            complement(9983..10156)
FT                   /locus_tag="AM1_B0011"
FT   CDS             complement(9983..10156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31737"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLX0"
FT                   /protein_id="ABW31737.1"
FT                   /translation="MEVPKAELTCVFPVPLGPKIRMLLPDSNQWVVWENSIRAAGLRLG
FT                   IWSNSKLVQDFP"
FT   gene            10695..10817
FT                   /locus_tag="AM1_B0014"
FT   CDS             10695..10817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31740"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLX1"
FT                   /protein_id="ABW31740.1"
FT                   /translation="MHDGIAKTKLDSRAIIKSMKTEQKKLAYLIDIRHLAMKSM"
FT   gene            complement(11018..12238)
FT                   /locus_tag="AM1_B0015"
FT   CDS             complement(11018..12238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0015"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31741"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLX2"
FT                   /protein_id="ABW31741.1"
FT                   /translation="MRSLNSPAPLALGVIAFVFIPLPTAIALTATDVSAIAEAITVRID
FT                   GQNPGSGVLIKHQGNTYTVLTASHVVATEDTYELVTFDDQRYPLNYNRIQKFPGIDLAV
FT                   VKFTSTISYRVAKLGDSSEVKAGESIYVSGFSTPTKAITEAIWNFSKGEVTSNTKRPLA
FT                   DGYGLVYSNNTLPGMSGGAILNRQGRLIGIHGRADAEQQVQQSATVHIKSGFNLGIPIN
FT                   TFLNLTNNTSQKLSDVDPPIAAKGSELKADDWYLQATHRSKKGDFLGAISDLDKAIELD
FT                   PDYVIAYFRRGTARLNLKEYPKTIADLNKVIELDPEFAAAYVSRGISYTYLMKYSRAFS
FT                   DYNKAIELNREFAAAYAIRGATYVLIGNLTQGKQDIQTAAQLFKQQNIPEGYEMTINFL
FT                   KQPEFSR"
FT   gene            complement(12573..13772)
FT                   /locus_tag="AM1_B0016"
FT   CDS             complement(12573..13772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31742"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLX3"
FT                   /protein_id="ABW31742.1"
FT                   /translation="MKESLSIQQARKLVLLSQRLPPRNQSGRAIEATLSAIEHLGYIQI
FT                   DTISVVQRAHHHTLWNRNPRYKASQLDQLLSDKQVFEYWSHAAAYLPFRDYRFSLPRKY
FT                   AFASGDQRHWYQRDEQMLKWVLKRIATEGPLMAKDFEHSGTRIGAWKTKPAKRALEYLF
FT                   MQGDLMVPYRINFHKVYDLTERVLPEGTDTTLPTPEEYARFLITRYLRGNGLGLSAEIT
FT                   YLLKGIKPLVDKTLEDMVSTGELLQIRVAGRLYYAFPTSLELLSKSLARSKLKILSPFD
FT                   NLVIQRKRIKALFDFDYLIECYVPEAKRRYGYFSLPILWDGKLVARMDCRTERAESLLH
FT                   IYHLALEPTVLKTEVLFPALRKELESFLQFNHCDQLRLHRTSPAQAKPELQTLINDLTI
FT                   "
FT   gene            complement(13869..15218)
FT                   /locus_tag="AM1_B0017"
FT   CDS             complement(13869..15218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0017"
FT                   /product="PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31743"
FT                   /db_xref="GOA:A8ZLX4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLX4"
FT                   /protein_id="ABW31743.1"
FT                   /translation="MQSTDVVIPLQSEWDYTQKFLQALLDNLSNGIVACNNQGVLTLFN
FT                   SSAQELHGLPLCPIPAEQWASYYHLYQADGTTSLPQDDIPLYRALQGESVHNAEIVVKP
FT                   SQGKPRTILASGDPIIAQDGQKLGAVVAIQDITLRKQAELELGKSEERWQLALEGTGDG
FT                   LFDWNIVTNEAFMSLQLKQTLGYADHEVENSFEGWRQLVHPDDLGEVAAAIEAHLRQSM
FT                   PRYTAEYRMRCKDGSYKWILARGQTKWDDNGQPIRMIGSHQDITRQKQAEMELARLNRD
FT                   LEERVTSRTTQLEVAKNQKEALVVKEQEARRQSKIDRAGIKLYESIISNIQLGILVWHS
FT                   QNLESEEHLELVSTNPAAESILKMKLHEEIGRQMSDIFPSFVEKHPEILLSLVEIIRTQ
FT                   HPRSIENVPYTFPEGDENLFSLRAFPLPNDCVGVAFENVTVQETTEPTFS"
FT   gene            complement(15197..15592)
FT                   /locus_tag="AM1_B0018"
FT   CDS             complement(15197..15592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31744"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLX5"
FT                   /protein_id="ABW31744.1"
FT                   /translation="MTSGPEFPFSSDSVLSETSGDKQHALQLKPQQLLDRLPVTVWQAN
FT                   DQGQIISLSARWQLITGHAPIESLGEAFWNAVLLEDRDLSFQQWTNACQQQQPFVLHLH
FT                   LCSIKGKPDPFLIQGVAGWVRCSQRML"
FT   gene            complement(15686..16039)
FT                   /locus_tag="AM1_B0019"
FT   CDS             complement(15686..16039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31745"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLX6"
FT                   /protein_id="ABW31745.1"
FT                   /translation="MQMAPPFLVENTAMLNHPTPLFDKLCEVTGYTLLDLAVFAKDEGY
FT                   PLMPILLSPFQKIQLRNIVLCHWAIKEGYFTSWSHAEVEFIKLWGKVKEIDLIGAWVDY
FT                   CHDRELISQGMVC"
FT   gene            16336..16674
FT                   /locus_tag="AM1_B0020"
FT   CDS             16336..16674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31746"
FT                   /db_xref="InterPro:IPR014945"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLX7"
FT                   /protein_id="ABW31746.1"
FT                   /translation="MIKKMSPNNFNTRASKTSDKNDNLCSGWWLEVGTANPPCIDFYGP
FT                   FEGKAEAEVAKLEYVQKSTKTSQIVFSHSKFCQPRQRTLTQNDFTIQDLKDCPPTFFKV
FT                   VLGGHRIY"
FT   gene            16805..16921
FT                   /locus_tag="AM1_B0021"
FT   CDS             16805..16921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31747"
FT                   /db_xref="GOA:A8ZLX8"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLX8"
FT                   /protein_id="ABW31747.1"
FT                   /translation="MLTMQQVNQIFHKVTADSVRCGALTIFAVAQALFIGVM"
FT   gene            16955..17710
FT                   /locus_tag="AM1_B0022"
FT   CDS             16955..17710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0022"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31748"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLX9"
FT                   /protein_id="ABW31748.1"
FT                   /translation="MKQVAKSSKSLKFLITDIGVMKLNWFKFLPLSACLLLCIFPRNAM
FT                   ALESHDEVQESTKVFTEINREPKTRIPSSLLQRSQAIAILTNVTQGGFIFGVRRGDGVI
FT                   LIRKPNGGWSNPAFITITGGSFGLQAGARSSDVILVFPSQTALKTVLSEAFEFGGSVSG
FT                   TAGPVGEQPVESLEGFNGDKVYTYSRSEGLFGGVTLEGSDLDDDDGLNKEFYGQPITAT
FT                   QIFQRSSMQAPVVVDSLKQVLQQAEAGIR"
FT   gene            17838..18182
FT                   /locus_tag="AM1_B0023"
FT   CDS             17838..18182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0023"
FT                   /product="phosphoribosyltransferase like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31749"
FT                   /db_xref="GOA:A8ZLY0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLY0"
FT                   /protein_id="ABW31749.1"
FT                   /translation="MVITLPRGGVPVAFEIAKELNAPLDLCLVRKLGVPGMNELAMGAI
FT                   TSDGVILLNDEVVSELDISPQIIEQVATNEMRELCRQAYLYQGDRQPSRIHDHILILVD
FT                   DDGIATATTI"
FT   gene            18195..18413
FT                   /locus_tag="AM1_B0024"
FT   CDS             18195..18413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0024"
FT                   /product="phosphoribosyltransferase like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31750"
FT                   /db_xref="GOA:A8ZLY1"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLY1"
FT                   /protein_id="ABW31750.1"
FT                   /translation="MLQKQQPCQIVVASPVIEAGTYETLKTEVEEVVFLINPKPLYSIG
FT                   FWHEDFSQTSDEELKQLLAIKYRSKYR"
FT   gene            complement(18459..18716)
FT                   /locus_tag="AM1_B0025"
FT   CDS             complement(18459..18716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31751"
FT                   /db_xref="InterPro:IPR014945"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLY2"
FT                   /protein_id="ABW31751.1"
FT                   /translation="MMTTLLSFLADLSNHLGLAWWVEIKTLSPICTYFFGPFLIRKEAE
FT                   AALFGYVEDLEAEQAQNIVAHIQRCHPPHLTICNEMEYSC"
FT   gene            18916..19044
FT                   /locus_tag="AM1_B0026"
FT   CDS             18916..19044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31752"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLY3"
FT                   /protein_id="ABW31752.1"
FT                   /translation="MIDHQICVQGFWQIMVATGDIAIVPIFSNDKGTTITSIQLKR"
FT   gene            19206..19853
FT                   /locus_tag="AM1_B0027"
FT   CDS             19206..19853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0027"
FT                   /product="CobQ/CobB/MinD/ParA family protein"
FT                   /note="CobQ/CobB/MinD/ParA nucleotide binding domain
FT                   (PF01656 and COG1192)"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31753"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLY4"
FT                   /protein_id="ABW31753.1"
FT                   /translation="MQTPKIIAFANQKGGSGKSTSAAHAAYWLAQKGLSVLLVDADGQQ
FT                   SSSAWLNELELDYQVLIDPEQLFESLPTFSDDYDVVVVDGPGSLSEVTKAILSRCDLVL
FT                   VPTRDSIIDLRSTGKIVQFIKHAKELRGGFPKAAIFLNATRKSSVLLREAQEALEDVVI
FT                   PLMQTVIYDRQCIKDAPGQGSTVFKMKGKPAKEASKNYEELFTEAMEIFGND"
FT   gene            19846..20796
FT                   /locus_tag="AM1_B0028"
FT   CDS             19846..20796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0028"
FT                   /product="chromosome partitioning protein, ParB family,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31754"
FT                   /db_xref="GOA:A8ZLY5"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLY5"
FT                   /protein_id="ABW31754.1"
FT                   /translation="MTRRTLKKAIQADNQLSDFVFGNVEVADGDLKYIPLNSIKRTTLQ
FT                   QRRYFDQKQIEEWAKHEIKINGIRSPLWVRKLPKSNRKQEYELVAGERRYRAAEFLNLL
FT                   EVPVRIFILDDRQALMASLVENMQRQDLSPLEETEGTLEFLSMELDLPIEKVTKFLYQM
FT                   NNASKGTVNQNVLVSDNAHKVENVFKVLGRLTWTSFVSSRLPLLKNPSDILNALRSGEI
FT                   EYTKAMAISKLKDKKTRVKILKKAINESLSLTEIKQLINSYREPVDQPTELSLDTEVKK
FT                   ALAKFKKSKVWTNPKKEKQIRRLLQQLDKLMDDDN"
FT   gene            complement(21008..21646)
FT                   /locus_tag="AM1_B0029"
FT   CDS             complement(21008..21646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31755"
FT                   /db_xref="InterPro:IPR011518"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLY6"
FT                   /protein_id="ABW31755.1"
FT                   /translation="MSIDCKATVELGESSRRGKTRTQTKACDHDMGSGPKYVPCGILEE
FT                   DADTLHIIFGHSHKTSDFMVDNLQDWWNTLAPTEQQTLQLIQIKLDIGPENSGVRTQFL
FT                   NRLVAFSDHIGTAIQLLYYPPYHSKYNPIERCWGILEQHWNGTLLTDVDTLLGWASTMT
FT                   WKGNHPVVTVTQKIYETGISLTKQAMKGIEKRLERHPQLPKWDILIHPI"
FT   gene            complement(21673..22149)
FT                   /locus_tag="AM1_B0030"
FT   CDS             complement(21673..22149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31756"
FT                   /db_xref="InterPro:IPR011518"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLY7"
FT                   /protein_id="ABW31756.1"
FT                   /translation="MTGARRRAFQADIALKYCDGNPNLTEIIFGWGRNTVATGLGEKRT
FT                   GMICVGAQSGFCGRKRWEDLHPEVAAALRELAEAHCQQDPTFSSSTAYTRLTAAAAITH
FT                   LRAQGFPPKSVPAKSTMAVVLNRLGYRLRRVLKAKPPKNCRKPMPSLPTSNTKT"
FT   gene            22328..22471
FT                   /locus_tag="AM1_B0031"
FT   CDS             22328..22471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0031"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31757"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLY8"
FT                   /protein_id="ABW31757.1"
FT                   /translation="MRYSTPDSEGAENIAVYVPAFSPIMFIKTDDMLRQQQYFNFKSLY
FT                   LA"
FT   gene            22497..22967
FT                   /locus_tag="AM1_B0032"
FT   CDS             22497..22967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0032"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31758"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLY9"
FT                   /protein_id="ABW31758.1"
FT                   /translation="MEKPAIEHYWQSYCQTLSPDEDLDQPYLVEQFGDSPEMANELGQL
FT                   VLAGTKTATCSALWEWEAEHSPLPTVGLKTIVVDGSETPFCIIETTEVNICPFDQIDAQ
FT                   FAYDEGEDDRTLESWQREHWKYFSRALPKIDKEPTHNMLLVCERFQIVYRTH"
FT   gene            22992..23510
FT                   /locus_tag="AM1_B0033"
FT   CDS             22992..23510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0033"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31759"
FT                   /db_xref="GOA:A8ZLZ0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLZ0"
FT                   /protein_id="ABW31759.1"
FT                   /translation="MKRIQLASESDVLALANLYRQTVLTWGPRYYTPAQVTAWASFTSE
FT                   TDQFRAFILQATTFVARNHTGILGFAGIAEDGHVTSAYVRQDCIHQGIGSALMRNLLEY
FT                   AQSRCIQRLYAEASEFSLGLFKKFGFQLYETEMVERHGVQFQRFLVELKLNDQRRHCRN
FT                   DSGLPHDCG"
FT   gene            23497..23658
FT                   /locus_tag="AM1_B0034"
FT   CDS             23497..23658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31760"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLZ1"
FT                   /protein_id="ABW31760.1"
FT                   /translation="MIVDETAEPEDDPVLAPYRKLVLSNIALSHSWNQPGYLAHPKHYN
FT                   PLISYAIT"
FT   gene            23691..24281
FT                   /locus_tag="AM1_B0035"
FT   CDS             23691..24281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0035"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31761"
FT                   /db_xref="GOA:A8ZLZ2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLZ2"
FT                   /protein_id="ABW31761.1"
FT                   /translation="MARPKRNEHIREQLLDQGLKLFLTQGYHGTGIKEILDQINVPKGS
FT                   FYNYFESKEQFGAEVIRHFTKGVIANMSACLHDPEDDAITALQHFFEQEMHRHEDLKAG
FT                   CMLGNLGAELGGSSQLCQQAMIEGFQGMKQQFSFTLQRGQSQGKIRDDIDIEELADFLV
FT                   NAYEGALLRMQVEQSVQPIQQLSLLLNSYLAKT"
FT   gene            24390..24797
FT                   /locus_tag="AM1_B0036"
FT   CDS             24390..24797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31762"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLZ3"
FT                   /protein_id="ABW31762.1"
FT                   /translation="MKSTLRWNIPNQEFEDGSKISDWKQIESSPWHLQIESGYEMTFGI
FT                   YEHDGQFWKLYQARWVVEGTTEYLYRYGGQACRMTQVEYKSQARSPHSGLLKNVGDLEW
FT                   IRTYEVDAQLHRVIQVGRRDLKYDDHLDLVP"
FT   gene            24893..25516
FT                   /locus_tag="AM1_B0037"
FT   CDS             24893..25516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0037"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31763"
FT                   /db_xref="GOA:A8ZLZ4"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLZ4"
FT                   /protein_id="ABW31763.1"
FT                   /translation="MNLLTLQNVQNFDAYVFSKQPDYHEPTVRQEFAKAVPLRTVVVYC
FT                   YDPRAVGVPAAVAREFDEVYPGEILTDEQGNKIASTTTLFEVIVAGGRAIDALRSITVA
FT                   QHLFGIKNIVIVHHTHCGATSFTADGIVNAFQKEQGNDISTLYEQDSICISDFVTSLQH
FT                   DTRLVRASKGTPHNVDIYGYVYNIDTDELSLVTQDKGAPVQIGA"
FT   gene            25491..25607
FT                   /locus_tag="AM1_B0038"
FT   CDS             25491..25607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31764"
FT                   /db_xref="GOA:A8ZLZ5"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLZ5"
FT                   /protein_id="ABW31764.1"
FT                   /translation="MHLSRLEPKTMTKADREVAVITAIGLGFAIIAQILLII"
FT   gene            25638..26090
FT                   /locus_tag="AM1_B0039"
FT   CDS             25638..26090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31765"
FT                   /db_xref="GOA:A8ZLZ6"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLZ6"
FT                   /protein_id="ABW31765.1"
FT                   /translation="MRTEKRLEISLAIIRISTAIFLLVWSTGKLLAPALTQNIFSKFYF
FT                   SEISLVMSYAVGVLQTILVLLFLVGLYKTFSYGVVLGMHSVSVLSTYEKLFNPYYPPNI
FT                   LFWAGVPVLAGLVALFLLRDHDHWLTLQWRAFTSSNSIKSHPHSLH"
FT   gene            26188..26925
FT                   /locus_tag="AM1_B0040"
FT   CDS             26188..26925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0040"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31766"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLZ7"
FT                   /protein_id="ABW31766.1"
FT                   /translation="MAKPICLVTGVGDGTGTAIVRRFVEGGYRVAMIARNRDRLRQLEQ
FT                   DMTDVKAYVCNVGDLDALLVTLNSIRREVGSPSVLIHNAVRATFGTFLEVHPEELERNF
FT                   RVNTTSLLYLARELVPNMMEKGKGTIIITGNTAAHRGIPSYALFAPTKAAQRILAQALA
FT                   RDLGPKGIHVAYITVDAVIDTPWSTNLPVQGLATEPLNQHSSQSKDFFCQPVDIAEEVF
FT                   HVAHQSSSAWSFDVEIRPFAEKW"
FT   gene            27424..28518
FT                   /locus_tag="AM1_B0041"
FT   CDS             27424..28518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0041"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31767"
FT                   /db_xref="GOA:A8ZLZ8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLZ8"
FT                   /protein_id="ABW31767.1"
FT                   /translation="MPQVSDAIVRPMRDDERQNVHALMRRAFPLLDQWAFSWTPYVLVA
FT                   EQGGQLQGAIVLKLFALPRNRQAGSIAWVFTAPEARGKGFGQRLVESGIDFFEKQGCDQ
FT                   ILTTVEGFNTSSSKLFATRGFKILPPEDQFRRYGLATLVVWAKLSHYFDLGHFLWARPV
FT                   APAVDSPSLQWWSTITANSLIGLLMLWRASGFRAFHPEMWLVLPGIFLVLFGLRHLGMW
FT                   LTAHRQGLTVRFRTWESGFLLSTAISLLFPGAVFPIPGSLYPITHQWRYRDLLPQLGWM
FT                   AVAGTLPVLILVWGVWVLGELNEPLPYVRAWLEAVLLVGKPLVLFDIAMPFFPFVSFNG
FT                   RQLWDWNKTVWGILAMATITIFLV"
FT   gene            28601..28729
FT                   /locus_tag="AM1_B0042"
FT   CDS             28601..28729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31768"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLZ9"
FT                   /protein_id="ABW31768.1"
FT                   /translation="MKQESPAISEGLEGERQVSWKFTQGFIVCEDHGLFTDGDGFL"
FT   gene            complement(28769..29176)
FT                   /locus_tag="AM1_B0043"
FT   CDS             complement(28769..29176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0043"
FT                   /product="endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31769"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM00"
FT                   /protein_id="ABW31769.1"
FT                   /translation="MAPSLTYLNPASLPDASAFGYSQITIMEPGRLAFISGQVAWQSSG
FT                   EAVPDSLTGQAELVVKNAKAALDAVGASSEDIVMVRIYMVDLTPDRIEELMPHLLAMFD
FT                   GAKPSLTGVGVAALAGPELQLEIEMIARLPS"
FT   gene            29499..29756
FT                   /locus_tag="AM1_B0044"
FT   CDS             29499..29756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31770"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM01"
FT                   /protein_id="ABW31770.1"
FT                   /translation="MMRLKLVPLFLMMALATVLGACEKANQDVPAPPVNQGDTPQGGAE
FT                   LNQSEDESAPSIQEEAPAPEAPLTPDGEETSPENSDEQSP"
FT   gene            complement(29776..29895)
FT                   /locus_tag="AM1_B0045"
FT   CDS             complement(29776..29895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31771"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM02"
FT                   /protein_id="ABW31771.1"
FT                   /translation="MGVMTCVIFSSQSGLKIMDDFSQNALENQASSHTNAMSV"
FT   gene            30015..30149
FT                   /locus_tag="AM1_B0046"
FT   CDS             30015..30149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31772"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM03"
FT                   /protein_id="ABW31772.1"
FT                   /translation="MKRFKAQFPIQLVSTVIGLSSLLASLPVAARTPSSVINFDGVDT"
FT   gene            30204..30623
FT                   /locus_tag="AM1_B0047"
FT   CDS             30204..30623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31773"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM04"
FT                   /protein_id="ABW31773.1"
FT                   /translation="MKILCKNFSLNSRCSGTSQSDTTPSSEEAPDVEGAADTPESVESE
FT                   NLEPEDSTAPDMASSDTEPEEAPVDSSTTDDMDESTEGGAEQPDGTMGSPEEGTNSPDT
FT                   MPPDNTIPNEPTAPDDTQGPPVTPPMVPVPEGGTE"
FT   gene            30670..31224
FT                   /locus_tag="AM1_B0049"
FT   CDS             30670..31224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31775"
FT                   /db_xref="GOA:A8ZM05"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM05"
FT                   /protein_id="ABW31775.1"
FT                   /translation="MSNSPYPSNSDPSFHEPSLESSNATRYTELGRTVQAIRVENTRLN
FT                   SDVQQLRGRTSSLIGLLIGLILLTIGGFAWLAISLQNLEKEEQQRANGIDPALASQVEQ
FT                   LEKQVNDLRKFIPGNLSDTLQSNQTTLAQLQTQLQQVTTQIKTLERSASNSQPQSNTPP
FT                   QTAPPSNQQSSESPQLNNNQE"
FT   gene            complement(31175..31312)
FT                   /locus_tag="AM1_B0048"
FT   CDS             complement(31175..31312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31774"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM06"
FT                   /protein_id="ABW31774.1"
FT                   /translation="MSLNRKDQAAIIGILEPISSVLNHLALKSSIPDYCSVVEIPRIVD
FT                   "
FT   gene            31467..32441
FT                   /locus_tag="AM1_B0050"
FT   CDS             31467..32441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0050"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31776"
FT                   /db_xref="GOA:A8ZM07"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM07"
FT                   /protein_id="ABW31776.1"
FT                   /translation="MVAIHIDHLYKSFTFSRGWGKHRKQTNVVAVDRISLNIPCGQAIA
FT                   FIGPNGAGKSTTIKMLTGILHPTAGKAMVLGYVPWKDRQSLARRIGVVFGQRSQLWYHL
FT                   PPRDTLELLARIYDLEPKVFRQRRDSLVERFGLNEFWSTPVRKLSLGQRMRAEVAASLL
FT                   HAPQILFLDEPTIGLDVLARQKLRNLICEWNQQEGTTVFLTSHDTGDIERVAQRIIVIN
FT                   HGQVMLDAPVSELRRRYLNEKILSVKFHTPIYEFPTLQGVRQLEVMDFGLKLEINTRLI
FT                   PIEQVISQILQIGSVADVAIEDPPLDAVIAHIYNQPASEGLSL"
FT   gene            complement(32617..33333)
FT                   /locus_tag="AM1_B0051"
FT   CDS             complement(32617..33333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31777"
FT                   /db_xref="GOA:A8ZM08"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM08"
FT                   /protein_id="ABW31777.1"
FT                   /translation="MRGYSQCAKSLYHNVKSQVVRSITQVIEASKKHWVSEIECSRNIF
FT                   WEGKWQRVDGVAQQLKADHPESFRHKRVRCRNGKTREIWAFSKTVRLRKYGRKRLVIVH
FT                   ETEDLSDSPRFLLTDALHWDASRVFATWSYRWPCEIFHEFSKQLVGFESAQLRKEEAVK
FT                   RHFCLSCVAQSILQDTSCSGRKSERLKFAQNDEPTVGQKLYSLTRESVQQLVEFVHVLF
FT                   NQGQSVEQVMECIMPG"
FT   gene            33295..34404
FT                   /locus_tag="AM1_B0052"
FT   CDS             33295..34404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31778"
FT                   /db_xref="GOA:A8ZM09"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM09"
FT                   /protein_id="ABW31778.1"
FT                   /translation="MVERFGTLGVSPHLSSTPMIKIDFTAEEIQQLNYERYHHPHPRVQ
FT                   RRMEVLYLKSQGLSHTQICQLCQISRPTLAKTLRQYQQGGIEGLKTLEYKGQPSLLNAH
FT                   SDSVRAYFEQHPPRTSAEAQAVIEQLTGIKRSPTQIKAFLKRIGCRYRKVGYVPGKSSL
FT                   PEKIEEQEQFRHTRLEPLLEEAQRQERLVFFVDAAHFVHRAYLGFVWCITRIFIPSPSG
FT                   RQRFNVLGALDAITKDLVSVTNHTYINSHSMCLLLAKLALLDPVIPISVILDNARYQKC
FT                   QLVTDFAEIVDIELVYLPSYSPHLNLIERLWRFVRKECLYSKYYADFPAFKGAIQQCID
FT                   QCNGEHKAKLTTLLSLKFQSFKKVNILAA"
FT   gene            34478..35788
FT                   /locus_tag="AM1_B0054"
FT   CDS             34478..35788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0054"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31780"
FT                   /db_xref="GOA:A8ZM10"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM10"
FT                   /protein_id="ABW31780.1"
FT                   /translation="MSASRSPEPTIGFVDEYCQLFAELFPQVRSYEAFKHLHLGMISDI
FT                   KRKSLPAIARAVGLENHQSLHHFLSESPWVASHLSDKRLDIILKILDGRRLILLIDETG
FT                   DCKKGKSTDYVKRQYIGNVGKKENGIVAVTAYGLFQGMILPLSFEVYKPRERLKEEDEY
FT                   LSKPQIAAGMIRQLQGMGFCFELVLADSLYGEAQTNFVNVLEELKLPYILAIRSNHAVW
FT                   LPAEQAVFAEPWQSFERTFSNGTTETRYRQEIIYGQRHHQKRYWLLTTDPQTLPENSTS
FT                   YVMAAAPEIKLDEIGDCYGFRTWIEYGLKQSKDTLGWADFRMTHYEQIEKWWEIVMSAF
FT                   LMVSLFADVFNDSCPVAHQHFAQHPWWDNQNGWKNLLNNVRLIIQPLISWNLLKRWLEV
FT                   FPSRALKKGFEQLTSKMEAFCCPLVRKLLKHPDFLSV"
FT   gene            complement(35760..36452)
FT                   /locus_tag="AM1_B0053"
FT   CDS             complement(35760..36452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31779"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM11"
FT                   /protein_id="ABW31779.1"
FT                   /translation="MRSVFCRDDGFAHISRYLNGLLLSPNKTLQGIYSQLVWPEGEQVS
FT                   YRAMHEAIFEAGWHHQELMAHHRNVLGPKHRGRGREVISLDWTYSHHPYSQEIFGDKAA
FT                   YDHVNRCWSCYQTVVTAVAANPERLDGIAVEVQQPNYQLEELAYLRMTRRETYESMEQV
FT                   HQRLLELLHYQKNRLRYRKRTELAVDIVRQLEAERNFPDADYAFDQGVLTLELSLFYHF
FT                   RQRENQDA"
FT   gene            36412..36555
FT                   /locus_tag="AM1_B0055"
FT   CDS             36412..36555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31781"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM12"
FT                   /protein_id="ABW31781.1"
FT                   /translation="MWANPSSRQKTLRKDANDLAMVGAIPTRGSIGFEGIRQLPQFDQV
FT                   SA"
FT   gene            36567..37238
FT                   /locus_tag="AM1_B0056"
FT   CDS             36567..37238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0056"
FT                   /product="ABC transporter permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31782"
FT                   /db_xref="GOA:A8ZM13"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM13"
FT                   /protein_id="ABW31782.1"
FT                   /translation="MRVTYSEVQAQQLGGFTLPQMLWYLSVTESLAISAPRIAQDVDQD
FT                   VRTGALTVQLVRPISYPMYRLWSSMGERCVRFGFNFAVSAVLALFFVGAIPMSIGGCLL
FT                   FLLVLPIAFILDFLVMFLIGLGAFWLEDTSGLVLIYSRLLWLLGGLMIPLELFPEFWQG
FT                   ILHNLPFALVIYAPARLFVHPSISDTLALLMRQGVALLMLTLCVQWVYGLAIQRIHANG
FT                   G"
FT   gene            37243..37779
FT                   /locus_tag="AM1_B0057"
FT   CDS             37243..37779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31783"
FT                   /db_xref="GOA:A8ZM14"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM14"
FT                   /protein_id="ABW31783.1"
FT                   /translation="MKALLNYLNLAIAYVRLNWNAHMEYRGAFVSQLLAMLLNNLMWVA
FT                   FWGLFFTRFPVLRGWTVQDVVTLWAIAAAGFGLAHAIYGNALQLAKLIAQGQLDVWMLY
FT                   PRMLLPHLLLGQMNATSWGDLLFGYGVYLGFVHPDIVHFVWFIGLTTSVAALFVGFSVL
FT                   TGSLSFLHGQCLGAE"
FT   gene            37790..38038
FT                   /locus_tag="AM1_B0058"
FT   CDS             37790..38038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31784"
FT                   /db_xref="GOA:A8ZM15"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM15"
FT                   /protein_id="ABW31784.1"
FT                   /translation="MAMLTFSTYPGTLFDGAIKLLLYSFIPAGFVTYLPVEALRSLSWV
FT                   HAIGSVMGSVTILGIGIGVFYHGLRRYESGNLINMRG"
FT   gene            38078..38911
FT                   /locus_tag="AM1_B0059"
FT   CDS             38078..38911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0059"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31785"
FT                   /db_xref="GOA:A8ZM16"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM16"
FT                   /protein_id="ABW31785.1"
FT                   /translation="MDMTETFQLKIGSAQLAGEYSGHGKPLIFLHAGVADRRMWCPQID
FT                   TLKNYFQTVIYDRRGFGKTTCLDEAFSHVNDLRQVIEQLGLTDVVLIGCSQGGRIALDF
FT                   ALAYPHQVTALVLIAPAVSGAPEPITFPQNIQARINALDEADEANDLELVNTIETDLWL
FT                   DGPTSPSGRVDDSLRKLLLDMNGIALRKPELTLEQEPTSAYEKLPNLSIPTLVVWGNLD
FT                   FPHVSERCHYLVNTIPTAIGEEMPNTAHLLNLEEPEYLNNLLQAFLSSSNELKNT"
FT   gene            38960..39508
FT                   /locus_tag="AM1_B0060"
FT   CDS             38960..39508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0060"
FT                   /product="acetyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31786"
FT                   /db_xref="GOA:A8ZM17"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM17"
FT                   /protein_id="ABW31786.1"
FT                   /translation="MHTFLETERLALRQFTLEDVDCLVELNSDPDVVRFATIDKQVDPA
FT                   SIQTQILPKWLQHYEDYEGYGFWAAIEKSSQTFIGWFLFRPAVHAPYFDPALAEPTDIE
FT                   LGYRLRKDSWGHGYATEGSKALIQKGFSELGAKRILAVVFSVNVASIRVLEKSGLHLDM
FT                   QFIDKHTGQEVVLYALNHC"
FT   gene            39660..40262
FT                   /locus_tag="AM1_B0061"
FT   CDS             39660..40262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0061"
FT                   /product="glucan synthesis regulatory protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31787"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM18"
FT                   /protein_id="ABW31787.1"
FT                   /translation="MIAESWERIIEWGNRNAPEMLKDLNPGASEEQIAAVEAELGQPIP
FT                   ADFRASLLIHNGESDGWPCKVFADYGAYLGTESILESWKQRKQVAAEVENYADEMPDPE
FT                   QQIRDGIIFVEGPVRPKLFLPEWIPIMDCNGDVFWALDMNPEEGGVSGQVIAVDWEGCS
FT                   WKVIADSFRSFIRDYAQELENGAYRVVDEQPTKEDNQ"
FT   gene            complement(40306..41457)
FT                   /locus_tag="AM1_B0062"
FT   CDS             complement(40306..41457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0062"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31788"
FT                   /db_xref="GOA:A8ZM19"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM19"
FT                   /protein_id="ABW31788.1"
FT                   /translation="MLDIQQAPSKPPQTTGWLALAEALGPQLAESEQAADISDQYVLEN
FT                   IKRLKEAGFTAAGVPTQLGGGGASHAEMCNVLRILGQHCSSTALALSMHTHQVMIPTWK
FT                   WQHQQMAVEGLLTRVAQEKIMLLSTGGADWLNGSGTATPSEGGFIINSRKGFVSGSPTG
FT                   DLLITSAIYDDPTAGKTVLHFALPMKSPGVSIDSVWQAMGMRGTGSHTVLLEDVFVSEQ
FT                   AISLRRPAGKWHPAFHLITLIAIPIIYSVYVGIAEAARDLTIQNAQKRRDDDHVCYLVG
FT                   GLENELTNAKLVQQQMIAIAASQSPSIETTNQIMTGRTLITQSVLKVVDAAMEITGGLA
FT                   FHRPYGLEKLFRDAQGARYHPMREEVQRKLAGQLALGNTPEIL"
FT   gene            41577..42299
FT                   /locus_tag="AM1_B0063"
FT   CDS             41577..42299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0063"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31789"
FT                   /db_xref="GOA:A8ZM20"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM20"
FT                   /protein_id="ABW31789.1"
FT                   /translation="MGKSYGQYCPVARAAEAICERWTPLVLRELMSGSCHFNEISRGVP
FT                   LMSRALLIKRLKELETAGIITRQDKKSGQGSIYQLTPAGEALRPIIKGMGEWAQQWGSD
FT                   RLTPEQLDPDLFMWGLRRGFNLEAMPDHKIVLQFDLRGIPRQRKTKRSYWVVTEKHRVD
FT                   VCIQDPGFDVDVLIAADLSAIIHVVMGYDPLDLALRAKTIQFEGNQDWVGQLPTWLFLN
FT                   GERRYLSGLATATIGTML"
FT   gene            42496..43740
FT                   /locus_tag="AM1_B0064"
FT   CDS             42496..43740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0064"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31790"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM21"
FT                   /protein_id="ABW31790.1"
FT                   /translation="MDNSIRIPLNLPDIRILELSKTERGDWLIKIESTLQGTTCHQCGR
FT                   EITDLHCHDQPFRIRHLPLFEVPVYLEIRPKRYRCKYCDDHPTTTQHLEWHEPRSPNTK
FT                   AYERWLLRILINSTVSDVARKLGVSEDIVSGIIDRWIAAQVDWSEYADLKVMGMDEISL
FT                   KRGHRDFVVLITIPTTDGVDILAVLADRKQQTVANFLQSIPIDLRQTIERVCTDMYQGF
FT                   VSAVREQLPQAKIVIDRFHVTKAYRNCADTVRKREVKRLRRELSKQEYDSIKGAMWPFR
FT                   KRPENLKESEQQLLERLFAYSPQLKQAYNLREKLTQIFEGRYTKHGAKCAIRAWCKQVL
FT                   KSDIKEFDCFLTTINNWMDEMTNYFLEGWTSGFVEGFNNRVKVLKRRCYGIFDIERLFQ
FT                   RISLDLNGYQTFAVT"
FT   gene            complement(43765..44835)
FT                   /locus_tag="AM1_B0065"
FT   CDS             complement(43765..44835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0065"
FT                   /product="acetyltransferase, gnat family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31791"
FT                   /db_xref="GOA:A8ZM22"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM22"
FT                   /protein_id="ABW31791.1"
FT                   /translation="MTNSLTLREAKPEEAIQLSGLAMRSKSYWGYSDDFMEACRDELTV
FT                   TSEMIQDSKFHYVVAEMANEVVGFYGVERLSSLQFELEALFVDPVHIGSGIGRALITHA
FT                   RDFIGESGGRSLIIQGDPNAEEFYLAVGAQLIGEKESDSIPGRFLPIFRMEIAESKDTR
FT                   TVSLESETLEFRQRPKSAKTFVGEPINTEHLQIRPFTRGDIEPFTRFMTDQESTRFLTF
FT                   GDEQKSSQGARDLLEATITSYGTEHPMLAFAVEAPKTSTFIGFCGLTPHDEETIEIMYA
FT                   IMPDARRKGYATEVAAVLSQYALNKLGYLRVIAPIAPANEVSKIVATKVGFKDNGLVTD
FT                   VNSGELVHQFIWLSGN"
FT   gene            complement(45023..45136)
FT                   /locus_tag="AM1_B0066"
FT   CDS             complement(45023..45136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31792"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM23"
FT                   /protein_id="ABW31792.1"
FT                   /translation="MNNTRDEGKSIIHLPPWLVVHQLIGRLHSPILWRNYE"
FT   gene            complement(45182..46360)
FT                   /locus_tag="AM1_B0067"
FT   CDS             complement(45182..46360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31793"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM24"
FT                   /protein_id="ABW31793.1"
FT                   /translation="MQISKRASFLLRLLAITLLAVVLDSRLTTKNMSQPHPEQRSFYQG
FT                   FIYQPYDWSDEAFEETFRVIGENSDIIGFYFDGFVPWNEAAAKKPYHPVQEQEIQKRIN
FT                   GIKPHQKIFLGTSLLGSDRVSLSGYLGEYEVPRTGKWKDKTFDDPEVIAAYLHWCRDLI
FT                   TRFQPDYFMYVAEVDSGLVNVDDPRFQSLLRSVKQIYPVLKREFPSLPILIEFVLENDE
FT                   QMSKRAEVTQSLLPYTDMYAVSTFPFIMTGGNPADIPKDWFSRAKEIAPDIPFAVVETN
FT                   FLAEDFYHPTQGIPIPFRKKRLLIPAREKWQAAYIEFLLSEAHRLEAEFVLYWGYRDLD
FT                   QLQAKLDGTGGAFDSNIHGFASLSKDCGLIDEKGRHRPSFNVWQRWLSLPRS"
FT   gene            46598..47008
FT                   /locus_tag="AM1_B0068"
FT   CDS             46598..47008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0068"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /EC_number="1.13.11.39"
FT                   /EC_number="1.13.11.27"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31794"
FT                   /db_xref="GOA:A8ZM25"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM25"
FT                   /protein_id="ABW31794.1"
FT                   /translation="MQLNPYLFFNGQCQSAFQFYEQCLGGKVETIMPYEGSPMEDQVPP
FT                   EWRNKVMHAELTVNNRVLMGSDGMPGEYEVPKGFSVSLNMDDPAKAEQIFQALAENGTV
FT                   SMPIQETFWAIRFGMVTDQFSIPWLINCDKPA"
FT   gene            47053..47565
FT                   /locus_tag="AM1_B0069"
FT   CDS             47053..47565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0069"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31795"
FT                   /db_xref="InterPro:IPR011473"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM26"
FT                   /protein_id="ABW31795.1"
FT                   /translation="METTTPQQELTINHEPQKEHQWLQQLVGEWTYESDAKMGPDHPSE
FT                   KSTGTETVSTIGNFWVQCEGQGEMCGGPGTTIMTLGFDVQNQKFVGTWIGSMMAYLWQY
FT                   DGELNDTGKVLTLSSRGPSMAGDGTIGQYKDVIELKSDDHRIMTSHALGDNGQWYQFMT
FT                   TLYHRSK"
FT   gene            47523..47936
FT                   /locus_tag="AM1_B0070"
FT   CDS             47523..47936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0070"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31796"
FT                   /db_xref="GOA:A8ZM27"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM27"
FT                   /protein_id="ABW31796.1"
FT                   /translation="MVSVHDHTLSPEQMRNRTMNKHEKINYVEFPAKDMEATKEFFSTV
FT                   FGWSFIDYGPEYTAFSNEGIDGGFFKSNLTATTDKGSALIIFYSESLTKTQSKIEHSRG
FT                   SITKPIFSFPGGRRFHFSDPNGNEFAVWSDVDT"
FT   gene            48023..48175
FT                   /locus_tag="AM1_B0071"
FT   CDS             48023..48175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31797"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM28"
FT                   /protein_id="ABW31797.1"
FT                   /translation="MTFSRFLITQLSQPSPGDRQDELAFPKAGLFPKLAMKNKSRRVAN
FT                   GQYAV"
FT   gene            48400..49860
FT                   /locus_tag="AM1_B0072"
FT   CDS             48400..49860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31798"
FT                   /db_xref="GOA:A8ZM29"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM29"
FT                   /protein_id="ABW31798.1"
FT                   /translation="MNIKRWWWISSGTSILFIALIGLMWFRIDSSYQPNLEQLANEADI
FT                   IPHLKRRGISLNKSEAIPTGVFLQSLKFNNATEVNVTGYIWQIYDKSIFAKVPKDQDVP
FT                   VGFILPEAVDSGNNLDPQQAYRRSISDTEEVIGWYFESTLKQRFNYKKYPLDHKTVWIR
FT                   IWGKDFARSNMLVPDLNAYKSTQAGDTFGLDDSIVLGEWEVEETFFDFKTPQYDMDFGL
FT                   ETPLPQTPELYFNVVLKREFLGAFIVNLVPLLISAILLFATLLTITVKEGQADIFGFST
FT                   SEVLGVCSALFFVVLLSHIQIRQEIPGSDIIYIEYFYLAMYVALLGVAVDSYLFTHDSY
FT                   SSQFKFISYEDNIFPKLIFWPTLLGTSAFYSFLILKPFQPYKSNFLQPQTTHILLPSDR
FT                   PLVQREIFNTPPLEFAHTVRKSLPVTTLVNPPNGQSYHQFSSTSRTEQSHLTFLAQSSS
FT                   LQVTDLGASRHRIPGGARPSGWRSRSYS"
FT   gene            complement(50302..50766)
FT                   /locus_tag="AM1_B0073"
FT   CDS             complement(50302..50766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31799"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM30"
FT                   /protein_id="ABW31799.1"
FT                   /translation="MLYSASYFEPQNHHGLLVSISRSHPRSFQVDTKLPFLAPSQTLLD
FT                   DWKHQQLTEAGYIDRYRQELQQAWPQVNSWLASLTPEGDCTLLCWEKAGEFCHRNLAMK
FT                   VVRKHRPDCYGGRDISADLGLKCPNCQALIIPGIDQSYCPDCREWITTPI"
FT   gene            complement(50766..51143)
FT                   /locus_tag="AM1_B0074"
FT   CDS             complement(50766..51143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31800"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM31"
FT                   /protein_id="ABW31800.1"
FT                   /translation="MQTETKIPTRIKLRDWNVQKKAGAYVLKTPLMTHCWGCKQYRLAI
FT                   SAMPTGNHHQTQFKWFCQKRARNLGIQPSQELLKKLPTMNTLQSRYRKTQISQLQNVGW
FT                   TGDDLEECLQAAIENRSKAVF"
FT   gene            complement(51377..51910)
FT                   /locus_tag="AM1_B0075"
FT   CDS             complement(51377..51910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0075"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31801"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM32"
FT                   /protein_id="ABW31801.1"
FT                   /translation="MTVSVPPPTLTSESQRLSQPSFNRPLGLGQSPSGLAIFCNRANTK
FT                   TWYTLDVNTQPQELEYPALTGYLVRIEFPPKEYRGEKSHKLRFKIQADRLYTLEAGYRS
FT                   VFAKGFLSEIAMLTPEQLRQPIIVEATPSDQEEKVLFCSVWLGSEKVYYRWDDQTNWKS
FT                   IAQRAMANVAGING"
FT   gene            52167..52343
FT                   /locus_tag="AM1_B0076"
FT   CDS             52167..52343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31802"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM33"
FT                   /protein_id="ABW31802.1"
FT                   /translation="MQINHLERAAIPGQDLSNVDFHGIASGHHEKGPLVGDTRGLNNKD
FT                   KKSKRRFWGRGYF"
FT   gene            complement(52613..52852)
FT                   /locus_tag="AM1_B0077"
FT   CDS             complement(52613..52852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31803"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM34"
FT                   /protein_id="ABW31803.1"
FT                   /translation="MSFSEAGPMPPEITYAFVWVEDQIRVDAAVECGRRFKGIAWILDP
FT                   NSQNPSLRLDNPLGIRAVQAILDRTKIGFAAPTA"
FT   gene            complement(52905..53087)
FT                   /locus_tag="AM1_B0078"
FT   CDS             complement(52905..53087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31804"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM35"
FT                   /protein_id="ABW31804.1"
FT                   /translation="MLNDPLTHAWQPWTDAEMSERNKAVSGNWILAFFQDGYSHDTIDS
FT                   GDSKDCVPDTHPEDN"
FT   gene            53364..53780
FT                   /locus_tag="AM1_B0079"
FT   CDS             53364..53780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31805"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM36"
FT                   /protein_id="ABW31805.1"
FT                   /translation="MNKDMPLDNLGQMSVNDLSECVEAGLNAGAYAIAQAGLALREIQR
FT                   RGEYPTTFEAFVKDKFALTRARAYQLMYAADIIADLASVFESNKLPRSESAVRPMIGLT
FT                   KQQRIEVWRRALKGKQRSPGYGTVKAIVEQMQAS"
FT   gene            53853..54932
FT                   /locus_tag="AM1_B0080"
FT   CDS             53853..54932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31806"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM37"
FT                   /protein_id="ABW31806.1"
FT                   /translation="MVFTMPNQTSLFSESNYADFLDGLKQRIRTAQVQAHLAVNQELVL
FT                   LYWQIGREILQRQKLEGWGSKVVERLAKDLKREFPDMRGFSRSNLMYMRAEAWPEEQIV
FT                   QEVLGQFPWYHNIALLEKLKSREQRLWYTHEIVNNGWSRNVLVHQIESNLYERKGSAIS
FT                   NFERTLPHPQSDLAQQIIKSPYNFDFLTISNDAHERELERSLIVHIRDFHMELGLGFSF
FT                   MGSQYPLVVSNKEYRLDLLFYHVHLHCYVIIDLKMGEFIPEYPGKMGFYIAAVDNMLRS
FT                   DRDDPTIGIILCKSKEKTIVEFALQGNQQPIGVSTYQIQSQLPENFQDKLPTIEQLEME
FT                   ISSVVEDIEDNDNSTRPNS"
FT   gene            55380..55496
FT                   /locus_tag="AM1_B0081"
FT   CDS             55380..55496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31807"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM38"
FT                   /protein_id="ABW31807.1"
FT                   /translation="MSQLETDNLPIDETDILPEIDELDDVDLDDMLKDLQQD"
FT   gene            55532..56002
FT                   /locus_tag="AM1_B0082"
FT   CDS             55532..56002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31808"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM39"
FT                   /protein_id="ABW31808.1"
FT                   /translation="MDPNNLAVWKNVEARLGTPFRKNMVDLVLEMARDRTTDPHQIATW
FT                   MVTTSTYICSAIFGTNDPMPLLFLYVRALDTQYPDTMQEIYEIFSNEGLEKYAPSSLKR
FT                   GDLTSILWAAGSTFANGELKLIDDEIHINPKGLQRLRSIWQAPSRQTNNRQS"
FT   gene            56111..56539
FT                   /locus_tag="AM1_B0083"
FT   CDS             56111..56539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31809"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM40"
FT                   /protein_id="ABW31809.1"
FT                   /translation="MSQQSESPQWQPIRVMHECIPMVDGMLEEVQSQHSNMLEAQKKPH
FT                   TMDDATIQRVIDVYSEQHEFLWVYREQFSRWKQESPSPQQLKDIIRLEQQVEKIAQALT
FT                   GILNIVDDIKDKTIESILGKSDMELAMDVLMGNLKMPE"
FT   gene            56586..56828
FT                   /locus_tag="AM1_B0084"
FT   CDS             56586..56828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31810"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM41"
FT                   /protein_id="ABW31810.1"
FT                   /translation="MPSTQEPVRGIPLKEKPEGISRCGMSHATIAQNIFTSRWYEISAN
FT                   GQVIGSALDLDFYKQDATQGQNSGSTVKTKELSKV"
FT   gene            57003..57380
FT                   /locus_tag="AM1_B0085"
FT   CDS             57003..57380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31811"
FT                   /db_xref="GOA:A8ZM42"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM42"
FT                   /protein_id="ABW31811.1"
FT                   /translation="MPRKKKQTKPLTGKDLVAKVKQLSDYTREEKAKACGYISADKDGS
FT                   ERIKTIAFLNALLDAEGIDLDSQSPNGNGNSGRKASYKVSVQSNGNILVGRTYTQALEL
FT                   EPGDEFEIAVGRKHIHLTKVA"
FT   gene            57583..57858
FT                   /gene="hup"
FT                   /locus_tag="AM1_B0086"
FT   CDS             57583..57858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hup"
FT                   /locus_tag="AM1_B0086"
FT                   /product="DNA-binding protein HU"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31812"
FT                   /db_xref="GOA:A8ZM43"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM43"
FT                   /protein_id="ABW31812.1"
FT                   /translation="MNKGELVDSIAEKSGATKKQADAILSAVTETIIDSVSSGEKVTLV
FT                   GFGSFEARDRKARNGRNPQTGKKLTIPATKAPVFSAGKVFKEQVKD"
FT   gene            58034..58840
FT                   /gene="rpoD"
FT                   /locus_tag="AM1_B0087"
FT   CDS             58034..58840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="AM1_B0087"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31813"
FT                   /db_xref="GOA:A8ZM44"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM44"
FT                   /protein_id="ABW31813.1"
FT                   /translation="MATNYDSLHYYLQEMGRYPLLSHEEEIELARQAKAGSLRAKQRMI
FT                   ECNLRLVVSIAKKHQNRGLPLLDLIQEGSIGLSTAVDKFEIAQGCRFSTYAYWWIRQGI
FT                   TAALRAKSRPIYLPQYQWEMINKIKKHYRELNQKLGREPSLSELSESTEIKPKTINLTL
FT                   QLFQKISSLDQPVGPEQKDSLLDLLPGDNQPTLYMESLQRDEQLFHVMAHLDERERLVL
FT                   SQRYGLEDDQPKSMREIGEQIGLSHEGIRLILKKIMKKLERYAESA"
FT   gene            complement(59202..59351)
FT                   /locus_tag="AM1_B0088"
FT   CDS             complement(59202..59351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31814"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM45"
FT                   /protein_id="ABW31814.1"
FT                   /translation="MIELLNQSFWRVSQAGVKALDKKMAYKPEHNSLYKELPILKAREY
FT                   SQSN"
FT   gene            59351..59674
FT                   /locus_tag="AM1_B0089"
FT   CDS             59351..59674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0089"
FT                   /product="anti-sigma factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31815"
FT                   /db_xref="GOA:A8ZM46"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM46"
FT                   /protein_id="ABW31815.1"
FT                   /translation="MSYKIIQPTEFMDDSSANQIRYEISKAMANGVKTILVDLQEVAFI
FT                   NSSAIGALVATHKVVYEKGGTLSLCSLNEQVKIFFALTKMDHIFDIFIDRHEFMQKNGS
FT                   ATN"
FT   gene            complement(60010..60360)
FT                   /locus_tag="AM1_B0090"
FT   CDS             complement(60010..60360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31816"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM47"
FT                   /protein_id="ABW31816.1"
FT                   /translation="MLTIEDITGFFVENASYKSGQTPQEDTQNIPIIESWIDVEKDGIA
FT                   VIRGKLYGHPQHPLGVSMTTSTIQRYFGGAGHVYVKTRNSLYELGQPLKELELPDETSD
FT                   FQALAKKTIWHC"
FT   gene            complement(60502..61107)
FT                   /locus_tag="AM1_B0091"
FT   CDS             complement(60502..61107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31817"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM48"
FT                   /protein_id="ABW31817.1"
FT                   /translation="MASIFISEELEARGFLHDRSSSLEIQGESFVPGPSFHKSWRQTAI
FT                   EFCEEACTKGVKYILVEFPTYLMTWRCRQAALPTQAQSLHSSKSEEKLSTSLESLKVTP
FT                   ATQKPPQKRVPSTPPEMATQQALELANDDEEFISQCKQELAIHIGPMADFMIKQTLNQS
FT                   SEMSHQELIEALAIHIADHNAALSFRRACYSFNGIHLL"
FT   gene            61439..61618
FT                   /locus_tag="AM1_B0092"
FT   CDS             61439..61618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31818"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM49"
FT                   /protein_id="ABW31818.1"
FT                   /translation="MTNFTLQTSDLSPEIAALKMQLAISLQFHHRKTIERLPLEAAMQV
FT                   MAEVWDACDHQRSS"
FT   gene            61624..61830
FT                   /locus_tag="AM1_B0093"
FT   CDS             61624..61830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31819"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM50"
FT                   /protein_id="ABW31819.1"
FT                   /translation="MKPTQAFYNGTPIAPPSNHPTIEQNMELLDWHPIFTGRCPNCERP
FT                   IRKTTPPRSHWDCGSCGWRDDSD"
FT   gene            61913..62947
FT                   /locus_tag="AM1_B0094"
FT   CDS             61913..62947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0094"
FT                   /product="WD40-like Beta Propeller, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31820"
FT                   /db_xref="GOA:A8ZM51"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM51"
FT                   /protein_id="ABW31820.1"
FT                   /translation="MQPDSYPLIALKILLCIGLCTACTRTNSEDFVIAFTGEQDKNNRD
FT                   IFLMTADGSNRKRLTTHPGEDWSPVWSPDGTRLAFISDRNGQSDLYLINLDGSQLTRLT
FT                   SHAARDEDPAWSPDSQHITFVSKRDANQQHPYNTEIYLLNIKDSEIKRLTEHVGEDSSP
FT                   SWSPDGQQIVFSRKIQDNADLFLMTPEGTEFKQLTDDPNDDWNADWSPDGQQIVFTSGR
FT                   SNNVDLYVINADGSNLKRLTQDPEDENQGRWSPSGHRIAYISLSQNQWDLYTILPNGTG
FT                   RTRVTNDDALELAFDWLPNSNKILFESKDGIYQANVIGSKKQQMTDNPKDGSPTWKPLS
FT                   KAFK"
FT   gene            complement(63061..63762)
FT                   /locus_tag="AM1_B0095"
FT   CDS             complement(63061..63762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0095"
FT                   /product="pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31821"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM52"
FT                   /protein_id="ABW31821.1"
FT                   /translation="MANQEQIALLSQGVEVWNEWRKENLKVSINLSKASLTGMDLHGAN
FT                   LHKAIMIGANLTGANLNQASLCEASLWKANLRGAILSKANLKEANLIEADLCRASLWKA
FT                   NLYNVNLYKADLRGANLCRAYLYKANLSETDLSQASLCEVYLCEANLYEADLSGADLEG
FT                   ANFERSDLLNIRFDPETNWSSIGSWADARDIPQEWKDESSQGNGIQQRFDGSMVSDGNS
FT                   DVGSDSILLAD"
FT   gene            complement(63772..63924)
FT                   /locus_tag="AM1_B0096"
FT   CDS             complement(63772..63924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31822"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM53"
FT                   /protein_id="ABW31822.1"
FT                   /translation="MSCLKLFQDLFFDVSGLLGIWGFQSHVCFPKFPDSIAIMHGIREL
FT                   TSEHS"
FT   gene            complement(64536..64721)
FT                   /locus_tag="AM1_B0097"
FT   CDS             complement(64536..64721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31823"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM54"
FT                   /protein_id="ABW31823.1"
FT                   /translation="MSLLLIEEFAANPDWSRIPEQKLSRAQELINLIQLQSHLPRNQQN
FT                   EEYYGWIVELKGMLET"
FT   gene            65184..65396
FT                   /locus_tag="AM1_B0098"
FT   CDS             65184..65396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31824"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM55"
FT                   /protein_id="ABW31824.1"
FT                   /translation="MKAPKLHLQQQETPQCSPVASRGDPVFKDINRVLRNAIQNLPSKS
FT                   EEIRGNVSLILSSRIPLKTRTLEGF"
FT   gene            65529..65732
FT                   /locus_tag="AM1_B0099"
FT   CDS             65529..65732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0099"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31825"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM56"
FT                   /protein_id="ABW31825.1"
FT                   /translation="MTPTQAFYNGTPIAPPSNHLTTEQNMELLDWHPIFTGRCPNCERP
FT                   IRETTPPRSHWDCAEFEASQGE"
FT   gene            65742..65879
FT                   /locus_tag="AM1_B0100"
FT   CDS             65742..65879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31826"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM57"
FT                   /protein_id="ABW31826.1"
FT                   /translation="MLNWMTIAILELRSQTPTHDHLHQNDRRPHSPALPPSFTARFAHR
FT                   "
FT   gene            complement(65882..66565)
FT                   /locus_tag="AM1_B0101"
FT   CDS             complement(65882..66565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31827"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="InterPro:IPR026374"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM58"
FT                   /protein_id="ABW31827.1"
FT                   /translation="MKNSKFLAIVACAYTSCNLILGFTPPVTAASLTYNFRQDGFDEGA
FT                   YAEGFFIADDLNGDGQIAYFRGLQNSSEVSDFRVSFSGNRLTPPTTYGFGDLFGLVYDL
FT                   DGGPLGDGVTGVIEGISASVPNRNAIDQGYSAGPGPLNTYYFGPRQQFCVDSPFSLCGI
FT                   FDGSTSNEIVAVPEPSTFLGSIVTIGLGILAKRKRSHLVRQKKNPNALCRLHNGVFPGP
FT                   GLLQR"
FT   gene            complement(67224..67565)
FT                   /locus_tag="AM1_B0102"
FT   CDS             complement(67224..67565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0102"
FT                   /product="glyoxalase family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31828"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM59"
FT                   /protein_id="ABW31828.1"
FT                   /translation="MYFVSDRYAAAAWYSCLFDIEVTWLEKLEHFFIKVGNQEVWFHQS
FT                   DNKVPSGAAGHVAYWQVADFDVVLERALNLGAKLYRGPLDRQDGKYMCQVMDPDGNLIG
FT                   LIGPRRAEN"
FT   gene            complement(67607..67891)
FT                   /locus_tag="AM1_B0103"
FT   CDS             complement(67607..67891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0103"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31829"
FT                   /db_xref="GOA:A8ZM60"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM60"
FT                   /protein_id="ABW31829.1"
FT                   /translation="MVGIVDLEVVSTVMAGFEGHRGWINYLAVDPEFQRQGLGRKMMNE
FT                   AERLLQDFGCPKINLQIREDNLEAIKFYECIGFSEDKVVSFGKRLIADD"
FT   gene            complement(68023..68499)
FT                   /locus_tag="AM1_B0104"
FT   CDS             complement(68023..68499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31830"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM61"
FT                   /protein_id="ABW31830.1"
FT                   /translation="MNYKFLICLTISSVGFSFGEIANTLPIQGSILEAEAQILETPTSE
FT                   RGCENHSTTDGLKQNIINKRIYWIISGQSIGWTEYKKDGTYIEDNDDSGNYCVNQLLVT
FT                   MEIDSEQEITAHLTFPKKYLETRDTINVRVEQYGETILKTKAIISKIENLVEEK"
FT   gene            68669..69169
FT                   /locus_tag="AM1_B0105"
FT   CDS             68669..69169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31831"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM62"
FT                   /protein_id="ABW31831.1"
FT                   /translation="MKPPIISLNPKPIPQTTPGQPKPAPSAQKLLSKTAFPKKAPEGTW
FT                   PPKREPRHEELGGIRHSSRRTSRTTRPKKVPQSASSENLQVSQPRTPRESAELERLFRN
FT                   LELSQKDFVEQVKKGGDVVVGHRQKNKGMSWSERGSRALGILKTVELNGQWEQLWFPQT
FT                   IAE"
FT   gene            69284..69673
FT                   /pseudo
FT                   /locus_tag="AM1_B0106"
FT                   /note="cytochrome P450 family protein"
FT   gene            69711..70019
FT                   /locus_tag="AM1_B0107"
FT   CDS             69711..70019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0107"
FT                   /product="transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31832"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM63"
FT                   /protein_id="ABW31832.1"
FT                   /translation="MAYSSSLTDAEWEILKPLLPEFLPPKKKTRPLIWSYRELIDGMLY
FT                   RLKNGCNWEDLPKDFPPSSTVFWHYNVWRKAGSIETLMTLLHGQVREQVKKSPNGQR"
FT   gene            70022..70564
FT                   /locus_tag="AM1_B0108"
FT   CDS             70022..70564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0108"
FT                   /product="transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31833"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM64"
FT                   /protein_id="ABW31833.1"
FT                   /translation="MADSQAVKNTCNARVESKGFCFYKATNGIKRHLAVDTLGFPFFTL
FT                   CTPANVSDDMGLLMMLTLNIEYFKAKPVNIPKITFLLDNGYHVDTLTQKLGAIYPAIMR
FT                   KIRFELSPKPSKAEKAAQGKTGFVPVATRWVIERSNAWMERCKSLTKNFERTLVNAKAQ
FT                   MDLCFVRLMLKRLAANS"
FT   gene            70615..71577
FT                   /locus_tag="AM1_B0109"
FT   CDS             70615..71577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0109"
FT                   /product="cytochrome P450 family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31834"
FT                   /db_xref="GOA:A8ZM65"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM65"
FT                   /protein_id="ABW31834.1"
FT                   /translation="MLGTWKTGEIHDIHQDMSQLTVKVITKVLFGVDITQMALEIGDAL
FT                   ESILLQYYHKAQTSFLLPSWVPTPGNLRANRAIEYLNKLVIDIIEQRRESPQDDLLSSL
FT                   LLAQDEDGSQLSMKELRDEVMTLLLAGHETTATALTWTLMLLAQNPEVAQKLASETQSV
FT                   LEGRAPGITDLPRLPYTEMVLKESMRLYPPAWALSREVAQDCMIGPYFLKRGTSVFFSQ
FT                   WVVHRDTRFFDNPEQFLPERWQDNLELNLPRCAYFPFGAGPRGCIGQAFSIMEATLILA
FT                   MILKQNYFKLVPDQAIELLPSITLRPKYGIKMILESSNL"
FT   gene            71580..72191
FT                   /locus_tag="AM1_B0110"
FT   CDS             71580..72191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31835"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM66"
FT                   /protein_id="ABW31835.1"
FT                   /translation="MTNPIISLNPKPIPQTTTDQPNPAPSAPKLLSKTTFPKRAPEGTR
FT                   PAKREPGHEELGGIRRIVRRTPRSAKPEYTPKTRTSETPQTSQPRTPRVSAELERRFRN
FT                   LELKQKNLVEQTRTRGELEYLAVAKNGSGRFWITVAGTGKPFVRESFATPGFCWECAVE
FT                   IEESFEILQVIELRPGETMERIGEMIGVWLERERVSRVWG"
FT   gene            72267..72881
FT                   /locus_tag="AM1_B0111"
FT   CDS             72267..72881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31836"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM67"
FT                   /protein_id="ABW31836.1"
FT                   /translation="MNKVLTDWVTVKNLDIQNRSLLFRVGGQDRAGVVAKVTGLLELQH
FT                   LYVEAIQFNLILPEQNQFEMEILAKGALEDLTCIQGRIQSNQFLQPVSAAQNTYLYWPQ
FT                   AYMMHLALNTPDQEGLIARISNIVSTPRDNNNPFSAGNFVYLAGITHNSDGPQGGTAYF
FT                   SVRANIASQSLEVQHQIQNHLLEWAKESCIEEDIWIRDLNP"
FT   gene            73419..74522
FT                   /locus_tag="AM1_B0112"
FT   CDS             73419..74522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0112"
FT                   /product="cobalamin synthesis protein/P47K"
FT                   /note="putative cobalamin biosynthesis protein CobW/P47K
FT                   family protein (Cyanobacteria)."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31837"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM68"
FT                   /protein_id="ABW31837.1"
FT                   /translation="MTNSTASVQTSQSLDIKLPKKGMPVTIITGFLGSGKTTLLNHILN
FT                   TSQDLKVAVLVNEFGDIDIDSQLLTTIDQDMVQLTNGCICCTINDDLVEAVYSVLEREE
FT                   KIDHMVIETTGVADPLPIILTFVGSQLRDLTTLDSVITLVDSETFTPECFQSEAALNQI
FT                   TFGDIVVLNKTDLAADQKVEELEQWIREQKWGARLLRSQQGQVPLPLILDTTLFDPKAY
FT                   EEEVKAFAEQGTHHDEHDHHHHDEHDHHHGEHDHHHHGDHDHHHHHSEHLTIDGFSSMA
FT                   FESDRPFVLEKMQAFITDQLPEDVFRAKGFMWFEKNTSRYIFQLSGKRYTMDSDQWPDT
FT                   PKNQLVFIGRNIDTAQLKQLLTDCLAP"
FT   gene            74753..75148
FT                   /locus_tag="AM1_B0114"
FT   CDS             74753..75148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31839"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM69"
FT                   /protein_id="ABW31839.1"
FT                   /translation="MVTLKDARRIIAAAEKKAEEIGQPMNIAVADSGGNLVSHVRMDGA
FT                   WIGSIDISIKKAYTSRAFDISTKDLAEHSQSGGQFFGIHASNGGQIMIFAGGIPLMQDG
FT                   EVVGAIGVSGGSGEQDHAVAEAGADAF"
FT   gene            complement(75145..75267)
FT                   /locus_tag="AM1_B0113"
FT   CDS             complement(75145..75267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31838"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM70"
FT                   /protein_id="ABW31838.1"
FT                   /translation="MSKTVANTQLLRLTVLFFLIKKPQLISINNVGRNRANFFT"
FT   gene            75301..75417
FT                   /locus_tag="AM1_B0115"
FT   CDS             75301..75417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31840"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM71"
FT                   /protein_id="ABW31840.1"
FT                   /translation="MTVLDKYIDDLAKELIENTAGNTPCLPLSIQECRCPTS"
FT   gene            complement(75493..77346)
FT                   /locus_tag="AM1_B0116"
FT   CDS             complement(75493..77346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0116"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31841"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM72"
FT                   /protein_id="ABW31841.1"
FT                   /translation="MTSNSFLNEAIYLDQNPQVAEAVAQGLYASGLEEYVQIGQFQQRN
FT                   GVIFNGTTGDDIIHSSGQTSSIFGVPVQSIKSGRRLVNAQVESFGVGEFDTLLGSPGRN
FT                   IFYLGDNAEENPQDFYLGEGDRDYALIRFFDPFSEDAIYLAGNPEDYDFETIDNSVHIS
FT                   RNGDLIGIIEDVPQLIPDGLFTSNGILLFAPENSFYASRSKPYFNETAYLAANPDVEAL
FT                   LDAGDYNSGWDHFLAAGINEERLTFFNGVVGRDSFFYALGNAVIAGMPITSYDPSTQVI
FT                   TTATTGSGDYDHFHGAFGVNRILLGNDGTDFYVGQGDQDYALIGDFDPKEDQLIMAKSI
FT                   ENYQFENIEVEFGGETFTLLQISTLSGDVIAQLEDPDLTFIQAPSDIAGTYALISPQNE
FT                   TVPLPDTELIPTDSNIVAGSSEADDLFASITPGFDGVSDMVFAGAGNDDVDTAIAGSTA
FT                   GDNRISLGSGDDITFVADRDRAFGGAGDDIFEATEASRYRLSGGAGHDQFFLGSNGRAL
FT                   GGDGDDSFFTEIGGDNKLSGGAGSDAFWIVNGELPEGTNTIVDFEQGLDIIGISGQGDL
FT                   KFDGLALTVTGDDTEIGIGGTTIARLMGTTSLNADDFTFAA"
FT   gene            77377..77493
FT                   /locus_tag="AM1_B0117"
FT   CDS             77377..77493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31842"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM73"
FT                   /protein_id="ABW31842.1"
FT                   /translation="MRMIIILMAGMRVVFKPFFKTDFGFYLFKLKYGLLNLI"
FT   gene            77590..77784
FT                   /locus_tag="AM1_B0118"
FT   CDS             77590..77784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31843"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM74"
FT                   /protein_id="ABW31843.1"
FT                   /translation="MENNKSFDLKLRLTLVKMSEIDHGVCQAFQRIMPFSDSLKPEQQT
FT                   LDFILFLSFPALAISHLLN"
FT   gene            complement(77845..78888)
FT                   /gene="amiE"
FT                   /locus_tag="AM1_B0119"
FT   CDS             complement(77845..78888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiE"
FT                   /locus_tag="AM1_B0119"
FT                   /product="aliphatic amidase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31844"
FT                   /db_xref="GOA:A8ZM75"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR022843"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM75"
FT                   /protein_id="ABW31844.1"
FT                   /translation="MGSTGSVSSWSESLLVAMIQYPVPVITGPEDIQTQVKQICKAVDN
FT                   TKAGYPGLDLIVMPEYSTQGLNTKIWTYDEMLLTVDSPEIDQFKEACVRNKVWGVFSLM
FT                   EKNDVPGLPPFNTAIIINDQGEIALHYRKLQPWVPIEPWYPGNYGMPVCDGPKGSKLAV
FT                   CICHDGMFPELAREAAYKGCNVYIRISGYSTQVNDQWILTNQTNAWQNLMYTISVNLAG
FT                   YDGVFYYFGEGTVCNYDGNVLQQGHRNPWEIVTAELFPRLVDEARKNWALENNVFNVGC
FT                   RGYVGKPGGERENYLTWVKDLAEGKYQLPWDKDIQIRDGWEYYPDGVKLGPLPTEESAK
FT                   TLVGTSS"
FT   gene            79134..79367
FT                   /locus_tag="AM1_B0120"
FT   CDS             79134..79367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0120"
FT                   /product="pentapeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31845"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM76"
FT                   /protein_id="ABW31845.1"
FT                   /translation="MQRITGVCSGCSWFTLGVVVMTAEELLERYASEERDFAGVDLLGA
FT                   NLAEAQLTEVCLNQADLTDTNLVDVCLIDARN"
FT   gene            complement(79539..79943)
FT                   /locus_tag="AM1_B0121"
FT   CDS             complement(79539..79943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0121"
FT                   /product="biopolymer transport protein ExbD/TolR, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31846"
FT                   /db_xref="GOA:A8ZM77"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM77"
FT                   /protein_id="ABW31846.1"
FT                   /translation="MRLPDDPSPSAQINIVPMIDVIFAILSFFIIATLFLNRSDALPVN
FT                   LPQAKTVKPQLSTKVTVTIDAQGDLALNREPIQLNVLEAEVKELTDSADKVVVVIHADD
FT                   QVSHGRVVTVMDRIREIEGAKLAIAATKKP"
FT   gene            complement(79927..80580)
FT                   /locus_tag="AM1_B0122"
FT   CDS             complement(79927..80580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0122"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31847"
FT                   /db_xref="GOA:A8ZM78"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM78"
FT                   /protein_id="ABW31847.1"
FT                   /translation="MQFGQVIIAGGVVMLPLMVFSLIAIALIFERLIFWTRVNRNQLRI
FT                   VKQALQLYRQDNVYDALRYLQEQARFPIARIFLAALSLEDPTPEEFRLALESEAQAELP
FT                   TLKRFTTVFDTIISISPLLGLLGTVLGLINSFSSLDVGNIGGSESAEVTGGISTALIST
FT                   AAGLIVAISTLIFANMFRSLYQRQLAFIQEHGGQLELLYRHRYERGRVNHALTR"
FT   gene            complement(80796..81860)
FT                   /locus_tag="AM1_B0123"
FT   CDS             complement(80796..81860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0123"
FT                   /product="iron(III) ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31848"
FT                   /db_xref="GOA:A8ZM79"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="InterPro:IPR035568"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM79"
FT                   /protein_id="ABW31848.1"
FT                   /translation="MTDGNDRHLPDPLHGRPQISRYAGLGVLSSVLLMGVLVSLAFGSV
FT                   SIPLSDVITVLFGGQATNPTWQQIILQFRLPRTITAIAAGSALATSGLQLQALFRNPLA
FT                   GPSLLGINAGASLGAALVVLTRGTANAGNGFVQISIIGAASLGAGMSMGVVLLVAQRVR
FT                   SALALLIFGLMFGYMTTALVTILLHFSLLTQTQAYLNWTFGSFSNVTWQQMPLLLPVIA
FT                   LGLGGSQLLHKALNLLLLGEAQAQSIGLSVNRTRCLLIFSSSLLSGSVTAFCGPIAFVG
FT                   VAVPHLCRSLFRTVDHRILVPAVALLGAILALIADAISQLPGSQSVLPLNAVMAVLGAP
FT                   ILIWLMLKRQQSLY"
FT   gene            complement(81882..82661)
FT                   /locus_tag="AM1_B0124"
FT   CDS             complement(81882..82661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0124"
FT                   /product="phosphodiesterase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31849"
FT                   /db_xref="GOA:A8ZM80"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR013622"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM80"
FT                   /protein_id="ABW31849.1"
FT                   /translation="MTAPITLAQISDTHLLADTTALLRGTNPWQSLQAVLQQVNRDQLD
FT                   GILLTGDLADQGSVVAYQHLMRAILPLKMPAYWLPGNHDQVEAMHRELQSPQLYGPQAI
FT                   HLGSWLLISLNSVLPSAQFGEGYLSVSALQQLQSVLTQHPHKPTVIALHHHPVAIGIDW
FT                   LDQMQVQNADALLTLLESFPQVKVVLFGHIHLDFQYQHVFSQRPSPIYFYGCPSTCLQV
FT                   NPPVPTDHTHLPGFRLLSLDPNGTHRTWVQRVEYVQQ"
FT   gene            complement(82658..83920)
FT                   /locus_tag="AM1_B0125"
FT   CDS             complement(82658..83920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0125"
FT                   /product="Fe3+ ABC transporter, periplasmic iron-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31850"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM81"
FT                   /protein_id="ABW31850.1"
FT                   /translation="MKEPKASISDYATSGWIRLLKVTAGLAVVGFLGGVGCQPTQSPSA
FT                   LKSDSSPTSADQCPVAYDPTQDYFPNKVQSDYAVGFSVEYHRHYKIVTVQNPWKGANQT
FT                   FQYLLVQCGTPKPPGFEDLPMVEVPISSLVVLSTTYLPHLELLGQLDTLVGVSQFKQVN
FT                   SLKVRAKIDRGELVEFNSGNTLDVERLLVTAPDLVMTYGTGNPDTDSHPRLVKAGLPVA
FT                   LVGEYMEESPLGQAEWLKYTALFFNQEAQAEQVFSDIAQEYQSMVQLAQSVAQRPTVFT
FT                   GFSHNGTWYMPGGKSYVSQLLQDAGANYLWSESDARGSLPLDFEAVFNRAVKAEFWVNV
FT                   SQDWRSRQDAISTDARYGQLSAVQADRVFNNTARVNAAGGNDYWESGVVNPHKVLADLI
FT                   KIFHPELLPNHQLIYYQKLDS"
FT   gene            complement(83937..84824)
FT                   /locus_tag="AM1_B0126"
FT   CDS             complement(83937..84824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0126"
FT                   /product="iron-sulfur cluster-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31851"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM82"
FT                   /protein_id="ABW31851.1"
FT                   /translation="MSEFSRQVVPLNYRTVDPLATGGQIEYEDFPCTIEVLGPLLYTLF
FT                   QECWQQTQIGHVVEGSVLELEFTQAPKTCILYDGYLTVVTAGWHLHLCLEEHQGGPLGK
FT                   TPPALRRKRQVQRASFYRRFNDRGQARSWGIQFWNGAGEKMMNLFLPNPFVDADENLLP
FT                   EGTPQLDKLSLYETLRDIYVLGTRPIPYTENPLKRPYLSVCRSSRCYPSQDVQPIIEAL
FT                   QTAVQQSGLEVAVRTSGCLEVCAAGPVVFYSGDRTWYTRVTPEIAHRIVQEHVAQGRPI
FT                   QAHVYPPIKTQASV"
FT   gene            complement(84849..86915)
FT                   /locus_tag="AM1_B0127"
FT   CDS             complement(84849..86915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0127"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31852"
FT                   /db_xref="GOA:A8ZM83"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM83"
FT                   /protein_id="ABW31852.1"
FT                   /translation="MKGVKVGFPVIGKLIFVFGLSLTAWFSYTSRASLAQANPPTDEEA
FT                   LPSSIVEDEEVEITVTGEILDQPVYAPFRREGTVRDSSRPVYVINREQIEAQGARTVQE
FT                   ALKYLPGILRDGTAGGQLGALSSQFIRGSNTAQVLILLDGRPINDVGFMGGFDLSNFTT
FT                   DNIERIELLPGGGSTLYGSDALGGVINIITRAPADEKPEVTLRAAAGSFGLNEQAVQAR
FT                   GRSGDLGWSVGYTRTQATNDFPFEINRIGLQADRNNADVLYNNLNLKLEGKLSDRNQVT
FT                   FSALYLNKDFGSAGGVPIPDSIGQFNSLTPLARQTTEELFLDLTWQAQLDQAGNSQLTS
FT                   RIFADLLDSNFDNPDPAAFGTRDDVDRRSIGAQVQHNWKVAKNQTLTYGFDYRNTQSRN
FT                   TTFSYGLGTTDVNYDGGIDQGALFARYDVNITPKFNLNFGLRQDFNSLANGSFTSPSVG
FT                   ARLAIGDSTVLRANYARSFRAPQIVNLEGLAAFNVVGNPDLEPERGDSFDIGIDQSLGE
FT                   NGLLRLTFFANTISNLINFQFGAPSTYENIGKVRTLGLEADLNVRLLKNLYAFANYTLN
FT                   EPEIIEDGDPTITGNELSFRGADSLNVGLAYENAKGVYIAAIVRYLSSYFVNNTNTESL
FT                   PGYTTLDLKLRFPIGDSFAFTGSLDNLLDQHYEQFPGFPAVGRSFRLGVSATF"
FT   gene            87302..87460
FT                   /locus_tag="AM1_B0128"
FT   CDS             87302..87460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31853"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM84"
FT                   /protein_id="ABW31853.1"
FT                   /translation="MLAVVDGRTVKLYRDTRGISSSHADIHQSVSPGWVSELCDDDTVL
FT                   GGWIATV"
FT   gene            87420..87539
FT                   /locus_tag="AM1_B0129"
FT   CDS             87420..87539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31854"
FT                   /db_xref="GOA:A8ZM85"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM85"
FT                   /protein_id="ABW31854.1"
FT                   /translation="MTTLFWEAGLRRSELVNCDVCHFDLEQKRLSILGKGRNE"
FT   gene            87558..87671
FT                   /locus_tag="AM1_B0131"
FT   CDS             87558..87671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31856"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM86"
FT                   /protein_id="ABW31856.1"
FT                   /translation="MSGVQGIFRWLELRGECAPTDPLFISLDRVIGSRSYR"
FT   gene            complement(87628..87822)
FT                   /locus_tag="AM1_B0130"
FT   CDS             complement(87628..87822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31855"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM87"
FT                   /protein_id="ABW31855.1"
FT                   /translation="MSLACREYAWVPLKSPPVISKYVVVPLLWGPKSSLTPIFLAEART
FT                   IRHNDVTDNYDSLSPDPTI"
FT   gene            complement(87840..88799)
FT                   /locus_tag="AM1_B0132"
FT   CDS             complement(87840..88799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0132"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31857"
FT                   /db_xref="GOA:A8ZM88"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM88"
FT                   /protein_id="ABW31857.1"
FT                   /translation="MVIPGWTKTESPFHEGELAIQSRLNVQTQIDKQGRRIIREYLPEQ
FT                   FRRFFAQLPYVTVGTVDAMGNPWASILVGEPGFLSTPDRYTLNVNASPLPGDPLAMTLA
FT                   LGIDIGFLGIELHTRRRNRLNGVVTKTHREGFEVQVRQSFGNCPQYIQARTSELGEFDS
FT                   RAPRTINEVSVLSEKEKTLITSADTFFIATAYQADAAGAASGVDVSHRGGKPGFIRIDG
FT                   GHTLTVPDFAGNRHYNTFGNLQVNPRAGLLFIDFTQGDLLYLTGAANVIWEGSEIAEFE
FT                   GAERLMHFHLTKGYCVENSLPLRWSAPVFSPFLENTGT"
FT   gene            complement(88836..89435)
FT                   /locus_tag="AM1_B0133"
FT   CDS             complement(88836..89435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0133"
FT                   /product="glutathione S-transferase protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31858"
FT                   /db_xref="GOA:A8ZM89"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM89"
FT                   /protein_id="ABW31858.1"
FT                   /translation="MVKAYGFHLSGNSYKVRLLLELLKVDYDWKEMDLVNGEHKSPEYL
FT                   AVNPLGQVPALVDGETRLTDAQSILVYLAKQYGGEQWLPTETLPMVQVINWLFTTAGEV
FT                   RQGPESARLYHFFGVSNINVERTYQKSEHVLTYLNQHLSTRTWLEFERPTIADVAVFPY
FT                   VALSRDGKIDLDAYPHILNWIEQVKQLPGFISMPGL"
FT   gene            complement(89428..89547)
FT                   /locus_tag="AM1_B0134"
FT   CDS             complement(89428..89547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31859"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM90"
FT                   /protein_id="ABW31859.1"
FT                   /translation="MKPCGFSIGLGFAIPLVTNFYCPWEKTKTEIKKGEAQNG"
FT   gene            complement(89547..89822)
FT                   /gene="grxC"
FT                   /locus_tag="AM1_B0135"
FT   CDS             complement(89547..89822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="AM1_B0135"
FT                   /product="glutaredoxin 3"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31860"
FT                   /db_xref="GOA:A8ZM91"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM91"
FT                   /protein_id="ABW31860.1"
FT                   /translation="MANIEIYTWSTCPFCRRAKQLLDQKGATYTEYQIDGDEAARDQMV
FT                   ARGTNGRRSVPQIFINDQHIGGSDDLYALERQGALDKLLGSTEVLV"
FT   gene            complement(89864..90841)
FT                   /locus_tag="AM1_B0136"
FT   CDS             complement(89864..90841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0136"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31861"
FT                   /db_xref="GOA:A8ZM92"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM92"
FT                   /protein_id="ABW31861.1"
FT                   /translation="MQLTRQTVNQHTDQIYDVLVVGGGAAGLSAGIYLQRYLLSTLIID
FT                   KGKARSFWMQELHNYLGLPPDTPGREVLKQGKEHFLSLEGDYLNAYVEEIIDEGETFAV
FT                   KVRIGRKNPTYEVFHSRYLIAGSGIIDHLPQLADMKNVFDYAGHNLHVCLICDGYEMRD
FT                   QRVGVFGSSEGSLQVAFPLGWFTPHITLFTNGLFEVGHEMRERFTEAGYTLNERPIRQF
FT                   LGENHQMSGVELDDSSVVELDAGLISMGSNYHADYLKGIELEYNGGNLVTDSMNRTSHP
FT                   RIFAVGDLKVGMNQVVIAAADGANAATQIWRDIRRAEGTRRTAA"
FT   gene            91136..91702
FT                   /locus_tag="AM1_B0137"
FT   CDS             91136..91702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0137"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31862"
FT                   /db_xref="GOA:A8ZM93"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM93"
FT                   /protein_id="ABW31862.1"
FT                   /translation="MTRPKSPRSSVRDRILDTASELFYQEGTQNVGIDRIIAESGVAKM
FT                   SLYNHFKSKDALIAAWLQQRDESWRAWFQERVEARAVEPCDRILAIFDVLAEWFKQPDF
FT                   RGCAFINSTVELVDPEHPGYQVAIEHKRATSGYILGLVTMAELKNPEVLTQQLLILIEG
FT                   AIVVSMMQGNADAAQQAKQVAATLL"
FT   gene            complement(92192..92698)
FT                   /locus_tag="AM1_B0138"
FT   CDS             complement(92192..92698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31863"
FT                   /db_xref="InterPro:IPR013472"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM94"
FT                   /protein_id="ABW31863.1"
FT                   /translation="MTHVSMHYPIFGPETPCPHCRQMMSALTLTDTYLCQRHGAFEADP
FT                   NTEDLVHLQSGRHWRLWEGQWYRQHTHPDGIRFEIHEALDRLYNEGYRATKVIIARRYR
FT                   TLINTFLEHSPWSDKTLSGHPSLYGLPIEFGPDPEQDPRWQVINFDLDKEPGIPSNSPH
FT                   SRLFD"
FT   gene            complement(92889..93284)
FT                   /locus_tag="AM1_B0139"
FT   CDS             complement(92889..93284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0139"
FT                   /product="ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31864"
FT                   /db_xref="GOA:A8ZM95"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM95"
FT                   /protein_id="ABW31864.1"
FT                   /translation="MPEKLTPHQRRVLEVLFSTPQEFSAQDLHQEFGKQQQRVGLATVY
FT                   RALKVLQKCGKVQMRSLPNGEAVYSLASVHRHHLTCVNCGTSMPLMNCPVHKLEQELAQ
FT                   TQEFQVFYHTLEVFGLCQNCIEVEVSA"
FT   gene            93441..93560
FT                   /locus_tag="AM1_B0140"
FT   CDS             93441..93560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31865"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM96"
FT                   /protein_id="ABW31865.1"
FT                   /translation="MLYQTSRKRGNPLSFARNLFTDYDDRVLGWWGMQGHGGR"
FT   gene            complement(93593..94798)
FT                   /locus_tag="AM1_B0141"
FT   CDS             complement(93593..94798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0141"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31866"
FT                   /db_xref="GOA:A8ZM97"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM97"
FT                   /protein_id="ABW31866.1"
FT                   /translation="MGWGRWLILKNYDNDNHYIKILLAASLSMKETTSSYDVVIVGAGP
FT                   AGVGCAVALQDLGLKNFILLERQQVGASFSRWPAEMNLITPSFPSHGFGLLDLNAITLK
FT                   TSPAVAFRREHINGQQYALYLQTVANHFQLPVKTETDVLDIEPLSQCRGFILKTSGGDI
FT                   KTQFVIWAAGEFQYPRLNPFVGADHCIHNSQIRSWKNLPGDEFTIIGGYESGMDAATNL
FT                   VALGKSVRVLDRTGAWDNPDTDPSIALSPYTVQRVKLAVQTGRLELIGNVSIEEVKKVS
FT                   EGYAVFSEYHKWLTAHPPILCTGFETSLQQIASLFDWSEGYAMLNDQDESTLTPGLFVV
FT                   GPSVRHHDVIFCFIYKFRQRFAVVADAIARRLDLDPAPLEIYRQQGMFLDDLSCCDNDC
FT                   IC"
FT   gene            95101..95529
FT                   /locus_tag="AM1_B0142"
FT   CDS             95101..95529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0142"
FT                   /product="ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31867"
FT                   /db_xref="GOA:A8ZM98"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM98"
FT                   /protein_id="ABW31867.1"
FT                   /translation="MYDANSLKAELNDRGWRLTPQRETILNVFIDLEKGKHLSAEDLDT
FT                   LLQEQGKPISLSTIYRTVKLMARMGILRELELAEGHKHYELNQPYPHHHHHLICVKCNE
FT                   TIEFKSDAVLKIGSKTAKKLGFHLLDCQLSIHAICPQC"
FT   gene            95523..95651
FT                   /locus_tag="AM1_B0143"
FT   CDS             95523..95651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31868"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM99"
FT                   /protein_id="ABW31868.1"
FT                   /translation="MLAVLTTHLNQGLVNGELSLGKIAKSSGQIIGNGSSLCDCRI"
FT   gene            complement(95683..96108)
FT                   /locus_tag="AM1_B0144"
FT   CDS             complement(95683..96108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0144"
FT                   /product="ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31869"
FT                   /db_xref="GOA:A8ZL42"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL42"
FT                   /protein_id="ABW31869.1"
FT                   /translation="MQQQADKIIQTLKAKGLRVTPQRFAVYADLLARSDHPTAEQITNH
FT                   LNQDGPTSSQATVYSSLQALREVGLVREVLLEEGVCRYDANIEPHHHFRCQSCGAIEDI
FT                   AWDQLQDLDLKALRPGLQVTHYEITLYGGYCNRCHPE"
FT   gene            complement(96271..96399)
FT                   /locus_tag="AM1_B0145"
FT   CDS             complement(96271..96399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31870"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL43"
FT                   /protein_id="ABW31870.1"
FT                   /translation="MKAISSKHPWKISKNFPENGNLLESFYFLIQAVLFYHRHFSE"
FT   gene            96630..97838
FT                   /locus_tag="AM1_B0146"
FT   CDS             96630..97838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0146"
FT                   /product="cobalamin synthesis protein/P47K family protein"
FT                   /note="putative cobalamin biosynthesis protein CobW/P47K
FT                   family protein (Proteobacteria)"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31871"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL44"
FT                   /protein_id="ABW31871.1"
FT                   /translation="MRHTNKLPVTVLSGFLGAGKTTVLSHILNNREGKKVAVIVNDMSE
FT                   INIDSAIVQSEVSLNRSEEKLVEMSNGCICCTLREDLLEEVNKLAREGRFDYLVIESTG
FT                   ISEPLPVAETFTFTDEDGASLSDVADLDTMVTVVDAVNFLEDYEKARSLKDTGESLGEE
FT                   DERSVADLLVDQVEFADVILISKTDLVLPSDIERLTAILKTLNTHAKIVPIAQGQVNID
FT                   HVLSTGLFDFERAQQAAGWLKEMRGEHVPETEEYGIGSFSYVARRPFHPEKFYQFLSSR
FT                   DKYGKLIRSKGYFWLASRPQFAGHWSQAGGIARHGVAGMFWKAVPKENWPQDEEYLAAI
FT                   KKQWVEPFGDMRQELVFIGQGLDKERITQALDECLLSEEEIVRGHTYWKSLNDPFPEWG
FT                   HSA"
FT   gene            98087..98572
FT                   /locus_tag="AM1_B0147"
FT   CDS             98087..98572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0147"
FT                   /product="Fe2+/Zn2+ uptake regulation protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31872"
FT                   /db_xref="GOA:A8ZL45"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL45"
FT                   /protein_id="ABW31872.1"
FT                   /translation="MDAIQRVIDHAERRCKENGSRFTKKRKLALSLLLKSGKALSAYEL
FT                   VEAYKTELGDTMPAMSMYRILEFLMAENLVHRLDLINKYVACEHIKCEHEHAQTQFLIC
FT                   GQCQKVKEVAISAPIMDLLKKNTSDAGFHLASPQLEINCICQDCMSTELRAYSVGRY"
FT   gene            98744..100771
FT                   /locus_tag="AM1_B0148"
FT   CDS             98744..100771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0148"
FT                   /product="type II/IV secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31873"
FT                   /db_xref="GOA:A8ZL46"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL46"
FT                   /protein_id="ABW31873.1"
FT                   /translation="MGNDLSKRDLLVRNNFSPSNEKLIKSGYVDQTRLREAIYESRRKG
FT                   RSLLAILQKMTGKPLPPRLLRQIKRQQLFELKILYGLECLDPELTQVDFDEIDRLIRTV
FT                   IPLDYCRRYQLLPLSLNEEEDPPVVRIGMVNPDHLSAIDDIGYLLRSNGMTFQRVVLDL
FT                   DTYQMLIAKFLDAQAKRQATIQENLPVEYGLEDDLDRLGGIEDLATNDADTNLDEALLD
FT                   ENAAPIISLVNKILAKALQNQISDIHIEPQEENLRVRFRKDGLLHNAFQPLPRRITPAL
FT                   VSRFKIIANLDIAERRLPQDGRILRLFQGRKVDFRVSTLPSRYGEKVVLRILDNSSMQL
FT                   GLDNLIDDPMSLELVRSMVDRPFGLILVTGPTGSGKTTTLYSALTERNTPEVNICTVED
FT                   PIEYTLPGITQVQVLREKGMDFASILRAFLRQDPDVLLVGETRDKETAKTAIEAALTGH
FT                   LVLTTLHTNDAASAIVRLAEMDVEPFMVSASLLGVVAQRLVRRLCPDCRIPYRPSQERL
FT                   AQFGLVTSGKTDITFYKANTSTSDDILATANTEDACPTCSGIGYLGRCGVYEVMQVSEK
FT                   LKALITEGAPTEHIKEVAVEEGMQTLLAYSLKLVENGETSLEEVERVTFSDSGLKTELK
FT                   AKRKTALNCHVCNAALLPEWLDCPYCLTPRFTEQHPVNQH"
FT   gene            100907..101020
FT                   /locus_tag="AM1_B0149"
FT   CDS             100907..101020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31874"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL47"
FT                   /protein_id="ABW31874.1"
FT                   /translation="MLEGLPQVSPFHNGWRHYLFLAGSLEIEEISVNPMPL"
FT   gene            101141..101461
FT                   /locus_tag="AM1_B0150"
FT   CDS             101141..101461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31875"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL48"
FT                   /protein_id="ABW31875.1"
FT                   /translation="MLELTTIKQTALDYLLSHLEVFPEHCQLFEVVGATCFDNHEWMIN
FT                   ISVVGLVGKYWNVFVDGNTGKISQDCEFYTDCPDLNKPHQYAHLPDYLNQLLDRQTAKV
FT                   SK"
FT   gene            101498..105383
FT                   /pseudo
FT                   /gene="priA"
FT                   /locus_tag="AM1_B0151"
FT                   /note="prisomal protein N'; interruped by insertion
FT                   sequence"
FT   gene            complement(103088..104332)
FT                   /locus_tag="AM1_B0152"
FT   CDS             complement(103088..104332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0152"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31876"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKW2"
FT                   /protein_id="ABW31876.1"
FT                   /translation="MDNSIRIPLNLPDIRVLELSKTERGDWLIKIESTLQGTTCHQCGR
FT                   EITDLHCHDQPFRIRHLPLFEVPVYLEIRPKRYRCKYCDDHPTTTQHLEWHEPRSPNTK
FT                   AYERWLLRILINSTVSDVARKLGVSEDIVSGIIDRWIAAQVDWSEYADLKVMGMDEISL
FT                   KRGHRDFVVLITIPTTDGVDILAVLADRKQQTVANFLQSIPIDLRQTIERVCTDMYQGF
FT                   VSAVREQLPQAKIVIDRFHVTKAYRNCADTVRKREVKRLRRELSKQEYDSIKGAMWPFR
FT                   KRPENLKESEQQLLERLFAYSPQLKQAYNLREKLTQIFEGRYTKHGAKCAIRAWCKQVL
FT                   KSDIKEFDCFLTTINNWMDEMTNYFLEGWTSGFVEGFNNRVKVLKRRCYGIFDIERLFQ
FT                   RISLDLNGYQTFAVT"
FT   gene            complement(105416..105529)
FT                   /locus_tag="AM1_B0154"
FT   CDS             complement(105416..105529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31877"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL50"
FT                   /protein_id="ABW31877.1"
FT                   /translation="MRFKKAVSIFVAKPVQMDIPQARVVDIRVVDAVHNLN"
FT   gene            105747..106118
FT                   /gene="smtB"
FT                   /locus_tag="AM1_B0155"
FT   CDS             105747..106118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smtB"
FT                   /locus_tag="AM1_B0155"
FT                   /product="transcriptional repressor SmtB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31878"
FT                   /db_xref="GOA:A8ZL51"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL51"
FT                   /protein_id="ABW31878.1"
FT                   /translation="MSHSHLDISTHSLSEKPRSEKPVVDQILSFEKAQRMAEFLGVLSD
FT                   PNRWRILSALAIEEMRVGELAAAVEMSESAVSHQLRVLRNTRMVRRRKCGRTVIYGLKD
FT                   HHIFNLYRDVSEHLDEADY"
FT   gene            complement(106311..108191)
FT                   /locus_tag="AM1_B0156"
FT   CDS             complement(106311..108191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0156"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31879"
FT                   /db_xref="GOA:A8ZL52"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL52"
FT                   /protein_id="ABW31879.1"
FT                   /translation="MEYNVAKTTNWDTKIEESDPPKVESLVDLLRYRAAYQPDRRGITF
FT                   LVDGEEEALHFTYAELDIKARAIAAALQLACHPGDRALLVYQPGLEYVAAFFGCLYAGV
FT                   TAVPIYPPRPNRSLMRLQSVIADSQAIFALTTSQILSKLERRLIDTPELRALKWLATDS
FT                   LSVTEPRQAWQETHPQGQDLAFLQYTSGSTATPKGVMITHHNLLKNLSLIHQCFEHSSQ
FT                   SLAVIWLPPYHDMGLIGGILQPLYGGFPMVLMSPFMFFQSPIRWLQAISRYQGTTSGGP
FT                   NFAYDLCLRKIKPEQLQGLDLSSWRVAFNGAEPISAQTLEDFATKFAPYGFRSEAFFPC
FT                   YGLAEATLIVAGGQPDAQPALKTVQGTALEQHHVVSAQANDVNARTLVGCGTSLQDQEI
FT                   VIANPETLQQCSSEEVGEIWVSGESIAQGYWGQSDVSEETFQAHLADTGAGPFLRTGDY
FT                   GFLVGSELYVTGRLKDVIIVNGRNHYPQDIEWTVVQSYPGIRPNCAAAFSITEAGEERL
FT                   IVVAELERNYINRYRKNGKKPSSQPPQLNDFVSPTSLTADSEPTTVEKDILTQIRRAVA
FT                   KEHDLHIHALWLLKPGSIPKTSSGKIQRFTCRSKFLEGDLDSVARSMPRA"
FT   gene            complement(108583..109629)
FT                   /gene="cobW"
FT                   /locus_tag="AM1_B0157"
FT   CDS             complement(108583..109629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobW"
FT                   /locus_tag="AM1_B0157"
FT                   /product="cobalamin biosynthesis protein CobW"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31880"
FT                   /db_xref="GOA:A8ZL53"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR012824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL53"
FT                   /protein_id="ABW31880.1"
FT                   /translation="MHKIPVTVVTGFLGSGKTTLVRHLLQNNQGRRIAVLVNEFGEVGI
FT                   DGELLRSCQVCNDEETPNGSGPNIVELANGCLCCTVQEEFLPTMQELLKRRDEIDCIVI
FT                   ETSGLALPKPLVQAFRRPEIRTGATVDGVVTVVDGDALAQGRIVSNLDALNTQRQADDS
FT                   LEHETPIEELFEDQLACADMVLLAKTDVIQGEDTCSRIQQWLQQQTPSGVKVVPCHHGQ
FT                   ISPDILLGFNAAVEDNLDSRPSHHDQEEDHDHDDNINSICVELEQTFDPNTLIERLQVL
FT                   VQQQEIYRIKGFVAVPNKAMRLVLHGVGQRFDQFYDRLWQTSEPRLTQLVFIGQGLDSH
FT                   HITEAISA"
FT   gene            complement(109688..110080)
FT                   /locus_tag="AM1_B0158"
FT   CDS             complement(109688..110080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31881"
FT                   /db_xref="InterPro:IPR012863"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL54"
FT                   /protein_id="ABW31881.1"
FT                   /translation="MTQTTLFVCSLCRFSKDEACRDGISGGQYLINQLHQALEACNLQD
FT                   TVRLEPLRCMAGCSHPCNVSLAAPGKLTFILSQISPTEGAKAVAVFCQQYATSPDGKVP
FT                   YSERPNLVREATAFILPPLPTDAPTR"
FT   gene            complement(110103..110279)
FT                   /locus_tag="AM1_B0159"
FT   CDS             complement(110103..110279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31882"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL55"
FT                   /protein_id="ABW31882.1"
FT                   /translation="MAVEARATWQQAFVATNTLTLGHNTWCGFLAYEVVCNGWDAFKPL
FT                   APDFPNYNYFSLT"
FT   gene            complement(110269..110733)
FT                   /locus_tag="AM1_B0160"
FT   CDS             complement(110269..110733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31883"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL56"
FT                   /protein_id="ABW31883.1"
FT                   /translation="MRPPTSVWQGYSGYWQSAFIREYLLPIGHAAWQGYLTQWRGLVSC
FT                   DVDVVDVSTLDWHIDLVEYGIQYIPKAEIQDYLEVHNLDMDFVHRLMEAAMTYQPGQDI
FT                   LVAILGNGQVDINWLQNLAISPPDCYHEMRSRHSEFALAPSSGGRCKDGC"
FT   gene            complement(110717..110986)
FT                   /locus_tag="AM1_B0161"
FT   CDS             complement(110717..110986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31884"
FT                   /db_xref="GOA:A8ZL57"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL57"
FT                   /protein_id="ABW31884.1"
FT                   /translation="MTLAYTRMGMHREVKKALEAYWRGDVDTNSLHTTERDIEAGIANL
FT                   PMQQIWVNPDCGLKTRRCKEVMPSPKNRVAAAQQLREEIDATPH"
FT   gene            complement(111627..111746)
FT                   /locus_tag="AM1_B0162"
FT   CDS             complement(111627..111746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31885"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL58"
FT                   /protein_id="ABW31885.1"
FT                   /translation="MKGKRALMDFQSRFLFFTRGLSDHSDEILKGRQKTVCQT"
FT   gene            111768..111893
FT                   /locus_tag="AM1_B0163"
FT   CDS             111768..111893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31886"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL59"
FT                   /protein_id="ABW31886.1"
FT                   /translation="MGLTMLIGTNPYHAESGNTRNTYLGKPEVTHMPAPLPTAFV"
FT   gene            complement(111896..112654)
FT                   /locus_tag="AM1_B0164"
FT   CDS             complement(111896..112654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31887"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL60"
FT                   /protein_id="ABW31887.1"
FT                   /translation="MEARAGVTIALLLVGCAQTPVKVENIEPRTEVAKTTTPRPSPQQR
FT                   QMPWRLKLQLTLDHPNDLKVKVNEVVTKGQIVSERSLIRTSLVQERESLRQQLQHLQTQ
FT                   TFTVVPDFAVEQVEVKLARLRVEQARDAISNFYADSPWTDYARRVLPLSEKTELGKLEG
FT                   KYQEAKGKLTLAIAKLTKAKQQNRVRHNQSTQKAKLIAEIHTIENKLNTKGIVRSPYNG
FT                   QIKSIKWLRQTDQELYLDLVITVSGQSVSL"
FT   gene            112709..113125
FT                   /locus_tag="AM1_B0165"
FT                   /note="Fe2+/Zn2+ uptake regulation protein"
FT   gene            complement(113230..114720)
FT                   /gene="cysS"
FT                   /locus_tag="AM1_B0166"
FT   CDS             complement(113230..114720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="AM1_B0166"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31888"
FT                   /db_xref="GOA:A8ZL61"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL61"
FT                   /protein_id="ABW31888.1"
FT                   /translation="MNLTLHNTLTNQKEPFISVHPERVVMYCCGVTVYDNCHLGHARSY
FT                   MAWDVLRRYLKWCGYTVRYVQNFTDIDDKILHRAIVEGITMQEVSDRYINAYFRDIRRL
FT                   NILDADDYPRVTEHIPAIHQLIQALEQQGYAYAIDGDVYYSVRQFSEYGKLSGRKLEQL
FT                   KVGAGGRVADDTQDQKKRDPFDFALWKSAKPGEPAWESPWGLGRPGWHIECSAMIRARL
FT                   GETIDIHGGGGDLVFPHHENEIAQSEVLTGQPLARYWLHNGMVTVNGEKMSKSLGNFTT
FT                   IRDLLDGGWADYPEPVDPMAVRLFVLQGHYRKPLDFTKDAIVASINSWQTLKAGILFGN
FT                   RHRVALSSPFASIQSSPQEPSSEDPWTKRFQSAMDDDLNTSGALAVLFELAKALQREGN
FT                   RLVHEGKSQSSPELLWQQWQTLLYLAQVLGLEAKVNSDTDEATGKLDEAVITDLIQQRQ
FT                   TARKQRDFITADDIRAQLSAAGITVVDQPDGATRWHRH"
FT   gene            complement(115217..115336)
FT                   /locus_tag="AM1_B0167"
FT   CDS             complement(115217..115336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31889"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL62"
FT                   /protein_id="ABW31889.1"
FT                   /translation="MAVAVFIARDIVSKMGIPFDLLNTGGEKTLPPRVRLEGN"
FT   gene            115361..116680
FT                   /gene="thrS"
FT                   /locus_tag="AM1_B0169"
FT   CDS             115361..116680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="AM1_B0169"
FT                   /product="threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31891"
FT                   /db_xref="GOA:A8ZL63"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL63"
FT                   /protein_id="ABW31891.1"
FT                   /translation="MTIDCTCNSSVPPSIVWRVFYYLITQTTGETKMADHRELARDMDL
FT                   FHFEEHSPGMVFWHPQGLRLFRSIEDFMRQVYQGHGFEEVRSPIALNRSLWERSRHWEK
FT                   FRQGMFVVGSVEADIDDESALSVISPDYALKPMSCPAHIAIYQSRKRSYRENPMRLMEF
FT                   GICHRNELSGTLSGCMRLRQFVQDDAHIFCRASDVQREISNFLNMVQQVYVAFGYDQFS
FT                   LQISLRPEQRLGSDHLWDQAESVLVKAVQSLGHSYKLAPNEGAFYGPKLEISLQDQLGR
FT                   SWQCGTIQVDFNLPQVFELAFVNELGELERPVMLHQAILGSLERWIGILLEHHSGALPI
FT                   WAAPTQVAVASISNKASAWAETIFFRLRQLGARVELHNQNRTISKKIRGLSKRKIPLIA
FT                   IVGEQEAMSQRLNLRCLGALKQQEMSLAELEQKLADLSMP"
FT   gene            complement(116670..116894)
FT                   /locus_tag="AM1_B0168"
FT   CDS             complement(116670..116894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31890"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL64"
FT                   /protein_id="ABW31890.1"
FT                   /translation="MAVSANSWLGVDAASTHCFLFEGVERRDENTDNGEGKQQQIILAP
FT                   HQVLPSVCSAVDLACERTSSTSGKKLATA"
FT   gene            117373..118101
FT                   /locus_tag="AM1_B0170"
FT   CDS             117373..118101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0170"
FT                   /product="peptidase M23 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31892"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL65"
FT                   /protein_id="ABW31892.1"
FT                   /translation="MVTSVLFSVSTFAPNLPQLTSSVETQTTLVQSMRKPTIELIVDDD
FT                   IKRVHAKKGYGGISTQSGPSNTRTLFASATPLPQKPTVDDPLRGFCHPLNGEGWLSQGI
FT                   RGRTHQGRMEYAYDLAIKIGTPIYAMRAGKVLALRDKYPDTGGGKENATRSNFIWLEHE
FT                   DGYRSIYVHLQQGFKSKVNLKAGDFVEKGQLIGYSGNSGWSTGPHLHIEVQKPSPRKRF
FT                   TNSVPFAISGTCKDTPIADQ"
FT   gene            complement(118336..119457)
FT                   /locus_tag="AM1_B0171"
FT   CDS             complement(118336..119457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31893"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL66"
FT                   /protein_id="ABW31893.1"
FT                   /translation="MAHQNQLYRMPMDEGLRQAMENAEDRILHHINELVHRINEASRMG
FT                   INFNVIDNGQLIGYYPALHHIDEPTEAEGTLTQGDIETVIEHMQNQHNAMYSSAYDSAI
FT                   PSGRLTVWEMVLHQHRINCRLSQEEIEPQFDNNDPCYDPSLNEPYEVPLLEPGVHEQIN
FT                   YSQIAETHEAQLIRLIDMDAREVAQHSLMRDKKNSFITQELAEQFCTEYRNPGSDAPVF
FT                   TDLYWQEINDHRKSGDWYVFRIPTDKHFMPLELHALPEFNEFIRRLAKDTGEHEDYITV
FT                   PFGVRESWRCWHNWVMNLPMGAVPPKEFPMIQVGEQIVIAEPERYKVYQILGRRGRYFI
FT                   VQDLWFQGQQAIVLHPGKEVYILLQRIDELEFQ"
FT   gene            complement(119463..119582)
FT                   /locus_tag="AM1_B0172"
FT   CDS             complement(119463..119582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31894"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL67"
FT                   /protein_id="ABW31894.1"
FT                   /translation="MIIIIIGNLLSTPSNLYVYCFFDFASTYFLQTTAAASPM"
FT   gene            119671..120303
FT                   /gene="folE"
FT                   /locus_tag="AM1_B0173"
FT   CDS             119671..120303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="AM1_B0173"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31895"
FT                   /db_xref="GOA:A8ZL68"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL68"
FT                   /protein_id="ABW31895.1"
FT                   /translation="MTVPSIPTFVPALTTEAQPIVSEAEMQAAVRTLLLGLGEDPDREG
FT                   LRDTPKRMVKALKFLTSGYQQSLDELLNGAIFPEDLDEMVLVRDIDLFSSCEHHIWPII
FT                   GKVHVAYIPNGKVIGLSKIARICEMYARRLQVQERLTAQIADALQGLLNPQGVAVVVEA
FT                   SHMCMVMRGVQKPGSWTSTSAMRGVFSSDSRTRQEFFNLISHSPASR"
FT   gene            120447..120791
FT                   /locus_tag="AM1_B0174"
FT   CDS             120447..120791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31896"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL69"
FT                   /protein_id="ABW31896.1"
FT                   /translation="MPSLNSFVPFTKICRAIAPVAALCSVFGTVLGQAAPSHAVTPRSL
FT                   LTPSLIQSIPITTSVAEAVNRVRGVEPKFCCHMLALAIDEILEDPRFETAQWGIVVESI
FT                   TGPTVLYQHN"
FT   gene            121007..122167
FT                   /locus_tag="AM1_B0175"
FT   CDS             121007..122167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0175"
FT                   /product="peptidase M23 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31897"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL70"
FT                   /protein_id="ABW31897.1"
FT                   /translation="MGLICTISLATLLFTLGGLHTLAQNSSDLNDLQERRIQVDEQRSN
FT                   VRKQRQQIENLEGAAKRRLGGLERNIQFTEGQIMENEVKLKQANQTLQKIEADLTVAET
FT                   AYKEKQSNTVARLRVLQRQRESSTWIVLLQSQSIEELLERRYRLQQVYKADRKSLLALK
FT                   TEKEEISDKKLLAEIQKNQIALLSEQLQYQKANYTAQASVQAELVTRLKTDRRALEAAE
FT                   QQLSQEANNLSSIIAQRLGEQQVAFRSGTPGYQRILGTGQLVRPVVGPVTSNFGYRIHP
FT                   VLGGRRFHAGTDFGAPTGAPIFAADSGTVIVAEWYGGYGNTVIVDHGNGLTTLYGHCSE
FT                   LYVTVGQGVQRGQTIAAIGSTGLSTGPHLHFEVRQQGEPVDPLAYL"
FT   gene            complement(122234..122395)
FT                   /locus_tag="AM1_B0176"
FT   CDS             complement(122234..122395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31898"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL71"
FT                   /protein_id="ABW31898.1"
FT                   /translation="MRALWTLYTTEQSFEKDLSNSLHKILKNELHPGQDSEVKHEETSE
FT                   KPASQVDE"
FT   gene            122476..123330
FT                   /gene="dacB"
FT                   /locus_tag="AM1_B0177"
FT   CDS             122476..123330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="AM1_B0177"
FT                   /product="D-alanyl-D-alanine carboxypeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31899"
FT                   /db_xref="GOA:A8ZL72"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL72"
FT                   /protein_id="ABW31899.1"
FT                   /translation="MSQAAPSHAVTQRSLLTPSLIQSIPITTAVAKAVNRVRGVKPKFC
FT                   SHMLALAIDEILEDPRFETAQWGIVVEPVAEPTVLYQHNRDRALIPASNTKLLTTAAAI
FT                   NLISNRVPEIPVPLNQQLIEVNRYSNNSEADALLRQVGGQRRVNQELMRLGLRPESYIQ
FT                   VDGSGLSRSNRMPPSTLITLLKAMKRHREGVVFYNSLPIAGVNGTLRNRFQNTRLHGKL
FT                   HGKTGTLRGVRALSGYLDNADYGTIAFSILVNQPGQSGQVLTQAIDQIVLQMAQVNRCN
FT                   LDS"
FT   gene            123382..123528
FT                   /locus_tag="AM1_B0178"
FT   CDS             123382..123528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL73"
FT                   /protein_id="ABW31900.1"
FT                   /translation="MWSQSGNSLTQRQISQTVVWPKFKTLMIARNYNLLLNRAHTCNKK
FT                   GDA"
FT   gene            123525..124868
FT                   /gene="pyr"
FT                   /locus_tag="AM1_B0179"
FT   CDS             123525..124868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyr"
FT                   /locus_tag="AM1_B0179"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31901"
FT                   /db_xref="GOA:A8ZL74"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL74"
FT                   /protein_id="ABW31901.1"
FT                   /translation="MTKKILIKNAQLVNEGRVFLSDVRISNERIEQISRSITPSGSDEV
FT                   VDAAGFYLLPGMIDDQVHFREPGLTHKGTIASESRAAAAGGITSFMEMPNVSPSTTTIE
FT                   ALENKYKIAQKRSVANYAFYLGATENNLEQIKRLDPSKYCGVKVFMGASTGNLLVENIT
FT                   ALEDIFREAPTLIVTHCESGPVIAKNLARVKAFNRPTVITDHPTIRDAEACFASSSLAV
FT                   GLAKRYGSQLHVLHITTAKELSLFDPGPIANKSITAEACVHHLWFSDQDYAGLGNLIKC
FT                   NPAIKSAEDRAALIQAVHEGLIDIIATDHAPHTWEEKQMDYPQAPAGLPLVQHALLTLF
FT                   DHVTHKRMSLAQLVEKTAHNPAIRYGVIDRGYIREGYFADLVLVDMDTPFTVTPENTFY
FT                   HCGWSPFMGYRFSSSILRTWINGQLVFDGQQIIECPGASKNLEFRGVR"
FT   gene            complement(125028..125492)
FT                   /locus_tag="AM1_B0180"
FT   CDS             complement(125028..125492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31902"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL75"
FT                   /protein_id="ABW31902.1"
FT                   /translation="MREATDRSNWAQEFVASNLLVIGYNAWAGHLSQKRGAIVCSTNSP
FT                   IMGISGESFKTHFVGRSRLMPFLKAWLEAPDRAVLPHCHMINHILEVVDNYSPTTEVVL
FT                   LLESFDQATFFYLKNLPITPPQCYEQVCKTWDEFQPGVPTWQDKKLPTEA"
FT   gene            complement(125503..129144)
FT                   /pseudo
FT                   /locus_tag="AM1_B0181"
FT                   /note="methionine synthase"
FT   gene            complement(129421..130071)
FT                   /locus_tag="AM1_B0183"
FT   CDS             complement(129421..130071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31903"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL76"
FT                   /protein_id="ABW31903.1"
FT                   /translation="MFKQLELDFASALASALDEPEQADISLMCASLDQHLQGRSPHEQL
FT                   RVAGDAIKDMAEVCLQRAELMIQGWEERYNSEGPVLDEDFLAGMVQQTMFLDVSDLCRQ
FT                   PKSRKRRQGFMGKPVESVVGDVSKESVLKFVEELESGESVAMKVSHEEDVSAWVAAIST
FT                   YLQQVPGKVPMVELMQELQLSLVSIWLGMLLGGFQFEQRGGFYDQNVWIETGA"
FT   gene            complement(130055..130582)
FT                   /locus_tag="AM1_B0184"
FT   CDS             complement(130055..130582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0184"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31904"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL77"
FT                   /protein_id="ABW31904.1"
FT                   /translation="MARPINPKCLACIDYSRSEAKRIHGPQGDDCWKDNTCDNKRNHYR
FT                   HRKESNAKRKGNYAQRKVITTPIEATETFSIPVQAPLVALLYLYKEKPKDAHLHALAVS
FT                   VWQGSKKLADIEPIHCMGMTNTQVRHYLNQVLKVIRERYGITEFEPPIRMEPSECEIAD
FT                   CPLKDKRHVQTA"
FT   gene            complement(130830..132974)
FT                   /locus_tag="AM1_B0185"
FT   CDS             complement(130830..132974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31905"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL78"
FT                   /protein_id="ABW31905.1"
FT                   /translation="MALEAAVAGAFIKALFDLGIKIFDERDEIKIDDSFRQLFFNATKA
FT                   YFQNYSDRHGQVQVLGMSKPVSLDAIYSGARMLDTESMKSYDSREALEEAYRNRGDRRF
FT                   RHHNCPKRNGIDIANECERLIVLGDPGIGKSTFLRKVGLEALKGEQGSYKHQQIPVFLE
FT                   LKLLTSPDLDLETCIAAEFENCGFPHPDGFTKKALAKGRLLILFDGLDEVLAENLDNVI
FT                   QKIQAFVDRYSKNRFIASCRIAAYHTYFKRVTTVAIAEFDDEQIEKFITNWFSSELDQQ
FT                   SQTAQHCWELLQKPENKGAKELAQSPLLLTFLCMVYNKSLTVPSSRHTLYEDALNILLK
FT                   EWASEKRVGRGQIYEGFHTDLEKQLLAKIAYQGFEDNQLFFTEEQLMKSIADFLGDSLG
FT                   APKNLDASAVLEAIEVQQGIFVERATNVYSFSHLTLQEFLTAKYIVKWNLLDDLVELHR
FT                   SSERWREVFFLVTGLMGEAAIGLLEKLEVQTQELSEHPKLKRLLAWAGAKTTHASSDYS
FT                   GEVKRVFTLILILVLAIASAIDRALDRALDLDRASARALDLARALDRASARALAIASAL
FT                   DRASALDLDLDRAIDRASARASARASAIARARARARAIAIAIAKFALDNKLITDVDIQT
FT                   LISYLEKSFDSSTVSIEGISSSLDISPELLDLSTDDVQAITNYFSTCQLMIDCSKQASG
FT                   ISAQQWDSIKQRMFLPKPAE"
FT   gene            133233..135197
FT                   /locus_tag="AM1_B0187"
FT   CDS             133233..135197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0187"
FT                   /product="phage integrase / plasmid pRiA4b ORF-3-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31907"
FT                   /db_xref="GOA:A8ZL79"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL79"
FT                   /protein_id="ABW31907.1"
FT                   /translation="MAIPEVNLIVLADQAATPIDAARSRTQPATTPLADLRWMRVEEFL
FT                   RSREIRPNTHKAYERDLKQLMDWTPKGWHEITSRDLDRYKTYLKTEPNHRGKLRKCATI
FT                   NRSLAALQSFFKWLTVRDYITKNPALLLEKLKSDPLLPQEFSQDEVDNLYQAICDRGFH
FT                   SFRDRALLHLIDHGLRASEIQGLNVGDYDGQRVHIREAKADSVGSVPLLSKARRAFDQY
FT                   KQWREQQGEVLEDESPLFVSHSNNSKGQRLQYWGIYKIFKAIADIAEVENAHPHRGRHT
FT                   LATRLVMKDMDSILARKVTRHKSEQSFVRYSDRGIELKAEQQFYEVHGEAPGGEDGIVE
FT                   DQLEGIELKAVVEEPANWPKIKAVGLPLNTVQVRLTLEVSGKKKGKVRKEIEERVFSPF
FT                   QMVKPKPRGNEYELMVVVEGGDTLSAITDQMKWDMELLGELDDCEVKVAWLDQQESTGE
FT                   VTLESQEDESAFAESSAGQRPTSTSSVYQMKIMLLGVRPQVWRRIQVPETTTLAQLHSV
FT                   LQVVMGWEGYHLHQFSDSEDEAMTLAELIEDDLFSFGYLYDFGDMWRHEIKVEKRLESK
FT                   PGKNYPICLAGKRACPPEDCGGDWGYARLLRVLNNPRHPEHEERLEWVGSDFDPKAFDL
FT                   EEVNQALKELEVETMSYFD"
FT   gene            complement(135185..135385)
FT                   /locus_tag="AM1_B0186"
FT   CDS             complement(135185..135385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0186"
FT                   /product="HicB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31906"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL80"
FT                   /protein_id="ABW31906.1"
FT                   /translation="MKYKGYESVVEFDANDQIFFGRVLGIRDVIAFDGQTADELKQSFH
FT                   NVIDDYLADCQQVGKDPSQSK"
FT   gene            complement(135386..135715)
FT                   /locus_tag="AM1_B0188"
FT   CDS             complement(135386..135715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0188"
FT                   /product="HicB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31908"
FT                   /db_xref="GOA:A8ZL81"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL81"
FT                   /protein_id="ABW31908.1"
FT                   /translation="MDAKYYTYRVIWSQEDEEFVGLCAEFPSLSWLDEDQQSAFAGIVE
FT                   LVKDCIEDLVAQDEPIPTPLSKKQYSGKFMVRIPPEQHRQLAIQAAEQGISLNRLASSK
FT                   LVSGG"
FT   gene            complement(135715..136203)
FT                   /locus_tag="AM1_B0189"
FT   CDS             complement(135715..136203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31909"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL82"
FT                   /protein_id="ABW31909.1"
FT                   /translation="MFLDERFQEQSHKDFRPNSNQRYFVHSSFLDLVAIMAISVSIYAN
FT                   SWILASHYDSSETLTNSLVLYRRVFYTSIDIDTINHMASIDKIVAKMGNNPAGIKFSDL
FT                   CKVCDHYFGEARQTSGSHRVYKTPWQGDPFVNIQSKKGMGKPYQVKQVLAAIQKLESM"
FT   gene            136425..137735
FT                   /locus_tag="AM1_B0190"
FT   CDS             136425..137735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31910"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL83"
FT                   /protein_id="ABW31910.1"
FT                   /translation="MAPDLRQFFRACNPGKTIRFEDPEERNYYIDFSSVRGGEVIEELG
FT                   QTIALMDPDPTCQLFSGHIGCGKSTELLRLKKELQEKGFHVVYFESSADLDMGDVDVSD
FT                   ILLAIAHQVSESLEAAKISTQSSYFNRLLKECVDFLNTPVELGIEAELSLGIGKLTAKT
FT                   KESPQLRSQLRQYLEPRTESLLNAINRELLQPAQEELNKQGKQGLVVIIDNLDRVDNRP
FT                   IASGQTQAEYLFITRGEQLGGLRCHVVYTIPLVLMFSNELQALKNRLGGGANPMVLPMV
FT                   PIRLREGNDCEAGMALLRQMVLARAFPQATPDERLASVTEVFDSPETLNQLCVASGGHV
FT                   RNLLSLLFTCLRKRKSLPITQDSLQLAIQEAKDDLTATIDAEEWELLKQVHSSKKVTGE
FT                   EECQALLRSLFVFEYRNHADGRWFDINPVLAGARELS"
FT   gene            137732..143224
FT                   /locus_tag="AM1_B0191"
FT   CDS             137732..143224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0191"
FT                   /product="WD-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31911"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL84"
FT                   /protein_id="ABW31911.1"
FT                   /translation="MTETSFTVGTEHLAQLEELAWTIEMSEGQFTLILANCNYAQLRTA
FT                   LIQRLAELCSVAIKPVHLNPDAVTLYSAIQQQLGQQVPPALMVTGLESLEALEQVLTSA
FT                   NQAREEFRKRLPVPMVLWLDDDLLKQMVRLVPDLKSWGTSFRFQAEPVELVQFLQDCSQ
FT                   RLFTKILDVGQFVPNSEVLGKRNRQEISYAIQALETPGTTLNPKLQATVIFAQGRNAYA
FT                   KGDLKKALDFYQHSLQEWPDSEQPSGGMPARTNDESGSTSEIENSRHKGIVLIHQGWCY
FT                   QAMAQQDSSQTAAFLEQAKQSFEQGLDCLGASSELGILYLGQLGEVLHQLENWDALDQL
FT                   ALNLYQNTTPEKHPLQYMEALVLRAQVCNHRQTWEPALDLTEEALQIWEVGSTEIQVLA
FT                   QQQILRMRMGLLSAQAQQALGKSQAAIDDLEQTIAATDASADPHLFVEILEQLRQLYFD
FT                   QKDYQKAFETKQLKTTVKLKFRLQAFIGAGQLQPQLGDEEGIDESLVLSGRQQDIEVIV
FT                   NERLSQDQYKLVILYGPSGVGKSSLVKAGLVPVLQQRVIRDRKTLPVVVNVYSNWVAEL
FT                   QAKLEQAASVPHTMKTEISGVETSEDVSQASDVVKGETGTSDSLEQIKQQLKHNVEAQR
FT                   LTVLVFDQFEEFFFNCQEPGLRRRFYEFLQACLDGRAIPFVKVVLSLREDYFHYLLEFG
FT                   RFTTRHGLEQDVLRQDNRYYLGNFDLDSARLVTERLAKRAQFHVQSQVIERLIGDLATE
FT                   LDQVRPIELQVSGAQLQTENITTLQQYEHLGEQPKKVLASRWLEQVVEDCGPENNETAW
FT                   KMLVSLTDSKGTRPLRTEQELWNAVSTFALLDTEDSNLQDLPQSNPEDLTHFSLILRIL
FT                   QGSGLIVHWPQEQDDRFQLVHDYLVEPIRQHFDTDLEQKLRSERQARQKAEAGRAKLLK
FT                   ISLGGAFIAIAGLIGLLWRAENLRYRAERREANAEVLALSLSSKNLFDSNYQLKSLTKA
FT                   LMAGQNLRDYEEKQENRLENHMYGVATLRDSVYNIRQQNNLEGHTDAVLALAYSPDGST
FT                   LATASSDKTVKLWSKEGSLITTLEGHTDLVLALAYSPDGSTLATASYDKTVKLWSKEGS
FT                   LITTLEGHTDAVLALAYSPDGSTLATASSDNTVKLWSKEGSLITTLEGHTDAVLALAYS
FT                   PDGSTLATASSDNTVKLWSKEGSLITTLEGHTDLVLALAYSPDGSTLATASSDNTVKLW
FT                   SKEGSLITTLEGHTAAVGDLAYSPDGSTLATASDDKTVKLWSKEGSLITTLEGHTAAVG
FT                   DLAYSPDGSTLATASRDNTVKLWSKEGSLITTLEGHTDLVLALAYSPDGSTLATASYDK
FT                   TVKLRSKEGSLITTLEGHTAAVLALAYSPDGSTLATASSDNTVKLWSKEGSLITTLEGH
FT                   TDLVNTLAYSPDGSTLATASRDNTVKLWSKEGSLITTLEGHTDAIWALAYSPDGSTLAT
FT                   ASDDNTVKLWSKEGSLITTLEGHTDAVGDLAYSPDGSTLATASSDNTVKLWSKEGSLIT
FT                   TLEGHTYAIWDLAYSPDGSTLATASRDNTVKLWSKEGSLITTLEGHTDVIWALAYSLDG
FT                   STLATASRDKTVKLWNFELEDLLKRGCQWLSGYFIRHPQELELLTVCHSPAILSLAALG
FT                   LVRQGQVLAEAGNMEKARQKLQTALKWSPKLDLDPETEMKDRDAKKLVIKWAAPAKAEK
FT                   AKQLARQGKVSDSILIFRELQSWQDTDKAVEISASSWNSLCWFGSLHRKAKSVMFACEK
FT                   AVAFDPSHGGRRDSRGLARALTNNPKGAIEDFEAYIKLSNRASDRKKQRQSWIDALKAG
FT                   KDPFTDEVLDSLFDE"
FT   gene            143424..143792
FT                   /locus_tag="AM1_B0192"
FT   CDS             143424..143792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0192"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31912"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL85"
FT                   /protein_id="ABW31912.1"
FT                   /translation="MKLQEYIKEDGSSPYQKWFNRLDAIAAAKVTVAVSRLELGNTSNV
FT                   KWFDGIGEYRINWGPGYRIYLIQDGKELIVLLGGGTKKDQQSDITKAKELSQEYKNRKK
FT                   QANIDPQKKKQRRKRKKK"
FT   gene            143798..144121
FT                   /locus_tag="AM1_B0193"
FT   CDS             143798..144121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0193"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31913"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL86"
FT                   /protein_id="ABW31913.1"
FT                   /translation="MALTRDFKETIHSRVQSDPEFATALLDEAAYLMLNGEPETARLIL
FT                   RDLVNATVGFEQLAVEANKPSKSLHRMLSAKGNPTMDSLNAIFTALRKRLNVDIQVHAV
FT                   SSS"
FT   gene            144263..145237
FT                   /locus_tag="AM1_B0194"
FT   CDS             144263..145237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0194"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31914"
FT                   /db_xref="GOA:A8ZL87"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL87"
FT                   /protein_id="ABW31914.1"
FT                   /translation="MELDAIPTPPASALKILENDVLSDLLRDKRSPSTRRAYRKDLTDF
FT                   FRKMFAEDPTPEMVGLFLGMDRHEALQLVARYKGILIELELAEATVNRRLSALRSLVSY
FT                   ARRAGQCTWGLEDIKGEKVIAYRDTSGVDLEDFQKMLAIPDRETQLGKRDYAILALLWE
FT                   TALRRGELNRCNVGDWEPEEKALWIQGKGRGTQKERVTVGNVSAIALEDWLSTRKHLED
FT                   DDPLIVALDIVHWGQRLSTTSIYKVVRNIATKAGISKVMSPHRVRHSSITAALDATGGN
FT                   VRAVQQLSRHAKPETVMRYDDNRKDLQGEVTGVLSRLLGEAED"
FT   gene            complement(145253..146704)
FT                   /locus_tag="AM1_B0195"
FT   CDS             complement(145253..146704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0195"
FT                   /product="pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31915"
FT                   /db_xref="GOA:A8ZL88"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL88"
FT                   /protein_id="ABW31915.1"
FT                   /translation="MLFRREKPSEDALGPNSYEIWQEKQVAIETAEIEKIEQKTSSKGY
FT                   LRWINPMTYVGGFWSSLLDDNRREAIKVIISMFGILATASAAVGLIWTVWDATEDRKLT
FT                   QERLITDRFSKAATLLSNEDNAVRIAAIYSLERIAKDSPRDHWTIMELLSAYVLERSPL
FT                   DEEDKVSKNEKDKASKQNPISKQSPSTEVTKKSSKSPKPIANDVQAALTVIGRRESGQD
FT                   QGKQLDLRSHDLSGADLSYADLSVAILRGANLIDANLSGANLRGANLIDANLRGANLID
FT                   ANLSDAYLSIANFIGANLGGANLSYSNLRKANLRHAHLSGANFRKANLSLADISKAHLG
FT                   HAHLNDADLSGAYFSGAYLYKANLSSAFLIGADLSRANLSDVILRGANLLSANLSDASL
FT                   SSADLNNAILLNTDLRETHLIQSQLESKEPPLICNSPLHNKIKIERNRDCDKVAAALHK
FT                   RLPKIFPSLDDAEIFVKEEQLKIWN"
FT   gene            complement(146819..147253)
FT                   /gene="umuD"
FT                   /locus_tag="AM1_B0196"
FT   CDS             complement(146819..147253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="umuD"
FT                   /locus_tag="AM1_B0196"
FT                   /product="SOS mutagenesis protein UmuD, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31916"
FT                   /db_xref="GOA:A8ZL89"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL89"
FT                   /protein_id="ABW31916.1"
FT                   /translation="MLVRSVHPVEWADSLCLPLLVEAISAGFPSPADDHLQNPLNLDEA
FT                   LIPHPGATFLMRVDGDSMKGCGIFSEDLVIVDRSLNPVDGSVIIAVLDGEFTVKRFRQS
FT                   NGRILLAAENPDYPPIVIQDGSDFHVWGVVTYVVHGLEVG"
FT   gene            complement(147335..147937)
FT                   /gene="udk"
FT                   /locus_tag="AM1_B0197"
FT   CDS             complement(147335..147937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udk"
FT                   /locus_tag="AM1_B0197"
FT                   /product="uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31917"
FT                   /db_xref="GOA:A8ZL90"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL90"
FT                   /protein_id="ABW31917.1"
FT                   /translation="MTTPKIIGIAGGSGAGKTTLAQALVDRLSGQALLISHDSYYRYMP
FT                   CGNYDLPESLDTDMMIAHLERLRSGYSVDLPIYDMIANSRKAETIQVHPHPFIIVEGIF
FT                   VLTLPEILECLDFKIYVETPDDLRMKRRIARDSKEKLRTKTSVIQEWQSNVMPTHKELV
FT                   MPGASVADLVVSGETAVGEIVQKILGEVKPMSLPDHL"
FT   gene            complement(147943..148110)
FT                   /locus_tag="AM1_B0198"
FT   CDS             complement(147943..148110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31918"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL91"
FT                   /protein_id="ABW31918.1"
FT                   /translation="MKKNRPPSKYAPKLPSTEKLRELRESGMTYKAIAEQYGASAQAVR
FT                   KRLLHNPERI"
FT   gene            148300..148422
FT                   /locus_tag="AM1_B0199"
FT   CDS             148300..148422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31919"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL92"
FT                   /protein_id="ABW31919.1"
FT                   /translation="MGFWLDLFEDFPSAVTGNDIRYFNGIQGVDFLSGYEYYYR"
FT   gene            148540..148737
FT                   /locus_tag="AM1_B0200"
FT   CDS             148540..148737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31920"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL93"
FT                   /protein_id="ABW31920.1"
FT                   /translation="MSGSMGYVQLEHTAQELEDIVFGLNEAENLDKYWKNLSPDQQENF
FT                   RRLTEFASEFLDLADQIDTD"
FT   gene            148752..149387
FT                   /locus_tag="AM1_B0201"
FT   CDS             148752..149387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31921"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL94"
FT                   /protein_id="ABW31921.1"
FT                   /translation="MNEQPIHNNPQILDKLCRRIDYLNDFPASIEGDDLDNAQLLGTLE
FT                   TDDFLGFVLGYSTEEGTFSADHFQMLSREENMKIKHYRLLKPVLPWPQPILGISVPGGE
FT                   PGKVTGIHRVPVVLKPCGVAQVWWGGDVAVLWEGLLDGDVKGRQDYEALMNQLWGCCEA
FT                   FLKGQGVRQVFTYNRDDEYPLEWYQGFLKRRRYVPVEDRKITVKKMLG"
FT   gene            149530..150063
FT                   /locus_tag="AM1_B0202"
FT   CDS             149530..150063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0202"
FT                   /product="staphylococcus nuclease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31922"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL95"
FT                   /protein_id="ABW31922.1"
FT                   /translation="MINRRAILSILLPPLLLGCSPPPQATNTNITSAKTTPAKILSTGD
FT                   GDSLKVRSPNGASTTTRIGCIDAPEYNQEYGPEAGQRLKALLPRGADIALRKITTDQRF
FT                   TRRGNQWVYSWLGKDMRSCITATLMVVPIQQISMLTQRMMRDHESSIFGVSQTQLCRGI
FT                   IAGIGGNIGPRVKV"
FT   gene            150105..150893
FT                   /locus_tag="AM1_B0203"
FT   CDS             150105..150893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31923"
FT                   /db_xref="GOA:A8ZL96"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL96"
FT                   /protein_id="ABW31923.1"
FT                   /translation="MSYSLSATKLKTYGQCPKSYQFRYEHKLPSPTIFGSTKLGNALHA
FT                   ALANVYKDWNYAYPLPSLDWFAVCWQQHTSELTPTQVHEGWVALQLYYERYISSLPQIR
FT                   KPLGIETKVRANLQVRNIEFTLSGRYDRLDYIDDGLELIDYKTSKSVNPPPSVDIQLGF
FT                   YYLILEQIYKKALKRLSLIYLRSNEKLTYEVTPDHHQQAQSLIEDMAMKLRCDQEWKPV
FT                   TGQHCDRCGYQKYCPAITTRPEPLPQDAREVTQVQLALGF"
FT   gene            complement(150904..151278)
FT                   /locus_tag="AM1_B0204"
FT   CDS             complement(150904..151278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0204"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31924"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL97"
FT                   /protein_id="ABW31924.1"
FT                   /translation="MTIDELRQLLNPLDASPTECDGMTRLCHTQLFRHNIPHQVYRGSC
FT                   RVDTQLIPLHFWIDLMEGLEGWCVDYRLGMWIRDKKLDVPHGVFNLAAFSQIHYQGKAI
FT                   EMPPLPESLFQVLMLAPNSP"
FT   gene            complement(151310..151585)
FT                   /locus_tag="AM1_B0205"
FT   CDS             complement(151310..151585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31925"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL98"
FT                   /protein_id="ABW31925.1"
FT                   /translation="MRSHFLEPNPAQCKSCIFRSPEDGGLVLGDDRTTEITEYLCSGKQ
FT                   HICHTNPELACRGGRDIQLRVFAALGMIDQPTDEALWLANQEFLRS"
FT   gene            complement(152075..153325)
FT                   /locus_tag="AM1_B0206"
FT   CDS             complement(152075..153325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0206"
FT                   /product="transposase, mutator family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31926"
FT                   /db_xref="GOA:A8ZL25"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL25"
FT                   /protein_id="ABW31926.1"
FT                   /translation="MSRKKKAPNRVDELLDELIGENPQPEDILGESGLLKRLSKRLVER
FT                   ALAGELTHHLQQSSNDQSGDENSNGPRNSRNGYSKKTVQSEQGEMDLSIPRDRCGEFEP
FT                   VLVPKGQRRIAGLDEKIIALYARGMTTRDIRAQLVELYGANISEALISDVTNSVMEEVK
FT                   DWRSRPLDEVYPIVYLDALYVNIKVNGQVSKRAVYVALAVTVEGNKELLGLWIGAAERE
FT                   GAKFWLSVLTDLKNRGTQDILIACCDGLKGFPQAIESVYPQTQVQVCIVHLIRNSLRHV
FT                   PWKESRAVAADLKPIYQAATLEESEAALDAFAHKWDETYPGISQIWIRHWDNVAPLFQY
FT                   PMAIRKVIYTTNAIESLNRSLRKVIKTKAVFPNEESVYKLMFLAMRNISKRWTRPILNW
FT                   KAALSHFAILFPTRFNY"
FT   gene            complement(153578..154366)
FT                   /locus_tag="AM1_B0207"
FT   CDS             complement(153578..154366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0207"
FT                   /product="transposase-associated IstB-like ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31927"
FT                   /db_xref="GOA:A8ZLA0"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLA0"
FT                   /protein_id="ABW31927.1"
FT                   /translation="MTLDIMLKRLGLSTVQRVLPELTPIAEKEAWSYTQFLERLVSEEI
FT                   AQRAENRIANQVAKAKFPFQATIETFDFTFKSDLKRQMLGRFLGPELVSEHRSLILEGP
FT                   PGTGKTHLCVSIAYKAIQNGFTARFTTATALINDLRVAHDLNLALKPYLQPNVLVIDEM
FT                   GYLGYGPGAADVLFQVVDQRYLKGKPILFTTNKPLKHWGRVLHDEELARAIIDRTLHHG
FT                   EYMKLTGASYRLKGRKIDLDLPAISERATVPKGGDDKSEN"
FT   gene            complement(154363..155826)
FT                   /locus_tag="AM1_B0208"
FT   CDS             complement(154363..155826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0208"
FT                   /product="transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31928"
FT                   /db_xref="GOA:A8ZLA1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLA1"
FT                   /protein_id="ABW31928.1"
FT                   /translation="MYKQLERYVVQKLRKKTVSQKEVRDLTGISEKSIQRIEKEPEITE
FT                   IDEEGFRKSRNMGRPSSVSQYEEQILEWFQEPRAPEDGLIKGQEILARLRQAGYTGGKT
FT                   AVYELVRRLRPKAPPKPILRFEGLPGEFSQHDFGQRWVTFADGTRKLVRFFASRLKYSR
FT                   FVDIQIVDNEQQETVVRSLLKAFEHFGGVPMMGVFDNMSSAVKSREIQEDGSVKVHWTE
FT                   RFGQFVVDCGLIPLACWPYRPQEKGSVENLVGFVKGNFFCGRTFQDMEDVHQQLQAWMN
FT                   HVNEQRPCDATGEIPAVRLKREPLQPLNHNAQTYAFKVSVVVRLTARVHYRGIEYSVPG
FT                   HTVGQTVTLHLQQEQVSIYQGKRCLGVHPRFPENGKSSVLSEHAQEFFASPHKKPYAQR
FT                   QILLDLDPSVEPYLTELVHRRPQAWAEDVDLTYQLYEKVGRTELLAAIELAVEARCIGS
FT                   EYLLEFVEHPHACADSHLLQNTSEGGTAP"
FT   gene            complement(156048..156623)
FT                   /locus_tag="AM1_B0209"
FT   CDS             complement(156048..156623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31929"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLA2"
FT                   /protein_id="ABW31929.1"
FT                   /translation="MNSTTNTVTPATQPKAELQTVSQAHQFQPQDFSHERALGFGDSPS
FT                   ALAIFCNRANTNTWYTLDKDSEPVELLKPALTGYLISIEFVPTKYKGKPSHKLRFKMNA
FT                   HRPCTLEAGYDSTFAKGFLIAISNLTPEQLKQRITIEAIPADDDKVLFCAVWLGNQRIF
FT                   QRWDERTDWRLIARKAMDNVAELQRQEN"
FT   gene            complement(156620..156880)
FT                   /locus_tag="AM1_B0210"
FT   CDS             complement(156620..156880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31930"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLA3"
FT                   /protein_id="ABW31930.1"
FT                   /translation="MNKQMWNFMQRGRGVLQLKPLGCLSNHSPSFCSGCEPGQYYECQA
FT                   CGYLQPWCKGAADDYPEICDHCWGLVEQMHKTIKISMETEK"
FT   gene            complement(156877..157254)
FT                   /locus_tag="AM1_B0211"
FT   CDS             complement(156877..157254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0211"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31931"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLA4"
FT                   /protein_id="ABW31931.1"
FT                   /translation="MPMIRARYPDNWDEIATRVKDAANWRCTQCGKPCRKPGVEWLHFA
FT                   FWLMITHPEWFPMTSEGEEEKPQRFTLTVAHLDQDPQNNHPDNLKALCAPCHLRFDAPF
FT                   RKANAYTKQEWFGQVKLEDLS"
FT   gene            complement(157254..157664)
FT                   /locus_tag="AM1_B0212"
FT   CDS             complement(157254..157664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31932"
FT                   /db_xref="InterPro:IPR025475"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLA5"
FT                   /protein_id="ABW31932.1"
FT                   /translation="MPTIHIANLRKSRQLQPGVRCDRGTPLGNPFHMFAESERDRCIAA
FT                   FRVFLYEVAILGNEPSQDLIRRIAEQHKIMPSGSYKPFGRGAMMAALEALGQKSEVTLL
FT                   GWCHPKPCHCDVIKAFLDWKCPAPQQQTLEVL"
FT   gene            complement(157697..158029)
FT                   /locus_tag="AM1_B0213"
FT   CDS             complement(157697..158029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31933"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLA6"
FT                   /protein_id="ABW31933.1"
FT                   /translation="MNHTTLPRLVIDSIALPSYELHARPTGENDRKLNVFFGSRLIGYV
FT                   YINFIQGQSNYVGTTLRHQSFGPYSRRMEAAEAVLEAFNAGLTDEQRLRVALAHEMAEN
FT                   MTVIAC"
FT   gene            complement(158103..158483)
FT                   /locus_tag="AM1_B0214"
FT   CDS             complement(158103..158483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31934"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLA7"
FT                   /protein_id="ABW31934.1"
FT                   /translation="MQAHHLNLPEFLLNPPTVNLAYSPVAVMTVATAKNLMQSQELLLS
FT                   GAQKLFNPAVWPQLEPEIERIPFDRQKAQCFRDCVAYLMAEATTLRSERRHVDALKHME
FT                   TALMLEALIHGGYVDVPSISEQ"
FT   gene            complement(158575..159231)
FT                   /locus_tag="AM1_B0215"
FT   CDS             complement(158575..159231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31935"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLA8"
FT                   /protein_id="ABW31935.1"
FT                   /translation="MTAALDNNATRNALTKAIKEHIATKENIDPSKSQKVNIKKYIVKQ
FT                   YKPDDPTGQDKLAKFAWELHHGNRNLRNRDHVLELFGLLTLEATGLEQRKTNKAKCSPL
FT                   KEAVFKVLKQVAGQDILMIVALNELMDQLTVTRINSWETFFKQLAIKRTELESLADTVY
FT                   ELSGVSPGAVEDLDAVIVPLYNEAKGQDIKAINWERRSWWDWAHNHLLEQVSKAA"
FT   gene            complement(159295..159621)
FT                   /locus_tag="AM1_B0216"
FT   CDS             complement(159295..159621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31936"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLA9"
FT                   /protein_id="ABW31936.1"
FT                   /translation="MKPTTRYKLIPRVRFITTIELHDQQTAILNRLVLSSKDLTDDEAL
FT                   DLWLSLNPYIHTFQHSTPRDIFSSLRYAALAALPDNPKPSYPVELLNSVRSEIEADGQD
FT                   FICC"
FT   gene            complement(159798..160175)
FT                   /locus_tag="AM1_B0217"
FT   CDS             complement(159798..160175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31937"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLB0"
FT                   /protein_id="ABW31937.1"
FT                   /translation="MITASELQAELAHCHCSESHYQHWLGIRYTEGVKTLAEKGESFWL
FT                   LDAIASYQRVRLIKYNPNLQEFQLWLLTVNDDHSAVLACYEDSPSTCSPVITQDIPFTD
FT                   FVLPEIKLYVEYGVVLLPSEH"
FT   gene            complement(160246..160548)
FT                   /locus_tag="AM1_B0218"
FT   CDS             complement(160246..160548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31938"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLB1"
FT                   /protein_id="ABW31938.1"
FT                   /translation="MTTLTEAPTTVTELLQLVDSQVTDPLHPEVIAVEMQIEKYPGVRE
FT                   GGDLFEVYAPVKSKPGLIQPRLESWVKTFYGDDHWLADWRTIPTTRQIKAENEEF"
FT   gene            160514..160651
FT                   /locus_tag="AM1_B0219"
FT   CDS             160514..160651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31939"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLB2"
FT                   /protein_id="ABW31939.1"
FT                   /translation="MTVVGASVKVVIVIAFDWVLTRASENLPGDRMPLFVCNNYITLSV
FT                   "
FT   gene            160740..160937
FT                   /locus_tag="AM1_B0220"
FT   CDS             160740..160937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31940"
FT                   /db_xref="GOA:A8ZLB3"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR012869"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLB3"
FT                   /protein_id="ABW31940.1"
FT                   /translation="MCGVGIVAMTNKSRMTRINITVPEDLLEEFKEYCDSQVRSVSSQI
FT                   QFFMKQAVESNQKQKGNESS"
FT   gene            160986..161231
FT                   /locus_tag="AM1_B0221"
FT   CDS             160986..161231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31941"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLB4"
FT                   /protein_id="ABW31941.1"
FT                   /translation="MTNSNPQRWTDDRLDALAASTQSLLAATQANTKAIGENSELMQKV
FT                   IEGQLAMQTLHGQLAEQTLQLKRAVDYLLSKDGGQS"
FT   gene            161235..161453
FT                   /locus_tag="AM1_B0223"
FT   CDS             161235..161453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31943"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLB5"
FT                   /protein_id="ABW31943.1"
FT                   /translation="MESEEIIIRYYRNPIPVMVDPGQNHPRHEHDLLLGWICQGKDRSP
FT                   VLKNFPNAEIVAKAKSEAKPYLTLVKQ"
FT   gene            complement(161422..161844)
FT                   /locus_tag="AM1_B0222"
FT   CDS             complement(161422..161844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31942"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLB6"
FT                   /protein_id="ABW31942.1"
FT                   /translation="MDLRDFQDKSLADLEEIFLEPPDTGSDALLSSGLALKTIQDKKLY
FT                   LPDSKGFKVYVEENLGVTYIHAFRCIQAAELVLFLQEHFSVLPQSESAARPLVKLSRAN
FT                   QLKAWGEVVRITAGDKWAPGKDRIKKTIASLGLDKA"
FT   gene            161954..163282
FT                   /locus_tag="AM1_B0224"
FT   CDS             161954..163282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31944"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLB7"
FT                   /protein_id="ABW31944.1"
FT                   /translation="MTKLISKLVSAKTSDPQGDLSANSQIDTAPQLSVEDIWDTLADRD
FT                   LYRLSIEIDSGLRLSARLDAEDLGLDPHVVDELAGGYRKAFSEAFTKARNQLSGLQKKF
FT                   NKKFTIYVKPFRFIDGSIINDAVDFAQEIKKEAASLRQGLVDTYTDQLKTFLVELEQKL
FT                   NETIPGKKKQIEKALIYYAGEFPSIDDFSGSLQVIIDGPVQLTSLKNKLKADADLQAEL
FT                   AKKKRLTAKQKKEAQEIQERIKTSQLMLNGIAQAVQQSRVACLDEGWELLADLIDRFGA
FT                   SPDGKLTTKDQSAINSTFSRLELLEKHNPEISKHLAEARKLHEVMQGTPTPEQAQDAYD
FT                   KFSGFLAQQSKSASGEGAEKLQKSLQFTNDYKALVTKLEKLIETPDAETLAELEAGQLA
FT                   NIETTLTRRVTNLKRLTKKAQESAKYANEQAVAHGGVDPVVGF"
FT   gene            complement(163443..163595)
FT                   /locus_tag="AM1_B0225"
FT   CDS             complement(163443..163595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31945"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLB8"
FT                   /protein_id="ABW31945.1"
FT                   /translation="MFISTSFYDIICCLLGKFFCYYWNAPMQNIFKKIEYRKIIFPDMS
FT                   FKQNY"
FT   gene            complement(163623..163736)
FT                   /locus_tag="AM1_B0226"
FT   CDS             complement(163623..163736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31946"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLB9"
FT                   /protein_id="ABW31946.1"
FT                   /translation="MSFYLGTLKRKELQACNISITGKDRTVQLIQKLPFKE"
FT   gene            163874..164020
FT                   /locus_tag="AM1_B0227"
FT   CDS             163874..164020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31947"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLC0"
FT                   /protein_id="ABW31947.1"
FT                   /translation="MLYSLNGPLSNKILALGIKSKKSLKNSLTLKMVVLKYSQLNKQVQ
FT                   FRD"
FT   gene            164585..165127
FT                   /pseudo
FT                   /locus_tag="AM1_B0228"
FT                   /note="AAA ATPase"
FT   gene            165135..165743
FT                   /locus_tag="AM1_B0229"
FT   CDS             165135..165743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31948"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLC1"
FT                   /protein_id="ABW31948.1"
FT                   /translation="MGWTIKGNRPQVSQGLISLAELDQMCAEIQQVKFTDAMVDAFTEI
FT                   IHALIRDGFVISARRRVKLLQLVQCYAYIQGDEQVYLEHLHELLPQCCWKSKIEEIREI
FT                   KKLIETSAPIAKKKLADIAKAAQGEVSRLEEQLNNQMLDHTHHVNAADFARTQLTNLSS
FT                   SLDKVQADLCRNGASQKAKAETELKAQSDRINELVEGLY"
FT   gene            165746..167197
FT                   /locus_tag="AM1_B0230"
FT   CDS             165746..167197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31949"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLC2"
FT                   /protein_id="ABW31949.1"
FT                   /translation="MYTELKAQDLNPITTEVSETSKLFWQDYLNSNPAMVEVTSETNIK
FT                   TLNSFALEVFHRLYYSPDPEWLPEKPEHQWARVLHNQLSESEEFQNLTLTCAGDPLGAA
FT                   IAAQSMITNLYRQLEEASDEQEIDELDTLRAQARQAKRDGREDLFQQLQAQGQAMSQAA
FT                   QAFAQKLEEKEGEGIGESVEDAEGEVQEKKDELEALGMSWGNESGDRNPTPTGEKLKLA
FT                   ALIEQRPQLKKILALAGNALETANRKRRQHQTETGYGELVGITTGNDVSQILPQELARL
FT                   SDSRQKLSFYRDFLEGQLFQNDLQAPEEKGKGPMVICLDCSGSMVKGNRFLWSKALIVA
FT                   LVKLANEQERVVSLVLFESICYDPIYFHPREDIDQLIRLLVTSPTDGGTEFQRPLEQAR
FT                   DIIEQDEDYSEADIVFITDGIAPLSSVFLQEYSDSLEKLKTDLFLLEIEPKQGWSNELR
FT                   TLASQSWVIDANGNFEELGAVFTAC"
FT   gene            167454..167873
FT                   /locus_tag="AM1_B0231"
FT   CDS             167454..167873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31950"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLC3"
FT                   /protein_id="ABW31950.1"
FT                   /translation="MKLSEIKEAVIVAFAKQHQISVTTTAELKQAAKQLWPEQTYNFRK
FT                   AQTWLNFAEPLGVDIGDYSAPTPRHDRKLSDIKAEVCKHYEVKDTPALKAKLKSWGIAY
FT                   DKLSTRKAWEELLAGCKASQKGQLIELIDPLGVAA"
FT   gene            complement(167920..170421)
FT                   /locus_tag="AM1_B0232"
FT   CDS             complement(167920..170421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0232"
FT                   /product="haemagglutination activity domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31951"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLC4"
FT                   /protein_id="ABW31951.1"
FT                   /translation="MNKSVLLISVLSIWSLLFKSGLAQVTSDQTLLRENSVVELQNNRI
FT                   LIKGGASRGSTLFHSLKELSVGTGQEVYFNNPSNINLILTRVTGGNRSNIFGTLGVLGD
FT                   ADLFLMNPSGIFFGPHSKLDLNGSFIGTTASSLIFDQDIEFSAENPQNLPNLTIGVPLG
FT                   LQFNSRSADIIAKGPRFQLTSTNPFVTFSGRTGSQEFDLTVKPNKTLALLGTNLDLRGS
FT                   ILTAPGGSIQLGGVKSGYVGISPSPLGWTFDYQNVQRFGDIHLSELALVDGTGMEGGPT
FT                   GFIQVQGGQVSITDGSVIRIGNLGNQTGRRLVIKAADSIKLIGTNLTTGTSSGLITTSL
FT                   ETGSGSDIYLSTPHLILKEGGLISANTLGFGSGGTLVINATEFIDVIGTSFDPNLLSFI
FT                   STSTFGVGNAGDIIITTKHLRVKDGGLVTSATLAAGQGGNIKVSASDGIVLVGANNALS
FT                   SSSLASGNAGDLFIQTKRLLIKDGARVDAATFAGGNAGDVIITAVDEIIVSGVDQGSQD
FT                   PSLISSSTIQLSPELQSGFQVSPIPTGEAGSVSIQTKALRVSDGAEITVRNDEIGNAGT
FT                   LHINADQILLKNQGNISATSSAGKGGDIDLQIRNYLLMRNNSLITAEGRGINDGGNIKI
FT                   TASKIVAIPSENSDIFASSSVGKGGQIIITAKELFGFRASGQLTNFSDIVSFSQNEPQI
FT                   NGFVAILFPDGLKKLPETIVVPKTITTKCRPGQTLGNSTFVDIGRGGIPLGPHHLQTPP
FT                   SVWQDLRQPQLLKQKSPSSKLPVKPGSSGVENNNLSSNSASPPTIVEAQGWIRDKKGNI
FT                   FLSANASELIAYNSGQPVATC"
FT   gene            170665..171159
FT                   /locus_tag="AM1_B0233"
FT   CDS             170665..171159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0233"
FT                   /product="acetyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31952"
FT                   /db_xref="GOA:A8ZLC5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLC5"
FT                   /protein_id="ABW31952.1"
FT                   /translation="MITFTWTTADHILQLRHQVLRPGLPIAEVIFPEDQDQETRHYGAF
FT                   SQQGEVICCVTLIPSTWHGELAWRLRAMATAPGWRNQGIGTGLIRYLLEDLQESNQARP
FT                   IWSNARVSSARFYRELGWREVSEQFENGNAGLSVTMLKEEKTLAAGHVPGAGVVSKISL
FT                   R"
FT   gene            171294..171419
FT                   /locus_tag="AM1_B0234"
FT   CDS             171294..171419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31953"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLC6"
FT                   /protein_id="ABW31953.1"
FT                   /translation="MGAGFGIGIRSEIAKQSVTFLPGSINHSSANFQNPYRLYIV"
FT   gene            complement(171494..171907)
FT                   /locus_tag="AM1_B0235"
FT   CDS             complement(171494..171907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31954"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLC7"
FT                   /protein_id="ABW31954.1"
FT                   /translation="MTQIPSLTHQQLELLRLAKKNSVEELQLFYEFPVVDGDEPPVVHP
FT                   QFIQELIDIHLIQVREIEASVLASEFQQSSWTEYCEDLDFPAQVDWDRWRQGIITQLGE
FT                   GVEQLMSPGKGLGQFTKVWIREIRIRAVQPSNL"
FT   gene            complement(171904..172197)
FT                   /locus_tag="AM1_B0236"
FT   CDS             complement(171904..172197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31955"
FT                   /db_xref="GOA:A8ZLC8"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLC8"
FT                   /protein_id="ABW31955.1"
FT                   /translation="MTSDNQDTTPTRFSSLVDLSKDLLPVLAVIGLLIGGLFFLINTSV
FT                   AAIVPTSESRLIDKIADNRIEIELLRKDMNSQFEGVNTRLDRIEQLLQNGQS"
FT   gene            complement(172333..172554)
FT                   /locus_tag="AM1_B0237"
FT   CDS             complement(172333..172554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31956"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLC9"
FT                   /protein_id="ABW31956.1"
FT                   /translation="MAVNKNSLKNLTIGKTAPDSNELLADTPLSVRLPASLDKIVRQMN
FT                   NRPQWLRSAIVNAAIADDSIDWPKNDKE"
FT   gene            172745..172957
FT                   /locus_tag="AM1_B0238"
FT   CDS             172745..172957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31957"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLD0"
FT                   /protein_id="ABW31957.1"
FT                   /translation="MFNLTDVETPILRFGTEFIDPNLLVAVEVYEDTLGDGEASQPATG
FT                   TKAHTGYIDGVCVAYRSDGTPVSIE"
FT   gene            173014..173358
FT                   /locus_tag="AM1_B0239"
FT   CDS             173014..173358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31958"
FT                   /db_xref="InterPro:IPR022243"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLD1"
FT                   /protein_id="ABW31958.1"
FT                   /translation="MEIIQSTPQTTIAKLNDRFRQGDHSLGKICTTQAVNSLPSADQQE
FT                   LFRLLRTFNDFTPGNDPYGEHDFGSIEFQGETYFFKIDYYDKSLRYGTEDPSDPAKTTR
FT                   VLTLMHSREY"
FT   gene            173374..173697
FT                   /locus_tag="AM1_B0240"
FT   CDS             173374..173697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31959"
FT                   /db_xref="GOA:A8ZLD2"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLD2"
FT                   /protein_id="ABW31959.1"
FT                   /translation="MPCLKSGHFQTNIGTMILTREKEMTTTSPDRLDRIESLLSTLGED
FT                   MQTVKADISTVKEDISELKEQTTKTNEKVETYQKASQQVVNLAFGLIVTAALAIILPVV
FT                   TNH"
FT   gene            173799..174065
FT                   /locus_tag="AM1_B0241"
FT   CDS             173799..174065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0241"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31960"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLD3"
FT                   /protein_id="ABW31960.1"
FT                   /translation="MKLRYRYRVYPTPVQANRLAQMFGCTRVVWNDALTFCQQQYAQGG
FT                   KYPGSTALMKQCITKAKQTEERSWLSSVSVVPLQQSVRDLEAV"
FT   gene            complement(174072..174872)
FT                   /locus_tag="AM1_B0242"
FT   CDS             complement(174072..174872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0242"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31961"
FT                   /db_xref="GOA:A8ZLD4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLD4"
FT                   /protein_id="ABW31961.1"
FT                   /translation="MPTAYDSDLTTLQWELLEPLIPAAKPGGRPRTTDMLSVLNAIFYL
FT                   VVTGCQWRQLPHDFPCWSTVYSYFRRWRDDGTWSQINEHLRMQVRVSEDRHPSPSAAIC
FT                   DAQSVKVGNPRCHLIGFDGGKMVKGRKRHVLVDTLGLVLMVMVTAANISDQRGAKILFW
FT                   KAQRQGASLSRLVRIWADAGYQGQALMKWVMDRFQYVLEVVKRSDNLAGFQVIPKRWIV
FT                   ERTFGWLLWSRRLNKDYEVLTRTAEALVYVAMIRLMVRRLAQEH"
FT   gene            175018..175914
FT                   /locus_tag="AM1_B0243"
FT   CDS             175018..175914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0243"
FT                   /product="transposase, IS605 family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31962"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLD5"
FT                   /protein_id="ABW31962.1"
FT                   /translation="MPRFKKRHSTQTARFTLRGFSVGTKLYLAKIGSIKVQWSRALPSE
FT                   PSSVTIIKDPSGRYFASFVVEKEPELLLWNDTSIGIDLGITTFATLSTGQKIEAPKPLK
FT                   RYLKKLARLQKTLSRCEKGSNRRQAAKLKVAQLHNRIKDIRTDFLHKLSTQLIIENQEI
FT                   NLEDLNVSGMLKNRRLSKAISDLGWRQFRTMLEAKAIMYGRDVNIISCWEPTSQTCSCC
FT                   GHREGRKQLGIREWQCLNCGVFHDRDINAALNIKAAGGHSEAINGCRRECKSEVNSAVL
FT                   SDASTRLVDKQLELFAS"
FT   gene            175944..176147
FT                   /locus_tag="AM1_B0244"
FT   CDS             175944..176147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0244"
FT                   /product="dioxygenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31963"
FT                   /db_xref="GOA:A8ZLD6"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLD6"
FT                   /protein_id="ABW31963.1"
FT                   /translation="MSKLYFRETVSNQIFTQSPYNIREQSRIRNDQDGIFRNGGDQLIT
FT                   ELTHDSATGAYAGIFNVGLELR"
FT   gene            176458..177621
FT                   /locus_tag="AM1_B0246"
FT   CDS             176458..177621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0246"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31965"
FT                   /db_xref="InterPro:IPR025938"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLD7"
FT                   /protein_id="ABW31965.1"
FT                   /translation="MILRVPVISPEGQPLMPTKPSRARRMVRDGKAVGKWNDAGVYYIQ
FT                   LTADPSDTQTQPIHLGCDPGKSYSGIAVQSAHFTLYTAHLVLPFQRIKERLGAAVIKNG
FT                   KVIKNVRGRALQRRVRRGRRINRKVPFHLRAHRQKRFNNRRQPKLPPSIKASRQMELRV
FT                   IKELSKIFPITSIVYEVVKADVDRTSGRKGAKSGKGFSPVMTAQYWAMEQLEAIAPVIK
FT                   RHGWQKDGNGTSQIRKHLGLIKCKDKKAQAPEAHAVDGIALAASQFTRYQASQSDSMDW
FT                   VGSIDVTPCQFRVITRPAYFRRALHFDNPGKGGTHKRKGGTVTPWVFRSGDLVVGEKAG
FT                   KVFRGWVGGYTKKAKSVSLYDHNWRRIGKFVVSKCTLLRRSNKLCVA"
FT   gene            complement(177607..177792)
FT                   /locus_tag="AM1_B0245"
FT   CDS             complement(177607..177792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31964"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLD8"
FT                   /protein_id="ABW31964.1"
FT                   /translation="MKLAIGLTQRWPSEAKSYLPMLWRKLCSASTQQNRVDLRLQRSKT
FT                   EGDSGQTKAGNLLGYA"
FT   gene            177863..178474
FT                   /locus_tag="AM1_B0247"
FT   CDS             177863..178474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31966"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLD9"
FT                   /protein_id="ABW31966.1"
FT                   /translation="MANNLLIIDPAELQPVNHLRPRQALLAALRTTHKAGWHLAMISDQ
FT                   SKIAKGERSLTEVLDCHQAAMNRYDQLIGVSMFTTNQGSEMVVTRCQIPDIGIFNTQST
FT                   LTQKIAKSFDATITGDWFLPPNPGLLMACMALHSSTFETTVMVGTGRFDALAVRNGLLL
FT                   MHPETFEQKGVTVGHSAHSVQQTTLQIRDMLGQNYSLTEN"
FT   gene            complement(178690..179169)
FT                   /locus_tag="AM1_B0248"
FT   CDS             complement(178690..179169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31967"
FT                   /db_xref="GOA:A8ZLE0"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLE0"
FT                   /protein_id="ABW31967.1"
FT                   /translation="MSQEDLSGHKKNSINTDDASTLEDQNILENSLEFYRNWMENFYKP
FT                   EEFRSNVKLWGSGILALSLWCLLGMLAWSHFEASRKFANEISSLKPQLEEDGTISLVHQ
FT                   QEIQLNEKANAMVDSTSNRLYTFLTPIVTAVTGYFFVSSATKPPIKQTDLGKPKG"
FT   gene            complement(179700..180119)
FT                   /locus_tag="AM1_B0249"
FT   CDS             complement(179700..180119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31968"
FT                   /db_xref="GOA:A8ZLE1"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLE1"
FT                   /protein_id="ABW31968.1"
FT                   /translation="MLKLSTMSSIIVWLLVNSIGGVVLGYHLAPLWFGIVELTGIAALV
FT                   GCISLPTLSDVVWLKKLRVGLFCFGSFLTMLAIYTASSIGFNPFIGWFMVLCFWMTLNL
FT                   AAQNLEGTLNYVVRGFLLYASAGLGLGLGYLLSAS"
FT   gene            complement(180119..180379)
FT                   /locus_tag="AM1_B0250"
FT   CDS             complement(180119..180379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31969"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLE2"
FT                   /protein_id="ABW31969.1"
FT                   /translation="MLMLGLSRNYVYSDMGRNPNPTFDHLEPLPRADNTTGKLAKSLSI
FT                   RLEEEVYEALATKYPGKGELTAWLRQQARIGAENEGLLTKS"
FT   gene            180588..180899
FT                   /locus_tag="AM1_B0251"
FT   CDS             180588..180899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31970"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLE3"
FT                   /protein_id="ABW31970.1"
FT                   /translation="MTTLLKTPTTVTELLQLVDAQVTDPLHPEVIAVELQIEQYPGVRE
FT                   GGDLFEVLAAVTSKPGLLGDRLRAWVQSEYGNDYRLADWRTIPTTRQIEAEKNFEDEF"
FT   gene            180967..181269
FT                   /locus_tag="AM1_B0252"
FT   CDS             180967..181269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31971"
FT                   /db_xref="GOA:A8ZLE4"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLE4"
FT                   /protein_id="ABW31971.1"
FT                   /translation="MNSSDTTQMPQWLDVLAKLATIVIAIVALISALASVNFFVVRSVV
FT                   AEQITPQFQQIDQRFQQVDQRLQQIDQRFQQVDQRFQQMDQRLERIEIKLDKITN"
FT   gene            complement(181353..181721)
FT                   /locus_tag="AM1_B0253"
FT   CDS             complement(181353..181721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31972"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLE5"
FT                   /protein_id="ABW31972.1"
FT                   /translation="MNLDRLFGSLNVANTIINGDFSGFELASYSDTPSKNSVGALNESL
FT                   FSNQAKNMGFLIQEWPEKTRVVMYNFSASNLLAEVEFNNDNPMLEMLLRRLCNPSYEIP
FT                   LNDFEAMKSQILQGIYVT"
FT   gene            complement(181778..181942)
FT                   /locus_tag="AM1_B0254"
FT   CDS             complement(181778..181942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31973"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLE6"
FT                   /protein_id="ABW31973.1"
FT                   /translation="MTDNPPNPVDSGPAEDSAQGGNAEEKALTALAGMLECRDRIRETI
FT                   NDLKTQKSS"
FT   gene            complement(181939..182064)
FT                   /locus_tag="AM1_B0255"
FT   CDS             complement(181939..182064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31974"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLE7"
FT                   /protein_id="ABW31974.1"
FT                   /translation="MPDRSPDPDYPLIAPRRPHWLGLRDYCLDFASQVEKMRVFP"
FT   gene            complement(182337..182591)
FT                   /locus_tag="AM1_B0256"
FT   CDS             complement(182337..182591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31975"
FT                   /db_xref="GOA:A8ZLE8"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLE8"
FT                   /protein_id="ABW31975.1"
FT                   /translation="MLADNDAAIQQRYAHWKMIEKEQDQAERAQRIKRVNSDIRKEGYL
FT                   FRAAHIALGLAIGVWATLYGVSLNKPSDTPAPVVQINQK"
FT   gene            complement(182609..183316)
FT                   /locus_tag="AM1_B0257"
FT   CDS             complement(182609..183316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31976"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLE9"
FT                   /protein_id="ABW31976.1"
FT                   /translation="MHNLDDILQLLEVSEETLGKILKACGWEGLTQFDDEQSEILIAIN
FT                   EGHNANGWSYVESYLRKVADQQGLGPEEYDRLASAITQAGATLGEYRETFADICQRFKG
FT                   GASAEEAVLPPADKPVKLTEAYDLPPADGEDNPLAGLSPEELTFINEGGKTAATITLSR
FT                   MQGFADKAAEEQERLEQAFLYCYRQEIAKSLRDPEFKAQFTLRLQRSMEGKKPPANEIS
FT                   GAATTIPLLSSTS"
FT   gene            complement(183423..184238)
FT                   /locus_tag="AM1_B0258"
FT   CDS             complement(183423..184238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31977"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLF0"
FT                   /protein_id="ABW31977.1"
FT                   /translation="MHSPYSLNQLGALVRPFLLSLQAPLQQFQLAVELVEKARSSNLLA
FT                   ITCRQKIFQTNINPNRMPMRWDFRDRDISLDTQHDVPARMLADNPYCLDIKIIGYGSVQ
FT                   GNRNPTNLGQLNLITLNWAGLELREQEGTVLSKLLKAWKTVTSLPHGLKRRINPAQNIL
FT                   QYLRMHILQVWQDFLSLSQVFLLRVIARIGSICRNDVLRLQRTSVYLALTATDPIFSLS
FT                   QRIVVHRATSLKPRQHPCLLLKARVNPVAVRHGEHVLIIAFSREVLCSP"
FT   gene            183897..184721
FT                   /locus_tag="AM1_B0259"
FT   CDS             183897..184721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0259"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31978"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLF1"
FT                   /protein_id="ABW31978.1"
FT                   /translation="MPKIGWVPITLHRPIPDDFDIKTVRVVRKHSGWYVVLCIQADVSI
FT                   PEVPPHGHSIGIDVGLEYFLSTSDGEQIARPRFFNKLHRKLELLQRCLKRKQKRSNQRA
FT                   KLIQRIGRVHEQIAASRLDWQFKLAHHLCDQAQTIFAEDLDFRIMAKGMLGKHTLDAGL
FT                   GQFLNVVLPWVCFKRGVYYVKVDPNGTSQECPDCGARVKKDLSVRIHECHECGSVKPRD
FT                   VASGQVINARGLSGVQIASGRDLSGFQVTDARQDRTKLEYFKSNLEKPALYA"
FT   gene            complement(184789..185073)
FT                   /locus_tag="AM1_B0260"
FT   CDS             complement(184789..185073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31979"
FT                   /db_xref="GOA:A8ZLF2"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLF2"
FT                   /protein_id="ABW31979.1"
FT                   /translation="MFIYLIAGSGCSFALSIAFLRRAIKSGKNYKPSVALGVGFALSFS
FT                   CTALFGVLAAVQQIPVEDNETMEAQQKYLIGRERPLAEFRKLPIQANSN"
FT   gene            185076..185204
FT                   /locus_tag="AM1_B0262"
FT   CDS             185076..185204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31981"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLF3"
FT                   /protein_id="ABW31981.1"
FT                   /translation="MSPYQCTYFFNRWVLAWVKILYRHCDALRAALGYRIAVSRNN"
FT   gene            complement(185201..185623)
FT                   /locus_tag="AM1_B0261"
FT   CDS             complement(185201..185623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31980"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLF4"
FT                   /protein_id="ABW31980.1"
FT                   /translation="MKANQTDQELIRVGRRYPHDSIHTRQYHALRRYYGADFSEVFFQA
FT                   AWAVLGPVGSALDGASFDEVQRLSTVGKHFKLALEAEALTLASGDESGNFAAGPVPGGL
FT                   TAQLDEGTPDLDTWEADSDNDDDDLPSAPIAGDPFG"
FT   gene            complement(185613..186620)
FT                   /locus_tag="AM1_B0263"
FT   CDS             complement(185613..186620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31982"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLF5"
FT                   /protein_id="ABW31982.1"
FT                   /translation="MDRDLTICTDLGSSLGKGCYYIDNNLHWIAQDNAVEEEKIRDLTA
FT                   DSCVIEYKDRAWTVGASAGNGIYETNIHQQKAEQASLRALGMLGKAIETENFTEGYVDL
FT                   TVLLPQGEGRYFKTLEANLEKGIYGSTFNGLKPNVKVRRVRVLPEGSGIASQIQDAEAI
FT                   AIMFGHKDISILYVREGRVITKQSLTLTGMGMIALINECGIHVSDELILATLICREVRN
FT                   KNGLKLAFSDKEELQSARRILKSAKAKVWPKISERFDRFRPLTTATKIYVTGGSHPVWG
FT                   PELKAKFGPKLRYLKTELEEMSAAFPDLSAPEFSGYKNRFTDSYLLIKGGTYES"
FT   gene            complement(187222..188004)
FT                   /locus_tag="AM1_B0264"
FT   CDS             complement(187222..188004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0264"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31983"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLF6"
FT                   /protein_id="ABW31983.1"
FT                   /translation="MAPTLRRTPRTGSGYIEPLLEIPNALPLHMVLVPGGTFMMGSPED
FT                   EPDRLGREDPQHEVTVPAFFMSRYPVTQAQWKVVAELETVERSLKSEPSYFKGENRPVE
FT                   QVSWYEAVEFCNRLDSLTKRPYRLPSEAEWEYACRAGTTTPYYFGETITNDVANYVGEE
FT                   TTPVDHFGIANAFGLSDMYGNVFEWCQDHWHDSYKGAPTDGSAWLSKNESAGRIRRGGS
FT                   WKHYPRICRSAYRNNDSPKSLSSNLGFRVVCSAPRPLQ"
FT   gene            complement(188558..189394)
FT                   /locus_tag="AM1_B0265"
FT   CDS             complement(188558..189394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="contains DUF323 domain"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31984"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLF7"
FT                   /protein_id="ABW31984.1"
FT                   /translation="MSYTITKTKAPLQFYDEILAEGVLPLRMMQIPAGTFLMGSPNEEV
FT                   DRSDFEGPQHEVTLSRFFMAQYPVTQAQWRVVAAMEQVNRELDSEPSNFKGDLNPVEKV
FT                   SWYDAVEFCDRITNLTNRQYRLPTEAEWEYACRADTTTPFHFGETITTDLANYDGIGDE
FT                   SIGLSGSYGGGPKGEYRQQTTPVDHFGGGNAFGLSDLHGNVWEWCQDHWHDYDGGPTDG
FT                   SAWISENDSAYRVRRGGSWDFNPRYCRSAYRYYDNPKFRDNSIGFRVVCSAPRSLP"
FT   gene            complement(189437..193042)
FT                   /locus_tag="AM1_B0266"
FT   CDS             complement(189437..193042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0266"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31985"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLF8"
FT                   /protein_id="ABW31985.1"
FT                   /translation="MSTEQFVSALTEYKLDPTEIAEILWLALREPEKFDVSDVDQENKD
FT                   PDDNLELEDVDDDNLDLENGNEEDAGNEEDDDNDNQNDEVDEPDFGVAPELPSGKLPQK
FT                   ALPISIPDPDILDETLPLVRALKPILKQIDSQFCSSVNEAETVERIAETDIWSPILEPD
FT                   QEPWYEVALVIDSSPAMDLWQRLIQDIRRLLRCYGSFRDFRVWQLNVKQGEVGICAAPD
FT                   PVLRSPNALLTPDARRLILVFSDCTANYWWDGSLQPILSLWGDSTPTAIWQVLPDWMWK
FT                   RTALGIGEYVAVRSRTPGAKNTKLTPIYMSLRSTVNRGRRRSDQEPDQTQETQSSSPVC
FT                   IPIITSDSEYLGAWSRMLAGDRRYSAPGFMLPSTGWSATPTSSELESEEIVDGLLEDFR
FT                   LRATPEARRLAALLSAAPVITLPVMRLIRASDEFLPGSSPLPVAEVFLGGLLTKAPEQP
FT                   PELESEVVQYLFPETVRNRLLDVLPNVDKLEVIEKVSQHVAERLNCTLADFQALLLSPD
FT                   LKDEVDQYGLKAFAKVTAQILRTAGSDFAEIVRQLESQQRQDDSGLENRQNEVAWLEGF
FT                   THETLTYQVSEYINFPELEAFEFDEGVLANDIEILPKVPLTTLLISFDERSPKADQYFV
FT                   DAWLVPNPKNYNAQTGEGVQYLSTLDINRYGNGSSDSRLSEGITFQDIPSVLASLLEQA
FT                   RTQTEKTVFTIHLFLPQSLLDLPIEQMGIPSLSNTDDPIGIGRDCNFVVLRLKERVESL
FT                   QYTQKLQLQWAQLQERWNDNSNDAFDNWPFGQPEDLISLSQGSRLGLTLGSGFQSAEVR
FT                   GVLENGTPIVLWSRKEKITDNWQQFLNENILNGTMEQIPMKVFAVRLAATEDNPLFHWA
FT                   RDLAFLWDDPLLVPPSQQDIFPPPLQTGDFTILRLQPEESISDAINVESFDFTVAKLIL
FT                   SQKKWETEQHQQSANRYIERLLDKIDLEMVSIPAGTFMMGSPNTEPERLVREGPQHQVT
FT                   VESFFIGRYPITQAQWRVVANQPQIERELETDPARFKGDNRPIEKVSWFDAIEFCDRLS
FT                   RYTGREYRLPTEAEWEYACRAGTTTPFHFGDMITTDVANYSGSAFVDGPKGERRGETTP
FT                   IDYFSFANAFGLSDMHGNVWEWCQDYWHVNYYDAPTDGSAWLSENESTRRMRRGGSWLG
FT                   PPRNCRSASRLNDGPGGRDNLIGFRVVCSAPRSLP"
FT   gene            complement(193057..194238)
FT                   /locus_tag="AM1_B0267"
FT   CDS             complement(193057..194238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0267"
FT                   /product="ATPase, AAA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31986"
FT                   /db_xref="GOA:A8ZLF9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLF9"
FT                   /protein_id="ABW31986.1"
FT                   /translation="MTDWKFFTAQPNEDRTPRQAALKPIQERPAWRQFMSQAIFEDKWA
FT                   GASKTRWKQLRDSNRLDTRSKERGESFRIRQSEGRQSEIISAINSALALRRPLLITGNP
FT                   GSGKTSLAYAIAYELQLGPVLLWPITTRSKLSDAQYRYDAIARLQDTQFDKSELELQLL
FT                   LAKSDDQPLDHNKIDELKQGRNLGDYIQLGPVGTAFLPSHLPRVLLIDEIDKSELNLPN
FT                   DLLNLFEEGSFEIPELVRYKTDVPVPVRTEDEGLPADIEQGKVTCYEFPLVIMTSNGER
FT                   DFPPAFLRRCLRITMPDPSDSAVLTHIVGAHFERKDRPKTELPWSELEPKVAQLIENFA
FT                   KDLQRKQSSLATDQLLNLIYMVRQSQLSGSGLSEEDKETELEMLKQILLRRLT"
FT   gene            complement(194265..196211)
FT                   /locus_tag="AM1_B0268"
FT   CDS             complement(194265..196211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0268"
FT                   /product="nucleoside phosphorylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31987"
FT                   /db_xref="GOA:A8ZLG0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLG0"
FT                   /protein_id="ABW31987.1"
FT                   /translation="MVQDSLKAVILTALPVEFKEVRKFVADPTRIIHPEGNRYEKGTFK
FT                   ANGRIWTVGIVQTGAGDSRSALQTERAITYFDPDVVFFVGVAGGLKDVDIGDVVASTKI
FT                   YGYESGKAEEEFKPRPHIGLSGFSLVEEAKAEARSEAPNWLARVKQPYNTTPRLRVGPI
FT                   AVGEKVVASKESNVYKLLRKNYSDALAVEMEGYGFLEAVNARDKPLSAIVIRGISDLID
FT                   HKNDGKGQKSEDKRQQKASHHASALAFHLLANYDPKPRIPGVGKTSYKVETKFWDDLFI
FT                   CLGDYDLDFLEAALREVLDNRKDDLLGSIETFAALKQALIRLDDQVLAVSWVGHLIKKL
FT                   QDFPNNENECEIKPEWQVWYDANAPTELEVDPKQEPSQKYLLVTLEPVVDTEPGDASAT
FT                   VDTVRILAELYVCGEQTRTSLLTDYPKCSIEQVWEHLSEVIPNAGEVRAVEIFLSWQHF
FT                   GQPVHKWKIWTSLGKTRRKPLWRFPYNTVVRSLDRLLDPLWSELWIKDLKVRMQQLKTM
FT                   QQPLDQHTCCVECFTDEIFEDELPEKLVFKLWETLPEDIDELRSLISGVIEEKVPLWLW
FT                   TYETPVNGDEFKKTVDKVLKPENFTESAALGESILTHRKKIQELGFLFDNCTRIPCLPT
FT                   LAVNESGRLTQPT"
FT   gene            196299..196853
FT                   /locus_tag="AM1_B0269"
FT   CDS             196299..196853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31988"
FT                   /db_xref="GOA:A8ZLG1"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLG1"
FT                   /protein_id="ABW31988.1"
FT                   /translation="MDRTEKTLQIFLEEYRVLKAEQNSRIGFRDNLLYVTLGLFGGILS
FT                   FALTNDNGTNALLVVPWVCIVMGWTYVVNDEKISAIGRYIRHNLEKRISNLIEGSADSE
FT                   SLFGWEKAHRSDSKRTSRKYLQLLVDEVAFVFSGLAAIVLFCLSSTNCPTPIIILIAFE
FT                   SFFLISLGITIAIYADLAKGR"
FT   gene            complement(196909..197709)
FT                   /locus_tag="AM1_B0270"
FT   CDS             complement(196909..197709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31989"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLG2"
FT                   /protein_id="ABW31989.1"
FT                   /translation="MANTVDSLTLFEYECTNESYTIDLGDDVPLTLMLIPAGELWISND
FT                   ENESGDTQDKQRQKCIQLPQFLMGTTPVTQEQWRVVAGYEEQDGTVDLSPSAFESDDFP
FT                   VESVSWYEAVEFCKRLSSKTGKNFHLPSETQWEYACRAETQTAYHFGQKITPKLANYLE
FT                   DEMIGQTSAVESYSPNRWGLYDMHGNVWEWCQDYYGSDYLDVPSDGSPFWEGDRIDDSS
FT                   VIRGGSWYSYPWDCRSACRSYNSPESRLSHIGFRVVCSAPRPLQ"
FT   gene            197856..201809
FT                   /locus_tag="AM1_B0272"
FT   CDS             197856..201809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="Shows homology to DNA helicase but no HMM support"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31991"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR024385"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLG3"
FT                   /protein_id="ABW31991.1"
FT                   /translation="MLNITTINSNIKDGAKYYTKEESYYSQNKEIQSMTQTEWFGSMAP
FT                   DEHYSAELFTEMFYGNLPNGGRMRNEVKGKGQERLAYDLTFSVPGKSLSMSIHGPNGDK
FT                   RLWNAHVETIKEVLAIVEERYAAARIQANNDRQVVKTSSIAAALVHHHETRAGDPHVHT
FT                   HVVLFNGTLCPDGEYRAMYIEPLIRSGILGDLYDQKMALKVQELGYEIRETKTGFDLAG
FT                   ATDEQIKKFSKRSTEIEDYLKEKGWSNTPKNRQKATFETRIGKDITESLEQKQERWGEE
FT                   MASVGFHGLTPSDQPIKPESQETPRELLDAAIEHLTEHQSSFNAEDIQRFVFSHLRSFD
FT                   EKPLNTEISKHPDLLTAWDGRLTTQTAVDRDQRILDIVLFKDSKVEPLNPTADFSDTML
FT                   NSGQAEAMKRLLSFSDQYQILKGLAGTGKTTALGLAREQLPPDVDIKVFAPTHNAKHQI
FT                   SEAFGLKGATIASFVVSPPPEGANQLWIFDEAGMFGSADMEKILQKAEQVGARCWFVGD
FT                   TGQNASISAGAPVRMLMNRGVTVHRLDQIIRQQNKEQLRAVELIADGHGVEALRALEKN
FT                   GNIREVEDSETKLTSAVAYYMEKPKHRRDKTLVVVGTNAERFGFTKLLRAELIKEGQLT
FT                   KNTEFTQLQRRNLSKAQKKRAENYNKGDLLVLHKKHRLYTQLQTHVPYKVLAVEGKKLK
FT                   VQSLGGRNFTINPAEHELTQAYTTRRNQIAVGDKLRFTSTNMKKDIHNNAFLTCTDIKD
FT                   QIATVKDKHGRVHHLDLTKPLQIDHDWATTTYRSQGSTNSETLYIASLNPTSARESFYV
FT                   GISRNKTKYLTVFTEDLSKLQEWVAQSNAQENALEILFDPHAGWSPTYDKEERPFGLDE
FT                   DTWTEMKGSGIHPNLLTSNHLRSEAPDPYGSIRDNPLVAALLEAEFTKSKYGKGQEVTG
FT                   KMKQYLHGASTVEGHTVYDHEKEYGRIAQGGGWIGYGGVDLLSVIEGNPQPSQYCQVKP
FT                   KTPRIFDGKENKYETPKGVDQQVFLPHIPHEIEERIYQRNGISPTAEERTKGIWSVADK
FT                   YNLPLVITEGLKKTWASLSQGHLTVGLPGVTALYRAKNEHDERLPQRELTEYGKALAKP
FT                   GRQITLAFDQDTKVSSILNVRRDLVRTIELMQTRGVVCKIAQWKPELGKGLDDLIVKAG
FT                   PKAYNLAIANAVRPDAEIKRHYRTQYNAITKRAIKRFGDIPKERLDMEVYSYCLSPDNG
FT                   ATINDAHRFLSASDHMRSAEPGDYKRYMLAIHKTHGIYQDILASGKPPNELVTKLVEHS
FT                   VYEQLAEELKEKDLLYPEQTLSDNQSQGYSVGF"
FT   gene            complement(201806..202180)
FT                   /locus_tag="AM1_B0271"
FT   CDS             complement(201806..202180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31990"
FT                   /db_xref="GOA:A8ZLG4"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLG4"
FT                   /protein_id="ABW31990.1"
FT                   /translation="MCEWTKEDFAKNSTRLRIPFADFRECGVEITSFDVAFRFDRKVDL
FT                   EAINKGPVPGETRDKSSPAYIPVEEPASPVSAPVAVAGPSFPLIPVVGIAFVIVGMGLV
FT                   GLKVRNLVRAKAKAKEQEPA"
FT   gene            complement(202267..203802)
FT                   /locus_tag="AM1_B0273"
FT   CDS             complement(202267..203802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31992"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLG5"
FT                   /protein_id="ABW31992.1"
FT                   /translation="MANPINDKYQELRRTEQEIFDEYPLLKVGKPLIQTLAMPALVAGA
FT                   ATHLPLAGPAVAGAIGQGTDFIQNNLHGLREAQLTKHFAEMRQNIQPGFAYWARQRAFD
FT                   DWATLRSADLLGKSDMLTRPLAGYLAPTAVGKAMMDAGPMVAKYVTQLPISTAIGRTID
FT                   QTQAIFSNVQDWIHSSYQNIREYGIHAEKFVQKELNKLSNNQDPKQANQQNVSQEPQTQ
FT                   NGHKVDAPATVLSNSETQIEPETTQAKQEKKPEQTLRDEPQKQAPDADLQETPEYLDDG
FT                   IPEFLTKSKQEPDKIAQDYFQALASEIAGKGMNADGMRFFFNNQEVFRLSDGQPDLNHT
FT                   SVSNEQMAAFKAALEDPANFKGTLEIRQGNRLLLSIIDGQVFDPMQKVQDLLQIKMTAP
FT                   AETIPETTTQGFYQKASEGVQSTGIDEVVDIAKNAINNGHSQAEITSMLLENNPHIKAI
FT                   ESKHGPDMARDTAHDLIQSASDELLMARPDIQQDQAQRQEHSQQQDQTVSQSF"
FT   gene            complement(203854..204297)
FT                   /locus_tag="AM1_B0274"
FT   CDS             complement(203854..204297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31993"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLG6"
FT                   /protein_id="ABW31993.1"
FT                   /translation="MDNLSQRYVDDHSLSQDGHKAGQVSEKAVEDSLRLLVEGIYFLYQ
FT                   QRQQQVKISYTSPDDLFNNVRDALAVGTDDKTLSVFMDQHQAVQMTAQQYPENVEGLKQ
FT                   DVIADAKQDLLVEQQKNTPEFKQALDLMQKQQQAPAQSQGQSF"
FT   gene            complement(204330..206183)
FT                   /locus_tag="AM1_B0275"
FT   CDS             complement(204330..206183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31994"
FT                   /db_xref="GOA:A8ZLG7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLG7"
FT                   /protein_id="ABW31994.1"
FT                   /translation="MQSSTQPPPRPPQPGQQQGLGTFVGPIIAVVILVVCVFILNGKPK
FT                   TEIPDGMPNARFSTKDEIRAGNREARRQIAKGELTETAFELNPETGITFAFSNPGGVFP
FT                   GLSGTGKSKNFIIPTLRSAIKQKHSIFVTDVEGELIKATAAYAHANGYKGRIYAYAPGV
FT                   QSLSPLGKLVQFGGSFNFLEVMRHPNDKAKAQEISRGLNVNTQEDTQKRHAYFGPQSDA
FT                   LMETALMLAKGSRYPDMLMVWAIITLPDLAERLDIAAKTGRLGKELSFYAKQSSAGLRA
FT                   VASQGKGKGDSPSASIQSSAFNMFSKFIDPEVAKAFLPSTIPLEHSGPSIVYCRLDRTQ
FT                   LKATSPLVATALHLWLNYNLDPQRNRDRNLTLISDEANFFILPDLSALAKLARKKGGTF
FT                   WLAYQQNSAMEEAYGKAQWKGIEANLKNKAYFNTGEHDYHKIVSESLGKKTIVINTANS
FT                   SHSSNNRTTGSSDQLKEVPLVPAEKLDEQKLAGRCVISSASYPHPISFLDKPIPYDPNS
FT                   KTAKMEKQCVKAWEEKLLPALQEEHASNQTSFTDPETGKVTTVTIEDEIALRERVANSL
FT                   LPHPDVVRARELAAKKAKEKAEKEAQAQAQGDDKPVTVLPL"
FT   gene            complement(206311..206736)
FT                   /locus_tag="AM1_B0276"
FT   CDS             complement(206311..206736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31995"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLG8"
FT                   /protein_id="ABW31995.1"
FT                   /translation="MKYKLLLPLVLLFVSIPLSARADVNSCTQKLIKERIVFSPWAFTG
FT                   GDHVAKTEYNGATYHLIYLIDEAGRETTVVIKENSSVCEAAYYNPTGGGRDAEEVLPGP
FT                   VFKALVPAATARNNERAKQNQALEREITEEYRRRKGN"
FT   gene            complement(206754..207743)
FT                   /locus_tag="AM1_B0277"
FT   CDS             complement(206754..207743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0277"
FT                   /product="M23 peptidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31996"
FT                   /db_xref="GOA:A8ZLG9"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLG9"
FT                   /protein_id="ABW31996.1"
FT                   /translation="MTSALESTGTQNQVDVAVAIMNRVVSPKHPNTITDVVYQPKQYQP
FT                   NFGFSPVNTKEEAIARIALKTGSIQSAISEYETLEAALNDPNQIKASQIFLGGATDFRG
FT                   QKLLHNSKPGDPYRGNVGANWYLQESRDASVAATTLGVLGIETTAADIAAIEAAAVQTV
FT                   ANRAAYCSQIGALASSQGVPTGIIQPEGNGIATGDFGNPNPGYPVTSRFGHRSLGWHGG
FT                   IDLGTPVGTPVNASDGGIVEEIGYQAGGYGNYVIINHKNGYSTLYAHLSEAQVRVNQKV
FT                   TKNTPIALSGNTGRSTGPHLHFEIIRTVNGVTPRKGSTINPEFLVNFN"
FT   gene            complement(209916..211352)
FT                   /locus_tag="AM1_B0278"
FT   CDS             complement(209916..211352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31997"
FT                   /db_xref="GOA:A8ZLH0"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLH0"
FT                   /protein_id="ABW31997.1"
FT                   /translation="MSQVEAQEGREIFTTQEQDSVIETLAQPIEDDRPISTIETGIAPE
FT                   GRKTHEWFKSTYFYGAVILVFVGVSAIGVHRVFTGNRKPKIVVAGETEQIAGLKAKISQ
FT                   LESEKSQQLGDNSSLTQGAQFESIPLEGQQNPNATGKPTAQQPGIATNPAARPGTTTTA
FT                   PQTPPRGPARVPARRTVTPRNTVRLNRPRYTAPAPVRAYRPAVAPAKPRTALKAEPKPT
FT                   LENCVEFLQGGINVPACAKHRISIKTQAPTKPITLGQTTPTPTTPKPIKPVKLTPYKRP
FT                   IKTAYARPSVVKAKPSHQVNFLAGEIQTMDQYDQEFSGSNSPTSSNTPTVSKMSAKVVR
FT                   HVEWRSQDEAQRVIIPLTITSGPHKGQSAEAKITSLNGTQFTAELTKLNNQPVGPGQYM
FT                   IEQKNTTYLLAQYKTQGGTSFGNRILGAALAVGGEVASDQLGNVRGGSHISNLVPRGQQ
FT                   RGPTGQYWKFSGNVDIVAKS"
FT   gene            complement(211349..212011)
FT                   /locus_tag="AM1_B0279"
FT   CDS             complement(211349..212011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31998"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLH1"
FT                   /protein_id="ABW31998.1"
FT                   /translation="MTPKRAFLFVVVLLQFLILQRVSNPDVGDYQAFSQSQGARNGAEA
FT                   QQIDPNEAQARIASFAANLIKSGYDWQPGQMVQEGQEIYPRNFYLASLYFDMESDLRQN
FT                   WLLTRARSYERQGFSFDKFLKGKYLSTVELSGNPQVKKLSKSQWQVDVRGVRVAVATDK
FT                   NAKGAAFKEKLSFTFRIQEQQPRTGHEWGLEQSTLTQALNKFQTDGLKIIEYREEVR"
FT   gene            complement(212083..212775)
FT                   /locus_tag="AM1_B0280"
FT   CDS             complement(212083..212775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31999"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLH2"
FT                   /protein_id="ABW31999.1"
FT                   /translation="MARKEKWSVKLWGMRKHLRAWAVAMVLILLMQVNALATVGNTPVG
FT                   GATYRFVQLKNGETIEAQAMPGYYRSDAVVARFVSDLVTLGYRWDTSKQYVEDRKILFP
FT                   ATYAAVGHLFDQPTLLKWGIDFATKYGKVQGGTQTLQNSYALLTSDPVVEDQGNGLWFV
FT                   EVRAIRFATDGKEKILGQEKLHFKFAVKAINPNTQSYWTLADQALNPYMERFWSDGLAV
FT                   VDFVDMHG"
FT   gene            complement(212857..213309)
FT                   /locus_tag="AM1_B0281"
FT   CDS             complement(212857..213309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32000"
FT                   /db_xref="GOA:A8ZLH3"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLH3"
FT                   /protein_id="ABW32000.1"
FT                   /translation="MAVGLVVVMASIRDEYRANPLSLLAATALIYAAICAPAGLNYFQH
FT                   FTQGVDFAPRLNFFWSFIAYWLGLKCCDCKLPRFRVSFGEGLNKSLFAFGLYQCLASCF
FT                   AWSQIVFIFLMPVGFLATLLIPLGAVWPRRNFWRYRHHGRGLYELE"
FT   gene            complement(213353..214681)
FT                   /locus_tag="AM1_B0282"
FT   CDS             complement(213353..214681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32001"
FT                   /db_xref="GOA:A8ZLH4"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLH4"
FT                   /protein_id="ABW32001.1"
FT                   /translation="MINSFLNALYLADLNGTKSLELSDDHIKFWETARRYVVGGDTLGS
FT                   SNLVSKTVEAPVNLLFVIGIIGVSVVLINRLGFKTAKDGPVAVVLDAAPQFFWVILAVF
FT                   LLASQFVRAYDIANTTWAFRNNMRNNTKSVVHANQVFTEAIANEFFNVQFGQEVSDQLA
FT                   ICQGLPFPTVRVPQAVRPTGAEGVKLEEGQTYDFLDCLTTLEETIKRNQAQLKQQCGAK
FT                   LQSCEIVEAKADGLARQVGDGTKKIRRRLIADLGPGSNPGFDQIGGIPDPLLIQDDFSA
FT                   IGDLVASALSGIGDFLYMGLVEFGNTLYTSSIEILFLLGGMFFPITVAWSVIPGKRQVL
FT                   LDWFVTMLSLIITEQVYLIIIGMVAVLSSQPQFHEFGPKLFLFTLGITAPLIAAASGGV
FT                   SGFQMARTYRGTAIGAAGAALSVISGVAFSIAYKANSKRQLAR"
FT   gene            complement(214678..215940)
FT                   /locus_tag="AM1_B0283"
FT   CDS             complement(214678..215940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32002"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLH5"
FT                   /protein_id="ABW32002.1"
FT                   /translation="MKHKEAFLTALFLTVAAPEVILAQSVFESVTNPSGNVSFSTNNLP
FT                   LQSNYPPLNQATNLGTDIYTSNSGPPDTGSYSPSGLYQVDDIYQQSKDSKPSFLKDLLQ
FT                   GPSGNRALHPTTVKVFDILGKAQKGLKTYKLGRSVLDAFNNRNSGSLVGGVRSILELYG
FT                   VIDPNAAVASVATSTASQRIATLSNATTRSQKFKKAALGNPVTPQQWYVKTVNNDAISS
FT                   MAAQTGPDIVLGPEGQEQLKQEDEFSDASAEALEAVISDAALSAIQVRELQAASQKQAA
FT                   TSAEVATGAQKRKSTQQAVKDLNTLAGIQANLGSMQVAALAELNDSSLRQLGGMASIVG
FT                   MQRAQLNKTTTMQLMTALNGRQLANINSGVHRAHNYEVRKDLRARKRRGRSIGGLIVPV
FT                   NETVNTTNTANAANTTPGGQQ"
FT   gene            complement(215945..219076)
FT                   /locus_tag="AM1_B0284"
FT   CDS             complement(215945..219076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32003"
FT                   /db_xref="GOA:A8ZLH6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLH6"
FT                   /protein_id="ABW32003.1"
FT                   /translation="MGVTTYEQKAADNEALRNGMVNLSIGSLQLQPYTMSQVIAALVCL
FT                   VLAIIVNFLFGIEVAGLLFIILLVSLITWGGKDFALEKERMTKTRDFYSEGPTKGEGSD
FT                   GLPRPVFKDESYIERGDRRFYSIEQRFSHLRFYGSYEKNHSSAGFYYQNRGSSPNVYLV
FT                   FGFKVAGFSPCMDHQECMQVMKDIHRTFRNYPKLKLRFVWSVPSDASAQILQQKRLLEQ
FT                   ADQDALTVEIIKARGRWAVDGEKRGRIVAPTLYVYARVQSPLGQENFVPQDWKDRWSQK
FT                   LTPQVARYFGDKPKQKMAMQAIDFAFEAGCTLPMQSLNKGIKIRTRPLTVHELYQRDYS
FT                   KIHDKPVDTCPQYIRVTDQGFFERNELGDDRHILGELFGDGGDVPPIPIFARSDIWYPL
FT                   KGKKNQEGNPAGLFSACVRVDQMEGYADINGSHAIGHVQNTFRWLEGLSDVEIITEIEA
FT                   VNPLRKKQEIAKGLTNRTKRSNAAIGRQTVDTDSLGDVDELMDAAQTLRAGGRTMSSST
FT                   LIWIYADTRDQLKLKTTTVMGRVGVDHCTLVQNSIEQYWIDSQPYTWDAMCFDPDRRIE
FT                   YEATQVVPLVPLTQPQPLDERGVGYIGKHISAQVFIDFCGKKNHTFISAKSGGGKSMQG
FT                   LEILSQCIATNTPFVFMDSPPIADQSTGEVAASTYTPAIDLWQACGVDCAYQDIKKQNF
FT                   NMLGRYGLGRNSWEIDALVETHVETLQAAVIGDDPHHPLADDVLTVLSLAYRDFARKTS
FT                   GEEKDPLVGDFLREYIPWSRDYLAGNVDLAKTTGVEGLGAFEPSEQEKQAVAMIRSRLT
FT                   GMLSQPWGKRLNAQTSFDPSVRYLVLGLTDVKNGSKEGLVYSLAALAFMKRITSTYDHS
FT                   VFGLDEGTTLLPMQAFASKFSRIFPEGRKKGGNGILLATDVGSLLKSPYCDDILSNFDN
FT                   VLVGRSETNSIEHFVHSFGLKQEILERYTQDPDLTDMSSQWYLKRGDLHMELLYYTTRM
FT                   LLSLGATQPKELLAKRQFIKGDTPEELIKSYQNFGNSLYAAYSQGRGPETVVCR"
FT   gene            complement(219109..219624)
FT                   /locus_tag="AM1_B0285"
FT   CDS             complement(219109..219624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32004"
FT                   /db_xref="GOA:A8ZLH7"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLH7"
FT                   /protein_id="ABW32004.1"
FT                   /translation="MNTLAIKLLNGLNTIATYRLTNLQRFQALTIFSFFWGAILLPHNV
FT                   LAQNPGGPLTNGAGQNAGGTGAQCGQDFWFMSDLYSFIATAFAGLGGAAESVCQVINIV
FT                   VIGGIILMVGMILWGLGDHHMNETPLKKAFAPFMGWLIGLVCIYLVIFVAFFTGGTSGN
FT                   AGRAPGVI"
FT   gene            complement(219836..220612)
FT                   /locus_tag="AM1_B0286"
FT   CDS             complement(219836..220612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32005"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLH8"
FT                   /protein_id="ABW32005.1"
FT                   /translation="MSGETDHFLDLSETGYTVLEARSSDHTEFRALAPSQAERDQLVLR
FT                   WVKGSTAKSASLVLKVSGPLGTKSLRYRITRVGEAPDNILTMYTAGPAQPLVATAPPVN
FT                   KGFQQFPRLEVVHSGQENAPINKPVTLSVKPPKPSSPRSSFPVKVSDPSAKAPRPVQIR
FT                   QSPKLVRRVAKVSTTGRILIDRSTLDNKALANYLIRGLHRARGLRQINRNHKLYWQAQS
FT                   AARYLRRGASVEKALKYSHLPQKTYDDLLGHGGVSR"
FT   gene            complement(220632..222158)
FT                   /locus_tag="AM1_B0287"
FT   CDS             complement(220632..222158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0287"
FT                   /product="RNA polymerase sigma factor domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32006"
FT                   /db_xref="GOA:A8ZLH9"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLH9"
FT                   /protein_id="ABW32006.1"
FT                   /translation="MSSIAETLTIKANLHLKGHSAYVSSMEIKEEPTEQKQASTISTPP
FT                   KPESLKPTTNSRLMDMIGRFTQEPKSDSRLTFDQELDLIQKVRVGNPRALRQLIKEYKG
FT                   FIVTASQRYDRSIDRQALVCSGEAAVDIAAKKYDESKGHRFITYFSWVLRTEIQKRYCS
FT                   EAGISREVSRNVSAVNEAAAFLTNALGREPSVEEIAEQSNLTVQTVLNALMAKNFTQSL
FT                   SLSGLIDEDSTIQYESALVDHSCDPWAYALSTEQADILQALEESGRLESKHVDAVTSRI
FT                   EGYSAKEIGERHGVGPERVRQFIKKAKSTVHEFLAGDTSVETPEVLAIPEVVVRRVFPI
FT                   LPRVDAVRLGGRIGRAIQAVVTPVQSMVDALVDCPLLKQSETGINRPGLGLDLETVFEG
FT                   RSADMPTSDPTKEERILSSLPGFSGVLPFAFGFLKGAVHYATGLFHVLRRDSVRGPTTK
FT                   EGRIRSSQPSKKLDRYSTYVQNNIIDFRPSGINRITRTSEPCLFGDRRGL"
FT   gene            222250..222366
FT                   /locus_tag="AM1_B0288"
FT   CDS             222250..222366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32007"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLI0"
FT                   /protein_id="ABW32007.1"
FT                   /translation="MARADVDVIANSPSDINVVLIIFYVADELHRKGRQNGP"
FT   gene            complement(222396..222596)
FT                   /locus_tag="AM1_B0289"
FT   CDS             complement(222396..222596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32008"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLI1"
FT                   /protein_id="ABW32008.1"
FT                   /translation="MDKFTPFKQSQIRAAKQALKQGLVERIERKTQALTLARYEDETML
FT                   HWSRLPKTTLKDFLDHGGIDR"
FT   gene            222725..223444
FT                   /locus_tag="AM1_B0290"
FT   CDS             222725..223444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32009"
FT                   /db_xref="GOA:A8ZLI2"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLI2"
FT                   /protein_id="ABW32009.1"
FT                   /translation="MNGIITALIGALIGGAIGFYTSLYMKYLEKKEFILRNYINHLKIA
FT                   NEELFIRINVLLNLRQSRKLEIIDISSFQELEDKNTEWYNEEGAFFGTTAYFLCWLFFS
FT                   IDLIKREIPHFKLRKVKSNIVMNSLFDLQHVFLKDFGIYYAIQMSIGREMENPDGRVIS
FT                   YRQFVEKLQDYNSRIWFKRIVCFILDFKNGNRFRQFQEIYKYSYELAKVLDAITESEGT
FT                   LDSRLSKESLPLFGTKF"
FT   gene            complement(223473..223670)
FT                   /locus_tag="AM1_B0291"
FT   CDS             complement(223473..223670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32010"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLI3"
FT                   /protein_id="ABW32010.1"
FT                   /translation="MEGTGKPFIRIPFASPEFCFECALELEDTFDVLQVLSLRPGETIE
FT                   RIEEMVGVYLGRESVARIWG"
FT   gene            complement(223978..225708)
FT                   /locus_tag="AM1_B0292"
FT   CDS             complement(223978..225708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32011"
FT                   /db_xref="GOA:A8ZLI4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLI4"
FT                   /protein_id="ABW32011.1"
FT                   /translation="MKIESIKNNVDFAIITIKQEEFDAVLCRFESWTGVAGGRHIYIFS
FT                   QVSTPGGCEYSIVLTRCLEQGQGAAQQITNDLIEDIKPKLLVLVGIAGGVPAIEYTLGD
FT                   IILASRLYDFSVSAINPDRSIENNTSGGPIHPSVSRILEVISAYKNQLGEWNSVTSISQ
FT                   EMPVVNVPEDINDNAYYGDLEWKEKVHESIRHHFCDTSTKRQPIYRVAPTASSNFLVKN
FT                   IDIIQQWQDCARSVSNVEMELGGVYRAAWRGERIYPVLAIRSLSDIVGYKRSSEWTEYA
FT                   CNAAAAFTYSLIKTGILGSIFQLTSSANIENLASNQSMKKKVRITLDLELEKFLELQCD
FT                   EKLKYTLAGFLGVDVKKISIEDVEEGSVKVTVEIPEDLVDYLIKNKSKFSLLLGKKENL
FT                   VVIDIEELPPILQEVEEEITSLKRVELYASALFYSLYAEYYSAKREWNYRSCYSASEIS
FT                   ERWGISVEELTERKICLVEKNAIRLLEDLLLDSKEIGVKKIFTRDLYKELFSRSPSYVD
FT                   DSLSFSYSEVILMSTFRGYSIPDLGHFGPTLPYGLDKFIDQKLLLEKIQIDLKDIRADS
FT                   "
FT   gene            complement(226061..229807)
FT                   /locus_tag="AM1_B0293"
FT   CDS             complement(226061..229807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32012"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLI5"
FT                   /protein_id="ABW32012.1"
FT                   /translation="MTSTASLTLNPPQLGFGTPGRTPSKLVPFRGANHCPVCDSHDGRC
FT                   RGGGDIVLCMSETQDIGTVNGYKFRKLTKNYLWGIWAPHTGEDFNAIDWETRKALREKQ
FT                   AEEKRQQRIARELPIELRDQQYRQLLSDLSLCSMDQGDLVRRCMSQAEINGFQAFSVGQ
FT                   FQRVKDFSLDLPGVLPDGFLNSQGGYLWPLYNVHGQITALQLRKRNVDTDNRYIWLSSF
FT                   TRRNPNGNGPHVNGEIPLAVYKSFGPYSRIALVEGTGVKPYLLSQRLQLPTIGAAGGLW
FT                   ASSPETLRETLTVLSKSAEQTPIITLYPDAGAVRNLNVFHQYQRVIRLLEEWGYAVEVA
FT                   WWGQTYKENSCDIDELTQVELAQIVFKPTWFFNSLGLEYELGQLFLKLNGLSDKATTVI
FT                   NKRYIELSDLGTIDPGSVVAIASMCGTGKTEMLKSLVGQVKGQVIMPGYRNNLLFNTED
FT                   RFTETDANGNTLYKLIHLFRLNKEYQGNISMGFRSERSILLCFDSLLKIELDDIEPDSC
FT                   IILDEADAALFHVLSGQTLGDRQNQILEHFHAIANRVLETQGNIILLEDSLSQIPIDYI
FT                   KGITGGKYNTKIIVNEYKPDDNFPTKVFSGQTSQFLERILNAVAADEKFIVVATSQEFL
FT                   EKLERIIAEMNPEFAKGILRHDRKTSERPENKTFQANPTQFVEDYRPTALFLSPTAESG
FT                   VSIDEPRLIPYFSRVFCYASSNHARSVYQQLWRYRAKVTREIYVTRKAHIPDIPSIKSV
FT                   EQVIMLQSKYGQDVAASIDLEQQLIHDQSPETAQQLAALKAYQQNPNNCHNVSFARYQT
FT                   RSIASLLALRESLMLLLKDHGHSIEMEELRERNADIVESFSKVRKQMERETAVMLGTAD
FT                   GERFTVEQAIRVMGSSSATYKDTLDAKKVLLQDELPGVDLTDEFIHQVCVEHRGRLKSA
FT                   TKLHWMSFHPEVAEELDRRNFMKQLNSQFVLTHRLTNNRIQVQLLRDLGVFDLVDTYNV
FT                   TSADYEAYDKALEKGRQVQRQRQSLRLEVKGLAGQIREIIQEQKVIQAKLTALGRKAHP
FT                   RKATLKGELEQLEQQKQTLKGQKQGLVEAIEQQSQAFTQARYEQVEARMRMEIMVMTED
FT                   DQRLEDIKVKALEYRYQIYRHFRNVISEGQSAVAIVNKLIKRVAHELVKVGSEESVSLY
FT                   VIRYSGNEAYKDQMLKAFQAKWNQRLEKNRPSCEICKKEDDLITEIDKRSEIDGFGQGN
FT                   DQELGQLEGGDDGSPLDSTEKTG"
FT   gene            complement(230335..231600)
FT                   /locus_tag="AM1_B0294"
FT   CDS             complement(230335..231600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0294"
FT                   /product="sigma-28 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32013"
FT                   /db_xref="GOA:A8ZLI6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLI6"
FT                   /protein_id="ABW32013.1"
FT                   /translation="MIGTTSRNPQTQRSEQFSNEVQYPQILLAQAGDRRTEDRFIRKNQ
FT                   RLVFKEANRYRGLDDWNDLVTAGNWGLARAIEKFDVSKGCKFSSYAVKVIRTEIQQFLN
FT                   DQRGLSKEIAKHLKDIKQASQKLEWELERQPTLEELSERTGYSQRIITSTLDRARVVET
FT                   SSLNIPVGENLKAEQIDLVEGDDDLWDYAENIDEKEYIAQLPERYNVIVRARRDGHSYR
FT                   AIGRMFGLSGERIRQLFKEALAYLKHLVTYGACLVRFPQPLQAKEPEEVKKPVMKRVDA
FT                   PRLGGKIGRALNQIFNSTKEEFNCQLGGLANVAKPILAFCRCSNHRIAPKSGYQPSSTN
FT                   QRCCGLGGIQDAWGGYLEIGQEILSVFLLPLALVYLAIRGFQENYITHTRRSTMHSMAT
FT                   NIFKFLGMKHLIVHPRPPNITP"
FT   gene            complement(231768..232073)
FT                   /locus_tag="AM1_B0295"
FT   CDS             complement(231768..232073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32014"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLI7"
FT                   /protein_id="ABW32014.1"
FT                   /translation="MIGSIYFNPQIPFTHKHFSNIRRTEADWERTISQQLLNFILAWLS
FT                   HANHLDHQPNPTKIRIGNSQQSKPRKYPSSLQRHNSPIKRLFRSLLPRLPTIQLAL"
FT   gene            complement(232528..232920)
FT                   /locus_tag="AM1_B0296"
FT   CDS             complement(232528..232920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32015"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLI8"
FT                   /protein_id="ABW32015.1"
FT                   /translation="MKMIGRIDLSTQTTFLKQVLGLIKVLFLGWTAQQNSQPQTYSQYS
FT                   QSDGKQTQRIGTSCRPFILFGYSLTKTIRVLLPRLPTEDELLKTIHDSLIRAFAASSTV
FT                   KVKTNKSAMPIGGVPDFRKAFKQISK"
FT   gene            233274..234638
FT                   /locus_tag="AM1_B0297"
FT   CDS             233274..234638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32016"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLI9"
FT                   /protein_id="ABW32016.1"
FT                   /translation="MEFEKAKSYINELSLIKWGKKLGLPGEIAIQAAWEGITIAQAIKD
FT                   HPLGASTSEGYVSCRVGPDLWKLLSQELGIEVKKKNLRLVFEELDQQGMFATTTSDPTP
FT                   EQEGTKKTSQQIDNTTSITTALGHHPPKVPHFYGRDEDFLQLSTTLAQNRFVALIGAAG
FT                   IGKSALASIYVQRMNSKPQPDFKKIIWMSLHHGQTVSGLMEFHFKECEFTALIQELSCL
FT                   FVIDCGPVEFEEDKNFQAIAQQFCVGRHQSTLLILSRNTVRSVQQLARIQRPAATIKLS
FT                   GLPDKDALRILKEQGIQGESDCKKLIKSYRGNPQLLLLAAERINRFCGGKLVESFMLHK
FT                   TSFASDYVRRVIQEYRMQELTPTEQRILDILIQSDNDAPRWITFSELMMELSSGGGNAS
FT                   MSELIEVLEKWEGMSLIESDNDQNTGEATFMLPPTTRKVLMRNTLNSLVSFSQPA"
FT   gene            234743..236350
FT                   /locus_tag="AM1_B0298"
FT   CDS             234743..236350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0298"
FT                   /product="serine/threonin protein kinase with TRP repeats"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32017"
FT                   /db_xref="GOA:A8ZLJ0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLJ0"
FT                   /protein_id="ABW32017.1"
FT                   /translation="MIRPLRELVDLIPSEVFEVEDITGSYAIPPGRRVLKTLRTVDAKR
FT                   VEMMEREVRALQMLNHPGIPKADLGDFFEFQPNSGFPLYCILMTKLEGQDLDKWIEENG
FT                   RISQEKALDWLKQLFELLHEVHDCGFFHRDIKPSNILLKEDGTLALIDFGGVREVTDTY
FT                   LAKLSGTGEPTGFDKEHEITIVRTPMFSPPEQVNGRAIPQSDFYAVGRTFVVLVTGLDL
FT                   FDIPLDDDNKKLLWRKKAPHIDPPLADFLDKLMSLSPKQRPKTTGDILDQLNQLPKRIR
FT                   WHRRVKSVPFRLSAILLTILVVVGLFQGGKIGLSRYFFRMAGESEGRNDLEAAKQNYKL
FT                   AVQFDPGDYAAYNNLAAVCQLLKKYPCAIENYKKALQLKPNNEVVFYNIASIYDDAQDF
FT                   TEARFYYQKSIEASQGKFVAAINNVARLDILDDQPRKAVKSISPALKKVENIRTKASLY
FT                   KNLGWAYFQLEQYKKSVVNLEKSVEIEANEASTQCLLAKAKNQLNLPSKSNLQLCLFLS
FT                   SELPEVWTWKQEFVDRLE"
FT   gene            236410..237321
FT                   /locus_tag="AM1_B0300"
FT   CDS             236410..237321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32019"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLJ1"
FT                   /protein_id="ABW32019.1"
FT                   /translation="MYSFKKVFLALFVLFSFCRISETAYAETGETPSQANRCLTTVARI
FT                   LSSGDQRHAKGRLLCPGDQVRPIAGKQTLVLCHNGKSLTKGKEGEVGRLCSSGPKRLQQ
FT                   KGRLRFLKSRGTTDKEGKLSIVQPLGTMIMQLRPDFAWKPVKGSTHYEVTLQGPNSKWE
FT                   QKVTSGHRLNYPKSWPALEYGKAYYVTVYAYQNEKIIGSDRTKLNLLYEEEISLVNEAV
FT                   AAIHQLSLSPVEAAKELDAVYMSFKLLDQSIGVLQNLKDSGQSNSQLNRLLGDRYYQVG
FT                   QPELAPRAEEAQLPTSMKLPQK"
FT   gene            complement(237285..239678)
FT                   /locus_tag="AM1_B0299"
FT   CDS             complement(237285..239678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0299"
FT                   /product="TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32018"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLJ2"
FT                   /protein_id="ABW32018.1"
FT                   /translation="MKLNPYQVLSLLLLVSSPYQATAVTSSPTIQQGDSLIQEGLQYLN
FT                   TNQPQKALKRFQNAESVYEDAQHSNGFNGALINQSIALKRLGQYHRACTVLTEVLTLNR
FT                   EICQRPSNNSLSIPDLDKLGLAPEQQLAALQNLGNNLQLLGQLESSVTVLKRATTLDPS
FT                   HPDIILSLANSYQSQYKDAINQLSLTADPTSEATAINTAQEKALEAISLYTSLDSIPSH
FT                   RVHAQLNNLQLIQHLKTVKSSNLSPVYQQSQHLIQPYISNLASTDFSQFHEVDAVNLEL
FT                   KLSGLLNEQGMTREAFHHARSALDRAKLLQDSSLRSQAFGTLGKIYLESEQLGDAKKVF
FT                   SKALKLAQSSNDDSLAYQWSWQLAQIYQQSGQRTHAIAAYNTTISHLDQVRTMLISASS
FT                   DLQFSYKNSVEPVYQEYIKLLLSSPTPSYQLVLDTHQQLQVAELENYLKCGKLLAQSSE
FT                   QLASYSATIHILDLNGQIEIIAQTPEGIYRHQPDSTIVQQELFKLLTLFDGDSVEEISE
FT                   AHFLRNAQILYSELIAPLSDHLPPTGDLLFVLDSKFQNLPLSLLHDGQGYLIQNYSVTN
FT                   SLNTYLQTRKPKSLKSLNVLFAGLSQESPSFNSPDVPKGLPALPEVDEELREVKQISQR
FT                   FTSLVNRDFTADRLKAAIYQETPIIHIASHGQFSSDPQKTFLLAYNEPINAQQFHDLIN
FT                   QKSELGQATLELLILSACETAKGDRRSALGITGLAIQAGSKNTLASLWLAESRATTELI
FT                   TAFYQGLKEGRSKAQALQQAQLKLLASKDYWHPYFWGNFILVGS"
FT   gene            complement(239691..242156)
FT                   /locus_tag="AM1_B0301"
FT   CDS             complement(239691..242156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0301"
FT                   /product="haemagglutination activity domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32020"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLJ3"
FT                   /protein_id="ABW32020.1"
FT                   /translation="MYFLLFSGIAQAQIIPDSTLPNNSRVSVNQQKYVITGGSRSGVNL
FT                   FHSFDTLSVPSHRTAHFLNDISIQNILARITGTSMSNINGTLQANGAANLFLINPNGII
FT                   FGPRSQLSLGGSFIATTANRIDFLDGKKLDLNSINEISLLSKSLPVSLSIDSSSGSITI
FT                   QGTGNSLQRANPLPAGSPIVDSPLSIPFQTPNQTLAFVGRNIIFNGGVVASPSGNLVLS
FT                   SVDEGEVGISLDPTGFQFNDEKIVHFADVTLSNKSLLTATGSPSGNIFIRGKNLLINDQ
FT                   SLVISSNYSSNNNSQININLSGDLVIQGVQDPAALTVSLSDGTVPYGGIVSQNFSSYTG
FT                   PNIKVSSQNGVLTSYGFINSFNFAGGTGGKIDFSIDNSLLIDGTSPIPLNFRPSSITSL
FT                   TTNGNAGGIKGQGRQLTITGGGFISSSTTSSSPLSLGDTGDIKVTFDDISISGGSPISI
FT                   GPDLPLSFNPSFIGTTTVSPGDAGNIFLKVDNLTIVDGGRINSTTTNSGDAGNIEIDVQ
FT                   GSLILQGKIPGSDDFRDSSQIISSSERTNEFFRALFQLPDIPTGEPGSIRITANSILVK
FT                   DSGRVNVRNDGPNDAGNISLQAQNIQVDNASLLATALGNGGNIQLLSNFLLLNNGTISA
FT                   SAKGDGPGGNIQIDADVFVGLGSNNISANAINNRGGNIQINTVGLFLSPDTKITATSAS
FT                   GTQQEGSVTVNTQRTDAEETTSAAPNVERSPKVVSACNPTQGRSSFVVLGPGNQKAKAH
FT                   DIATTDVPWNASQMQLASNSEGNQTAPDLPVIQEAIGWQKIDGKLVLIAEHQDQTTRIA
FT                   SQAATCDKT"
FT   gene            complement(242199..243521)
FT                   /locus_tag="AM1_B0302"
FT   CDS             complement(242199..243521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0302"
FT                   /product="cytochrome P450 family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32021"
FT                   /db_xref="GOA:A8ZLJ4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLJ4"
FT                   /protein_id="ABW32021.1"
FT                   /translation="MTLETLEYTEASLPPGSLGLPIVGESLEFIKNKNFISDHQKKYGN
FT                   IFITSLFGTPIVFVGGGDEVNFILSNENKFFQAFPVGNVKSLLGEYSLSLQTGETHLKR
FT                   RKLILKAFSPRRLASYQETIHAITQSYINKWAKTDSFKWYDELRNYTFDIASKYLISLD
FT                   NGSETKLCEYFKSWSNGLFAIAPPLPFTKTRKSLVDRKKLIKLVDEIIQDRLSSSQTYD
FT                   DALFHLMDAELEDGEKLSVEEVKHQILLLLFAGHETLTSSLCSLCRNLSLHPDILSRCK
FT                   EEQSNIPHNPDINQSSMPYLDKVLLESMRIVPSVVSGFRKVLKECEIGGYKVEKGWLVF
FT                   YQIDFTHYNKETYPNPHSFNPENFNPAEHKELVKSSNYIPFGGGVRECIGKDFAMLEMK
FT                   IFASSLISQCDWELLPNQNLEYDLVPLPRPKDGLITKLRIN"
FT   gene            243934..244692
FT                   /locus_tag="AM1_B0303"
FT   CDS             243934..244692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0303"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32022"
FT                   /db_xref="GOA:A8ZLJ5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLJ5"
FT                   /protein_id="ABW32022.1"
FT                   /translation="MACLQGKIAVVTGAASGLGKAIVERFSKEGAQIVVADINEDLGRD
FT                   VSASLASSHFIKVDVTDPASVEKLVRSSVERYGQIDILVNNAGIEGELSPTIDSSLENW
FT                   HKVIAVNLDGVYFGIKYGVAAMLANRNGGVVLNMSSIVGLVGFGNLPPYSASKAGVIQL
FT                   SRAAAVEYAAQRIRVNAICPTVVRTPLLERVIENSPDPKQTRERMENMNPLPGLPTPDD
FT                   IAAATLFLASDEAKFITGIALPIDGGYTAR"
FT   gene            complement(244861..246336)
FT                   /locus_tag="AM1_B0304"
FT   CDS             complement(244861..246336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32023"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLJ6"
FT                   /protein_id="ABW32023.1"
FT                   /translation="MISTPAIAATLPPKIRKDIGIQALSRSIPIARIARENQTSRKFVY
FT                   EQKAIAAQALDESFLGDKGDDEVLFYLPITKTWLFQLILALVLICHSSYRGVVELLRDL
FT                   FDWSISLGTVRNRLEVAAAKAEEINQSQDLSTIKQGLHDEIFQGSLPVLAGVDASSTYC
FT                   YLLKAAEHRDEDTWGWYLLELQSQGFDPDFTIADAAKGLRAGQKAVMPSTPCNGDVFHI
FT                   LHQFEELVLSLTRKANGATTSRMKLEEDIAKAHLAQESTRSLTSKWVHLKRREQRLLGL
FT                   AKDVKILFQWMAHDVLELAGPLLSVRQELFDFIKIELKQRDDGEFPMLRKLWKALHNQR
FT                   DQLLAFSGVLDQKLAEIAERLEVSLAKVRDVCLLHRKQPTSNAYWEKWNQLYRGLSGKF
FT                   HLLMEAVTEALKQTPRASSLVENLNSRLRNYFFLRRTLGNSYLGLLQYFLNHRCFMRSE
FT                   VPEREGKSPKELLTGEPHPHWLELLGFKRFQRA"
FT   gene            complement(246608..247240)
FT                   /locus_tag="AM1_B0305"
FT   CDS             complement(246608..247240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32024"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLJ7"
FT                   /protein_id="ABW32024.1"
FT                   /translation="MVSTLTATETSQGSALRIFGDGDAYVGDVSGFLRDLEYAYNSAYV
FT                   FDSILEEAEEFYRTGNNPGLPIRNLLWMAWWPPTPEKVAAMVPEADRLRLIGVELHSPG
FT                   FWDFLGKLNPLEKIRLYLNDRHERQKDRQYRSRIEAEKLELENFKDKIDVLKQLGATDK
FT                   DFALLKDQLLAKSLRQLNPHQDQGLILEGEIVDPNIEKKRSLNPDEY"
FT   gene            complement(247302..247415)
FT                   /locus_tag="AM1_B0306"
FT   CDS             complement(247302..247415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32025"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLJ8"
FT                   /protein_id="ABW32025.1"
FT                   /translation="MVKEHGVFMVLSKRPVPHPKNIALEEKESSLEDQENS"
FT   gene            complement(247544..251422)
FT                   /locus_tag="AM1_B0307"
FT   CDS             complement(247544..251422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0307"
FT                   /product="WD-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32026"
FT                   /db_xref="GOA:A8ZLJ9"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLJ9"
FT                   /protein_id="ABW32026.1"
FT                   /translation="MTYFGSNSTAEKGHSHLTYGPITRKRTKRLLEALLTYANDEVLLP
FT                   DSLRSKICYNWKTENLLVIETTIRALQGLIHCDKYQGQLSSDQIKKSLKLLEKFLKVLS
FT                   DNRSQPRGSDKWHFSICFWYSRHKIADNLKQFDLEWEKLQPDKSKQVTRNQFDLLEEIS
FT                   AINQSKRNELDAKTDHLIADQNNSYNLKVDWGDAVDTSNFLGRQSELALLTNWIKEDNC
FT                   RLISLLGMGGIGKTSLAAKLAQINQDYFQCLYWRSLRNALPFNDLLQNLISFLSKQQVS
FT                   SLPESNDDRISLVISYLRKNRSLLILDNIESVLQSGQLGGRYLKGYEGYGHLLRRLADE
FT                   SHQSCVLLTSRERPKSLSMREGKNSPVRSLELSGISLKVGKALLNAKGLQDVEYESVEL
FT                   VNYYSGNPLALNIVAATIKTIFLGRIPKLINHIANFGDIRDLLEHQFNRLSQVEKYLMY
FT                   WLAINREPVTLLSLRDDLLASHHQQTLIEALESLKGRSLIEVTIEGYTLQPVLMEFLTH
FT                   KFIQQICNEIQIYSNDIDSKIQQLHLLRTHALVKAQAKEYVQEAQVHLILRPLIDELIT
FT                   LLGSKPNVASCLSRLLSLTRGKSLEEMGYVGGNIVNLFRHLQVDLSDHNFSHLSVWQAD
FT                   MRGINLYGVNFTGSDLSKSVFSQTLGSVHSIAFSPDDQMIAAGDVNGKIRLFDSENGQH
FT                   LRTITGHTSWVQSIVFSPTGNLIASGSPDQTIMIWDVEKGENLKLLTGHTNVVYSINFS
FT                   PDGQQLVSGSDDGTVRLWNSQSGQCHKIFKYSHGARSTAFSPDGQNLAIGYADGTIRIW
FT                   DIKSGLCLKAWSGHEGWVWSITYSPDGQALASASDDETIKLWNVINGACTSTLVGHSNA
FT                   LRCIVFSPSGDYLISGGADHLIKIWDIRTTQCLKTLFGHTNWVWSVAINSTQRTIASGS
FT                   EDGSIKIWDIKSGMCLHTLLGYTQATWAALFARLPINHFESSKTVHQENQYIISGGEDK
FT                   LLRIWSLRSKQCVTLAGHTDAIRAIAFSPLEQVIASGSSTNDKTIRLWDVQTGQCKHIL
FT                   SGHDKGIWSLAFHPKGKILASCGSDQTVKLWDTQKGVCLTTFQGHNHWIWSVAFSPKEE
FT                   ILATGSFDCSIKLWNIQSEKCLNTLNGHSSCVSSVAFCPNGTILASGSFDHTAILWDLN
FT                   TNQYIHKLEGHSHPIWDMDFSPDGQLLATASVDHTVRLWKVDTGQCLRILEGHTNAIFS
FT                   ASFSFDGQLLVTSSQDETIKIWNVSMGKCIATLRPTKPYAGMNITETTGLTDAQKETLL
FT                   ALGGICRS"
FT   gene            251851..251994
FT                   /locus_tag="AM1_B0308"
FT   CDS             251851..251994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32027"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLK0"
FT                   /protein_id="ABW32027.1"
FT                   /translation="MHYIAASVVLDLLEMIDGPTDEALKEANQDFIRWPKASRRPLQAL
FT                   TG"
FT   gene            252011..252388
FT                   /locus_tag="AM1_B0309"
FT   CDS             252011..252388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0309"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32028"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLK1"
FT                   /protein_id="ABW32028.1"
FT                   /translation="MVIEELRQLLTPLDKSLTECDGMTRLCHTLLLQHDIPHQVYCGSC
FT                   QVETQLIPLHFWIDLKGVLRGWRVDYRLRMWIGDKKLDVPHGVFNFAAFSQVHYQGETI
FT                   EMSPLSESLFQVLMLAPNSPS"
FT   gene            complement(252395..253183)
FT                   /locus_tag="AM1_B0310"
FT   CDS             complement(252395..253183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32029"
FT                   /db_xref="GOA:A8ZLK2"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLK2"
FT                   /protein_id="ABW32029.1"
FT                   /translation="MSYPLSATKLKTYGQCPQSYQFRYEHKLPSPTLFGSTKLGNALHA
FT                   ALATIYKDWNYAYPLPSLDWFAVCWQQHNGELTPTQIHEGWAALQLYYERYISPLPEIR
FT                   KPLGIETKVRANLQVRNIEFTLSGRYDRLDYIDDGLELIDYKTSKSVNPPPSVDIQLGF
FT                   YYLILEQIYKKALKRLSLIYLRSNEKLTYEVNDDHHQQARSLIEDMAMKLRCDQEWKPV
FT                   TGQHCDRCGYQKYCPAKSGEPEPLPEGARGTQQVQLALGF"
FT   gene            complement(253250..253777)
FT                   /locus_tag="AM1_B0311"
FT   CDS             complement(253250..253777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0311"
FT                   /product="staphylococcus nuclease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32030"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLK3"
FT                   /protein_id="ABW32030.1"
FT                   /translation="MKNTIPILSLLIPPLLLGCSPPPQATNADIAPANTTSVEVLSTGD
FT                   GDSLKVRSQDGSSSKVRVGCIDAPEHDQEFGPEAGQRLKALLPSGADIELRKITTDQYG
FT                   RTVAEIYSEGKSVGLQLVREGYAVVYHRYLDGCSDTANQYVDAENDARSRKLNFWSQPN
FT                   PVMPWDYRRNRR"
FT   gene            complement(253781..254116)
FT                   /locus_tag="AM1_B0312"
FT   CDS             complement(253781..254116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32031"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLK4"
FT                   /protein_id="ABW32031.1"
FT                   /translation="MTVLCHRCERFSGYLGSQYLVCAIHPSGPVQNPCSDFAEVIEDWE
FT                   PVGAFYEDGELIKDWAGYLTSSERIEVLESHPFFTGACPECGANFGDSRPIHYDCRECG
FT                   WIDDSIN"
FT   gene            complement(254123..254464)
FT                   /locus_tag="AM1_B0313"
FT   CDS             complement(254123..254464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0313"
FT                   /product="conserved hypothetical protein"
FT                   /note="contains a tandem repeat of the PF07411: Domain of
FT                   unknown function (DUF1508)"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32032"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLK5"
FT                   /protein_id="ABW32032.1"
FT                   /translation="MGRKFEIKRASDGQFHFNLKAGNNQVILTSEMYTTKAAAINGINS
FT                   VQTNAPHDNLYDRRESKKQEPYFVLKATNGQIIGNSEMYSSTSAMENGISSVKTNAPGA
FT                   PVEDLTAAE"
FT   gene            254670..255101
FT                   /gene="umuD"
FT                   /locus_tag="AM1_B0314"
FT   CDS             254670..255101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="umuD"
FT                   /locus_tag="AM1_B0314"
FT                   /product="SOS mutagenesis protein UmuD, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32033"
FT                   /db_xref="GOA:A8ZLK6"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLK6"
FT                   /protein_id="ABW32033.1"
FT                   /translation="MLVRSVHAVEQADSVCLPILSVPVSAGFPSPADDHLQSELNLQDA
FT                   LVHHPAATFFMKVEGYSMTGCGIFSGDLLIVDRSLDPVDGAVVIAVLDGEFTVKRFRRS
FT                   KGQVLLAAENSDYPPITVQKGMDFYVWGVVTFVVHGLAT"
FT   gene            255098..256363
FT                   /gene="umuC"
FT                   /locus_tag="AM1_B0315"
FT   CDS             255098..256363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="umuC"
FT                   /locus_tag="AM1_B0315"
FT                   /product="DNA polymerase V, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32034"
FT                   /db_xref="GOA:A8ZLK7"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLK7"
FT                   /protein_id="ABW32034.1"
FT                   /translation="MKQRLIGLCDCNSFYASCESALNPSLQHKPVVIASNNDGVVVTAN
FT                   AKGKALGLVMGVPLFKVQALIKKHDVRVFSSNYALYGDLSSRVMTILETFTPEQEIYSI
FT                   DECFMRMPEFAEATTYSHKVRKTVLQWTGIPVSIGISTSKTLAKIANHVAKKQKQYGGV
FT                   FDISAARNAEGILATFPVADIWGIGRQYNKWLLSQGIESAKELRDANEGLIRKKMGVVG
FT                   VRMIHELRGISCLPLELVAKPKKETCVSRSFGQPVTELADLQEAIAAYASRAAEKLRHQ
FT                   EQVAEAMVVFARTSPFKSGYFRQSATVQFPIATNYTPTIVESARNAMARIYEPGREFQK
FT                   AGVLMVGLCPETTIQGHLWEKDEGWEKRKRLMSIMDEVNDRFGRGTLEIAASGLRQTWR
FT                   MQSKWRSPRYTTCWAELPVASC"
FT   gene            complement(256433..257626)
FT                   /locus_tag="AM1_B0316"
FT   CDS             complement(256433..257626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0316"
FT                   /product="pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32035"
FT                   /db_xref="GOA:A8ZLK8"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLK8"
FT                   /protein_id="ABW32035.1"
FT                   /translation="MNPDHLSELNKGSHSWNQWRKENSNEKPDLGNTILTGFDFTGYDL
FT                   SMADLSGTQLIGVNLVGVNLRNGDLKRATLFKAKLSGADLIGVDLDGADLSMADLSSTQ
FT                   LIGADLRKTQLVGATLNGANLFGAILSEVDLRETRMCGTNLTSVDLRMANLSGADLSGA
FT                   NLSKANIKGLRARFSIVDGATLLNECQMDCNTDFSGVGLDSARINGTLKAKLKRNIRQK
FT                   HWDERYPYYVDWKSIPRYTRLIPKYLYRMSKLKYWRSIPEITWSCLVRLFWWSSDYGSA
FT                   GTRIILSFLIVSVVFTLIYLSPIAFRLDASFIQGIQFAEIINSSGESTQYSFNLWGIFL
FT                   RAFYFSVVTMTTLGFGDISANPASPLGHFLVMFQVLIGYILLGAFITRLSILFQDVG"
FT   gene            complement(257741..257857)
FT                   /locus_tag="AM1_B0317"
FT   CDS             complement(257741..257857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32036"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLK9"
FT                   /protein_id="ABW32036.1"
FT                   /translation="MPTKHIQRISGHRTLTALSGYLEVTDEQVEGAIAKLVF"
FT   gene            258536..260143
FT                   /locus_tag="AM1_B0318"
FT   CDS             258536..260143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0318"
FT                   /product="pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32037"
FT                   /db_xref="GOA:A8ZLL0"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLL0"
FT                   /protein_id="ABW32037.1"
FT                   /translation="MTELMQFSEELIRAKAYLIYLQQKENGVSTCDEQNWQTAIDELLK
FT                   EKNMVIKNTSNLRWPLIRKIWKELEYEAAREKTKIFISFLGLGATVIAAIGLGVNYQLS
FT                   EKKLITDRFIKAVDLLASGTSETAIIGGMFSLEKLAIDSVNDHWTIMELLSSYIVKNSS
FT                   LEENNTPPTKISNEVELAIKIICRRKIERDPTEGKLNLNRINLSGAKLRNAKFKNLNLV
FT                   NSNLISADLSNADLRGANFSETTFDKAILKNAVIDKTTKIDLKWRIVHQLVNKNGIGKN
FT                   LKGTDLVNVQLNDIDLKKANLEGANLSNTSLKNANLSEAKLFQADLEEADLSDSKLIEA
FT                   DLKEADLSNATLVEANLKKADLSKAKLFQADLKEGNLSHSKLIEADLVNADLSKAILKS
FT                   AELNKSYLTFAKLQEANLTNAQLTEAYLISTSLREADLRSANLLKADLRWADLINSDLR
FT                   GANLRETKLSGARLYGANLKDADLSKANLSADNEGNKDVRLIGVDLSGAKLCQTKLPRK
FT                   SSLNPNRDCKELGLDIEK"
FT   gene            complement(260292..264746)
FT                   /locus_tag="AM1_B0319"
FT   CDS             complement(260292..264746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0319"
FT                   /product="WD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32038"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLL1"
FT                   /protein_id="ABW32038.1"
FT                   /translation="MIIVDNVINAILKLIAQNIGRRERYIRLKRKFLGDSNQIPSEFDQ
FT                   LYAYTIIHYSDAKEDKILLILLPILRDINFKNLFRSKKYFLNPNDFSISDAYEINSYNL
FT                   PKSYFVKEIKNFCAVFYHFSQLSEIPSEVIRDQNIKNLQDDISLITNKIDNLIESENIV
FT                   ETLLETFNHKYTIEKKYINSNINTSNILKLSKLLRGWFEAIGYKFEREIFSNNNYFEWI
FT                   ISVHVHIHGREKIVVRGIDGEIGLANLNRLKKSTTIHGASVGWLVTSRRVSNAVKEKLK
FT                   KEPKPKLFCYTFDELIDLDADFEGYFKWLEDEVNRRNISNIYIPLSCKKDEIDFETGRL
FT                   IGSSRYSKKDGWIDGYIDKWQDDPSKKHISILGEFGTGKTWFALHYAWAQLKKYKEAQL
FT                   KGLERPRLPIYVPLRDYANASKIEPLFSEFFFRKHDLSLPNYAAFEQLNRMGKLLLIFD
FT                   GFDEMAARVDKQKMTENFRELADIAVPNSKVILTCRTEHFPDADIARKILSSTLMDINP
FT                   LATSDYAQFETLDLELFSIDQVSQVLSKQAPPETVKTIVSNPELLDLACRPIMTELVLE
FT                   ALPDIIAGRPIDIARVYLYAVSQKMEKDWDAERTFTSIADKLFFLCELSFEMLSNNKLT
FT                   INYREFPERLRACFGKQVQEAKDLDHWQHDMAGQAILIRNSSGDYSPAHRSFPEFFVAF
FT                   KLASELGILEDDFTDLARRQSKIDSLKNPTKYSWSSYFTREFDENDEIVSISGLTLFRP
FT                   ENIEKIIKSIGDFPLAKAIPDLFLPMIDSKQEAINKLLEIIYFTKGKTFDEVGYAGGNA
FT                   ATLLAKIDPFILEGKDFSNCIMYNSNLIDASLRETNFSDADVSNSSFVTSSAPVISVSF
FT                   NATGDFLATAEGNEVCLWRISESDSVLPEAYMTMVGHTDWVRTIAFSPMPDYHLASGSY
FT                   DRKIIIWDVRDRSKVIELKDHTGTVRSVAFSSSGEYFASASDDGKIFIRQTSNWKVITS
FT                   IDEQLGSVRAIVFSPSEDVLASAGHSSYIKLWNIKSGKCIKTLDEHLGVVRALKFSPNG
FT                   DILASGGKDTDIRLWNLKSGKCENTLKGHSRPIWSVDFSNNGSFLASAGEDKNVLIWDL
FT                   KSDNIVSRSLVKHKNWVRSVSFHPKSTLLVSGSEDKSVQICNMLTNACQKTLQGRTNWV
FT                   WAISFSYDSTTIASATEDTSVKLWNIETGKIKKKFSDHDGSVRTLSFHPNDKYLASAGD
FT                   DEIIRIWNVDSDKEFKILKGHTNWIRSLEFSPDGQFLVSGSNDNTIRLWETKAWECHRL
FT                   YEYHTDTIRAISFDPGSRIIASVGEDRRLVFWSTDSDRPCKVVDSAHSKRLTSVVFSSD
FT                   GKLVATGGEDHLIKLWNSQTGVKLLELKGHSNYVNSLCFLSQSSRLVSASSDNLVKIWD
FT                   INSGKCIYDLIGHTGGVYSVTMSKTGEVASCGHDDKIILWDLDTRQPSKVFDNKPYSNM
FT                   KISNIRGISDTEKSALLNLGAIT"
FT   gene            complement(264976..265548)
FT                   /locus_tag="AM1_B0320"
FT   CDS             complement(264976..265548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0320"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32039"
FT                   /db_xref="GOA:A8ZLL2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLL2"
FT                   /protein_id="ABW32039.1"
FT                   /translation="MVICRQRNEHYRSREYLTLAEVNRLIMAAELRGRHPIRDKALLLL
FT                   MFRHGLRVSEAISLRWDAVMLELKAIGITRLKGSVSGTHPLQADEVESLKDLRAEGYPD
FT                   PYLFVGERGGHLKRHAVTSLINRCAELAQLGIKCHPHMLRHSCGYHLANQGLDTRLIQD
FT                   WLGHRNIQHTVTYTMLNPRRFGEIQWG"
FT   gene            complement(265755..265886)
FT                   /locus_tag="AM1_B0321"
FT   CDS             complement(265755..265886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32040"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLL3"
FT                   /protein_id="ABW32040.1"
FT                   /translation="MRSFKQDSRKAYLHACMQAGINEFSFCLLATHLTQTSVARFFE"
FT   gene            complement(265904..266200)
FT                   /locus_tag="AM1_B0322"
FT   CDS             complement(265904..266200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32041"
FT                   /db_xref="GOA:A8ZLL4"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLL4"
FT                   /protein_id="ABW32041.1"
FT                   /translation="MPTNYTEIFEQAKKEKDQEEDQAVEGSKKHQVVQEDNASMQAGKT
FT                   TSMDEGNKAEELVNLCVRVPKNWHREVKAYAALEEKTLAELIVLSVDQYKDSH"
FT   gene            complement(266190..266798)
FT                   /locus_tag="AM1_B0323"
FT   CDS             complement(266190..266798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0323"
FT                   /product="chromosome partitioning protein, ParA family,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32042"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLL5"
FT                   /protein_id="ABW32042.1"
FT                   /translation="MKVIAVSGFKGGVGKSVSAIHVAKFFGTKGKTLLIDSDPNRSCLR
FT                   WYERSPIEHPFKVVNEKGAVSFIPGNDFLVLDTPARPSSDELKEISQGADITLLPTIPD
FT                   AFSLQAMLSMIPMLHQESVYRCLLTVCPPPPSKEATSVRDCLIEAKIPLLKAQIRRAAG
FT                   FTKAIAQGVTVADLTGRDRMAWRDYQSIGTEVEEILNAN"
FT   gene            267222..267365
FT                   /locus_tag="AM1_B0324"
FT   CDS             267222..267365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0324"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32043"
FT                   /db_xref="InterPro:IPR022573"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLL6"
FT                   /protein_id="ABW32043.1"
FT                   /translation="MKTDSIFYRIFKTDPGILFELLDLSPEIAQGYEVESQNEEPLSIP
FT                   LS"
FT   gene            complement(267417..268295)
FT                   /locus_tag="AM1_B0325"
FT   CDS             complement(267417..268295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0325"
FT                   /product="pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32044"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLL7"
FT                   /protein_id="ABW32044.1"
FT                   /translation="MNDQADCDKKALRCSKDLQKFWEKYRSSERQFAGTNLPGANFYQM
FT                   NLSGFDFSHSRLSEVNLIWADISGANFKASKLQRSLAIWVQAYWSDFSDADLRHADFSC
FT                   AKLSAAQLKRTDFSQANLMGADLSDSEAQDACFKGANLWGVWAQRTNLTNVCLSQVDMT
FT                   TSDLTEAQLSESDLSWSFLSQAVCVGANLTSACLEGSDLKKTDFQDACLSRADLSAADC
FT                   ENACFFNANLYKADLRGAKLCGADFRGANLTQANFTGADISGAILPDEYASKLGMLGHQ
FT                   QVPCEQRWSIQ"
FT   gene            complement(268311..269240)
FT                   /locus_tag="AM1_B0326"
FT   CDS             complement(268311..269240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0326"
FT                   /product="pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32045"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLL8"
FT                   /protein_id="ABW32045.1"
FT                   /translation="MAQLTVSEVLSKAQNQQSLRCAELSHINLTGALLRGCNFSQAYLR
FT                   GANLAKSICDEADFSLATLVLAILSGASLERACLRKAELTKAKLDRGVFHELNAPQAKF
FT                   HGADLHEADLSFATLLKADLSTAIGLGANFKNSNLQESTLSDGDFSGANFRETKLTRSV
FT                   GHRSILNGAVFSLADLEAVEFEAVRASKADFTQAELINANFQQSVLSHAILRQVQGDWG
FT                   KFNGASLKYTDWQDSMLFGTQFEGADLTGANFTGVNLQQANLERSNLFDVNWSNAQVSG
FT                   TLMTDAQGLTPQEARELRERGALNVPQV"
FT   gene            complement(269406..269528)
FT                   /locus_tag="AM1_B0327"
FT   CDS             complement(269406..269528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32046"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLL9"
FT                   /protein_id="ABW32046.1"
FT                   /translation="MTISFGTLEQHVRQISPFSEALPYTSADSADQVTEDSDGR"
FT   gene            269871..270347
FT                   /locus_tag="AM1_B0328"
FT   CDS             269871..270347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32047"
FT                   /db_xref="GOA:A8ZLM0"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLM0"
FT                   /protein_id="ABW32047.1"
FT                   /translation="MKFLRFRLKQRISFLVKKFKKEFIINPILKFKKEFSENPFEAVKK
FT                   LIINNSKKYLYQFYFVLLIVFICSHGFDIKSLPLIRTVVNYASMNSNQLLFTWISYIIL
FT                   ILYAFLIQNTTSTLKNSLQSKNLRKKTLKRLFIGFIAFLTFSGLESLIWRMLEF"
FT   gene            complement(270536..270964)
FT                   /locus_tag="AM1_B0329"
FT   CDS             complement(270536..270964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32048"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLM1"
FT                   /protein_id="ABW32048.1"
FT                   /translation="MPHIAASVVLGHTRSTQRRYSARYTAGRTRPSRVSRAFESKFHKL
FT                   ESKQKNLVQQTKLEGQLEYLAVSRSSSGKYLITVEGSGKPFIRIPFETPKFCYECALEL
FT                   EVKFDVLQVLSLRPGETIEMIGVWLERERVSRVWGDEN"
FT   gene            complement(271013..271495)
FT                   /locus_tag="AM1_B0330"
FT   CDS             complement(271013..271495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0330"
FT                   /product="helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32049"
FT                   /db_xref="GOA:A8ZLM2"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLM2"
FT                   /protein_id="ABW32049.1"
FT                   /translation="MQRLESSSVPQAGESLGDYVHRLRTTLGLSQKEVAIKAGVHAQSY
FT                   GKLERNKTSSLNRKTKQGLAAALQIPSDYLDAVCRGTVVSPNQGIRFCPHCWRPGTPPD
FT                   SIWLHSRAQYCYVCGTQLRDRCVNCDERIASLKHRFCPYCGTAYQALKALHVEKEG"
FT   gene            271577..272473
FT                   /locus_tag="AM1_B0331"
FT   CDS             271577..272473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0331"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32050"
FT                   /db_xref="GOA:A8ZLM3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLM3"
FT                   /protein_id="ABW32050.1"
FT                   /translation="MSKPLAMVTTEFLDRPGLAASTVRSYEFTLLPLLQQYGQWSLELL
FT                   DRQTLEEYLNSLSHLSFKTHHRHQAILQALLNFAVEQGYLRSNPMTRMKRRKPDPAKGE
FT                   HDSDQIIRYLTPDQLQLQYQLVSKDARTAALVRLLHRTGARISELLSLDLEALDLEQRK
FT                   FQVIGKGNRQRWCFYSEDAAEVLQKYLAEYRHPGSPALFTAQQYLSDQVNRLSYRSAHH
FT                   NWKQLIKGHPTLAGTRLHDLRHTFATERVGIIALEELRALMGHQSIQTTLRYQKVTSEQ
FT                   AQNAAQRAFDKLSQTTL"
FT   gene            272697..274862
FT                   /locus_tag="AM1_B0332"
FT   CDS             272697..274862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0332"
FT                   /product="transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32051"
FT                   /db_xref="GOA:A8ZLM4"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLM4"
FT                   /protein_id="ABW32051.1"
FT                   /translation="MKRQWQPDELIESFILLPNELALIPNYQTNATEHNQLGFAVLLKF
FT                   FQLEGRFPKHLGEIPQIVVEFIAKQLKLTHQSLVDYKWKGRTIKEHRAIIRSFLGCRPT
FT                   QRPEKKSLMTWLKEKVMPLGLHLNAIREQAYQRLRHLKLEPPSPKELTRLISSAAHNHE
FT                   QDFCQTIAARLPADTRKRMDALLETEFTRDHEESQFRQSDFNRLKSDPGRLGLKSLFNE
FT                   IDKLQSIRQIQLPTDLFASYSPKLIEQYRRRASADLAGRLRRHPKAIRYTLIASFCYQR
FT                   EKEITDNLVDLLVQIIHRLSISAERRVERELIANFKRVNNKEALLYRIAEAALANPDQP
FT                   VKEVIFPVVSPDKLTNVIEERKRTGITYREKVNVKIRASYLHHYRRMVPAILETLDFHS
FT                   NNKQHRPVIEAIELLRQYQGSGKRYFTEDEKVITTGVLKSGWRELVIESNSKGQDQVNR
FT                   VNYEICVLQTLRDTLRCREVWVMGAKRYGNPDTDLPQDFEAQREQYYLELNQPLDAEAF
FT                   VTKLKLDMTAALSSLNTSIPNDPQVNILSRGNGWISVTPYPAQEEPSNIHKLKQEVAKR
FT                   WPMTSLLDILKETDLRVNFTDQFHTAASRQQLHGPTLQKRLLLSLFGLGTNMGLKRVCA
FT                   GIADESYPNLLYVKRQFLHREHLRNAIGEVVNATLKARLGNLWGEATTACASDSKKFGA
FT                   WDQNLMTEWHSRYGGRGVMIYWVRFVG"
FT   gene            275326..275451
FT                   /locus_tag="AM1_B0333"
FT   CDS             275326..275451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32052"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLM5"
FT                   /protein_id="ABW32052.1"
FT                   /translation="MEVDWLRVGANQKLGGGKDWVKSKSPTVMVRISRQTHGDLE"
FT   gene            275474..277204
FT                   /locus_tag="AM1_B0334"
FT   CDS             275474..277204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0334"
FT                   /product="RNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32053"
FT                   /db_xref="GOA:A8ZKQ7"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKQ7"
FT                   /protein_id="ABW32053.1"
FT                   /translation="MSKARVKPMMEWSAIPWPKLERKVFKLQKRIFRARQRGDVKVVHR
FT                   LQKTLMRSWSAKCLSVRRVTQDNQGKKTAGVDGVKSLSPEARLPLVGQLKLGSKAPPTR
FT                   RVWIPKPGKDEQRPLGIPTLYERARMTLVKLALEPEWEAVFEPNSYGSRPGRSCHDAIE
FT                   QIFAAIKQKAKYVLDADIAQCFDRINHEALLKKLKTFPTLRRQIKTWLKAGVIDGHQFL
FT                   QTSEGAPQGGTISPLLANVALHGLEYRIKQAFPIRKIADGNKRKRIATPDVIRYCDDFV
FT                   ILHEDLSVVQRCQSLVHEWLKDMGLELKPSKTHISHTLKRYEAENPGFDFLGFSVRQFP
FT                   VGQHQSGRLCGTLLGFKTIITPSRKKQKVHYNRLVSIINAHKAAPQAALIRHLNPVIRG
FT                   WTRYYSTMASKETFSRLDHLLYQKLQTWANHRHPGKSRKWVVNKYWQTVGGDKWVFATR
FT                   VTKSRTEKLLKHRQTPIIRHVKVKGDASPYNGNLVYWSSRTGKHPEAPKRVSMLLKKQK
FT                   GKCAQCGMFFREEDLLEVDHILPTSMGGLDVYKNLQLLHRHCHYVKTAKEKSSQAKWYV
FT                   "
FT   gene            277368..278117
FT                   /locus_tag="AM1_B0335"
FT                   /note="fragment; similar to C-terminus of transposase"
FT   gene            complement(278230..278568)
FT                   /locus_tag="AM1_B0336"
FT   CDS             complement(278230..278568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32054"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLM7"
FT                   /protein_id="ABW32054.1"
FT                   /translation="MKRPVHITDEYVLERAQEDIEAANGHQGNPIEGDASVTADFDNFD
FT                   LSVDAYEEAGTIVFCVTGSVDVHYEFSEYVQKGRSDEYDHKQWGKDEREDYEMYYHIAA
FT                   EKLVEGEP"
FT   gene            278632..278778
FT                   /locus_tag="AM1_B0337"
FT   CDS             278632..278778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32055"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLM8"
FT                   /protein_id="ABW32055.1"
FT                   /translation="MLLDLKRPKLRWANDVAQASILSVLWNGLSSLKSTPCGEGKLPAI
FT                   VAE"
FT   gene            complement(279021..279245)
FT                   /locus_tag="AM1_B0338"
FT   CDS             complement(279021..279245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32056"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLM9"
FT                   /protein_id="ABW32056.1"
FT                   /translation="MIVLEFKARTSKHQASAIDEAIRTAQFIRNKCLRFWMDNKGTGKY
FT                   DLNKLCRVLANDFPFAKQLNSMARQASAE"
FT   gene            complement(279356..279697)
FT                   /locus_tag="AM1_B0339"
FT   CDS             complement(279356..279697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0339"
FT                   /product="HicB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32057"
FT                   /db_xref="GOA:A8ZLN0"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLN0"
FT                   /protein_id="ABW32057.1"
FT                   /translation="MKNMMEYQGYFGSVNFSDEDEVFFGKVEFIRSLISYEGTDVQSLK
FT                   SAFHGAVDEYLADCTENEIEPERPFKGSFNIRPGTQLHRRAAIAAQQRGINLNALVTEA
FT                   LENYLQPSK"
FT   gene            complement(279694..279948)
FT                   /locus_tag="AM1_B0340"
FT   CDS             complement(279694..279948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32058"
FT                   /db_xref="GOA:A8ZLN1"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLN1"
FT                   /protein_id="ABW32058.1"
FT                   /translation="MTRKEKLIKRFLTRPKDFTWDELVLLLSFFQFSEVSTGKTGGSGR
FT                   RFINEEGLVISLHKPHPKKILKKYQIEQVMDILEQEGLL"
FT   gene            complement(280025..280672)
FT                   /locus_tag="AM1_B0341"
FT   CDS             complement(280025..280672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32059"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLN2"
FT                   /protein_id="ABW32059.1"
FT                   /translation="MFKQLELDFASALASALDEPEQADISLMCASLDQHLQGRSSHEQL
FT                   RVAGDAIRDIADVVCQRAELLIQDWEDRHNTQGPVLDDDFLAGLVQETMFLDVSDLCRQ
FT                   PKSRKQRHGFTGKPVESVVGEVSKDDVLEFVDELESGEAVALKVSHEEDVGAWVGAIHD
FT                   FLEGKEDAVLFGDLARGLGFAPVAVLIGVLLGGFRVEQRGGFYSQSLRVSQR"
FT   gene            complement(280656..281186)
FT                   /locus_tag="AM1_B0342"
FT   CDS             complement(280656..281186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0342"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32060"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLN3"
FT                   /protein_id="ABW32060.1"
FT                   /translation="MGRPINKLCLECSKLSQKEAISLHGPETTTACWNPKTCPRKRSHY
FT                   RHRRENNEKQRAHYRDRNSKPAPAETTETFSIPVQAPPVALLYLYKEKPKDAHLHAMAV
FT                   SVWQGSEKLAEIEAVHCMGMTNTQVNRYLKEVLRVLRERYGITEFEPPIRMEPSECEIV
FT                   DCPLKDKRHVQTA"
FT   gene            complement(281188..281598)
FT                   /locus_tag="AM1_B0343"
FT   CDS             complement(281188..281598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0343"
FT                   /product="PIN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32061"
FT                   /db_xref="GOA:A8ZLN4"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLN4"
FT                   /protein_id="ABW32061.1"
FT                   /translation="MTYLLDTNACIQLLKANQDSAIAKRLAQYTPADIRLCVPVKSELF
FT                   YGAYKSVKRQANLERLRLFYRQFQSIPFNDEVAKVCGQIRAALAAKGTPIGPYDLQIAA
FT                   IALVHDLTLVTDNVREFSRVDGLAWENWQEEA"
FT   gene            complement(281595..281837)
FT                   /locus_tag="AM1_B0344"
FT   CDS             complement(281595..281837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32062"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLN5"
FT                   /protein_id="ABW32062.1"
FT                   /translation="MSQPISIRSHVGADGVLRLEVPTEFADADLEVTVLLSPAESSAPT
FT                   TTEWQPGFFSDVIGSWEGELTRSDQGEFEIREDWT"
FT   gene            complement(282034..284256)
FT                   /locus_tag="AM1_B0345"
FT   CDS             complement(282034..284256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32063"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLN6"
FT                   /protein_id="ABW32063.1"
FT                   /translation="MSLEGKTLETAVTGLVSISLKVFGQFLENQPLISVEQQIYNLSEI
FT                   YAQNYYKRHGQIQVLGMSQSISFDDIYTNVKMMDAETVKILESIERLEKVYREAHQRYL
FT                   WQQTEAKQKGIAVENTEQYLCVLGGPGIGKTTYLRKVGLAALLRNVESYDHEKIPVFLD
FT                   LKRLRDPDLDLKKSIAEEFEICGFPKPEQFTDHALKSGDFLILLDGLDEVLSGSFNQVV
FT                   QSIIDFSDRYSNNRFITSCRIAAYPTYFTGFKTVAIAELDDDQIFEFIKKWFDADPNPQ
FT                   LTREKKAEYVNTIWEQLKEPDFIYTKELPQTPLLLAFICLVCRQGKTIIDNQAKLYSKA
FT                   LDFSLKDWANSKLMDENWEIYQDFSADIKKDMLASIAYVGFEEDKLFFEKDELAEQITA
FT                   FLTNNLNVSKHLDVNKLMEEIAVQSGILVKQATDIYSFSHLTLQEHLCAEYIRNWSYED
FT                   QLIQNHAADKHWRGVFLLVTELKGHSAIEFLQQLEEQTQALSEYPKLSGLLAWVESKTS
FT                   TAISDFSGEIRRVFTLILIFDLTIALTLALALDLDLALALDVALARDRDRERFASSASV
FT                   IASLRESERAKAIATIGDLASVRALASNLSSGLNLDVALDHALDDTLASDLALASAFAR
FT                   GNVLAMAQFALDKKLMVDVELQTLISCLKNSSHALKTSSKGLTSIVSSSLNISQELFDL
FT                   SKDDLQMLTNYFSTCQLMIDCSKQASGLSVNDWNAIRQQMFLPPQF"
FT   gene            284525..284848
FT                   /locus_tag="AM1_B0346"
FT   CDS             284525..284848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32064"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLN7"
FT                   /protein_id="ABW32064.1"
FT                   /translation="MTDKTYKASWAKIGNSSGYRITSDFFREHPEFVGSDGVIQVIAPD
FT                   TVVFSRAKTEEEGQEEDDLMLSLYLDFLTKQALANPDELEEYTQDMADEDEELIAGVIL
FT                   DAD"
FT   gene            284838..285281
FT                   /locus_tag="AM1_B0347"
FT   CDS             284838..285281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32065"
FT                   /db_xref="GOA:A8ZLN8"
FT                   /db_xref="InterPro:IPR021679"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLN8"
FT                   /protein_id="ABW32065.1"
FT                   /translation="MLINDWNIYFLKRLFGQQRLALRTEVKRLKATLPPEDYVRHPQVK
FT                   LYAATMQAIKAKIPADPFASHFALTGPLKKFGRVKKMGIPNRYRLFFRAFKVPESQSIF
FT                   VLWLGYPRKEGDKKDCYRAFRKMVERGDFPDSLDDLMVESEQG"
FT   gene            285281..286936
FT                   /locus_tag="AM1_B0348"
FT   CDS             285281..286936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0348"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32066"
FT                   /db_xref="GOA:A8ZLN9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLN9"
FT                   /protein_id="ABW32066.1"
FT                   /translation="MSKNYGVDIPEVKLITFPTTEADQAPSPKSIRRGRPTQIPTPMDI
FT                   RWPMVQEFLRNSNLSPNSQKLYERELKRFLGWTHFRWSDLTLRHLGQYKVYLMELKVAE
FT                   GKTLSKNSLNSALTALKSFFKWLTQFHPELCPTNPTKGVKFEKVPLPPAQNLTPEEMTR
FT                   VWDAITQREQTQLRDLALVQLLSHNLRAGEVVTANVGSFDGRLISITKTKNNQPRLVPL
FT                   STEGQQVVQEYLDWRKDQQGEALSAESPLILSHHQGWEGQRLSYHGVYFAVEDIGRLAE
FT                   LPDLHPHQFRHTSATEYLRMGLDPAHARRLTGHTDERSFRRYTVAAEQEAAITAFYRAE
FT                   KEGQPLVFAQSLDRKQRQLLEALAEMTGKPPLYQDDLDEGIIDFAQLWQENLQELELLV
FT                   ADVRALPEKLGLRGFVKNERQSTSLEERVLRGEIPTNEVLQLDPVVEEPSDCPQVRSVE
FT                   SSHQVIHLGMKLWVNGKKKGKVRKAIEERVLEQFQMVKRKPRGNEYQLTVEVEEDDDLP
FT                   AILSQMKWEMEVLGELDECLVEVKLNDEAKKGKP"
FT   gene            286936..287829
FT                   /locus_tag="AM1_B0349"
FT   CDS             286936..287829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0349"
FT                   /product="WD-40 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32067"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLP0"
FT                   /protein_id="ABW32067.1"
FT                   /translation="MHIVSGHLDCVSGISVSPDGQTLFSASWDKTLKIWELATGRELSI
FT                   LSGHTDFVSDVMISPNAQTLVSASWDMTLKVWELETGKVRHTLTGHTDFVNGISISPDS
FT                   QILVSTSWDGTLKVWELETGKELHTLNGHTFSVHSVSISPDGQTLVSASSDKTLRVWEL
FT                   ATGRELGILKGHSDSVSDVKISSDGQTLISSSSDNSLKIWELATGRELGILNGHTDSVI
FT                   GISISPNAQTLVSTSLDKTLKVWDLQTGKEVMSFSGESAFSCCEIALDGHTVVAGDFDG
FT                   KLYFFSLEDLSFSDEH"
FT   gene            complement(288169..291237)
FT                   /locus_tag="AM1_B0350"
FT   CDS             complement(288169..291237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32068"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLP1"
FT                   /protein_id="ABW32068.1"
FT                   /translation="MALFCDRIAITAITLTVFYSLPTIAEPQPSTQASDLRFSPRFGIG
FT                   ANSPSSGTNTTTRLETFVPVWQKPGRALTFFEGRLLLDDQGNPGGNILFGFRQYSDDLK
FT                   RIFGGHLGFDIRNTDNNTFQQLSLGIESLGKDVDLHLNGYWPVGSTRRQTRQRIFEVLQ
FT                   LNGDPRFTGNILLLDLLRRRLITRQFEEALAGVDFEVGKQLLSFKNGGDLRAYLGPYFL
FT                   HSSIRGNTIGGRLRLQVRPTPNISGGIGIQHDDFFGTHVLGNITFTLSVNQPQSPVSPA
FT                   NNVVARMGDSVIRNNSIIVDTPNTTELLETETQTVAAMNPTTGEPWFFHHVNLGLGNSD
FT                   GTFESPFPSLEDALGVIRGDGNDIVYVANGINSGIEGFTIPDKVQVRSRGAVQQIDVNP
FT                   ISFPLRPESVLRLGQVQLPFSGDSSFPRITSTVSLGNNTLLSGFDVQVTGAPALVANNI
FT                   TTATVIDNSLASTNSTTNGISINGISGSLNLDNNAINIDNPAMAGVDISNVSASTGSVR
FT                   IVGTSGSRIQRTGRDGVVLGNNTTIANLNIAPLPNNVDFSGNRGIFGRNVRNVRVQNNQ
FT                   IIVIGRDFSPGIKLENITGSAEIINNQITRNPIFVDPAAPGISHGISLSLSNINLDRVV
FT                   ISENTIKTTGISTDGIVIQSLNDSAIQSVTISGNTIETNGVQSDGIVVQSSNNSTIQSA
FT                   NISGNTVETAGLNSQGISVRPIYNSVITTATISGNTVSTDRIFSYGILVEPFNKSTITT
FT                   ASISENTVSTTGIADGILLRPGYNSAITTTTISGNKISTAGLISDDMVLRPFFTIPSTT
FT                   ASINIRPTTNSVISTAIISGNTVSTTGLAYGINVQPSQNGTITVATISGNTVSTDRFNA
FT                   AGIRVQPYIDSTINKATISGNTVSTSGKNADGILVRPVGNGAIQSATISNNKILQAGRD
FT                   SVRIQARQDSLRIGNYDVNPICAAISGNRSDNPNVAMAGGLDFNLISARSPFQVESLTT
FT                   VSLDNNNAIFSFDGTLVPPGTPSSPFTNVVSCP"
FT   gene            complement(291590..291754)
FT                   /locus_tag="AM1_B0351"
FT   CDS             complement(291590..291754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLP2"
FT                   /protein_id="ABW32069.1"
FT                   /translation="MKLVSAALQSSEGRFPAACSEEMELQFKSTVWEQIVFHTPSACSR
FT                   AVDLGLVVS"
FT   gene            complement(291942..292073)
FT                   /locus_tag="AM1_B0352"
FT   CDS             complement(291942..292073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32070"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLP3"
FT                   /protein_id="ABW32070.1"
FT                   /translation="MHFLKHHQKWTRSRGYENTQFIKECSEFSIIKAFQLSQSMANK"
FT   gene            complement(292098..293771)
FT                   /locus_tag="AM1_B0353"
FT   CDS             complement(292098..293771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0353"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32071"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLP4"
FT                   /protein_id="ABW32071.1"
FT                   /translation="MELFQQFLPCQDTLHLDSWDLDSTNHQMTFHVSSTQALACCPVCH
FT                   QTSHRVHSRYERTLRDLPCVEFCLTILLQVCKFFCSNKTCKRRIFTERLPQVAVPWARR
FT                   TVRFAEHLSSIGLALGGAAAARLSYQINYGSSRNTMLRALFKLPLPSVTTPKILGVDDF
FT                   ALRRGHEYGTILVDLEKHQPIVLLTDRKADTLADWLNEHPGVEVISRDRSKAYKSGASE
FT                   GAPDALQVADRFHLLQNLEEILENVFSSHSQVIKTVEYTLLKATLAEHQDTEAMSQPVV
FT                   KPQVDPNSRKAQNRARRLEKYEQTHALRKQGYLIKDIAHHLGIGKRTVYTYLAADTFQE
FT                   YKTHPRRGWSGLNPYKAYLLEQWNKGRQNSKQLLAEIQQQGFKGSYTMVVRYTHKLRQS
FT                   LPPQPPRDSLNELPGRGPVPEAQELIQKPLTVQRAAWLVMRKVENLTEEDETILEQLSS
FT                   QPELSKAIDLAQSLLFIVRKRLPQHLDPWLDRAKNSALKPFQSFAKGLLDDYEAVKAAL
FT                   TLEVSNGQVEGQNNRLKMVKRQMYGRAGLDLLNKRLVLMS"
FT   gene            294720..296378
FT                   /locus_tag="AM1_B0354"
FT   CDS             294720..296378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32072"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLP5"
FT                   /protein_id="ABW32072.1"
FT                   /translation="MNISALLKVSRNERDITWLRKALQTALKLEFSTLPPYLIALWTIN
FT                   DRNSFAYQSIRNQIAEEEMLHMGLVCNLIVAMGGEPDLTSSDGVPTYPGPLPGMVQSDL
FT                   EVSLARYSPEALQTFLAIEYPENPPIEIGNDPKPDAQANDCASDCAKTIGQFYTEILEE
FT                   FQDLQDRGELPEFDTNQQLKYSVDFQNDPDRKVFLIESLKDVKRAISVIKRQGEGTGTS
FT                   PEDTGVEDLSHYYRYLELDRERRIRFINGQFVYGNKPADQIKAPAEVYSMATIPENGYQ
FT                   RENVSSDVWEKITKFDRTYSKMLLEIERAWTYPEEEGGGKLSLDDAVLRTMFELTNDAV
FT                   SILQEIIPNASGERYGPCFRFDPTVTLPDGNDSDNTGGINPFPTWEIDIKNFFTAGDIG
FT                   CMNNVGNPPFDLASYTDVFQFADQILDRVSLPEEDPLLMPQGGPRWHQDKIDTFQNWIT
FT                   NGKPKVPTWDDNIRDLFESLDVNCMKNSGSRFDLSNYDDVVAKASDILNRVSRAEGASG
FT                   VMPPQTDRHWPDNWVATFKYWSENGMPKSNDNLPE"
FT   gene            complement(296583..297209)
FT                   /locus_tag="AM1_B0355"
FT   CDS             complement(296583..297209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32073"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLP6"
FT                   /protein_id="ABW32073.1"
FT                   /translation="MLEDRFFTWVAMRVSRRAIFRLIAIALMSCISVACSASNSDVRAE
FT                   GADLSGNSGKSDPMTMNIINNSSSTFQLEIGDEVRQTLKLHLEGGSLKIARLVIRDVYP
FT                   QAAKDLKGVRIFIENPDADANTTIDDQHYISSFVLGLEDVQSQQFNIAPTLSRLWHAGI
FT                   ITPAHLDGRKQLQVTFVPIHWDYVTAFPTDFALTFKSLTLEVPNQ"
FT   gene            complement(297202..298668)
FT                   /locus_tag="AM1_B0356"
FT   CDS             complement(297202..298668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0356"
FT                   /product="tyrosinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32074"
FT                   /db_xref="GOA:A8ZLP7"
FT                   /db_xref="InterPro:IPR002227"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008922"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLP7"
FT                   /protein_id="ABW32074.1"
FT                   /translation="MFTSKTRREFLISAGAATALFFLPTKVAQAQELRTRKNVASPDAE
FT                   GDLASLRDGVSEMKRLINTDPEDPRGWILQAYIHGNCNDFTDCKHSNWYFAPWHRSYLY
FT                   YFEQLIQHFSGNATFALPYWDWSQTHTVPSSFYGDANPLDDNISIQSICSSAPTAGRGR
FT                   PDGEEITQQELEEYVGPVRIESIQQNPDYATYGGIGGSGELEVIPHNFIHRWVGDVGGK
FT                   NSNMVQFFSPLDPIFWMHHCNIDRLYSDWLSRPGHLPPSEDEWQNQSFNEFYDVDKNQV
FT                   GSEFTCGQTVDSRVMGYVYSTDQITNLTQTLAARSSIIRQQVVESVIESKSILVENVLS
FT                   FEANVDLSLRTRRLISTAAVGVPNYVVRLRIEGVKTPKQQNTGVFVFLGPDITAETPIS
FT                   APGYVGNFTFFEGQGGGNRKRWSHGHKKNVLLNATEAVKRLYGDTRLSESNSLKVSIVT
FT                   RSLFGDQNAFASVEEIQPNMVQIDVVDLNA"
FT   gene            299212..299421
FT                   /locus_tag="AM1_B0357"
FT   CDS             299212..299421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32075"
FT                   /db_xref="GOA:A8ZLP8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLP8"
FT                   /protein_id="ABW32075.1"
FT                   /translation="MDHQFVAITSFHDLRNVGFRRTALTRMHNAGVPTKPIQRIPGHRT
FT                   LAVLSGYLEVTDEQVEGAIVKLVF"
FT   gene            complement(299783..299932)
FT                   /locus_tag="AM1_B0358"
FT   CDS             complement(299783..299932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32076"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLP9"
FT                   /protein_id="ABW32076.1"
FT                   /translation="MHKKILRFLVFAFSQGTLPISYNEEKRFLSKLTDWEGNIFHTCLL
FT                   AWGS"
FT   gene            300291..300956
FT                   /locus_tag="AM1_B0359"
FT   CDS             300291..300956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32077"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLQ0"
FT                   /protein_id="ABW32077.1"
FT                   /translation="MNKKNLLALACILPLFIQAPVHSESQQPSGRNCRHIKSVLQLADD
FT                   NNLDTEILIKLQEKYCSTNHSDKLFILPEQQTEKTCSEITTIGNFSYVSNDQQSRELSK
FT                   QIVNRSKFICRFDDGNGSFDWGNGQTAKSIGGTWYYPNGQTAKSIGDTWYYPNGNRASS
FT                   VSTSLLPWACEKVEQEICDRRLSLVSKLQQSNDSTNEDYREFYLNQSIIMLAWHAHLQ"
FT   gene            complement(300960..301124)
FT                   /locus_tag="AM1_B0360"
FT   CDS             complement(300960..301124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32078"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLQ1"
FT                   /protein_id="ABW32078.1"
FT                   /translation="MLETMGAEATQFTKNYVKLMRMKPSFVKQIIVLFIMNNFCSEVMH
FT                   AIKAKFHSS"
FT   gene            301371..301925
FT                   /locus_tag="AM1_B0361"
FT   CDS             301371..301925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32079"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLQ2"
FT                   /protein_id="ABW32079.1"
FT                   /translation="MQDSLPESLSKLLGNISTDQQNYVLEARKQILGFDDHIIEVGRTT
FT                   STEYGLRKGEKQIYKTLMCAKFIPFHRGVYRPKLLLLLPYPKREWAGQGSGRTYKREKV
FT                   KGLTWVEASHTKAWDQNSQLKLYFYTGKSQSRYSSVMDLTPYESMCHLLLGKEDLKFTS
FT                   LFDIINLALNEWKLQVDERDQ"
FT   gene            302069..302266
FT                   /locus_tag="AM1_B0362"
FT   CDS             302069..302266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32080"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLQ3"
FT                   /protein_id="ABW32080.1"
FT                   /translation="MGAFYKDNELIKDWVGYLAASERIEVLETHPFFTGVCSKCCASFG
FT                   DSRPIHYDCNNCGWMDDSIN"
FT   gene            302355..302621
FT                   /locus_tag="AM1_B0363"
FT   CDS             302355..302621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32081"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLQ4"
FT                   /protein_id="ABW32081.1"
FT                   /translation="MIAFIVYWSKWRQSRGNLGRVIDYSKGNKGARREQWQNYSSSKAK
FT                   LIQRIGREATERLIVNVLLDNPSKSRTWCSDKALRDLERDQGL"
FT   gene            302674..303150
FT                   /locus_tag="AM1_B0364"
FT   CDS             302674..303150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0364"
FT                   /product="nuclease, SNase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32082"
FT                   /db_xref="GOA:A8ZLQ5"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLQ5"
FT                   /protein_id="ABW32082.1"
FT                   /translation="MGCDPPSSTITNDVAPANTTPAEVLSTGDGDTLKVRSKDGTSSKI
FT                   RIGCIDAPESSQEYGPEAGQRLKALLPSGITIELWEITTDQYGRTVAEIYSEGKSVGLQ
FT                   LVQEGYAVVYHRYLEGCSATADQYIAAEEEARSQKLNFWSQSNPEMPWDFRRSR"
FT   gene            303171..304007
FT                   /locus_tag="AM1_B0365"
FT   CDS             303171..304007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="contains DUF323 domain"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32083"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLQ6"
FT                   /protein_id="ABW32083.1"
FT                   /translation="MEEAQHQNAFYPEDLGGRQTLSMMEIPEGEFMMGSPEGEMDRQDD
FT                   EGPQHWVKISRFYMSQTPITQTQWRIVAQWPFVNIELQGYPSYFEGEKRPVEEINWFEA
FT                   IEFCDRLTQHTGRPYRLPTEAEWEYACRAGTTTPFYFGETITTDLANYRGTDWEKYNSS
FT                   GSYGSGPKGTYRGETTPVDHFQVTHPYGLSDMHGNVLEWCQDTWHSHYDGAPVDGSVWV
FT                   DEEDIDSDKVLRGGYWGENPGFCRSACRSGTDPDNRNFDIGFRVVCSPQGLPYSHR"
FT   gene            complement(304083..304325)
FT                   /locus_tag="AM1_B0366"
FT   CDS             complement(304083..304325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32084"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLQ7"
FT                   /protein_id="ABW32084.1"
FT                   /translation="MLEVYSPIPSLMSEQDQYAPAPSRNTEEIQKDYNSDAKAMRAKAA
FT                   RARIAARQKAERDARQRAAIEKIPLEHRYVPDQAS"
FT   gene            complement(304374..305261)
FT                   /locus_tag="AM1_B0367"
FT   CDS             complement(304374..305261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32085"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLQ8"
FT                   /protein_id="ABW32085.1"
FT                   /translation="MSRLNDLRFESEVIDASSSSFRDQSNEEWFKLRMKIKPEALKGIA
FT                   EGDSWFDYPPAWVSDISLGDLINQLNMRSKINLLRVAKAGDTLENMTFGTNPLVNSPQL
FT                   VKALALIDKYEPDFFLFSGVGNDVAGPNGFKFEPFLHHSRSQLSTIHLKEDYLDFMTNK
FT                   VFYEMFEFLIKEVISAKSDIKIFLHGYGYPTPDGRAVIEIGDYEFIGPWFEPALRRKGI
FT                   SQAEGKVIAKRLIDSLNEMLKDLSDKYPNNVYHIDLRIIIKDGDWENELHLSAQGFKKV
FT                   ADEMERTILEAFGV"
FT   gene            complement(305699..308515)
FT                   /locus_tag="AM1_B0368"
FT   CDS             complement(305699..308515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32086"
FT                   /db_xref="GOA:A8ZLQ9"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019791"
FT                   /db_xref="InterPro:IPR034815"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLQ9"
FT                   /protein_id="ABW32086.1"
FT                   /translation="MNDPNSAGSKCPFGFGKNVQLNTQSPGLETGDPLEAMNAGNHAQA
FT                   ITLLNIKVADGSASQTDIERLALAKFESGDPKGAAKIFRELGERFPESNHASWWQDRAR
FT                   VTGQAAMNGESVERKSPITDTYRSGDANRVLREFWEGPNKDIMDFNEEPLKVYVPKPSL
FT                   WRKGINLLLGGAFDLVQGLTSCIFKVVDTVFSRFGKYRQAMRHGIWTYLPSTIGLLRLA
FT                   SDRNELLAGRNIPESMKTQSDLSSSYTAKHPGPGGFFTDPDLPSAGAVGQPIPIHGGLG
FT                   DKPNKYEHLLPSAAEIAQAELYATGRRETADHLNVFAIDHLFDLPHDVLMPAFNEHKKI
FT                   PIPVASGSPEAELGIEWVWIRANEIDPKTGAVLSSTTNAWDGSPDRGSTPEAVKRMRTD
FT                   PATGEMLPGGKIYLQDGKWLPNIEHESGAKTIQTGIDQNMSIGVTLIRTVYVRFHNLVC
FT                   DILAKRHPELTDNQLYWKAANIVIQTRAKVHTAFWTPMLFGHETATRALHSNQFGLLQG
FT                   RTPLRQKLVHDPLHKGTHPALHGLAGNPKIAQMFSDPELKGLDFSETYRPVGHALQPDG
FT                   FDMALCDIHEQGKPVAGGEFISLTETLGSTGNELLQREGIGRIAHMLMNTSVGAFTLNN
FT                   YLPEFAHLATAGGTTRIGETDVQRGLDRGTGRYNSFLERLNIPGLKSYRELFKEPDSKN
FT                   AQEVIQRWEQLFGPYNEASGELFLTTGMGQLADEFRPEGYAVPNPTFMNFVMEASTRFM
FT                   HNEWLTNYAGPEQVTPTGTNIVNAVTFEHLLGLFGGDEFREYLEGRERPNAFSNMRTNI
FT                   PHPIESHVDYGEENLLDFGAGAAYLEAHWTGKGLENYEIYRVHDGDKSYLVDLTDRQVY
FT                   MDHDNDGRIRMSDAVFFLPEGCPSENELFAKAEGFALDSQQPGKLSTQEIKMLKQHNYD
FT                   KKKVGVAA"
FT   gene            308685..308831
FT                   /locus_tag="AM1_B0369"
FT   CDS             308685..308831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32087"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLR0"
FT                   /protein_id="ABW32087.1"
FT                   /translation="MISVTKNSSEFYPRLCSQSEDLIDKRDLSYHIIFAMQPPCGFGCV
FT                   LKL"
FT   gene            309255..309368
FT                   /locus_tag="AM1_B0370"
FT   CDS             309255..309368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32088"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLR1"
FT                   /protein_id="ABW32088.1"
FT                   /translation="MIEIILKAYRLPSLLRQFELSQSQSVARVHTTSRQVV"
FT   gene            complement(309713..309868)
FT                   /locus_tag="AM1_B0371"
FT   CDS             complement(309713..309868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32089"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLR2"
FT                   /protein_id="ABW32089.1"
FT                   /translation="MKSSSVATARQNLSWLILGGATPVMSLIYCSDGFARVSPKNLFSR
FT                   NSLMLR"
FT   gene            complement(310189..310950)
FT                   /locus_tag="AM1_B0372"
FT   CDS             complement(310189..310950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32090"
FT                   /db_xref="GOA:A8ZLR3"
FT                   /db_xref="InterPro:IPR010384"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLR3"
FT                   /protein_id="ABW32090.1"
FT                   /translation="MTIHKKIFISDWEKILENNIPIYNFLPSSLQSKLKDLILIFLDDK
FT                   RFFGCDGLEITDEIRITISAQACLLIINRKGKTYPLLSSILIYPDSINKKVERIENQFV
FT                   VTDMRRSWLGDSNARKGQIRISWKHAQLGALNWKDGQNLVLHEFAHQLDQEDSCADGVP
FT                   ILNCLNPQHAYMTWNKIITDEYKRLQSAVENNMVTVIDEYGATDLAEFFAVATEVFFEK
FT                   PIPMKLNHSKLYKILSDFYGLDPAEWSYFSQ"
FT   gene            310986..311099
FT                   /locus_tag="AM1_B0373"
FT   CDS             310986..311099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32091"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLR4"
FT                   /protein_id="ABW32091.1"
FT                   /translation="MTVLICLDDIQEWGYAMALHMRALDADCAVSVSGGGE"
FT   gene            complement(311175..311489)
FT                   /locus_tag="AM1_B0374"
FT   CDS             complement(311175..311489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0374"
FT                   /product="plasmid maintenance system antidote system,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32092"
FT                   /db_xref="GOA:A8ZLR5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLR5"
FT                   /protein_id="ABW32092.1"
FT                   /translation="MLMHNPPHPGETLKEFYLEPYGLSARQLAKALGVSHSAISRLVSG
FT                   QAAVTPDMAIRLEKGVGLTAGTWLGMQQDRDLWEALQQDRHEDIQPIDFEQLAASASGS
FT                   "
FT   gene            complement(311489..311764)
FT                   /locus_tag="AM1_B0375"
FT   CDS             complement(311489..311764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0375"
FT                   /product="plasmid maintenance system killer protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32093"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035095"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLR6"
FT                   /protein_id="ABW32093.1"
FT                   /translation="MIKSFRHKGLQLFFETGSTAKIQPKHAKSLRFRLELLNRIEVLST
FT                   LPPQLKLHPLKGDQKGRWSISVSGNWRLTFEFRDGDVHILDYEDYH"
FT   gene            complement(311875..312039)
FT                   /locus_tag="AM1_B0376"
FT   CDS             complement(311875..312039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0376"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32094"
FT                   /db_xref="GOA:A8ZLR7"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLR7"
FT                   /protein_id="ABW32094.1"
FT                   /translation="MAAKLGVKTQTIYNWESNTTKPKLDPWQTWILCETLGVTLKQLAE
FT                   AFKGEGGDD"
FT   gene            complement(312116..312478)
FT                   /locus_tag="AM1_B0377"
FT   CDS             complement(312116..312478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32095"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLR8"
FT                   /protein_id="ABW32095.1"
FT                   /translation="MRSEKELTQRECTPNNTVQIWGLIRLVVVATSPMGLTSNNEVRPC
FT                   TENPVEQSHRPVKHRYHPTLGFGEFNAAHRFCKAVDEVSNFLRPRSRMAEFVSLSDRRK
FT                   KFMKGVSELQELFQAA"
FT   gene            complement(312539..313270)
FT                   /locus_tag="AM1_B0378"
FT   CDS             complement(312539..313270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0378"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32096"
FT                   /db_xref="GOA:A8ZLR9"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLR9"
FT                   /protein_id="ABW32096.1"
FT                   /translation="MLTHWESIESQAMQENWSYAEFLLALCETEAQRREQARLKRALTE
FT                   ARLPNAKSFTNFDFSHCPQLNPAPLMQLAADPGWLERAENCLILGPSGVGKTHLATGVS
FT                   KKMLEFGKRVKFFAANALVQQLQQAKLQLQLHPMLKKLDRYDLLILDDLGYCKKSEAET
FT                   SVLFELIAHRYERKSLLITANQPFSQWDDIFTDSMMAVAAIDRLIHHGLIIEIQADSYR
FT                   RKSATQRTAQTQSQPQKSQSK"
FT   gene            complement(313098..314834)
FT                   /locus_tag="AM1_B0379"
FT   CDS             complement(313098..314834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0379"
FT                   /product="transposase, putative"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32097"
FT                   /db_xref="GOA:A8ZLS0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLS0"
FT                   /protein_id="ABW32097.1"
FT                   /translation="MPNKRIDSYHTRVYMNGRDLGLKQADAAYIAEISTRTGQRIEAGT
FT                   HQPNRGRLQDQRTVPDPLADVWEDELEPMLRRDPRLKPMTLYEYLQDKYPGQYPQVLRT
FT                   LQRRVRTWKALHGPSPEVMFELRHEPGVQGFSDFTELKGITITIAGKPFEHLIYHYRLG
FT                   YSGWRYAQIIEGGESFVALSEGLQNAFAACGGVPTQHRTDSLSAAYRNMGGRRSKNLTR
FT                   LYDELCDHYRLEPTRNNKGVAHENGSIESPHGHLKNRIKQAIYLRGSADFTSVAEYQAL
FT                   IDAQVAKLNQQCQTKYEQEKDHLQPLPKYRTPDYEVLTAKVSKRSTIDVRCILYTVPSR
FT                   LIGRQLELHLYHDRIVGYLERHPVVELPRKRVSGKGKRRDRCINYRHVIGSMRLKPRAF
FT                   IYCTWQSDLLPNPEYRQIWEQLKAQFDLEQAAKIIVEALYIAAVQDKEQAVAVYLQQQL
FT                   RSSSLTLNRLKKQFEPPQMKQVPELSIEQHSLELYDKLLPSCSVPAEPLPAPEPLFKKA
FT                   QALPHVDPLGIYRIPSHAGKLVLCGILTSLVRNGGPTKRTSSSKTCPHRSQAPKRKKFY
FT                   QL"
FT   gene            complement(314977..315165)
FT                   /locus_tag="AM1_B0380"
FT   CDS             complement(314977..315165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32098"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLS1"
FT                   /protein_id="ABW32098.1"
FT                   /translation="MEGTKAFFAQAIELHDDPPKKVATDGLASYPRAISEELGEDVEHE
FT                   VLDDNRADGLMTMSRRL"
FT   gene            complement(315514..316563)
FT                   /locus_tag="AM1_B0381"
FT   CDS             complement(315514..316563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0381"
FT                   /product="transposase, IS116/IS110/IS902 family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32099"
FT                   /db_xref="GOA:A8ZLS2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLS2"
FT                   /protein_id="ABW32099.1"
FT                   /translation="MKILGIDLGKYTSAACLFDTQSNDTLFFSFKSFASEFKALLSQTQ
FT                   PEQVVIEACTISGWVYDLCQAEGFNTIVANPTHEAWHWKHVKRKTDKDDALKLTKLAAL
FT                   GQISPVYMPSAESRQYRQLVKYRKRLVSHATRAQNTIRAVFNQQGISIPAGEKAWTISR
FT                   IEQLKKYSQNMDECSLLSLWQGQLDLELKRLDALWEQLHAVDKKLTEIAKQDNRVQLLE
FT                   SIPGVGRKTAEVVVAFIDDPKRFKNARQIGAYAGLVPRQHQSGEMNRMGKITQRGPRIL
FT                   RATLVEAAWIMQRYNPWAAALYQRLCGGQKTRRKQAIIAVARKLLILCWTLLKKQEKWD
FT                   SKQAGPMAA"
FT   gene            317293..318834
FT                   /locus_tag="AM1_B0382"
FT   CDS             317293..318834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32100"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLS3"
FT                   /protein_id="ABW32100.1"
FT                   /translation="MTRKAHIPDIPSIKSVEQVIMLQSKYGQDVAASIDLEQQLIHDQS
FT                   PETAQQLAALKAYQQNPNNCHNVSFARYQTRSIASLLALRESLMLLLKDHGHPIEMEEL
FT                   RDRNADIVESFSKVRKQMEVETAVMLGTADGERFTVEQAIRVMGSSSATYKDTLDAKKV
FT                   LLQDELPGVELTDEFIHQVCVEHRGRLKSATKLHWMSYHPEVAEELDRRNFMKQLNSQF
FT                   VLTHRLTNNRIQVQLLRDLGVFDLVDTYNVTSADYEAYDKALEKGRQVQRQRQSLRLEV
FT                   KGLAGQIREIVQEQKAIQAKLTALGRKAHPRKTTLKGELEQLEQQKQGLKDQKQGLRDA
FT                   IEQQSQAFTQARYEQVEARMRMEIMVMTEDDQRLEDIKVKALEYRYQIYRHFRNVISEG
FT                   QSAVAIVNKLIKRVAHELVKVGSEESVSLYVIRYSGNEAYKDQMLKAFQVKWNQRLEKN
FT                   RPSCEICKKDSDLITEMEKRSDINEFGCGSDQENGQFEGNDDGIEGGPEMIMGCD"
FT   gene            319459..321867
FT                   /locus_tag="AM1_B0383"
FT   CDS             319459..321867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32101"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLS4"
FT                   /protein_id="ABW32101.1"
FT                   /translation="MGLVYKVKKDLKRLAAFGWDEWFAQHGLDITAKDLGSECQKLLPA
FT                   IRRDLPGLGDFSVSGKRGIEPGKPALSLVYHALASPNVHPTNNGTPHNNPDAYPTLGEL
FT                   DNLENYIYGLARRSIDSFDNPVLAVFAYQYRIAENSPHKIHADLGFSRCGVSRIGTEAP
FT                   RYDAPTRSYTSSPVTSERGAAVLPARYGAFIAERRAPTSDDAVFRASSSDNQQIFLFPV
FT                   HKLFAGDECLLDELGAPMTVGTINFSEYHINEKLRRLHTDSPDNPGFIEPLDIFDIDAF
FT                   PFVRDSNNDPELASLEYVGDSVLVVSHHHDQLTRTATQKVDGAEQLARFQVPSGTSNRF
FT                   FSSLSLPAPSGRAAPEYANIRHKFVSNDTTEDLNQTLSADEFREQVIEKGGYEAVHFID
FT                   DSCDGVIAVEVSGLSDLPTSCAYSLVTAVDFFPLIRQLDIQRWVEQLYNADIGLSLSDI
FT                   SRNNRLHFNQGGPRPLSDGRFERSLSGEASLIHRSPNMSLKNPLTQASAFPRSDHANFT
FT                   VTSIIGRAAQGDAFDPGESPSRVLSWLPDAAADVFAPGWDISTHIVNGLGTYASYGLGS
FT                   PFLEDAKLCAALNSYWPAAAPDSSRTFNISGSPTAQPLLDSELGYHPNHPRVKLNEVIS
FT                   NRGWDGEYGPFIEREGGQEFVNSAHRNRSDYVSNALAGTIGFNGLNQVDAGEMIQRMDV
FT                   LRLCFSALSRQTVPNNDLWLVNAEKVDDWNQWNSEELPKADSVLSGAGYIYRFVIVDNS
FT                   SVEDVATNPVTRERYSLQEIYEFQVSAKKLFLKTAGHWNPPIDIDIVIE"
FT   gene            322522..323766
FT                   /locus_tag="AM1_B0384"
FT   CDS             322522..323766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0384"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32102"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKW2"
FT                   /protein_id="ABW32102.1"
FT                   /translation="MDNSIRIPLNLPDIRVLELSKTERGDWLIKIESTLQGTTCHQCGR
FT                   EITDLHCHDQPFRIRHLPLFEVPVYLEIRPKRYRCKYCDDHPTTTQHLEWHEPRSPNTK
FT                   AYERWLLRILINSTVSDVARKLGVSEDIVSGIIDRWIAAQVDWSEYADLKVMGMDEISL
FT                   KRGHRDFVVLITIPTTDGVDILAVLADRKQQTVANFLQSIPIDLRQTIERVCTDMYQGF
FT                   VSAVREQLPQAKIVIDRFHVTKAYRNCADTVRKREVKRLRRELSKQEYDSIKGAMWPFR
FT                   KRPENLKESEQQLLERLFAYSPQLKQAYNLREKLTQIFEGRYTKHGAKCAIRAWCKQVL
FT                   KSDIKEFDCFLTTINNWMDEMTNYFLEGWTSGFVEGFNNRVKVLKRRCYGIFDIERLFQ
FT                   RISLDLNGYQTFAVT"
FT   gene            complement(324050..325087)
FT                   /locus_tag="AM1_B0385"
FT   CDS             complement(324050..325087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0385"
FT                   /product="lipase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32103"
FT                   /db_xref="GOA:A8ZLS6"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLS6"
FT                   /protein_id="ABW32103.1"
FT                   /translation="MEIVQPPSGSIQNLNRLIPPNHEYNYFEEGDTHHFKYDSNEYQLV
FT                   NAWRLADSAFLAYIENEPVCEQHFKKIGLNKAKLFSGSSTQCYVASNDKFSIISFRGTE
FT                   IKRSNFVQDVLIDARLKLVDSSIIGKTHEGFKAALDEIWEKGPNLKGYLQELIDTNQEM
FT                   YLWFTGHSLGGALAILAASRFGKAQGIYTYGCPKVGNSEFVDSIDKKLEGKIFRFVNNN
FT                   DAITKFPLSDLIISVELVETPFPNIPFPRFNSPLSSFQLPELYQHVGELKHIDKNTNIS
FT                   TYPSKKVDYNDILINSSQNIFESTASIISKNFNDIKFSLIDHAPEYYSVHLRNNFARDL
FT                   GSSTN"
FT   gene            complement(325822..327507)
FT                   /locus_tag="AM1_B0386"
FT   CDS             complement(325822..327507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0386"
FT                   /product="peroxidase family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32104"
FT                   /db_xref="GOA:A8ZLS7"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLS7"
FT                   /protein_id="ABW32104.1"
FT                   /translation="MDNANFTELKDLFSTIEANIDDTPLEHKPEPSPYDQSADEPIYNE
FT                   ATLSDIQGNLLLGFNTNYEHFLFLSFGVGSSPKQFLRLISPYVSISSAYEVLKFRKIHR
FT                   QRRAQLGQRETYLSSAWLNLSFSYTGIAKLTSDEEANKFGDDSFRLGMAKRSTFLGDPS
FT                   DESSPGHQSNWRFGGTNNEIDMMITTAANSKDQLQEFVALIKQHAQDQGIELQYEQPGE
FT                   RLPGKFRGHEHFGFKDGISQPGIRGKLSERPGDFITPRYVAGTDERKDYFAKPGQLLVW
FT                   PGQFLLGEPRQSTEHLYLKGRIQTNIPGWAKLGSYVVVRRLHQDVSAFWGFVSSTAESL
FT                   NIDVIEFASRLVGRWPSGAPLMRSPNSELPELGKNAFANNHFLFDDNTSEIEFSDSHYP
FT                   GDSFPQAKADFLAKVCPHFAHIRKVNPRESVTDLGKPEDNLARMILRRGIPYGPAIAGN
FT                   PDLSDEDLLLDRGLMFVCYNSSIEDQFEFLQRRWANSAIQPNQGGHDMVIGQNGSTGNR
FT                   ERHIEFPGEHQTTEIKTQQDFVVPTGGEYLFAPAISALNDILAK"
FT   gene            complement(327512..328498)
FT                   /locus_tag="AM1_B0387"
FT   CDS             complement(327512..328498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32105"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLS8"
FT                   /protein_id="ABW32105.1"
FT                   /translation="MSLITQFDTPASIKDFDDDSDFYEKWHEFVKGLIAEETPGPNGGH
FT                   FYNPAEVDVDIIGEKTISWMGFPRRVLLPNLRDNKWEAYRTADNANRKDRGHEQDEYFE
FT                   WYVHKDDDAITRITFTTELHNYYEEMWKFDPDKVVEIYKDTLDKPVKKDDLMNGNGDYD
FT                   ILNRWNTTDGIMHFTQDINTLGAAIGLAEEMSMFPLDAANNYQANPAFATYTTSVDPRV
FT                   DYDVHMLLRKKLYVSLQEPIGIYIFGWDNSGIAQPDGSPAPIEWWQPKRGSNGKVMRLE
FT                   YSVPKALGFQVSDLTIGGHEIQYGAQLAEHITVGIVGSAGTQKGQEN"
FT   gene            complement(328736..328876)
FT                   /locus_tag="AM1_B0388"
FT   CDS             complement(328736..328876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32106"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLS9"
FT                   /protein_id="ABW32106.1"
FT                   /translation="MQDFPNSDRGPRLFFDQDHPFVTTGQERLIKVGPVDENRPLRITR
FT                   V"
FT   gene            complement(329105..332911)
FT                   /locus_tag="AM1_B0389"
FT   CDS             complement(329105..332911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0389"
FT                   /product="WD-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32107"
FT                   /db_xref="GOA:A8ZLT0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLT0"
FT                   /protein_id="ABW32107.1"
FT                   /translation="MARVSYGPTPRKRTKFLLEVILAYANDEFEIQDRLRSQILVNWQT
FT                   DQQLVVETTIKDLAELSKKYPSNRELSKDQIKISLKLLEQFVDILTDNRSQPKGSNKWH
FT                   FTLNFWYKRHNKVANLKQFDEEWEQRRPFKSKQATDQKSSALPVNSFLANPDLQLDTRN
FT                   RDWGSAIDVSWFYGRKTELTLLSQWLVDEHCRFIVVLGMGGMGKTALTIQLAQKVQYDF
FT                   DFVIWRSLASAPPITEILSDLIQFLSNQQENYLPKGIESQISLLLSYLRTSRCLVILDN
FT                   AESLLQSGDRTGRYRSGCEDYAKLFEMFGEATHSSCVLVTAREKPQGIAAMEGDSLPVR
FT                   CLQLKGLSTNACQTLVKTKGIFTGTEKEWSAINKHYAGNPLALKIVSSTIKECFEGSLS
FT                   RFLSFSQMEPFVLEDIYDLLNKQFERLSEIEQAVMYWLTINREPAQLEQLALDLMVQVL
FT                   PGDLLQSITSLQRRSLVDQTETGFTQQPVVMEFTAHKFIQQICTEIQEQQQYEERQENQ
FT                   LHLFRTHALIKAQAKDYIKDTQIRLILQPLIVSLVKVLGSRAHLEACLVQLLSVVRGKS
FT                   SEEAGYVAGNVLNLLRQLPVDFCGYDFSHLTIRQADLRGLNLHGVKFTHSDLSQSVFSK
FT                   DFGGILSIAFSPDGKLIAAGDFKGEIRLLRVPDGQPLLTCSGHTNWVKSLAFSPTNHLL
FT                   ASAGPDQTVRLWNVRTGECLKLLSGHTNFIWEVAFSPDGTLLASCSDDFTVRLWNSQTG
FT                   QFLKSFRYRAAARSIAFSPDNHELACGYADQTIRIWEVKSGQCLKVLAGHAGWVWSIAY
FT                   SPDGQMLVSACDDPIIRVWNLQSGECIQKLFGHSNSIRSIALCSSGHYLASGSADQLIK
FT                   IWDIRTGKCLKTLLGHTNWVWSVAINPTQKIMASSSQDGSIRLWDYNKGRCLRTLSGCT
FT                   FTIFEAIFATTPFGSFNYSETEKQHEQILVSGGDAQVLRVWSLSDHNCLDFPGHTDAIR
FT                   SVAYCPHDQIIASGGGTGDRTIRLWNISNGQCIKILKGHSNGIWSLAFHPKGKFLASSG
FT                   LDQSAKLWDIHSGECLETFQGHGHWVWSVSFSPNAEILASGSFDRTVKLWDIQEGRCLN
FT                   TLKGHSSGVSSVSFSPNEHFIASGSVDQTARLWDFKTNDCICIFEGHSGQIWDVAFSPN
FT                   GQLLATASLDHTIRCWDVETHKHLAILEGHTNGVTSVAFSSDGQRLISSSFDGTIKLWH
FT                   VQTGECIRTLRPTKPYAGMNITQMKGLSPAQKHTLLALGAVEN"
FT   gene            333257..333373
FT                   /locus_tag="AM1_B0390"
FT   CDS             333257..333373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32108"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLT1"
FT                   /protein_id="ABW32108.1"
FT                   /translation="MSKMLKSYFNSFKYFILKYMQILASMRKEKMEKYNADT"
FT   gene            333360..333761
FT                   /locus_tag="AM1_B0391"
FT   CDS             333360..333761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32109"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLT2"
FT                   /protein_id="ABW32109.1"
FT                   /translation="MPILSDFTTIVGNQRILIGDNSNSSGFTSNFRTAERRSDRNAFIS
FT                   FMVRGMTQTDENAEVFVNDIRIGSLENNNGGNINLWHTQSITLSGDRLNDGENTLRVDT
FT                   VPIAPGTQGVGNFDDFFITNVICHFHQDS"
FT   gene            complement(333773..333928)
FT                   /locus_tag="AM1_B0392"
FT   CDS             complement(333773..333928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32110"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLT3"
FT                   /protein_id="ABW32110.1"
FT                   /translation="MIYLISYKKVNSFTSLTRKFNDDQEWEHHRLYLFQNIYEEKSLAN
FT                   FSQNPN"
FT   gene            334254..334610
FT                   /locus_tag="AM1_B0393"
FT   CDS             334254..334610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32111"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLT4"
FT                   /protein_id="ABW32111.1"
FT                   /translation="MTKTKSISDAHQRVFKLDVEEVMKIVKRGKPLTADELEKYGPDEF
FT                   YLADQVPEEPALHRNIPLPAEVGDRIFPNVVLVSPFFCWCSSYTWCLEIDEFGRLRYVL
FT                   KCNYWCIPQFQVSA"
FT   gene            complement(334865..335038)
FT                   /locus_tag="AM1_B0394"
FT   CDS             complement(334865..335038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32112"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLT5"
FT                   /protein_id="ABW32112.1"
FT                   /translation="MTLEQFETFALPHLHIGTRGPQLKLFLFKIFNYILKFLYLGCQQK
FT                   ELPIRHWSITRI"
FT   gene            335420..337381
FT                   /locus_tag="AM1_B0395"
FT   CDS             335420..337381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0395"
FT                   /product="subtilase family protease"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32113"
FT                   /db_xref="GOA:A8ZLT6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023830"
FT                   /db_xref="InterPro:IPR034056"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLT6"
FT                   /protein_id="ABW32113.1"
FT                   /translation="MTSAINTKPILIAGLSDLWVETIGDPQISIAILDGFVDQSHPSLA
FT                   EAKLTNLETIALKASQQGSAAQHGTQIASIIFGQHQSLLKGIAPQCRGLVIPIFADGNQ
FT                   QAIDNNKFSETIAPCSQLDLARAILLAANQGAHIINISGGQLTPSGAADPILTNAVRYC
FT                   MENNILIVAAAGNEGCNCLHVPGALPSVLVVGAMSATGTPLNFSNWGEAYRTQGVLALG
FT                   ENIPGAVLGGGITSSSGTSYATAIVSGIAALLLSLQVKRGQTPNPQAIRTAILQSALPC
FT                   DDRPALECRRFLAGRLNVKEALSIILQKGETMSENIDVETVQPDSNGAVQAALSSNQSQ
FT                   IPAVQAATYNPPPTEVMPHPAQAQISLLTQVSPSAISPSACSCGEGGKTSSQAPSQAQL
FT                   VYALGQLGYDFGTEARQDSIQEHMGEGANPHDPRQFLPYLDENPWDAAMVVWTLSLDAT
FT                   PIYAIQPFGAYAEQGYERLRQFLKEQLEEGVERISAPGVIVGQVTLMSGQTVPVILPTL
FT                   RCMYSWTTSALIKTVCGESPDESAVQGVTNFLERVYYELRNLGIMPQERAINYAATNAL
FT                   NIERIFEAAILEEMDLDSIEVEPSPLCRQDSECWDVKLTFFNPRRVFEQARKVYRFTVD
FT                   VSDMCPVSVGRVRSWFVR"
FT   gene            337949..338488
FT                   /locus_tag="AM1_B0396"
FT   CDS             337949..338488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32114"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLT7"
FT                   /protein_id="ABW32114.1"
FT                   /translation="MSNELFIKGPHVPIEERALERLKRAVELGELEKLPNTPGIPNVPR
FT                   YLVTYMNSQTVNTQMRSATVVSVTNQSNLINRVFVTFFKGFTDDSSPIGTAAFAIPPQF
FT                   TVDFASRSLPSELTVTNAVPNPELTFDEGRAIVSSMWPEIGVSARVYYTAGDNDERLHA
FT                   ITDSKVVIYSRSNSGD"
FT   gene            338833..339315
FT                   /locus_tag="AM1_B0397"
FT   CDS             338833..339315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32115"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLT8"
FT                   /protein_id="ABW32115.1"
FT                   /translation="MKRKVAPEPGDDDRNPEPTLRYSRRESTDTQRTQRGYSARHTTSR
FT                   TRPPRVSRAFESKFNALERRQKNLVQQTKQKGQLEYLTVSKSSSGNYWITIEGSGKPFI
FT                   KISFETPEFCFECALELENTFDVLQVLRLRPGETIERIEEMIGVWLERERGSRAWG"
FT   gene            339572..339754
FT                   /locus_tag="AM1_B0398"
FT   CDS             339572..339754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32116"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLT9"
FT                   /protein_id="ABW32116.1"
FT                   /translation="MWSHLDRSLGLFSLIAALTLVIVEPLTSGDWQSKPKSNSASDKII
FT                   LSQKPASSLSEHLLR"
FT   gene            339867..339995
FT                   /locus_tag="AM1_B0399"
FT   CDS             339867..339995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32117"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLU0"
FT                   /protein_id="ABW32117.1"
FT                   /translation="MELEDTFDVLQVIELRPGETIERIEEMIGVWLDRERVSRVWG"
FT   gene            340379..341428
FT                   /locus_tag="AM1_B0400"
FT   CDS             340379..341428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0400"
FT                   /product="transposase, IS116/IS110/IS902 family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32118"
FT                   /db_xref="GOA:A8ZLU1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLU1"
FT                   /protein_id="ABW32118.1"
FT                   /translation="MKILGIDLGKYNTAACLFNTQTHDTLFFTFKSFAREFKALLYQTQ
FT                   PEQVVIEACTITGWVYDLCRAEGFDTIVANPTQEAWYWKNVKRKTDKDDALKLTKLAAL
FT                   GQLSPVYVPPAESRQYRQLVKYRKRLVGQTNKTQNTIRALFNQQGISIPTGSRAWTVSG
FT                   IEQLQRYAKTLSDCSLLSLWQGQIDLELNRLDALWEQLHLVDTKLTEIAKQDARVQLLE
FT                   SIPGVGRKTAEVVVAYIDDPKRFKNARQVGAYAGLVPRQHQSGDMNRMGKITRRGPRLL
FT                   RSALVEASWVMLRYNSWAADLYQRLCGGQKTRRKQAIVAVARKLLVLCWTLLRKQEPWD
FT                   LDKISPLAA"
FT   gene            341839..342126
FT                   /locus_tag="AM1_B0401"
FT   CDS             341839..342126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32119"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLU2"
FT                   /protein_id="ABW32119.1"
FT                   /translation="MATDGLASYPRAIEEELGEDVEHEVCPRIENSVEQSHRPVKHRYH
FT                   PTLGFGEFEAAHRFCKAVDEVSIFLRPRTRKREFVPLFDKRKKFIKGASG"
FT   gene            342179..342295
FT                   /locus_tag="AM1_B0402"
FT   CDS             342179..342295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0402"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32120"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLU3"
FT                   /protein_id="ABW32120.1"
FT                   /translation="MSTLTCPSCRSQNVVKILNGKQNHKCKTCGRQFVEAPQ"
FT   gene            342624..342887
FT                   /locus_tag="AM1_B0403"
FT   CDS             342624..342887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32121"
FT                   /db_xref="GOA:A8ZLU4"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLU4"
FT                   /protein_id="ABW32121.1"
FT                   /translation="MPGVYRQCAVAYTDFWDAYGCVFFPKQGHQPVGKETGQTCYIERF
FT                   NCTLRQRVSRLVRKTLSFSKKLENHIGAIWMFVHHYNASLQD"
FT   gene            complement(342911..343714)
FT                   /gene="aacC3"
FT                   /locus_tag="AM1_B0404"
FT   CDS             complement(342911..343714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aacC3"
FT                   /locus_tag="AM1_B0404"
FT                   /product="aminoglycoside N(3')-acetyltransferase III"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32122"
FT                   /db_xref="GOA:A8ZLU5"
FT                   /db_xref="InterPro:IPR003679"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLU5"
FT                   /protein_id="ABW32122.1"
FT                   /translation="MKKKQLITKSQLIQDLRKLGVCKKQTIMLHSSVRNIGWVVGGPDV
FT                   VLAAILSLLTDAGTLMMMASWEDNPYDLSRWPKHRQEAYLCECPAYDPSRSRADWREMG
FT                   ILTEYLRTWPGAHRSRHPFSYVAVGELAQWITAEQPWQYRDGPGSPLAKLCEVSGSVLL
FT                   LGSPIGDVTLLHHAEHLADVPNKWIDRYRMPILQNGKRVWMDFEEFDTTNGIVDWPDNY
FT                   FETIVKDYLATHPAQTGKVGGAKSYLLDAQSLTQFGVQWMEENFN"
FT   gene            complement(343867..343986)
FT                   /locus_tag="AM1_B0405"
FT   CDS             complement(343867..343986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32123"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLU6"
FT                   /protein_id="ABW32123.1"
FT                   /translation="MYLGLRLMIGEVMGGSPLHTASLSTRLTDWRGIVVKAYG"
FT   gene            complement(344190..345308)
FT                   /locus_tag="AM1_B0406"
FT   CDS             complement(344190..345308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0406"
FT                   /product="pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32124"
FT                   /db_xref="GOA:A8ZLU7"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLU7"
FT                   /protein_id="ABW32124.1"
FT                   /translation="MYDCSIILHEVILSTRANFMLFEARNTWIADIPFTIWSGLSLLIL
FT                   GGVVWLLPKWQVNGIDEQMEVRDRAFIEDAHRRTLIQALGGLFFLTTAYLSRRNLQITE
FT                   GKEVTERFSKAVAMLGDERLEVRLGGIYLLERVAKDSPSDHWIVMEVLTSYIRDKAAFR
FT                   SQRMTNMPTDIQAALTVISRRNVQNDLSGGQLDLSKTDLSRAELAQADLSNANLQAANL
FT                   AEANLNAANLSGANLIKMNAHHANLSAIKLNKADCNSANFSQANLFEGELEAANLLKVN
FT                   FSEANLTKANLSATTLVEANLKGTDFTKANLREANLIGANLSEANLLDANLRQADLRSA
FT                   ANLTMEQIQAAANNDAIYDPEFRDQLQQEFGK"
FT   gene            complement(345389..345565)
FT                   /locus_tag="AM1_B0407"
FT   CDS             complement(345389..345565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32125"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLU8"
FT                   /protein_id="ABW32125.1"
FT                   /translation="MTSDPAESSVTTASSLDQFAVSVPAREEQIYLVAAWLSDQIRYQL
FT                   ARNQSELDRQDGV"
FT   gene            complement(345592..345720)
FT                   /locus_tag="AM1_B0408"
FT   CDS             complement(345592..345720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32126"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLU9"
FT                   /protein_id="ABW32126.1"
FT                   /translation="MGRYCLKGKKVVHKPVLLCDQVQAYLQGFVNTPGSLSIHTQA"
FT   gene            345682..345963
FT                   /locus_tag="AM1_B0409"
FT   CDS             345682..345963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32127"
FT                   /db_xref="GOA:A8ZLV0"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLV0"
FT                   /protein_id="ABW32127.1"
FT                   /translation="MDNLLPFQAISPHKIRVFHPKSFEDAQEAINAMKTDDMLLVNLAA
FT                   LENKLAQRLTDYLAGSTFALSGERMEIGRGVFLFAPPSFLISRMMASA"
FT   gene            complement(345993..346886)
FT                   /locus_tag="AM1_B0410"
FT   CDS             complement(345993..346886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32128"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLV1"
FT                   /protein_id="ABW32128.1"
FT                   /translation="MAADNKYSTVLLELKTHYQETLAELEAQTIQLKTKITSLDTLIED
FT                   PLLGSDILSILQGEAASIESEAPGSTVANTVEPKSKPKKTTQKAASKKKSATPKKPDST
FT                   TKTKGTVKPEVEATATPKKAAQKASPSSGKRKSPTSKKSASAPKSTQKVKPKAEATSPQ
FT                   VAQKASSKKSSTSKNIASQNKAKKTKRQGRRSSSTVLKMNKPYDKMTKIDAISKIMQEN
FT                   PGKVMHTDDLSLILFGKLTPEQHKAERARMKTLMYRGVDQNRWLKVPKKQMRYVFESSR
FT                   NVGPTESGSSKNQKKT"
FT   gene            complement(347027..348937)
FT                   /locus_tag="AM1_B0411"
FT   CDS             complement(347027..348937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0411"
FT                   /product="penicillin-binding protein"
FT                   /note="Member of transglycosylase, PF00912."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32129"
FT                   /db_xref="GOA:A8ZK99"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK99"
FT                   /protein_id="ABW32129.1"
FT                   /translation="MSSSATSPQDFSSRSTSTLFLRGIGDATLTTILTLTLLGSAGLAG
FT                   GLMGVAISYRDLPDVTSLASFSPNETTYIYDINGKLLTGLHEEENRQVVPLAKISPHLK
FT                   LSVLAIEDSNFYQHDGINPVGILRAAITNYQAGQTVQGASTLSMQLAKNLYLTPERAFS
FT                   RKLAEAVLALRIEQLLSKDEILQLYLNQVYWGHNTYGVETAARSYFNKSAEDLTLAESA
FT                   MMAGIIKAPEGYSPFVDLDLAKEQQNIVLGRLEELKWITPAEAEAARAEKITLGEITSY
FT                   QRSQAPDVTNTVIQELTERFGREALVRGGFRVQTTLDWKMQKIAEETVRRNHQHYAYAA
FT                   DQMALVAVDPRTHFIKAIVGGVDNKKSEFNRATQAYRQPGSAFKPLVYYTAFATGKYTP
FT                   DSMVKDSPVSFNDGGLQRYKPQNYDRSFQGSMSIRQALAQSRNVPAIVMGQKVGIKNVI
FT                   DVSRKLGITSPIPNVISLPLGAVDLTPVEMASAYATFANNGWQSKTTAILQVTDPTGKV
FT                   LINNTPQPKLVLNPWAAAAVNSTLQTVVQSGTGVAAQIGRPAAGKTGTTSSERDVWFVG
FT                   YVPQLSVAVWAGNDNYARIGSGATGGGWMAPVWREFMSEALKDTPVQYFEPPSKFPKPK
FT                   G"
FT   gene            348998..349117
FT                   /locus_tag="AM1_B0412"
FT   CDS             348998..349117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32130"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLV3"
FT                   /protein_id="ABW32130.1"
FT                   /translation="MTEKLAIPKVCPYSTKVLRSFLKNHHLCKVTQQYGDFMS"
FT   gene            complement(349158..351419)
FT                   /locus_tag="AM1_B0413"
FT   CDS             complement(349158..351419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0413"
FT                   /product="helicase, RecD/TraA family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32131"
FT                   /db_xref="GOA:A8ZLV4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLV4"
FT                   /protein_id="ABW32131.1"
FT                   /translation="MPSSSAHPGSPPIEQLQGVVERLTFHSDESGYTVARLKAPRTREL
FT                   ITIVGSFANIQAGQTLQLQGIWRDHPKYGPQFQVKQYKETKPATLTGIEKYLGSGLIKG
FT                   VGPVTAKRIVAHFGLDTLDIIETHIERLIEVPGIAKKRVKLIQTALDSQKAIKEVMVFL
FT                   QGHGVSTTYAVKIFKQYGDESIETVTHNPYRLATDVYGIGFVTADEIARSLGISPHSEY
FT                   RYRSGLLHVLSESAEEGHCYLPQPELIDRAVKRLALPDYQPKPDQVEYLIHAMISDAEL
FT                   IVERLTHEGSTKLLCYAPPFFQAEFHLSRRVLQLLASSLVVDNERVRAWLDRFMAQTDV
FT                   SLSKQQQQAVEMAASQRVVILTGGPGTGKTFTTRTIVALWKAMGKDIVLASPTGRAAQR
FT                   LSEVTGHEAKTIHRLLEFDPKTMKFQRNSDNPIPADAVVIDEASMLDLFLANSLIKAID
FT                   TNAQLLLVGDTDQLPSVGPGNVLLDLITSGRIPIIELTEVFRQAQASHIIRNAHRINQG
FT                   QFPNLESVSPSPKTDCLWLGAPEPENGVQAIQELINDLLPELGFQPARDVQVLCPMTRG
FT                   EVGTRKLNQVLQALINPPCPDKPELTRGGLILRVGDRVLQQVNDYNREVFNGDMGVIED
FT                   INLEEIEVTVHYAERSVSYDLADLNEIGLAWAVTIHKSQGSEYPVVILPLYMQHYIMLS
FT                   RNLLYTGLTRAKKLAILVGPKNAISMAIRQIKDRQRYTLLERRLGGVPKANESLASAIL
FT                   "
FT   gene            complement(351487..352560)
FT                   /gene="recA"
FT                   /locus_tag="AM1_B0414"
FT   CDS             complement(351487..352560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="AM1_B0414"
FT                   /product="protein RecA"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32132"
FT                   /db_xref="GOA:A8ZLV5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLV5"
FT                   /protein_id="ABW32132.1"
FT                   /translation="MSAKNEMTEKQKALDLVMKNVEKTFGKGAIMRLGDATRMQIETNS
FT                   SGALTLDLALGGGLPRGRVIEIYGPESSGKTTVALHAISQIQKTGGVAAFVDAEHALDP
FT                   VYAAALGVDISELLVSQPDSGEMALEIVDQLVRSSAVDLVVVDSVAALTPRAEIEGDMG
FT                   DSHMGLQARLMSQALRKITSNIAKSGSTVIFLNQLRQKIGVTYGSPEVTTGGNALKFYA
FT                   SVRLDIRRIQTLKKGTDMYGIRAKVKVAKNKVAPPFRIAEFDILFGQGISTMGCLVDMA
FT                   EETDIIVRKGAWYSYDGSNIGQGRENTIHYFLDNPEFSQEVEQQVRQKLELGSKVSANS
FT                   ITTVEIEPADTEEVDAS"
FT   gene            352678..352881
FT                   /locus_tag="AM1_B0415"
FT   CDS             352678..352881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32133"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLV6"
FT                   /protein_id="ABW32133.1"
FT                   /translation="MATDTLAELLGFSGGWLVGVSLDLEWGYQCWVITPERQVHTDGEF
FT                   YVHSRVALEAGRFLVENSLEVE"
FT   gene            352878..353702
FT                   /locus_tag="AM1_B0416"
FT   CDS             352878..353702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0416"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32134"
FT                   /db_xref="GOA:A8ZLV7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLV7"
FT                   /protein_id="ABW32134.1"
FT                   /translation="MKSEPIVMSWEEYELMPWRLGWKHEYFNGMAYLTPRQQSVLTVIE
FT                   VAPRNDTPQSFKIRPVVSTDVLELKHLFFEIFHDSVEYCNYEERDIQESAQSCIDNYLG
FT                   AVKGEPSKVSCVAISPDRELIGIALVIEQPERQPYLRLLGVSPSWQRRGVATGLMTTIL
FT                   NQLVNTSFTQLESRYFLANEASRNWHHQFGFQDQLDIFVAHLFYRHAQHELWRQEQLGQ
FT                   LPKKDLALLASEVEQWQAEVDRQEVAFEATYPENCPNRLTSHHQRTKPTALP"
FT   gene            353735..356053
FT                   /locus_tag="AM1_B0417"
FT   CDS             353735..356053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_B0417"
FT                   /product="exoribonuclease II"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_B0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABW32135"
FT                   /db_xref="GOA:A8ZLV8"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZLV8"
FT                   /protein_id="ABW32135.1"
FT                   /translation="MPTATSEKLNQLRAQLQECTNPIAAKLLKSTIAKLEAQISSGQPK
FT                   TTASKIAQRKAALRHSQKQAKQKERSTLKPPSSKSEGVPQHKKPITLDQEKPIEQAKVT
FT                   AVVQVEKSKPLIQDGPQATTETTPKNKNRFSPDVIKIAKRLVLADELWERPQVQGITID
FT                   GPTSRDLDDAIWIEATESGVVLSVHIADVSELVEMGSILDKVALSRTVTRYFSNGNAPM
FT                   LPRPLSENKLSLLEGEARPTVTVQVTLNPNAQMVDVKIFESWLVSHKRFTYAEASQPKS
FT                   STPFHNTLEMAHQWASHLYRNRLTSGSIGATQTAQGQWLTEEGSLIQGKLHPSHILIQE
FT                   FMILANLAVAQWLADQDIPALYRNHTARAIAPDRETMYQTLLMLGSNAAIRQRLHSWMN
FT                   RAVYSPVLIGHFALNLPAYCHFTSPIRRVADLINHRIVKACLKHQGLPYKQSELAELGQ
FT                   HIAQVKDEHKEQASEFFKAAHQKVYQEQLQTPEDLANLSGKEFTRLLKYAVESQGVDEL
FT                   RSELLTRLGAEQLAVQDLYLLLFQSKELELQQQVIQYLSGHIYDAASVITIASNQERNW
FT                   EAFNYLEAENSPPFHIWLEVIISGDSLTTIHPATHSRKQPARHHACLIWLEDYLQKNLV
FT                   NPEASVQPPLPEAKLSSKDSAPSAASLSKAMQTALMKPLSGGQNFVGMLVDICQTLRWE
FT                   NPEYEMGSSDDWFICKCELDVLGERLEGSGVAKKKKLSKSLAAKEVLEQVRELAPQHWE
FT                   EWFPGVAFSQPKNLTNQED"
XX
SQ   Sequence 356087 BP; 97445 A; 80873 C; 80565 G; 97204 T; 0 other;
     tttagtgtgt ttcctttttc atccctatgg aatgatctga ggtagtactt cagagcaatg        60
     gcgtaatgga taactcaatt cgcatcccgc tcaaccttcc tgatattcga gttctagagc       120
     tatcgaagac tgagagaggg gattggctca tcaagattga gagtacgctt caaggaacaa       180
     cctgtcatca atgcggacgt gagattactg acctccattg tcatgatcag ccttttcgga       240
     ttcgtcacct gccattattt gaagtccccg tttacttaga aattcggccc aagcgttatc       300
     gatgcaagta ttgcgatgac catcccacaa caactcaaca tttagaatgg cacgaacctc       360
     gcagtcccaa tacaaaagca tatgagcgtt ggcttctgcg aatcttgatc aattcaacgg       420
     tctcagatgt tgccagaaaa ctaggcgtta gtgaggatat cgtcagtgga atcattgatc       480
     gttggattgc cgctcaagtt gactggagcg aatatgcaga cctcaaagtt atggggatgg       540
     atgagatttc tctcaaacga ggccatcgtg attttgtggt tttgatcacg attcctacga       600
     cggatggggt ggatatattg gcagttctag ccgaccgtaa acagcagaca gtggcaaatt       660
     tccttcaatc gattcccatt gatttacgcc aaaccattga gcgcgtctgt acggacatgt       720
     accaaggatt tgtcagtgca gtccgagaac aattgccgca agccaaaatt gtcattgacc       780
     gctttcatgt gaccaaagcc tatcgtaatt gtgctgatac ggttcgtaaa cgtgaggtca       840
     aacgtctacg acgagagctc tctaagcaag agtatgacag catcaaaggc gcgatgtggc       900
     cttttagaaa acgaccagag aatctgaaag agtcagagca acaactcctt gagcgattgt       960
     ttgcttattc tccacaactg aaacaggcgt acaacctccg agagaaactc acgcagatat      1020
     ttgagggcag gtacaccaag cacggagcta aatgtgccat ccgtgcttgg tgtaaacaag      1080
     tactcaagag tgacatcaag gaattcgatt gttttctgac cactatcaat aattggatgg      1140
     acgagatgac caactatttc ctggaggggt ggaccagtgg ttttgtggaa tattggatgt      1200
     caaccccata ggcgatgtcg cgacaaccac aaggcggatc aacccccaaa tttgaaccgt      1260
     attatttggc gtacactccc tttgcgttag ctctttttca gacctcatac gataccttca      1320
     gaacaaaacg acaacccgtg atcgaaatga caaccagtga tcgctcgatt atttggactg      1380
     ggatttttga ggttgagact gagtttgagc cgttctctga gtcgctgatt tgcgccgata      1440
     actatcggct tgaatttcga taatcaagcc atgatgaatt aagcgatcaa tggcagccac      1500
     cgccatcatc gaatcagtga aaatgtcatc ccattggctg aagggttgat tcgctgtaat      1560
     caacaaactt tttcgttcat agcgatgcgc aattaattca aacagaacgg acgtttccgc      1620
     ttccgacttt ttgcaatagc ccaagtcatc caagatcaac agatcatagc ggtccagttt      1680
     tttgagcatt ggatgcagct gcagttggag cttcgcctgt tgcagttgct ggaccaatgc      1740
     gttggctgca aagaacttca cccgcttacc gaattccagc atctttttgg acaccccagt      1800
     ggccagatgt gtttttccaa cacccgaggg ccccagaata aggcaattct cggcgcgctc      1860
     caaccaaccc ggatctgcgg ctaattgcat caagggagct ggattgagct ggggacaatg      1920
     gctaaagtca aagttggtaa aactttttgc gtttgggagc ctggcttcgg tgagggcacg      1980
     ttttagacga gcttgttctc ttcgttgggc ctccgtttcg cacaaggcta gtaagaattc      2040
     cgcataagac cagttttcct gcatggcttg ggattcgata gattcccaat gggtcaacat      2100
     gtgggagagc ctgagctttt ttaaatagag gctcaggtgc tggtaggggc tcagcgggga      2160
     ctgagcagga ggggaggagt ttgtcataaa gttcaagtga atgttgttca atgctgagtt      2220
     caggaacctg cttcatctga ggcggctcaa actgtttttt caggcgattg agggtaaggc      2280
     tggatgagcg aagctgctgc tgtaagtaca ctgctacggc ctgttcttta tcttgaaccg      2340
     cagcaatata cagggcttcc acgatgatct tggcagcctg ctccaggtca aattgggctt      2400
     tgagctgttc ccagatttgg cggtattcag gattgggaag taggtctgat tgccaggtgc      2460
     aatagataaa agcacgaggc ttcaatcgca ttgaaccaat aacatggcga tagttgatgc      2520
     aacggtcgcg acgtttgcct ttgccactga cgcgcttcct cggcaattcc accaccgggt      2580
     gtcgctccag atagccgaca atccggtcat ggtatagatg cagttccaat tgacgaccaa      2640
     tcagtcgaga agggacggtg tatagaatgc agcgaacatc gatggtgctg cgtttgctga      2700
     ctttagccgt gagcacttca tagtcagggg ttcgatattt gggcagtggt tgtagatggt      2760
     ctttctcttg ctcatacttg gtttggcact gctgattcaa cttggcaacc tgtgcatcaa      2820
     ttaaggcttg atactcagca acgctcgtaa aatctgcact gccgcgcaga tagatcgcct      2880
     gcttaattcg gttcttcaga tgaccatggg gagattcaat ggagccattc tcatgggcta      2940
     cacctttgtt gttacgagtg ggttctagcc gatagtggtc acacagttcg tcgtacagac      3000
     gagtgaggtt tttggaccgg cggccgccca tgttgcgata ggctgcactc aaactatcag      3060
     tacgatgctg tgtaggaaca cctccacagg ctgcaaaggc attttgcaat ccttctgaga      3120
     gggcgacaaa gctttcgcct ccttcgatga tctgggcata tcgccagccg ctgtatccca      3180
     gacggtaatg gtaaatcagg tgctcaaagg gtttgccggc aatggtaatc gtgatgcctt      3240
     tgagttctgt aaaatcggag aacccttgta cccctggttc atgacgcaat tcaaacatca      3300
     cttcagggct tggtccatgt aaggctttcc acgttctcac ccgacgttgt agggtccgca      3360
     ggacttgggg atactggcct ggatacttat cctgcaggta ctcatacagg gtcatgggtt      3420
     tgaggcgtgg gtctcgacgc agcattggtt ctagctcgtc ttcccacaca tcagctaagg      3480
     ggtcgggaac ggtgcgttgg tcctgaaggc ggccgcgatt aggttgatgg gtgccggcct      3540
     caattcgttg tccggttctt gtagatattt cggcaatgta agctgcatca gcttgtttta      3600
     agccgaggtc tcttccgttc atataaacac gagtatgata ggaatcaatt cttttgttag      3660
     gcacttgtac agccctctat tgattaggga tgtaaaaagt gtcttttttc ttgagattga      3720
     attctagaaa cgcgatctca cacatcattt ctagggaatt gagatctagt tttatccttc      3780
     tcaggggatg cctggtttct tcatagctat agccgacgtg acatcgtcat taatccgtca      3840
     gctcgattgt cgtctaatag tggaaggatt taataaccga gtcaaagtct taaaaagacg      3900
     atgctacggt attttcgata ttgaaagact cttccaaagg atttctcttg acctcaatgg      3960
     gtatcagaca ttcgctgtga cctaaacact atatctagcg gctaccacgc taattcccgg      4020
     agagccagaa gtttctggca tgggcccagc aagttggccc agcgacccag cagcaagtaa      4080
     cggacatttt ggataagaaa cgctatgacg aacaagcctt tcggaccctt cgaggggtcc      4140
     aatctctcaa tacagcctat ggcccagagc gattggaagc ggcttgcaaa cgagctaatg      4200
     ccttggggat ggtgggccga cgctatctcg agtccatgct caaacacaaa ctcgaatcag      4260
     acccattacc cggtgaggag catcaggtgg tcccccttca ccatgccaat ctccgagggt      4320
     ctgaatatta tcaatcgacg tagggggaga caacgatgca agcgatgatt gaacaactgc      4380
     aacacatgaa actcacgggc ctcttggagg cttggcgaga acagcaggca ctgcctacct      4440
     atcatgatct gtccttcgat gaacgactgg ctctaatggt ggagcgtgaa tacatccgac      4500
     gacaaaacca acggatgcag cgccgactcc ggcaagctcg actaccggtg catgccaccc      4560
     tcgatgcggt ggatttcgat gtgcccagag gactcaaaaa gatccagttc cttgaatttg      4620
     cccaaggcca ttggctccaa gagaatttgt cattgatttt tctgggcccc accggagttg      4680
     ggaaatcttt cttggcggcc gtactggccc atcacctgtg taagcagggc cataccgtac      4740
     gctatatcaa aaccgctgat ctacttctgg agctgaaact cactaaagcc gatggatcct      4800
     atcctaagct gcgcaagcaa ttagcggcct acgatctatt ggttcttgat gaatggctca      4860
     gagatcccct atccctctac gaggccaggg aaattctcga tgtcttagac gagcgattcc      4920
     gcaaagcatc gtgtctattc gccactcaga tcccggtgga gcaatggcat ccacagattc      4980
     aagatccgac gctggccgat gccattctcg accgcattgt ccatgatgcg atgaaggtct      5040
     cactccgagg tgaatccatg cggaaactga ccagtaaatt gataccccaa aaggagaacg      5100
     acaaccctgc tctatctaca aaacaacagg agaataagac ggatgcaaaa cccaaaaatg      5160
     aaacctctgc aaaatcgaag gctaaaggac tacaggaaac gactgatgat taagcctcac      5220
     tctgcttttc atgttatgaa tgatttaggc aattccaatg ccatttgatt gagataaagg      5280
     gacaccttct gacctgctaa ttctagatgc cgatattttt ttatcggaag gtgccgaagc      5340
     aaatggtcac ttacatgccg aggttaggat ctagtccact tttggtgatg cttgagaaaa      5400
     tgcacgcaaa gctataagca gcaactactt cagctcataa gcaccaagcg tttattcaaa      5460
     aggtcgagac cagccctccc atacatttgg cgcttcacca ttttcaatcg attattttgt      5520
     ccttcaacct ggccattact cacttccagt gttagggcag ctttgaccgc ttcgtagtcg      5580
     tctaggagcc ctttcgcaaa actctgaaaa ggtttcagtg cactattttt agctctgtcc      5640
     aaccacgggt ctagatgttg aggtaatctc ttcctgacga tgaagagcaa gctttgagcc      5700
     agatcaatgg cttttgagag ttcaggttga ctactcagct gttccaaaat tgtctcatcc      5760
     tcttccgtta gattttccac cttgcgcatc accaaccaag ccgccctctg aactgtcaaa      5820
     ggcttttgga tgagctcttg agcctcagga acaggtcctc ttcctggtag ctcattgagg      5880
     gaatctcgtg gaggctgcgg gggtagagac tgacgcaatt tgtgagtgta gcgaacgacc      5940
     atcgtataac tgcccttgaa gccctgctgc tgaatctctg ctaataattg tttggaattc      6000
     tgacgacctt tattccattg ttcaagcagg taggctttgt aagggttaag accactccat      6060
     cctcgtcggg gatgggtttt atactcttga aatgtatcag cagctaggta ggtatacaca      6120
     gtgcgtttgc caatccccag atgatgagca atatctttga tcaggtaacc ttgcttgcgt      6180
     aaagcatgag tctgctcgta tttttccaat cttcgagccc gattttgagc cttacgagaa      6240
     ttaggatcaa cttgaggttt caccacaggc tggctcattg cttctgtgtc ttgatgctca      6300
     gcaagtgtag ctttcagcag ggtgtactcg actgtcttga ttacttggga atgagagcta      6360
     aacacgtttt ctagaatttc ttcaaggttc tggagtagat gaaagcggtc tgcaacctgc      6420
     aatgcatcag gtgccccttc acttgctcct gatttatatg ccttggagcg atcacgagaa      6480
     atgacttcga caccagggtg ctcgttcaac caatctgcta acgtgtctgc tttgcgatct      6540
     gttaacaaga caataggttg atgcttttca aggtccacaa gaatggtgcc atattcatgg      6600
     cctctgcgaa gtgcaaaatc atccacccct aatattttgg gcgttgtcac tgagggaagt      6660
     ggaagcttga agagggctct caacatagta ttgcgactac ttccataatt gatttgataa      6720
     ctcagccggg ctgcagctgc accaccaagg gccaagccaa tcgaactaag gtgttctgca      6780
     aagcgaactg tcctccgagc ccaaggaacc gcgacctggg gtagtcgctc agtaaaaatg      6840
     cgacgcttac aagttttatt ggaacagaag aacttgcaaa cttgaagcag aatagtcaga      6900
     cagaattcca cacagggaag atctctcaag gtccgctcat agcgactgtg aacccggtgt      6960
     gatgtttgat ggcagactgg gcaacaagcc aaagcttgag ttgaagaaac atggaaggtc      7020
     atctgatggt ttgtggagtc aagatcccaa ctgtccaagt gaagggtgtc ttggcacgga      7080
     aggaattgtt ggaagagttc cataaccaga cctggcaagg gtttactcct ctatcctcta      7140
     ccgcatagtt ggcatcacca aaagaggaca agagcccgag gttataaaaa tcagtcaaat      7200
     tggtgaggat ttcagtgatt ttcctgctgg atatttagga tggttaaaga tctgccttcg      7260
     aataatcact tgattcctaa tgtcaatgca acgccaagat tcaatcactg gtacgttgag      7320
     tgatgttgtg ctggatgctg ttagcgtggg ctgagaatgt tctaaataat aatagatcct      7380
     aaacccctaa tgacgtgatt ttcctactgt ccaaagagtc tgctaatcat caatttcaaa      7440
     cctatcatct tggtctgatt ggtccacttc aaagggtaag gatggtgcag ggcgtttaag      7500
     aataggagga gtaatgacga tggagggttt ctgaactgta acgtgggatg ggacaggttg      7560
     ggtggcaatc acaggcttag gaagtggtgc aggccgaaca ttcggctgag acggtggagt      7620
     tttttgcgac ggctcaggtt ggatttcagc gacaggctga gtcgtggacg gttctgctgg      7680
     cttggctgga gaggactcag gtttggctgg cgaagtagca ggcaatgagg ttggaggagt      7740
     catttggata ataatcggct cagcttgagg tgcttgagga ctcacatgag gtctgtagcc      7800
     taaggccgtc ccggtaatca caccgccaat accaacaaag gtcaaaaagc gtttcacgta      7860
     ggtttcgcca ccgttatagg ctttcaacat ttcatcgaca atgccgaaac cggcttttgc      7920
     acgttctttc ggccctggtt gttgtgggac ggtttgattc atgatcatca cccgttttgt      7980
     tcttgatgtg tttggcatag gctgctcacc cagccctttg ggttgtagac aaagaccttc      8040
     cgttatcggt ttacgtcagt gcccacctct gcgtcttacc ctttaagatc acgtctggcc      8100
     agttgagtga caattacgta gacagaggtt gtcaattgca tagtcttctc taggaatcag      8160
     aatctagttc aatccagaga tcacatctgc agagagagca tcagtcactt tcgatttttg      8220
     atagccccat acaggaaaga cactagggtt tgtactccta cgcaattagg aacctctagt      8280
     gccagctcct attaaacctc aacaggttca tctttatatg cagacaaagc aatccggctc      8340
     ttctcaagaa acagcagctg ctaaagccgg catttctacc cgcacagccc accgcattga      8400
     tagtggtact catcgtcccc aacgaggccg ccctcatgac tggaaaaccc gtgaagatcc      8460
     gctggatgga ttatgggaat tagaacttga gccgatgtta gagcgtgagc ctcgattaga      8520
     agcgactact ctatttgaga ccttacaaga gaaccatcct gggcaatatg atgacaagat      8580
     cagaaccgtg caacgccgaa ccgctaaatg gaaggcagct catggcaagc ccaaagaagt      8640
     gatgttcaaa attcaacatc atcctgggga gatgggacag tcagacttcg ctcagctcaa      8700
     aggtttcagt gtgacggttc agggtgaagc ctttcaccat atcttgtatc actatcgact      8760
     gagctatagc ggctggcagt acgtgcaggt gattcaaggc ggagaaagtt ttatcggctt      8820
     atcccaaggg ctacaaaatg ctctaaccgc ctgtggtggc gtgcccaaga ttcatcgtac      8880
     cgatagtctg agtgcggctt atcgcaatac tggcggccgc aatccccagc tgacccagtt      8940
     gtattcgact ctgtgtgacc attaccggat gcagccaaca cgcaacaatc tgggtgtctc      9000
     tcatgagaat ggcggaatag aggggtctca tggctatttc aaacgacgcc tgtgccaagc      9060
     cctatatcgt cgaggcagct ttgacttcga atccgtggcc gcgtatcagc aattcattga      9120
     gcaagtcatc gctaagctga atgccaagtg ccaaaaaaag tttgcactgg agctgcccac      9180
     cttacagccc ttgcccagat accgaactcc tgattatgaa gtgcgcagtg ccaaagtcag      9240
     ctgcaatagc acgattgccg tccgctgtgt cctttacacc gtcccctctc gcttaattgg      9300
     ccaccgcttg aaattacacc tataccatga ccgcattgtc ggtttcttag gcaccactcc      9360
     cgtagtggaa ttggcgcggg tccatgtcca tggctctgag aagaaaagac gcgctcgcag      9420
     catcgattac aagcatgtgg cagaaagtct caggagaaag ccaaatgcat ttctctactg      9480
     ccaatggcaa tcagagttac tgcccaatct tcagtggcat cagctgtggg aatcactcaa      9540
     agctagcttt gagcgggacc aggccgcacg attaatcacc gaagccctct acatcgccgc      9600
     gacccaagat caagaatccc aggtggccga ctacctgcaa acccaactgg accagtccac      9660
     cctgactttg agcgggttaa aacaggcctt tgagttccag ctttcgactg agcaataccc      9720
     tgacgtccct tcacagcagc acaatttatc tgactatgac caattcctca ccctcggatc      9780
     tggacaaccc ataccagttg ctgatgacaa ccctcaaaca gctccggtta agacatttcc      9840
     tcgacgagtg gcagagcatc gagcatcaag caactcagga gaattggtcc tacgcccagt      9900
     ttctattggc tttagctcaa ggcgaagcca gccgccgaga acagaatcgg atctcccgcg      9960
     cgctgtccga agcgcaactt ccttacggaa aatcctggac caattttgag tttgaccata     10020
     ttcccagtct caatccagct gctctgatgg agttttccca aacaacccac tggttagagt     10080
     caggtagtaa cattctaatt tttgggccga gcggaacagg gaaaacacac gtcagttcag     10140
     ccttggggac ttccatgatt gagttgggca agcgggtaaa gtttctcacc gccacagcgc     10200
     tggtgcaaca actgcagctg gccaaacttc agctggaatt gcaaagtcta ttatccaagc     10260
     tcgaccgcta tgatctgctc atcattgatg acctaggcta tgtccaaaag tccgatgttg     10320
     aaacctcggt cctgtttgag ctgattgctc atcgctatga gcgaaagagt ctactcatca     10380
     cagccaatca gcctttcagt caatgggaca aaatctttcc caactcgatg atgaccgtgg     10440
     ctgcgattga tcgcttaatt caccacgcca ccattttcga gatgcaggca gaaagtttcc     10500
     gcaaacaaga agctgccaaa cacacagcca agtctcaaaa gactgacaga taatcccttg     10560
     cgcgcataaa cccccttttc cccaccatta atagagttgc ttatttgtaa gcagccctat     10620
     taatggtggc tttatggata attgtcattt gttcaccggc gcgatcacct accgcaaaga     10680
     tcatgatttg tcgattgcat gatggtatcg ccaagaccaa actcgactca cgagccatta     10740
     tcaaaagtat gaagacagag caaaaaaagt tggcctatct aattgacatt agacatctgg     10800
     ccatgaagtc aatgtgaagg ttgaatgaga agactctcat aggagtattg tggaataacc     10860
     actaatgctg caatctccag cgtccctcac ccaaatcggc tattgacctc atccatgatc     10920
     gacatcaggc ttttctaggt tttccatcac tcatccttct cccagaggtc tccctgaatt     10980
     atcccaagca atcactccag cttagggatt ttggctccta tcgtgaaaac tcaggttgtt     11040
     ttaggaaatt gatcgtcatc tcatatcctt ctgggatatt ttgctgctta aatagttggg     11100
     cagcagtttg tatatcctgt ttgccttgag taaggttccc gattaaaacg taggtagctc     11160
     cccggatggc ataggcggct gcaaactcac gattcagttc tatcgctttg ttgtaatctg     11220
     agaatgccct ggagtatttc atcaagtaag tgtagctgat tcctcgacta acataggcag     11280
     ctgcaaactc aggatctagc tcaatcactt tgtttaagtc agcgatcgtt tttgggtatt     11340
     cctttaagtt gagacgggca gtgccacgtc tgaagtaggc aattacatag tcaggatcaa     11400
     gttctatggc tttgtctaag tcagagatcg cacccagaaa gtcacctttc tttgacctat     11460
     gggttgcttg taaataccaa tcatctgctt ttaattcaga accttttgct gctattggcg     11520
     gatccacatc actcaatttc tgactagtgt tgtttgtcaa gtttagaaac gtattgatag     11580
     gaatgcctag attaaaaccc gatttaatat gcacagttgc cgattgctgt acttgttgtt     11640
     ctgcatccgc acgaccatga ataccaatca atctaccctg acgattcaat atcgctccac     11700
     cactcatccc tggtaaggta ttgttgctat acactaagcc ataaccatct gccaaaggac     11760
     gtttagtgtt tgacgtcact tctcctttgg agaaattcca tatggcttct gtgatcgcct     11820
     ttgtaggggt agaaaatcca gagacataaa tggactcccc agccttcact tcagaggagt     11880
     ctcccaactt tgccactcga taagatattg tgctagtaaa cttaacgaca gctaaatcta     11940
     taccaggaaa tttttggata cgattgtaat tcaaggggta tcgttggtca tcaaaggtga     12000
     ctaattcata ggtatcttca gtagccacga catgagatgc cgttagtaca gtataggtat     12060
     tgccctgatg tttaattaag acccctgacc ccggattttg gccatcaatg cgaacggtga     12120
     tggcttcagc aatcgcactg acgtcagttg ccgttagtgc gattgctgtg gggaggggta     12180
     taaaaacaaa tgctattaca cctaaggcta gaggagctgg agaattaagc gatctcatca     12240
     ctgatcaagg tgattacaga tggggaactg aaatcctcct agacccaatc tttttgacgt     12300
     aggttccagc aataaaggtg agcaaacgtt agtactgtga attcagaatc cacaagcaac     12360
     ttgcagggga taaagccctg aatatactct atgtaatatt aatcagagcc actctgacag     12420
     agattctatt tagatttaat caattttgat attggggctt ggagatgacg aacaatttta     12480
     ggtcattact cacccgctag agagtgtctg ctttctctcg caataacagc tactaatact     12540
     gccgaaaaag cagctcatat ccacatttag tgtcaaatcg tcaagtcatt gatcagagtc     12600
     tgcaattctg gtttagcttg tgcgggggag gttctgtgta acctaagctg gtcgcagtga     12660
     ttgaactgca gaaatgattc taattccttg cgtagagcag gaaacaacac ctcagttttc     12720
     aagacggtgg gttccagggc gagatgataa atatgtagca gtgattcagc cctctcggtc     12780
     ctgcagtcca ttcgagcgac cagctttccg tcccacagaa tgggtagtga gaagtagccg     12840
     tatcggcgtt tggcctcagg aacatagcac tcaattaaat aatcaaaatc aaacagcgct     12900
     ttgatgcgtt tgcgctgaat aacaagattg tcaaatggtg agagtatttt cagcttgctg     12960
     cgggctaagg atttactgag caactccagg gaggttggaa atgcatagta gagcctacca     13020
     gcgacacgaa tctgcaatag ctcgccggta gaaaccatgt cctccaatgt cttatcaact     13080
     agcggcttga tgcctttcaa caagtaggta atttcggcag acagccctaa tccgttacca     13140
     cgcaaatatc gtgtaatcag aaatcgggcg tattcctctg gagtaggcag ggtggtatct     13200
     gtcccttctg gcaacacccg ctcggtgaga tcataaacct tgtgaaaatt aatacgatac     13260
     ggaaccatga gatccccctg cataaacaga tattccaagg cgcgtttggc aggcttggtt     13320
     ttccatgcac cgatccttgt accactatgc tcaaaatcct tagccatcaa cgggccttcg     13380
     gtggcaatgc gtttgagcac ccatttcaac atctgctcat cgcgctgata ccagtgacgc     13440
     tgatcaccac ttgcaaacgc atatttgcga ggcaggctga agcggtagtc acgaaagggc     13500
     aggtaagcgg cggcatgaga ccagtattcg aaaacctgtt tgtcagaaag tagctgatcg     13560
     agctgggaag ccttgtaacg aggattgcga ttccatagag tatggtgatg ggcacgttga     13620
     acaacggaga tagtatcaat ctggatatag ccaaggtgct caatcgctga tagtgtcgct     13680
     tcaatggcac gaccggattg attcctcgga ggtagccttt gtgatagcag gactagtttt     13740
     ctggcttgtt gaatggatag tgattctttc ataactcagc aatctccagc gttcctcgtc     13800
     cgcatcggcc attgacctga tccacgatcg ccatcaggcg cttttacact atagaaacgt     13860
     tgttgacttt agctgaacgt gggttcagtc gtttcttgaa cagtgacatt ttcaaatgca     13920
     actcccacgc agtcattggg tagaggaaat gcccttaagg aaaacaggtt ctcatcacct     13980
     tcaggaaagg tataaggtac attctcgata gaacgggggt gttgagtccg aattatttca     14040
     acaagagata acaatatttc agggtgcttt tcgacaaaac tggggaaaat atcactcatc     14100
     tgtctaccga tttcttcgtg cagtttcatc ttcaatatgc tttctgcagc tgggttggta     14160
     gacaccagct caagatgctc ttcggactcc agattttgtg aatgccagac taaaataccc     14220
     agctgaatat ttgagataat gctttcatag agcttgattc cagctctatc aatctttgac     14280
     tgtcgacgtg cttcttgctc cttaaccact aacgcttctt tctggttttt agctacttcc     14340
     aactgggtag tacgtgaggt gactcgttct tctaagtctc ggttgagtcg ggctaactcc     14400
     atttctgcct gtttttgacg ggtgatatcc tgatgagacc cgatcattcg tatgggctgt     14460
     ccattgtcat cccatttggt ctgaccccgt gccaaaatcc acttatagct gccatcctta     14520
     caacgcattc gatattcggc tgtatatcga ggcatacttt gcctaaggtg agcttcaata     14580
     gctgcggcaa cttctcctag atcatccggg tgaacaagct gccgccatcc ttcgaagcta     14640
     ttttccacct catgatcggc ataaccgagg gtctgcttca attgcagaga catgaaggct     14700
     tcgttagtga caatattcca gtcaaacagc ccatctcctg tcccctccag ggccagctgc     14760
     caccgctctt cactctttcc tagttcaagt tcagcttgct tgcgcagggt gatatcctgt     14820
     atcgcaacta cggccccaag tttttggcca tcttgggcaa taatcggatc gccacttgcc     14880
     aatatggtgc gcggttttcc ttgactaggc ttcactacta tttctgcgtt gtgaaccgac     14940
     tctccctgca aggcccgata caaaggaatg tcatcttggg gtaaagaggt tgtaccatca     15000
     gcttgatata aatgatagta actggcccat tgttcagccg gaattggaca tagcggaagt     15060
     ccgtgcaact cttgggcaga gctgttaaag agagtcaaaa ccccttgatt gttacaagcg     15120
     acaatgccat ttgatagatt atccagtaat gcttgcaaaa acttttgggt ataatcccat     15180
     tcggattgca gtggtattac aacatccgtt gactgcaacg tacccaccca gccacaccct     15240
     gaattagaaa aggatcaggc ttgcccttga ttgagcatag gtgaagatga aggacaaatg     15300
     gttgttgttg ttgacatgcg tttgtccatt gttgaaagct aagatcgcgg tcctctaaca     15360
     agacagcatt ccaaaatgct tctcccaaac tttcaatagg agcatgtccc gttatgagct     15420
     gccaacgcgc actaagggag atgatttgac cttgatcgtt cgcttgccag actgtcacag     15480
     gtagcctatc tagtaattgc tgtggcttga gttgaagcgc atgctgctta tcacctgatg     15540
     tttcggatag aacggaatca gacgagaatg ggaattcagg gccggacgtc ataacactat     15600
     ttgctgcata acattagctt cactactaat aaaaaattgg ccagcagttt tcgacaggtg     15660
     taaatgggct acttgatgct agccatcaac aaaccatacc ctgactgatt agttctctgt     15720
     catgacagta gtcaacccaa gcccctatca aatctatctc tttgaccttt ccccagagct     15780
     tgatgaactc aacttctgca tgtgaccaag atgtgaaata gccttctttg atggcccaat     15840
     ggcacaacac aatatttcta agttgaattt tttgaaaagg gctaagtagg atgggcatga     15900
     gggggtagcc ttcatctttt gcaaatactg ccaggtctaa taaggtgtat cccgtcactt     15960
     cgcaaagttt gtcgaaaaga ggtgtagggt gatttagcat cgctgtattt tctacgagaa     16020
     aagggggagc catctgcata gatataggaa tgacccagca gaattatgca tcacttatta     16080
     tttattgatg attggcttga ccttcctaaa atcctccgat tcatccgcag atcgtcttgt     16140
     acctcaacgt aagcgttgaa gtccagatac tccaagattt cgggtagtgt cagtacgaaa     16200
     atcccttcaa tgaggatcgg atggggatgg acctgaactc accagacaaa gttggaaaat     16260
     cttcacacaa tactcaggtt cagcctctaa cctcggtagt aagagtaatc aatctccact     16320
     gactggagtc ttcaagtgat taaaaaaatg agcccaaata attttaatac aagagcgtca     16380
     aaaacctcag ataagaatga taatttatgt tcaggttggt ggttagaggt gggtactgca     16440
     aatcctccct gtatagattt ctatgggcct tttgaaggca aagctgaggc tgaggttgca     16500
     aaactggaat atgttcaaaa atctactaaa acatctcaaa tcgttttttc tcacagcaaa     16560
     ttttgccagc cacgtcagcg tacacttacc cagaacgact ttaccattca agacttaaaa     16620
     gattgtcctc ccacattttt caaagtcgtc ttaggtggcc atcgcattta ttaaacaaat     16680
     aagttaggga tctgtaactt tgacctattc caaggacttc caggtttgag aacatcttat     16740
     gagtatgtct ctaccattct gctttgactt ccactgcttc gttagaaaag caggagaaaa     16800
     gtccatgtta actatgcagc aagtaaatca gatctttcat aaggtcactg ctgattcagt     16860
     cagatgtgga gcgctaacta tattcgctgt ggcacaggca ctattcatcg gtgtgatgtg     16920
     atgctactca ccccatcaac tgcttttaaa gacgatgaag caggtagcaa aatcctctaa     16980
     gagtctaaaa tttctgataa cggatattgg tgttatgaag cttaactggt ttaaatttct     17040
     acccctgtca gcatgtctat tactctgtat ttttccgcga aacgcaatgg ctcttgaatc     17100
     tcatgatgaa gtgcaagaat caactaaagt gtttacggaa atcaatcgcg aacctaaaac     17160
     tcggatcccc tcaagtctcc tacaacgtag tcaagcgatc gccattctta ccaatgtcac     17220
     ccaaggggga ttcatctttg gagttcgacg gggcgatggc gtcatcctca ttcgcaagcc     17280
     gaatggtggt tggagtaatc cagcctttat tacgattacg ggaggtagtt ttggtctaca     17340
     agcaggtgct agatccagtg atgtcatcct ggtctttccc agtcaaactg cgctaaagac     17400
     tgtgctttct gaggcatttg aatttggagg gagcgtctcg ggaactgcag gacctgtggg     17460
     agaacaaccc gttgagtctt tggaaggatt caatggggat aaagtctata cctactcccg     17520
     cagtgaaggg ctctttggtg gggtgactct ggaaggttcc gatctagatg atgatgacgg     17580
     tctgaacaag gaattttatg ggcagcctat tactgctact caaatttttc agaggtcctc     17640
     tatgcaggca cctgtagttg ttgactcact gaaacaggtt cttcaacaag ctgaagctgg     17700
     gattcgttga ccatcactca agctcagtat ttaagatatt gggggttcga gtcatgatgc     17760
     cacttctccg taatcgtgcc gatgctggtc aacagttagc aacttaatta actcactatg     17820
     taaaccaatc caatgttttg gtaattacct tacctcgggg aggtgtcccc gttgcttttg     17880
     agatagcaaa ggaactcaat gcacctttag atctctgcct agtgcgtaag ttaggtgtcc     17940
     ctggcatgaa cgagctggca atgggagcaa taacttcaga tggggtaata ctgctgaatg     18000
     atgaggttgt cagtgaacta gatatttctc ctcagattat tgagcaagtg gcaaccaatg     18060
     agatgcgaga attatgccgc caagcttatc tttatcaagg tgatcgtcaa ccatcccgta     18120
     ttcatgatca tatccttatt cttgttgatg atgatgggat agctacagct acaacgattt     18180
     gagctgctat tgtcatgctt cagaagcagc agccttgtca aatcgttgta gcttctccag     18240
     tgattgaagc agggacttat gaaacattga aaactgaggt ggaagaagtg gtgtttctga     18300
     taaacccaaa gcctttgtac tcgataggct tctggcatga agacttttct caaacatctg     18360
     atgaagagtt gaaacagttg ttagctatta aatatcgatc caagtatcgt taaaaagcgt     18420
     tactgcgtag tatctgaagt tctgccactc ctagacagtc agcacgaata ctccatctca     18480
     ttgcaaatgg tcaaatgggg tggatgacaa cgctgaatat gggcaactat gttctgtgcc     18540
     tgttctgcct ctaaatcttc tacataccca aacaatgctg cttctgcttc cttgcgaatc     18600
     agaaagggac caaaaaaata agtacatatc ggggataacg ttttgatttc aacccaccag     18660
     gctagaccca ggtgattcga tagatcagcc aggaaactta atagagtagt catcatattt     18720
     gtaggggtgt attttacaaa ttactcttta tcattcattc gtcaagacta gaaagaaaac     18780
     ttgagaatta tgtgaggatt gagatcgttc taacaaaatt tagctaaggc tcttaacttc     18840
     cttaagcttc caggaattac tcaatatgca tgacatagat aaccttgtcg agtgaccaga     18900
     cctcagtcgc ttcagatgat cgatcatcag atctgtgtcc agggcttctg gcaaatcatg     18960
     gttgccacag gggatatagc gatagtaccg atcttttcga atgataaggg cacgaccatt     19020
     acatcgattc aattaaagcg ttagtcaggg tgtttttgcc tcggccacta cccccatcta     19080
     tgctgatgat gggggtagtg gtttaattta gtcttttcag gtaaaagata acgattacat     19140
     ttgcaaaaat tcagatagag tatagtatct gtttggttag gttcgaatat agaaaccact     19200
     gctctatgca aactcccaaa ataattgcat ttgcgaatca aaaaggtgga tctggaaaat     19260
     ctacaagtgc tgcccatgca gcatattggc ttgctcaaaa aggtctctca gtattacttg     19320
     ttgatgcaga tggtcaacag agtagttctg catggctcaa tgagcttgaa ctagactatc     19380
     aagtacttat agatcctgag caattatttg aaagtctacc tacattctct gatgactatg     19440
     acgttgttgt agttgatgga ccaggttcat tgtcagaagt cacaaaagcc atattgtcta     19500
     gatgtgattt agtattagtt cctacgcggg attccattat tgatctaaga agtactggta     19560
     aaatcgtcca attcataaaa catgccaaag agcttcgggg aggatttcct aaagcagcaa     19620
     tttttttaaa cgctactaga aaatcatctg tattgcttcg tgaagcacaa gaagcacttg     19680
     aagatgttgt aattccatta atgcaaacgg ttatttatga tcggcaatgc attaaagatg     19740
     ctcctggaca aggtagtact gtcttcaaaa tgaaaggtaa acctgcaaaa gaagcttcta     19800
     aaaactacga agaacttttc actgaagcta tggagatttt tggtaatgac tagaagaaca     19860
     ttaaagaaag caattcaagc agataatcaa ttatcagatt ttgtttttgg caatgttgaa     19920
     gttgctgatg gagatctcaa gtatatcccc cttaactcca ttaaaagaac tacattgcaa     19980
     cagaggagat acttcgatca gaaacaaatt gaagaatggg ctaagcatga aatcaagatc     20040
     aatggtattc gttctccgct ttgggtaaga aaactcccta aatctaatag aaagcaagaa     20100
     tatgaattgg tcgcaggaga aagaagatat agagctgctg aattcctgaa tttgctagaa     20160
     gtccctgtac gcatttttat ccttgatgat agacaggcat tgatggcttc attagttgaa     20220
     aacatgcaac gccaagattt aagtccacta gaggagacag aaggaacact tgaattctta     20280
     tcaatggagt tagaccttcc gattgaaaag gtcaccaaat ttctctatca aatgaacaat     20340
     gcatccaagg gaactgttaa ccaaaacgtt ttggttagtg acaacgctca taaagttgag     20400
     aacgtcttca aagtattggg ccgcttgact tggacatcat tcgtttcatc caggctacct     20460
     ctcttaaaga atccaagcga tatcctcaat gccctacgct ctggagagat agagtataca     20520
     aaggccatgg ctatttccaa gcttaaggat aaaaagacaa gagtcaaaat attaaagaaa     20580
     gctatcaatg aaagcctgtc tctgaccgaa atcaagcaac ttatcaatag ttaccgtgaa     20640
     ccagtagatc agcctacaga actttcgctg gatactgaag ttaagaaagc actagcaaag     20700
     tttaaaaagt caaaagtgtg gactaatccc aaaaaggaaa agcaaataag aagacttctc     20760
     cagcaattag ataaattaat ggatgacgac aattaaccac ctagtcttga gacctattat     20820
     gggaaggctg cctagcgact gagggtaatg gcagctactc caaccacaga aagccataga     20880
     attaagtacg acgatgatca aatatttggt tgaggacttg ccagagtcca attaagcaag     20940
     accattttga tcaaacgcta ggttcaagtc tgccctttag ggtgatttcc tgaaaagaag     21000
     ccccgtacta aattggatga attaggatgt cccacttggg taactgagga tgtctctcca     21060
     atcgtttctc aatgcctttc attgcttgtt tagtaagcga aattcctgtt tcataaatct     21120
     tctgtgtcac agttacaacg gggtgattac ccttccaagt catggtgcta gcccatccca     21180
     acagggtatc aacatcagtt aataaggttc cgttccagtg ttgctccaaa atcccccaac     21240
     atcgctcaat ggggttgtac ttgctgtgat aaggcggata gtacaggagt tgaatcgcgg     21300
     tgccgatgtg atcgctaaat gccaccagtc gattgaggaa ctgagtgcgt accccactat     21360
     tctcaggacc gatatccaac ttgatctgga tgagctgcag ggtttgctgt tcggtggggg     21420
     ccagggtgtt ccaccaatcc tgaagattat cgaccataaa atcgctcgtt ttgtgagaat     21480
     ggccaaaaat gatatgtaat gtatcggcgt cctcctctag gatgccgcag ggaacatatt     21540
     ttggcccact acccatatcg tgatcacagg ctttcgtttg ggttcgagtc ttgccccgac     21600
     gagaggactc ccctagttca acggtggctt tgcaatcgat gctcaatcgt ttgacggtac     21660
     cgtcatggtc tttcaggtct ttgtgtttga ggttggcaaa gatggcatcg gtttccggca     21720
     gttttttggg ggtttagctt tgaggacacg gcggagtcga tagcctaacc gattcaagac     21780
     gacggccatg gtactctttg ccggtacaga cttgggggga aatccttgcg ctctcaagtg     21840
     ggtgatagcg gcagccgctg ttaagcgggt ataggcagtt gagctggaaa aggtggggtc     21900
     ttgttggcaa tgggcttctg caagctcccg taaggcggct gcgacctctg ggtgaaggtc     21960
     ttcccaacgt ttcctgccac agaaacccga ctgagcaccc acacaaatca tgcctgttcg     22020
     cttctcacct aaacctgttg ccaccgtatt tcgaccccag ccaaagataa tttctgtgag     22080
     attggggttc ccgtcgcagt atttgagggc gatgtctgcc tggaaagccc ggcggcgggc     22140
     tcctgtcatt ttcgaggagg caaatttcag atcttcaagt tgattccagg ttaattggtc     22200
     acgcatgctc agagttagat tcaatgcatc actattacat tctgtggtca gaagtatgtg     22260
     aggtctttcc tagaaatcgc ccaaatggtg cagatggcag gcaatcatta tttctagggg     22320
     acagtgggtg cgctacagta cccccgattc agaaggcgct gagaacatcg ctgtctatgt     22380
     acctgcattt tccccgataa tgttcatcaa gactgatgac atgctacgcc agcaacagta     22440
     tttcaacttt aaatctctct atctcgcata aattcttcta aaattgtcaa atactcatgg     22500
     aaaagcctgc tattgagcac tattggcaaa gctattgcca aaccttatct cctgatgaag     22560
     atcttgacca accctatcta gttgaacaat ttggtgatag ccctgaaatg gctaacgagt     22620
     tggggcaatt ggtactagcg ggaactaaga ctgcaacctg ctcagcactt tgggaatggg     22680
     aagcagaaca cagtccccta cctactgttg gcttgaaaac cattgttgtg gatgggagcg     22740
     aaaccccctt ttgcattatt gagacaaccg aagtgaacat ttgtccattt gatcagattg     22800
     atgctcaatt cgcttacgac gaaggggaag atgatcgcac tctggaatcc tggcagcgag     22860
     aacactggaa atacttctct cgggccttac ccaaaattga taaggagccg actcataaca     22920
     tgctgcttgt ctgtgagcgc tttcaaattg tgtaccgcac acactgaaat tttgaacaat     22980
     tctctaagtc catgaaacga attcaacttg ctagcgaatc tgatgtatta gcgttagcca     23040
     acctttatcg acaaacggtt ttaacttggg ggccacgata ttacactcct gcgcaagtca     23100
     ctgcttgggc tagttttacc tctgagacag accaattcag agcattcatt ctccaggcaa     23160
     ctacctttgt tgcaaggaac cacacaggaa tcttgggatt tgcaggcatt gctgaagatg     23220
     gacatgtgac atcagcttat gtacgacaag actgcatcca tcaaggtatc ggctcggcgc     23280
     tgatgagaaa ccttttggaa tatgcacaaa gccgatgtat acagcgactt tatgcggaag     23340
     ccagtgagtt cagtctcggg ttgttcaaga agtttggctt tcaactctac gaaacagaaa     23400
     tggtagagcg acatggggta caattccagc gttttttagt cgagctaaaa ctcaacgatc     23460
     aacgacgcca ttgccggaat gatagtggtc ttccccatga ttgtggatga gaccgctgaa     23520
     cctgaagacg atccagtcct ggcaccctat agaaaacttg ttttatccaa tattgcccta     23580
     agccactctt ggaatcaacc tggttattta gctcatccta aacattacaa tccactgatt     23640
     agctatgcca ttacttgaca tttatagacg accggtcata tattatctct atggctagac     23700
     ctaaacgcaa tgaacatatt cgtgaacagc tcctagatca aggactcaaa ctgttcctca     23760
     ctcaggggta tcacgggacg gggattaaag aaatcctcga tcaaatcaat gtgcccaaag     23820
     gctctttcta taactatttt gagagtaaag aacagtttgg agctgaagtg attcgccact     23880
     ttactaaggg ggtaatcgcc aacatgtcag cgtgtttaca tgatccagaa gatgatgcaa     23940
     ttactgccct ccagcatttt tttgagcagg aaatgcaccg ccatgaagat ttgaaagcag     24000
     ggtgtatgct gggcaatctc ggagcagaac tggggggaag tagccaatta tgccagcaag     24060
     ccatgattga agggtttcaa gggatgaaac agcaattttc atttactctg caacgggggc     24120
     agagccaggg caaaattcga gacgatattg atattgaaga actggcggat ttcctcgtca     24180
     atgcctatga aggagcatta ctaagaatgc aagttgagca gtcggtgcag ccgatacaac     24240
     aactaagttt gctcctcaat agctatttag caaagaccta aaacttcttg ggattgtagg     24300
     ctttccattt ccgcccccca aagagcattg atttaaaatt cgtctactca ataaaaagac     24360
     gaccagtcgt atataaatag gagatactcg tgaaaagtac acttcgttgg aatatcccca     24420
     atcaagaatt tgaggatggc agcaaaatct ctgactggaa gcagatcgaa agtagtccct     24480
     ggcatttgca aatcgaaagt ggctatgaaa tgacctttgg catctatgag catgatggtc     24540
     aattttggaa gttatatcag gcccgctggg ttgtggaagg gaccactgag tatctgtatc     24600
     ggtatggggg acaagcttgc cgaatgactc aggtagagta caaatcccag gcaagatcgc     24660
     cccattccgg tctactgaaa aatgttggag atctggaatg gatcaggact tatgaagtag     24720
     atgcgcaact acacagggtt attcaggttg gtcgccgtga tctgaagtat gacgatcatt     24780
     tagaccttgt tccctaaatc attcttctca ctatttcctc gataccgtcc atccctattc     24840
     aggttggctc gaaatctaca tagctcattg atcaacaaca agaagaaaga tcatgaattt     24900
     actaacactc caaaatgtgc aaaattttga cgcctacgtt ttttctaagc agccggatta     24960
     ccacgaaccc actgtacgtc aggaatttgc caaggcggtt cccctgagga ctgtggtggt     25020
     ttactgttat gaccctcgtg cagtaggtgt tccagccgct gtcgcaagag agtttgatga     25080
     ggtttaccct ggcgaaattc ttaccgatga gcagggtaac aaaattgctt ctacgactac     25140
     tttattcgag gtgattgttg cagggggccg cgcaattgat gcattgcgct ctatcacagt     25200
     cgctcagcat ctatttggta ttaagaatat cgtgattgtg caccacaccc attgcggagc     25260
     aacttcattt accgctgatg ggattgtgaa tgccttccag aaagagcaag gtaacgatat     25320
     atccacgtta tatgagcagg acagcatctg tatcagcgat tttgtcacat cgctccagca     25380
     tgatactcgc ttggtgagag cttcaaaagg gacacctcac aacgtcgata tctacggtta     25440
     cgtctacaac atcgacacgg atgaattatc cctcgttact caagataagg gtgcacctgt     25500
     ccagattgga gcctaaaact atgacgaaag cagatcgaga agtcgcagtt atcactgcca     25560
     ttggattagg tttcgctatc atcgctcaga ttctattgat catttaaata tagtccgcaa     25620
     ggactaaggg gattcccatg agaacagaaa aacgcctgga aatcagctta gcgattatcc     25680
     gcattagcac tgcaatattt ctactggttt ggtccactgg caaactccta gccccagccc     25740
     tcacccagaa tatattctcg aagttttatt tttcagagat ttcactcgtg atgagttatg     25800
     ccgtgggtgt gttgcaaact attctcgtct tgctatttct ggtgggactc tataaaacct     25860
     tttcatacgg agtggtgcta gggatgcaca gtgtctctgt gctgtctact tacgaaaagc     25920
     tattcaatcc ctactaccca cccaatatct tattttgggc aggggttcct gttctagctg     25980
     gattagtagc cttattccta ttacgagatc acgaccattg gctaactctg caatggcgag     26040
     cattcacctc atctaattcc attaagtcgc atcctcactc cctacactag caagatgaca     26100
     ctcatatagg gcgttcgcct ccatcctgat gaaagtttag atgatctaga tatctatcca     26160
     ccaaaaatat ctatattagg agaaatcatg gctaaaccaa tctgcttagt tactggggta     26220
     ggcgatggta ctggaactgc aattgtccga cgctttgttg aaggaggtta tcgggtcgcg     26280
     atgattgccc gcaatcgaga tcgcctccgc caacttgaac aggacatgac cgacgttaaa     26340
     gcctatgtct gcaacgttgg cgacttagat gcactgcttg tcacgctcaa cagcattcgt     26400
     agagaggtgg gttctccctc tgtcctcatt cataatgcag ttagagctac ctttggtacc     26460
     tttctagaag tacatcctga agagctagag cgaaactttc gggtaaatac cacctcattg     26520
     ctgtaccttg cccgtgaact agttcccaat atgatggaga agggaaaagg aaccatcatc     26580
     atcactggga acaccgccgc ccaccgagga attccgtcct atgctttgtt cgctccaacc     26640
     aaagctgcac agaggatctt ggctcaagcc ttagctcggg atttgggacc aaagggtatc     26700
     catgtggctt acattacagt tgatgcggtg atcgataccc cttggtcaac taacttacct     26760
     gttcagggcc tggcgactga accactaaac cagcactcaa gtcagtctaa agactttttc     26820
     tgccaacctg tagacattgc tgaggaggtg tttcacgttg ctcaccaatc aagctccgca     26880
     tggtcttttg acgttgaaat tcgtcctttt gctgaaaagt ggtaagcaat gtctagcacc     26940
     ttctttatca gaggaaccat ctcatgaacg actcagctta atggcttctc ctgctctacc     27000
     atcagtgcct tggtgttctc actgacctaa gtatgagacc tacacctccc gtccagtcct     27060
     tcacacgggt ctacttcggg catgattgta gcgtaatctg acggcgataa taaagggtat     27120
     caaaggttgc actgaaggtt tgctggcagt gggtgcaacg gtaacgttgg ctgcctttac     27180
     tggttttacc gtgcttgtgg gtctttggat gaccacatag agggcattgc atcagaagat     27240
     aggaaaactc aactccctat aggtttaaca aacccacact tttttgatgc acgaccctca     27300
     aaaacggccc caggatcata ggagtctatt tgagttgagg tagattattt tgggttcgca     27360
     gggtactttc aaaaatttgg gtactaatat gccactgagc catctattcg tgagagaagc     27420
     ataatgcctc aggtatccga tgctattgtt cgtccaatgc gagatgacga gcgacaaaat     27480
     gtgcatgccc tgatgcgtcg ggctttccca cttcttgacc aatgggcctt ttcttggacg     27540
     ccatatgttc tagtcgctga gcagggtgga caacttcaag gagcgattgt tctcaaacta     27600
     ttcgcccttc cccgcaatcg ccaagcaggt tcgattgcct gggtatttac agcaccagag     27660
     gcccgtggca aaggatttgg tcaacgtctt gtagagtctg gaatcgactt cttcgagaag     27720
     caggggtgcg atcagatcct aaccactgtt gagggcttta atacaagttc aagcaagcta     27780
     tttgccacgc gcgggttcaa aatactacct cctgaagacc agttcagacg ttacgggtta     27840
     gcaacattag ttgtgtgggc aaagctctct cattattttg atctgggtca cttcttatgg     27900
     gcacgtcctg ttgcaccagc agtagatagt ccctctctgc aatggtggag taccattacc     27960
     gccaattctt tgattgggct attgatgctg tggcgagcta gcggttttag agcctttcat     28020
     ccagagatgt ggctggttct accaggaata ttcttagttc tgtttggcct gcgacatctg     28080
     ggcatgtggt taacagcaca tcgacaaggg ctaacggtgc ggtttcgtac ctgggagtct     28140
     ggatttctgc tcagcacagc tatctcacta ctctttcctg gggcagtctt cccgattccc     28200
     ggtagcctct atccaataac acatcaatgg cgatatcgag acttgcttcc ccagttgggc     28260
     tggatggcag tggccggaac ccttccagta ttaatccttg tatggggagt ctgggtcttg     28320
     ggtgagttga atgaaccatt accttatgtg agagcttggc tggaagccgt gctcttagta     28380
     ggcaaaccct tggttctttt cgatattgct atgccatttt tcccgtttgt cagttttaat     28440
     gggcggcaat tgtgggactg gaacaaaact gtttggggta ttttggcgat ggcaacaatc     28500
     acaatatttc tggtttagac ctgatttttc tatacgaggt atccaagcta gagggttagg     28560
     gaattgcaat caacgccctt caagaaacga ggtaaatgcc gtgaaacaag aatctccggc     28620
     tatatccgaa ggattagagg gagagcgtca agtttcttgg aaattcacgc aaggcttcat     28680
     agtctgcgag gatcatggct tgtttacgga tggcgatggc ttcctttgac tgcatcgccc     28740
     agcctgggaa aagggcttgc gactggggtc atgaaggcaa acgagcaatc atttcaatct     28800
     ccagttgcaa ctcgggtcca gctagagcgg caacgcccac acctgtgaga ctcggcttag     28860
     caccatcgaa catggccagt agatgtggca tcaactcttc tatgcgatca ggtgtcagat     28920
     ctaccatgta aattcgcacc ataacgatgt cctctgacga agcaccaact gcatcgagag     28980
     ccgcctttgc attcttgaca acaagttctg cctgtcctgt gagactatct ggaactgctt     29040
     caccgctaga ttgccaagca acctgccctg aaatgaaagc aagcctacct ggttccatga     29100
     ttgttatctg cgagtagcca aatgcagatg catcgggcaa agaagctggg ttcagataag     29160
     tcagtgatgg tgccataaat gaatttctca caagtcttgg ataaagggga tctaaaaata     29220
     gcgagaatgc aactaccaca aagttcctaa tggtcttgct acataaccct aactacaacc     29280
     gagtttaatt cagacaactc caacttgttc aggctcggtt ctcgtagcgt catggcagac     29340
     tttaacggag gtgaacttac cctagatgtg ggtcctctgt tgatcaagta gttcaataag     29400
     cttaataaat tctcacatta ttcacctttg cctcgtaggc tctgaaatat agcccatata     29460
     ccaagactgc tatccagtag ttttgtcagg aggtatccat gatgagactt aaactagtcc     29520
     ctctcttttt gatgatggca ttggcaactg tcttaggtgc atgtgaaaaa gcaaatcaag     29580
     acgttcctgc accacctgtt aaccaaggtg atactcctca aggtggggct gaactcaacc     29640
     aatctgaaga tgagtcagca ccctccattc aagaagaagc acctgcacct gaagcaccac     29700
     tgactcctga tggagaagaa acctcgcctg aaaattctga tgaacaatct ccttaggaac     29760
     cttcatctgt cagatctaaa ctgacattgc attagtgtga ctactagcct ggttttctaa     29820
     ggcattttgg gagaaatcat ccataatttt caacccactt tggctgctga atatcacgca     29880
     agtcattacc cccatatgat ttgccagaaa taatccatca caatctgctc gtatctgtcc     29940
     ttaatctctt atcgaagaag gacagttttc tgcgacccaa ctattgctat gcccccgatg     30000
     gcaaagaaat cctcatgaaa cgattcaagg ctcaatttcc cattcaattg gtatcaacag     30060
     ttattggttt gtctagtctt ctggcaagtt tgcctgtagc agctagaaca ccttcatcag     30120
     ttataaattt tgatggagtt gatacctaaa ttgctcaagt tgatgagagc gaagcccaga     30180
     aagaggaact ttctcctgga gtgatgaaga tcctctgcaa gaacttttct ctcaactctc     30240
     gctgttcagg tacaagtcaa tcagatacga ctccgtcatc tgaggaagca cctgatgttg     30300
     aaggggcggc tgatactcct gaaagtgttg agtccgaaaa cttagaacct gaagattcta     30360
     ctgctcctga tatggcttct tctgatacag agccagaaga agctccagta gatagttcta     30420
     cgactgatga tatggatgaa tctacagaag gaggagctga acagcctgat ggaacaatgg     30480
     gctccccaga agaaggcact aattctccag acacgatgcc accggacaat actataccga     30540
     atgagccaac cgctccagac gacactcaag gaccacctgt cacacctcca atggttccag     30600
     tacctgaagg cggaactgaa tagccctaga gctagtaata ccagacaatc tggaaatcat     30660
     ttataactta tgagtaattc accctatcct tctaactcag atccgagttt tcatgagccg     30720
     tccctagaat catcgaatgc gacccggtat acggaactag gtcggacggt tcaagctatc     30780
     agagttgaga ataccaggct caattctgat gttcaacaac tgcgtggccg tacctcatct     30840
     ctcataggcc tactcatagg actaatatta ttgacgattg gtggttttgc ctggctagca     30900
     attagcttgc aaaatttaga aaaagaggaa cagcaaaggg ccaatggaat cgatccagct     30960
     cttgctagcc aggttgagca actagagaaa caggtgaacg atctccgtaa gttcattccc     31020
     ggaaatttat cggacacttt gcaatccaac caaactacat tggcacaact gcaaacccag     31080
     cttcaacagg ttactactca gattaagaca ctggagagat cggctagtaa tagccaacct     31140
     caatccaata ctccacccca aactgctcca ccctctaatc aacaatcctc ggaatctcca     31200
     caactgaaca ataatcagga atagagcttt tcaaagcaag atgatttaaa actgatgata     31260
     tgggttcaag aatgccaatg atcgctgctt gatctttacg atttaagctc actctttccc     31320
     ttaatccgct ctatcatctc tggtggccgc aggccagcat tagataacca tctcccaaca     31380
     ttagaagttc cagaactcct tcaataattt cctgcttctt atactacatt tgtagtatac     31440
     tatggttttt ttcggaagtt ggggtcatgg ttgccataca catcgatcac ctctacaaat     31500
     cctttacctt cagcagaggt tgggggaagc atcgtaagca aactaatgtg gtcgctgtgg     31560
     atcggatcag cttgaatatc ccatgtgggc aagcaatcgc cttcattggc ccgaatgggg     31620
     cgggcaaatc gaccacgatc aaaatgctga caggaattct tcatcccact gctggaaaag     31680
     caatggtttt gggctatgta ccctggaagg atcgtcaatc tctagctcgt cgaattggtg     31740
     tcgtgtttgg tcagcgttcc caactctggt atcacttacc accccgcgat accctcgaat     31800
     tacttgcccg aatttatgac ctcgaaccta aagtttttcg acagcgacgt gattcgctag     31860
     tggaacggtt cggcttgaat gagttttggt caactccagt gagaaagctc tctctaggtc     31920
     aacgtatgcg ggcggaggta gcggccagct tacttcatgc accgcagatt ctgtttcttg     31980
     atgaacccac aatcggacta gatgttctgg cccggcaaaa gttgcgaaat ttaatttgcg     32040
     aatggaatca acaagaaggt acgactgttt ttctcacgag ccatgacacg ggtgacatag     32100
     aacgggttgc acaacgaata attgtgatta atcacgggca ggttatgctg gatgccccgg     32160
     tctcagaatt gcggcgtcga tatctgaatg agaaaattct cagcgtcaaa tttcatacac     32220
     caatctacga gtttcctact ctgcagggtg ttcgccagtt agaggttatg gactttgggc     32280
     tcaaactgga gatcaacact cgcttgattc ctatcgagca agtgatcagt caaattctcc     32340
     aaataggatc cgtcgcagat gttgcgatcg aagatccacc cctggatgca gtgattgctc     32400
     acatttataa ccagcccgcc tcggagggac tatcactatg aaatcactct acaaatacgg     32460
     ttggattgcc tggacatcag cgcgatccaa catggcttac ttgggtgaag tcgttgcccg     32520
     gacactattc ttggtcctta tcctgtacat ttttttgcaa ttgtggagag ttacacgact     32580
     atgaaggtta ctccattgac agtgatttga tgctgtttat cctggcatga tgcactccat     32640
     gacttgctct acagattgtc cttgattgaa aaggacatgg acaaactcaa ctaactgctg     32700
     aacggattca cgagtgaggc tatagagctt ttgacccaca gtaggctcgt cattttgagc     32760
     aaacttcaat ctctcagatt ttcttccaga acaactggtg tcttggagta tcgactgcgc     32820
     tacacaactt aaacagaagt ggcgtttaac cgcttcctcc ttgcggagct gagctgactc     32880
     aaagccaacc aattgcttgg agaactcatg gaaaatttca caaggccaac gataactcca     32940
     ggtggcaaac acccttgaag catcccaatg caaagcatca gtgagtaaaa atcgagggga     33000
     gtcgctgaga tcttcggttt catggacaat gaccaaccgt ttgcgaccat attttctgag     33060
     gcgaacagtt ttgctaaaag cccaaatctc tcgggttttg ccattccggc agcggactct     33120
     cttgtgacgg aaactttcag gatggtcagc cttcaattgt tgagcgaccc catctactcg     33180
     ttgccatttc ccttcccaga aaatgttgcg agaacactct atttcactga cccaatgttt     33240
     cttggatgcc tcaatgactt gcgttatact gcggacgact tgtgacttaa cattgtggta     33300
     gagagatttg gcacactggg agtatccccg cacctatcct ccactcccat gattaaaatt     33360
     gatttcaccg cagaggaaat ccaacaactc aattacgaac gctatcatca ccctcaccca     33420
     cgggtgcagc gacggatgga agtgctctac ttgaagagtc aaggtctttc ccatacccag     33480
     atctgccagc tttgtcagat tagtcgcccc actttagcca aaactcttcg tcagtatcaa     33540
     caaggaggga ttgaagggct gaagaccctt gaatataaag gtcaaccgag tctactcaac     33600
     gctcatagcg atagtgtgag agcttacttt gagcaacatc ctccccgcac cagtgcagaa     33660
     gctcaagcgg tcattgagca attaacaggc atcaaacgca gtcccaccca aatcaaagcc     33720
     ttcctcaaac gcatcggttg tcgttatcga aaagtggggt atgtgccggg aaagtcgagt     33780
     ctgcccgaga aaattgagga gcaagagcag tttcgacaca ctcgccttga acccttatta     33840
     gaggaagctc aacgccaaga gcgtcttgtc ttttttgtgg atgctgctca ctttgttcac     33900
     cgtgcttatc tagggtttgt ctggtgcatc actcggatct tcatcccttc tccttctggt     33960
     cgccaacgtt tcaatgtcct gggcgcgctc gacgctatca ccaaagacct agtcagcgtt     34020
     accaaccaca cctatatcaa ttctcacagt atgtgcctgt tactggccaa gctggcgcta     34080
     cttgacccag tcatacccat cagcgtgatt ttagacaatg cgcgatacca gaaatgtcag     34140
     cttgtaacgg actttgccga gatcgtcgat attgagctgg tctatctgcc ctcctattca     34200
     ccccatttga atttgattga gcgactctgg cgttttgtac gcaaggaatg tctctattca     34260
     aagtattatg ctgattttcc cgccttcaaa ggggccattc aacagtgcat cgaccagtgt     34320
     aatggagagc ataaggcgaa actcaccacc ttactatcac tcaagtttca gtcttttaag     34380
     aaagttaata tcttagccgc ctagagtata gccctctttt atcactttag acagataaaa     34440
     aatagactat tctcagtttc tatttttcta atgagtgatg tcagcttcaa gaagtccaga     34500
     accaaccatt ggctttgttg atgagtactg ccaactattt gcagagttat ttccccaagt     34560
     ccgcagttat gaagccttca agcatctcca tctggggatg attagtgata tcaaacgtaa     34620
     atcattgccc gccattgcaa gagcagtggg cttggagaac catcaaagcc tgcatcattt     34680
     tctgagtgaa tcaccttggg tagcgtcaca tttgtctgac aagagattgg acatcatctt     34740
     gaaaatactg gatgggcgca ggttaattct attgatcgat gagacgggcg attgcaaaaa     34800
     aggcaagagt accgactatg tgaaacggca gtatatcggc aatgtgggca agaaagagaa     34860
     tggcatcgtc gcagtcactg cctacgggct gtttcaaggg atgattttgc ctttgtcctt     34920
     tgaagtgtac aaaccccgag aacgtcttaa agaggaggat gagtatctca gcaaacccca     34980
     aattgctgct ggaatgatcc gacagttgca agggatgggc ttttgctttg agctcgtcct     35040
     ggctgacagc ttgtatgggg aagctcaaac aaactttgtg aatgtcttag aggagttaaa     35100
     gctgccctat atcctagcga ttcgtagcaa tcatgcggtg tggttacccg cagaacaagc     35160
     agtctttgcc gaaccgtggc agtcatttga acgaaccttc agcaatggca ccactgaaac     35220
     tcgttacagg caagagatca tttatggcca gcgacaccac cagaagcgct attggctatt     35280
     aaccacggac ccccaaacgc taccagagaa ctcaacctct tatgtcatgg cagcggcacc     35340
     cgagatcaag ctggatgaaa ttggggattg ctatggcttc agaacttgga ttgagtatgg     35400
     tctcaaacag tctaaagata ccttgggttg ggctgatttt cgcatgacgc actacgaaca     35460
     aattgaaaag tggtgggaga tagtgatgag cgctttcttg atggtgagtt tgttcgctga     35520
     tgtcttcaat gactcttgtc cagtggcaca tcaacacttt gcgcagcatc cttggtggga     35580
     taaccaaaac gggtggaaga atctgctcaa taatgtgcgc ttgatcattc aaccgttaat     35640
     cagttggaat cttctaaagc gctggttaga agtctttccc agccgtgctt tgaaaaaggg     35700
     gtttgagcaa ctcacatcaa agatggaggc attttgctgt ccactggtga ggaaattgct     35760
     caagcatcct gattttctct ctgtctaaag tgataaaaga gggatagctc taaggttaag     35820
     accccttgat caaatgcata atcagcgtct gggaagtttc tttccgcttc aagttgtctg     35880
     acgatatcga ccgccaactc agtgcgctta cgatagcgta ggcgattctt ttggtagtgg     35940
     agcagctcta acaagcgttg gtggacttgc tccatactct cgtaagtttc gcggcgggtc     36000
     attctcaaat aagccaactc ttctagttga tagttgggct gctgaacctc aacggctatc     36060
     ccatctaatc tttctggatt ggctgccacg gcagtgacaa cggtttgata gcaactccaa     36120
     caacgattga catgatcata ggcggcttta tcaccaaaga tctcttgact gtagggatgg     36180
     tgggaatagg tccagtcaag actaatcact tcccgacctc gtccccggtg tttagggcct     36240
     aacacattgc gatgatgggc cataagctct tgatgatgcc agcccgcttc aaagatcgct     36300
     tcatgcatgg ctcgatagct gacctgttct ccctctggcc acaccagttg actgtatatc     36360
     ccttgtaagg ttttgttggg acttaagagc aaaccattca gataccgact gatgtgggca     36420
     aatccatcat cacggcagaa gacgcttcgc aaagacgcca atgatttggc aatggtcggt     36480
     gctattccaa ctagaggcag catagggttt gaagggataa ggcaactacc tcaatttgac     36540
     caggtcagtg cctaaccttc aaagtcgtga gagttaccta ttcagaagta caggcgcagc     36600
     agctaggcgg cttcacacta cctcaaatgc tgtggtattt gagtgtgact gaatcactag     36660
     cgatttccgc tccacgcatt gcccaagatg ttgaccaaga tgttcgaaca ggagcattga     36720
     ctgtgcaatt ggttcgtccc atttcctatc caatgtatcg actttggtca tcaatgggtg     36780
     aacgctgtgt ccgatttgga ttcaattttg ccgtgagtgc tgtccttgcc ttattctttg     36840
     tcggcgcaat cccaatgagc atcggaggat gcttactttt tctattagtg ttgcccatcg     36900
     catttatttt ggatttccta gtgatgttct tgattggttt gggtgcgttt tggttggaag     36960
     acaccagtgg gttagtgctc atttattccc ggttactgtg gctcctagga ggattgatga     37020
     ttccattaga gctatttcct gagttctggc aaggaatctt gcataatctt ccatttgccc     37080
     tagtgattta tgctccagcg cggttattcg ttcatccttc gataagtgat acactcgcac     37140
     ttttaatgcg ccaaggggtt gcgttactga tgctgacgtt gtgtgtgcaa tgggtgtatg     37200
     gccttgccat ccaaagaata catgccaatg gaggctaagg gcatgaaagc tctactgaat     37260
     tatctgaatt tagcgatcgc atacgttcga ctcaattgga atgctcacat ggaataccgt     37320
     ggcgcatttg tgtcacaact attggccatg cttctaaaca atttgatgtg ggttgcgttt     37380
     tggggactgt ttttcactcg ctttccagtc ttgagaggtt ggacggtgca agatgtagta     37440
     actttgtggg cgatcgccgc cgccggattt ggccttgccc acgcgattta tggcaatgcg     37500
     ctgcaactag ctaaattgat tgcccaaggg caactcgatg tgtggatgct atatccacgc     37560
     atgttgcttc cccatctatt actaggacag atgaatgcga cttcctgggg cgatctactc     37620
     tttgggtatg gggtgtatct gggttttgtg catccagata tcgttcattt tgtctggttt     37680
     atcggtttaa ctacttctgt tgctgcctta tttgtggggt ttagcgttct gacaggtagc     37740
     ctgagttttt tacatgggca atgcctcggc gctgagtgat cagtggcgga tggcaatgct     37800
     cacttttagt acctatcctg gcaccctctt tgatggggca atcaagctgc ttctttacag     37860
     cttcatacca gcaggatttg taacttattt gcccgtcgag gcattgcgtt ctttatcctg     37920
     ggttcatgca atagggtcag ttatgggatc ggtgactatc cttgggatag gcattggagt     37980
     tttttatcat ggattacgcc gttacgagtc cggtaatctc atcaatatga gaggctaaaa     38040
     ttagccgtgt tcggtactcc taattatttt cacccaaatg gatatgaccg aaaccttcca     38100
     actcaaaata ggtagtgcgc agttggctgg tgaatattct ggccacggta agcctttgat     38160
     ctttctacat gctggggttg ctgatcggcg gatgtggtgt ccccaaattg ataccctaaa     38220
     aaattatttc caaacggtta tctatgatcg gcgaggattt ggcaaaacga cctgcttgga     38280
     tgaagccttc tcccatgtca atgatcttag gcaagttatc gaacaactag gtcttacaga     38340
     tgttgttctc attggctgct cacaaggggg acgaatcgcc ttggattttg cccttgctta     38400
     cccccaccaa gttactgcgc tagtgctcat tgcgcctgct gtgagtggtg ctcctgaacc     38460
     cataacattc cctcaaaata ttcaagcacg tattaatgca ttagatgaag ctgatgaagc     38520
     aaacgattta gagttggtta acaccattga aactgatttg tggcttgacg gtcccactag     38580
     tccgtctgga agggtggatg actcattaag aaagctgttg ttggatatga atggcatcgc     38640
     tttgaggaaa ccggaactca ctttggagca agaacccacc tcagcttatg agaaattacc     38700
     caatctatcg attccaacac ttgtagtttg ggggaatctg gactttccgc atgtcagtga     38760
     acgttgccac taccttgtga atactattcc tactgccata ggagaggaaa tgcctaacac     38820
     cgctcatcta cttaatcttg aagaacctga gtaccttaac aacttgcttc aagcattcct     38880
     aagcagtagt aacgaactta aaaatacata aatactatcg gattgctgta ataaagaaat     38940
     attggttttt taatttaaaa tgcatacctt tttagagact gaacggttag cactaaggca     39000
     atttacctta gaagatgtag actgcttagt tgaactcaat agtgatccag atgttgttcg     39060
     tttcgccact atagataaac aagttgatcc agcatctatc caaactcaga ttcttccaaa     39120
     atggttgcag cactatgagg attatgaagg atatggtttc tgggcagcaa ttgagaaatc     39180
     cagtcaaacc tttattggtt ggttcctttt ccgacctgcc gtacatgcac cttattttga     39240
     tccagcacta gctgaaccca ccgatattga attgggatat cgattacgaa aagactcatg     39300
     gggccacggt tatgccactg aagggtctaa agcgctaatt caaaaaggct tttctgaact     39360
     tggagcaaag cgtattctgg ctgtagtttt ttctgtgaat gtggcttcga tccgagtatt     39420
     agagaaatca gggttacacc ttgatatgca gtttattgat aaacatacag gccaagaggt     39480
     agttttatat gctcttaatc actgttaaca aacgacacct tccacgaagt ctgattcaat     39540
     aacaatccga ctgttgcttg aggatataaa caagataacg aaatactcta atttcattcc     39600
     tgtccaggca ttatattcgt tcttcaaata tctaaaaaat atcaaactag agtatcaaca     39660
     tgatcgctga aagctgggag agaattatcg agtggggaaa tcgcaatgcc ccagaaatgc     39720
     ttaaagatct aaaccctgga gcatcggaag agcaaatcgc agctgtggaa gcagaactcg     39780
     gccaacccat cccagcagac tttcgcgcaa gcttgctcat tcacaatggt gaaagtgacg     39840
     gatggccctg caaagtattt gctgactatg gtgcttacct tggaactgaa agcattcttg     39900
     aaagttggaa acagagaaag caagttgctg ctgaagtcga gaattacgca gatgaaatgc     39960
     ctgatccaga acaacaaatt cgtgatggca tcatctttgt tgaaggacca gtgcgaccaa     40020
     agttattttt acctgaatgg attccgatca tggactgcaa tggcgatgtt ttttgggcgc     40080
     tggatatgaa cccagaagaa gggggagttt caggccaggt tattgccgtt gattgggaag     40140
     gctgttcgtg gaaggtcatc gcagattctt tcagatcgtt tattcgtgat tacgcccaag     40200
     aactggagaa tggggcatac cgagtcgttg atgaacagcc gaccaaagag gacaaccaat     40260
     aacaaaccat ttggatcaaa caaggagaac acatcaaggt cacttctaga gtatttctgg     40320
     agtattgccc aacgctaact gacccgccag cttacgctgt acctcctcac gcatgggatg     40380
     ataacgagcg ccttgagcat cacgaaatag tttttctagg ccataaggac gatgaaatgc     40440
     cagtccaccc gtaatttcca tagcagcatc cactaccttc aacaccgact gggtgatcaa     40500
     agtacgaccc gtcattatct ggttggtagt ttcgatactt ggtgattgag aggctgctat     40560
     agcaatcatc tgctgctgca ccaattttgc gttcgttaat tcattctcta aaccgcctac     40620
     caagtaacaa acgtgatcgt catctcgtcg tttttgagca ttctggattg ttagatccct     40680
     ggctgcttca gcaatgccca cgtagaccga gtaaatgata ggaatggcaa tcagtgtaat     40740
     taaatggaat gcaggatgcc atttgccagc tggtcgccgc agggaaatag cttgctccga     40800
     tacgaacaca tcttctagga gcacggtgtg tgaaccagtc cctcgcatac ccatagcttg     40860
     ccagactgaa tcaatagaca cacctggcga cttcataggt aatgcaaaat gtaaaaccgt     40920
     tttgcccgct gttgggtcat catagattgc actggtgatc agtaaatcac cagttggcga     40980
     accactcaca aaaccctttc ggctatttat gataaagccc ccctctgagg gggttgcggt     41040
     ccccgaaccg ttgagccaat ccgcaccacc cgtactgagc aacataattt tctcttgagc     41100
     aacacgggtt agtaaaccct caacagccat ctgttgatgc tgccacttcc aggtcggaat     41160
     cataacttga tgggtatgca tcgatagggc tagggcagtt gaactgcagt gttgtccaag     41220
     aatacgcaaa acattgcaca tctcagcatg gctagcccca ccaccaccta attgagtagg     41280
     tactccagca gcagtaaacc cagcttcctt gaggcgctta atattctcaa gcacgtactg     41340
     atcagagata tcagcagctt gttcactttc cgcgagttgg ggccccaaag cctctgctag     41400
     tgctagccaa cctgtggttt gagggggctt ggaaggtgcc tgttgtatgt cgagcatgat     41460
     ccgtagttcc tgtttaattt tggtgttaat tccatactgc tgccagaaaa tctgtggtac     41520
     aagatcataa tctgaacttg caaacaatct gcaacacagt tttagggaat agagtcatgg     41580
     gcaaaagcta tgggcaatac tgccccgttg ctagagcagc cgaagcaatt tgcgaacgct     41640
     ggaccccctt ggttttacgg gagctaatgt cgggtagctg tcatttcaac gaaatcagtc     41700
     gaggagtacc cttgatgtcc agggcactcc taattaagcg actgaaagaa cttgaaactg     41760
     ctggcattat tactcgccaa gataagaaat ctggacaagg ctccatctat caactcaccc     41820
     ctgctggtga ggctctgcgc cccatcatta aaggaatggg tgaatgggct caacaatggg     41880
     gaagtgatcg cttaaccccg gagcaactcg atcccgattt atttatgtgg ggcttgagac     41940
     gggggttcaa tctggaggct atgccagatc ataaaattgt gcttcagttt gacctacggg     42000
     ggattccccg acaacggaaa acaaaacgaa gctattgggt cgttaccgaa aaacaccggg     42060
     ttgatgtttg catccaagat cctggctttg atgtggatgt gttgattgca gcagatttaa     42120
     gtgccattat tcacgtcgtg atggggtatg accctctgga tctagctctg agagccaaga     42180
     ctattcaatt tgaggggaat caagattggg tcggccaact accaacatgg ctattcctta     42240
     atggcgagcg acgatatcta tcaggtctag cgacggcaac aataggaaca atgttatagt     42300
     gccaaaactc gttttagatt cattcagata gtggtgcata acatacaaat tcggcacgcc     42360
     tgagtctatt caggcacact ctgtttgaat ataaacggct ctctgggaat tagcgtgtag     42420
     cagtcctaca tttagtgtgt ttcctttttc atccctatgg aatgatctga ggtagtactt     42480
     cagagcaatg gcgtaatgga taactcaatt cgcatcccgc tcaaccttcc tgatattcga     42540
     attctagagc tatcgaagac tgagagaggg gattggctca tcaagattga gagtacgctt     42600
     caaggaacaa cctgtcacca atgcggacgt gagattactg acctccattg tcatgatcag     42660
     ccttttcgga ttcgtcacct gccattattt gaagtccccg tttacttaga aattcggccc     42720
     aagcgttatc gatgcaagta ttgcgatgac catcccacaa caactcaaca tttagaatgg     42780
     cacgaacctc gcagtcccaa tacaaaagca tatgagcgtt ggcttctgcg aatcttgatc     42840
     aattcaacgg tctcagatgt tgccagaaaa ctaggcgtta gtgaggatat cgtcagtgga     42900
     atcattgatc gttggattgc cgctcaagtt gactggagcg aatatgcaga cctcaaagtt     42960
     atggggatgg atgagatttc tctcaaacga ggccatcgtg attttgtggt tttgatcacg     43020
     attcctacga cggatggggt ggatatattg gcagttctag ccgaccgtaa acagcagaca     43080
     gtggcaaatt tccttcaatc gattcccatt gatttacgcc aaaccattga gcgcgtctgt     43140
     acggacatgt accaaggatt tgtcagtgca gtccgagaac aattgccgca agccaaaatt     43200
     gtcattgacc gctttcatgt gaccaaagcc tatcgtaatt gtgctgatac ggttcgtaaa     43260
     cgtgaggtca aacgtctacg acgagagctc tctaagcaag agtatgacag catcaaaggc     43320
     gcgatgtggc cttttagaaa acgaccagag aatctgaaag agtcagagca acaactcctt     43380
     gagcgattgt ttgcttattc tccacaactg aaacaggcgt acaacctccg agagaaactc     43440
     acgcagatat ttgagggcag gtacaccaag cacggagcta aatgtgccat ccgtgcttgg     43500
     tgtaaacaag tactcaagag tgacatcaag gaattcgatt gttttctgac cactatcaat     43560
     aattggatgg acgagatgac caactatttc ctggaggggt ggaccagtgg ttttgtggaa     43620
     ggatttaata accgagtcaa agtcttaaaa agacgatgct acggtatttt cgatattgaa     43680
     agactcttcc aaaggatttc tcttgacctc aatgggtatc agacattcgc tgtgacctaa     43740
     acactatatc tagcggctac cacgctaatt cccggagagc catataaact gatgaactaa     43800
     ttctccagag ttcacatctg tgaccaagcc attatcttta aacccaactt tcgtggcaac     43860
     gattttggat acctcattgg ctggtgctat cggagcaatc acccgaagat aaccaagctt     43920
     gtttagggca tattgagaaa gcacagcggc aacttccgtg gcatatcctt ttctcctggc     43980
     atcaggcata atcgcataca tgatctctat cgtctcttca tcatgtggag tcaagccgca     44040
     gaaaccaatg aaggtagatg ttttcggggc ttccactgca aaggctagca ttggatgctc     44100
     cgtcccatat gacgtaatgg tagcttcaag caagtccctg gccccttgac tacttttttg     44160
     ctcatcacca aaggtaagaa atctagtgga ctcctgatca gtcataaaac gggtaaacgg     44220
     ctcaatatct cctcgtgtaa atggtcgaat ctgcaagtgc tctgtattaa tcggttctcc     44280
     aacgaaagtt ttagcgctct ttggtcgctg tctgaattca agagtttcag attcaaggct     44340
     aacggttcta gtatctttac tttcagcaat ttccatcctg aaaattggta aaaatcgacc     44400
     tggaatacta tctgactctt tttctccaat gagttgggca ccgactgcta gataaaactc     44460
     ttcagcattt ggatcacctt ggatgatgag tgaccttcct cctgactctc cgatgaaatc     44520
     cctagcatga gtaatcaaag cacgtccaat acccgaacct atgtgcacag gatcaacaaa     44580
     taaggcttcc aattcaaatt gcaacgatga caaacgttcg acaccataaa atccaacaac     44640
     ttcattcgcc atttctgcga cgacataatg aaacttacta tcttgaatca tctctgatgt     44700
     cacagttaac tcatccctgc aagcttccat gaaatcatca gagtaacccc aataagattt     44760
     tgagcgcata gcaagtccac tcagttgaat cgcttcttcc ggcttagctt ccctaagagt     44820
     taaggagttg gtcattgctc ggggagtgga tctatgaaaa tacggtcaat caagatcatg     44880
     caatttaacg ggttaggctt caccagcaag tttaagttct gaatgcaacc agaagctttg     44940
     aagctcttag tgtccgagag caaaccattg tcatgcctca ccttctagcc tagatactaa     45000
     aatatcgaaa tgcaaaacct cttcattcat aattacgcca aagaattgga gaatggagcc     45060
     taccgattag ttgatggaca accaaccaag gaggaagatg aataattgat tttccttcat     45120
     ctctagtgtt attcatcaag caggaaaaag cttagaattc aagcctgcgc tcacctcaaa     45180
     actaggatcg aggaagagac agccatcttt gccatacgtt aaaagagggg cgatgacggc     45240
     ctttctcgtc aatcagtcca cagtctttgg ataaactggc aaaaccatga atatttgaat     45300
     caaacgcacc acccgtacca tccaacttgg cttgtaattg atccaaatcg cgatatcccc     45360
     agtacagtac aaactctgcc tccaatcgat gggcttcaga aagcaagaat tcaatatatg     45420
     ctgcttgcca cttctctcgt gctggaatca gtaagcgttt cttacgaaaa ggaataggga     45480
     ttccctgagt tggatgataa aagtcttcag ccaagaaatt agtttcaacg acagcgaacg     45540
     gtatatctgg tgcgatttcc tttgctcgtg aaaaccaatc tttaggaata tccgcaggat     45600
     tgcctccagt cataataaag gggaaggtac tcaccgcata catatccgta tagggtaata     45660
     acgattgagt cacctccgct cgtttactca tctgttcgtc attttctagc acaaattcaa     45720
     tgagtatcgg cagggatggg aactcccgtt ttaatactgg gtaaatctgc ttcaccgaac     45780
     ggagtagact ttggaagcga ggatcatcaa cgttaacaag gccagaatct acctctgcta     45840
     catacataaa ataatcaggc tgaaaccggg taatgagatc tcgacaccaa tgaagataag     45900
     ccgcaatcac ttctggatca tcgaaagtct tatctttcca cttgcctgtt cttggaactt     45960
     cgtattctcc taaataaccc gagagactca cccgatcact ccctaaaaga ctcgtcccca     46020
     ggaaaatctt ttggtgaggt ttaatgccgt tgattctttt ttggatttcc tgctcctgta     46080
     ctggatgata gggtttcttt gctgctgcct cattccaggg cacaaaacca tcaaaataga     46140
     agccaatgat gtcactgttt tccccgatca cccggaatgt ttcttcaaag gcttcatcgc     46200
     tccagtcata aggctgatag ataaaacctt gataaaaaga acgctgttct ggatggggtt     46260
     ggctcatatt cttagttgtt agacgactgt ctaataccac tgccagaagg gtgattgcta     46320
     gcaatctcaa aaggaagctg gctcgctttg atatctgcat attacttttg gcactctcga     46380
     catctttaaa ccggggggtg cctcaaacat gaactatttt caactgtcca gtgatgatag     46440
     aacatcgccg atctgctttg tgtatttttc ttaagtttga ttttgccatt aatcagattt     46500
     tataagatat agtacgtttg aactatatca agaatagcga ttgcctcatt tcataaatgt     46560
     gagttcttta atccgtattt aaatctagga gggcatagtg cagttgaatc catatctatt     46620
     tttcaatgga cagtgccagt cagcttttca gttctatgaa cagtgtttag gtggcaaagt     46680
     cgaaaccata atgccctatg aaggttcacc gatggaggat caggtaccac ctgaatggcg     46740
     caataaggta atgcatgccg aacttactgt gaacaacagg gttttaatgg ggtctgacgg     46800
     tatgcctggg gaatacgagg tccctaaagg tttctctgtc tcactcaata tggacgaccc     46860
     tgccaaagcc gaacaaatct ttcaagccct agctgagaac ggaacagtgt caatgccaat     46920
     tcaagagaca ttttgggcta tacgttttgg catggttact gaccaatttt ccataccctg     46980
     gctaattaat tgcgataaac cagcttgatg attctccagg attactgcac taataactaa     47040
     ggagagaaaa cgatggaaac gactacccca caacaagagc taaccatcaa tcatgagccc     47100
     caaaaagaac accaatggct ccaacaactt gttggtgaat ggacctatga atcagatgcg     47160
     aaaatgggtc cagatcatcc ctccgaaaaa tcaaccggga ctgagacagt tagtaccatt     47220
     ggtaactttt gggttcaatg tgaaggccag ggtgaaatgt gtggtggtcc tggaacgaca     47280
     atcatgactc tgggttttga cgtccaaaac caaaagtttg tggggacttg gatcggttcg     47340
     atgatggcct acctctggca atatgatggt gaacttaatg acacaggaaa ggtgttaacg     47400
     ctcagttcac ggggacccag catggcaggt gatggaacca taggccaata caaagatgtg     47460
     atcgaattaa agagtgacga tcatcggatt atgacttccc atgcgttggg tgataacggg     47520
     caatggtatc agttcatgac cacactttat caccggagca aatgagaaac agaacaatga     47580
     ataagcatga aaaaataaat tatgttgagt ttccagcaaa agatatggag gcaacgaaag     47640
     agtttttcag cacagttttt ggttggtctt ttattgatta cggccctgag tatacagcct     47700
     tctcaaatga aggcattgat ggcggctttt ttaaatctaa cttaacggct actactgata     47760
     aaggtagtgc ccttatcatt ttctatagtg aaagcttaac gaagacccaa tcaaaaattg     47820
     agcattcaag agggtcaatt acaaagccca ttttctcatt tccgggtggt cgtcgttttc     47880
     actttagtga tccaaatggt aatgagtttg ccgtttggtc agatgttgat acatgacaaa     47940
     cgaacgactc aaaccgttca gatttcttcc cactacaact agcttgctgt aggactgact     48000
     tcctgatgca actcagacat aaatgacgtt cagccgcttc ttgattacgc aactcagcca     48060
     acccagccca ggtgatagac aggatgagct tgcattcccc aaagctggat tgtttcccaa     48120
     acttgctatg aagaataaga gtagacgggt cgccaatggt caatatgccg tctgagtttg     48180
     gggctgtccc gcctatccgt gctgtttagc tcgaaaatct gatacctgac tctagctgca     48240
     ctctcttgtg cccgttccag accgtaatca gaccagatca tgtacattgg ctggacataa     48300
     ctctactctg aatttaagca gcagcccttc gactaaagtc ggcttcctat cgttcacttt     48360
     taatggcacg attcagctaa ccttgagcct tagcaagtga tgaatatcaa acgctggtgg     48420
     tggatttctt ctggaacctc aatccttttt attgccctca ttgggttgat gtggtttcgg     48480
     attgatagtt cttatcagcc taatctagag cagcttgcca atgaagcaga tatcattcct     48540
     cacctcaaaa gacggggtat atccctaaat aaatctgagg cgattccaac aggtgtcttt     48600
     ctgcaatctc tcaagttcaa caatgctact gaagtcaatg ttacgggcta catttggcag     48660
     atatatgata agtcaatctt tgccaaggtc cccaaagacc aagatgtgcc agtgggattc     48720
     atcttgccag aagcagtgga ttcgggtaac aacctggatc cacaacaagc ctaccgacgc     48780
     tctattagtg atacagaaga agtgattggt tggtattttg aatcaactct caagcagcgt     48840
     ttcaattata agaagtaccc gttagatcac aaaacagttt ggattcgtat ttgggggaaa     48900
     gactttgccc ggagtaatat gttggtccct gatctgaatg cgtataagtc cactcaagct     48960
     ggggatacat tcgggctcga tgacagtatt gtcttaggtg agtgggaagt cgaagaaacg     49020
     ttttttgact tcaaaacacc acagtatgac atggattttg gcttagaaac accactaccc     49080
     caaaccccag agctatattt taatgttgtg cttaaacgag agtttttggg agccttcatt     49140
     gtcaacctag taccccttct aatttcagcc atcttgctgt ttgcgacact actcaccatt     49200
     acggttaaag aaggccaagc cgatattttt ggctttagta cgtcagaagt cctcggagtt     49260
     tgttccgccc tcttcttcgt agttttgtta tcccatatcc agattcgaca ggagatccca     49320
     ggatctgaca tcatttatat tgaatacttc tacttggcta tgtatgttgc ccttttgggt     49380
     gtagcggtag attcctactt gtttactcat gacagctatt caagccagtt taagtttatt     49440
     tcctacgaag acaacatctt ccctaagctg atcttttggc caacgctact gggaacttca     49500
     gcgttctatt catttctgat tctgaaacca tttcagcctt ataaatcaaa tttccttcaa     49560
     ccccaaacaa cccatattct gcttccttca gatcggcctt tagtacaacg agagattttt     49620
     aacacacctc cattggagtt cgctcatact gtgcgcaaga gtctgcctgt taccactctt     49680
     gtaaatccgc ctaatgggca aagctatcac caattttcct caacttctcg tacagagcaa     49740
     tcccatctaa ctttccttgc tcaatcctcc agcctacaag tgacagatct gggagcgtcg     49800
     aggcaccgga tacctggagg ggcaagacca tctgggtggc gctcacggtc ctactcctag     49860
     cagcacaacc agaggcgcac agcagggcgt aaatccctga ttttcacaga ggtaaagtct     49920
     ttactccact tcccggattt gtccttggaa atcatcagaa catgtttcct ggagactgtt     49980
     gaaaacacct tgagacgggt gccgttttgt cttctgagtg ttccgaggaa gtacaccagg     50040
     tgatgctgag gcgaatacac taaattgcgc atggaaactg tctcctattt ctattcataa     50100
     gcaaacagaa ggatgacgat ttcaccctcc tgttgaagtc ttaatcttgt tgtggcggct     50160
     atcgctttgc tatcagggga gccgaatgta gctgtgggca gacttggtaa atttcactta     50220
     gcggaaactg atgcgttgta gtagggcaac tttcttgccg tgggttgccc ttgatattcg     50280
     aggtgtagat gagtctagta tttatatcgg tgtagttatc cactcacgac aatcagggca     50340
     ataactttgg tcgattccag gaatgattag agcttggcag ttaggacatt tcagacccag     50400
     atcagcggaa atatcgcggc caccatagca atcgggtcga tgcttgcgaa ccaccttcat     50460
     agccaagttt cggtgacaga attcacccgc cttttcccag cacaataggg tgcaatctcc     50520
     ctctggggtt agggaagcta accaagaatt cacctggggc catgcctgct ggagttcctg     50580
     acgatatcgg tcgatatatc ctgcctcagt gagctgttga tgcttccaat catcaagcag     50640
     agtttgggac ggagccaaaa agggtaactt ggtatcaact tggaaggatc ggggatgcga     50700
     tcgcgaaata gacaccagca aaccgtgatg gttctgaggc tcgaagtagg atgcagagta     50760
     aagcatcaga acacggcttt agatctattc tcgattgcag cctgaaggca ttcttccaaa     50820
     tcatccccag tccaaccgac attttgcaat tgactgatct gggtcttgcg atatcgactt     50880
     tgcaaggtgt tcattgtcgg caacttcttc agtagttctt gactgggttg gatacccaga     50940
     ttacgagcgc gtttttggca gaaccacttg aattgcgttt gatggtgatt gccagtgggc     51000
     atggctgaga tcgcaaggcg gtattgctta caaccccagc agtgcgtcat aagcggagtc     51060
     ttaaggacat aagcccctgc tttcttctgc acattccaat ccctaagctt gatccgagtc     51120
     ggaattttgg tttcagtttg catgatagat ttctccctag gaaacagaag caattaattg     51180
     cttcaactga aggtgagtct tttaacaggg aatcgccttt ttattggtct attggttcga     51240
     cagcaaaaga tttgtgaaca tcaaataaat tattttgccg tcgtggtaaa ttctgatgcg     51300
     attgtgaaca gcaatctctt taggggcgac acactacact cctggtcgcc cttttccata     51360
     tctatgatga gggtcgttaa ccatttatcc cagctacatt agccatagct ctttgggcaa     51420
     tcgacttcca atttgtttgg tcatcccagc gatagtaaac cttctcagaa cccaaccaca     51480
     cagaacaaaa caacaccttc tcctcttgat cagatggagt ggcttcaacg atgatgggtt     51540
     gtcggagttg ctctggtgta agcattgcga tctcactcag gaatccctta gcaaacactg     51600
     accgataacc tgcctccagg gtatacaacc gatcagcctg aattttaaat cgaagcttat     51660
     gacttttttc gcctctgtat tcctttggag ggaattctat acgcaccaag taccccgtta     51720
     gagctgggta ttccagttct tgtggctggg tattaacgtc gagggtatac caagttttgg     51780
     tattggcccg gttacagaaa attgccaatc cactggggct ttggcctaag ccgagaggtc     51840
     ggttgaatga aggctgagaa agtctttgag actcagaagt tagtgtaggt ggtggtactg     51900
     aaacggtcat atgattttct ccagatacgc gaaaccccca gcgaataagc caggggaatt     51960
     agtaggtgtg aaatgaatta ataggtgtga agtaagggaa atgatttgag ctagtttgta     52020
     ggtggatgcg attgcaaatg aaccgccagt gttcgcatcc actgagacca ggattgcaat     52080
     accttactcc agtaaactaa ccgcaccctc atcgcagcca cgtactccct gatgaccgac     52140
     ccaaggtttt cctgggtttg ggcctgatgc aaatcaatca cctagaacgt gcggccattc     52200
     caggtcagga tttgagcaac gtggattttc atggaattgc ctccgggcat catgaaaaag     52260
     gccccttggt gggggatacc agggggctga ataataaaga taagaaatca aagagaaggt     52320
     tttggggaag ggggtacttt taattgggtt gcaaggcttg gagatatccc tccaatgatt     52380
     taaaagggaa aaccccggac aggagatgcc ggggttttag agagtaaccg aagatcgagt     52440
     gacaaaccca atcggtgaga gaagaaactc aaagatgaag tattgaggct taaatactag     52500
     ataatgctaa ttattgttag gttttagact acatttatag acctaatcaa gttgtaaatt     52560
     tgggtacata ttaatcaagg tcttaaccaa tcggggaaaa gaaaagctgg tatcaagccg     52620
     tgggagcagc aaaccctatc ttggtccgat ccaggatggc ctggactgct ctgataccaa     52680
     ggggattatc aagtctgaga ctgggatttt gagaattcgg gtcaagaatc caggcgatac     52740
     ccttaaagcg tctgccacac tccacagcag catcaaccct gatttggtcc tcaacccaga     52800
     caaaggcata agtgatttca ggaggcatgg gtccagcttc agaaaaggac atggcaaaac     52860
     accccggcag aaagagccag ggcgcggaat aagaacggag tgagctagtt atcctctgga     52920
     tgggtatctg gtacgcaatc cttagaatct ccagaatcaa tagtgtcgtg agaatagcca     52980
     tcctggaaaa aggctagaat ccagttaccg gaaacagcct tattgcgttc agacatctca     53040
     gcatcagtcc agggttgcca agcatgggtc agtggatcgt ttaacatttg aagtacctca     53100
     tctaagtgag cgtgttagag ccgctgaagt ctcctgccaa gaaggtcagc ggctcttttc     53160
     gatgaaaagt ttttgatttt gtctctagtt tttagccttg gtgggcatcg gattactccg     53220
     ctgtctgcgg aattcagcag ggtaaccagc actaagtaga actcacttat ttagttgtct     53280
     catttcgatt actcttattg tatactaact cgtatacatt cacaagtaat tgctccctaa     53340
     attttttgtg ataacttgag ggcatgaaca aagacatgcc actcgataac ctaggccaaa     53400
     tgtctgttaa cgacctgagt gaatgcgtag aagctggttt aaatgcaggg gcctacgcaa     53460
     ttgctcaagc tggcctagcc ctgagagaga tccaacgccg tggagaatat ccaaccactt     53520
     ttgaagcgtt cgtaaaagat aaatttgccc taactcgcgc tagggcctat caactgatgt     53580
     atgccgctga cattattgct gacttagcta gtgtctttga gtccaataaa ttacctcgct     53640
     ctgagtccgc tgttcgtccc atgattggtc tgactaaaca acagcgaatt gaggtatggc     53700
     gacgtgccct taaaggtaaa caaagatctc ctggctatgg aacggtaaaa gcgattgttg     53760
     agcagatgca agcctcataa atagctcaaa gacaacggct ttcttgagcg acttgaaatg     53820
     agcactcgat agtatgttgc ttgtcccgct gtatggtctt taccatgcct aatcaaacgt     53880
     ctctcttctc agagagcaac tatgccgatt tccttgatgg gctaaaacag cgtatccgca     53940
     ctgctcaggt ccaagcacac ttggcagtca accaagagct ggtattgctc tactggcaga     54000
     ttggacgaga aattctccag cgtcaaaagt tagagggctg gggtagcaaa gtcgtcgaac     54060
     ggttggccaa agacttaaaa cgagagttcc cagacatgag agggttctcc cgctcaaatc     54120
     tcatgtatat gcgagccgag gcatggcctg aagaacaaat tgtccaagag gtgcttggac     54180
     aatttccctg gtaccacaac atagctttgc tagaaaagct caaatctaga gagcaacggc     54240
     tttggtatac ccatgaaatt gtaaataacg gctggagtcg caatgtattg gtgcatcaaa     54300
     ttgagagcaa cttatatgag cgcaaaggga gtgctatctc aaacttcgaa cgcactcttc     54360
     cccatcctca atctgacttg gcacagcaaa tcatcaaaag tccctataac ttcgactttc     54420
     tcaccatcag taatgatgct catgagcgag aacttgaacg aagtctcata gtccatattc     54480
     gtgacttcca catggagtta gggctaggtt tttcttttat gggaagtcaa tatcctctgg     54540
     tagtcagcaa taaagagtat cggcttgacc tcctcttcta ccatgttcat ctccactgct     54600
     atgtgatcat tgacctcaag atgggggaat tcattcctga gtaccctggg aagatgggat     54660
     tctatattgc tgccgtggat aatatgcttc gctctgatcg cgatgacccc accatcggca     54720
     tcatcctttg taaatcaaaa gagaaaacta ttgttgaatt tgcccttcaa ggaaatcagc     54780
     aaccaattgg cgtctcaact taccagattc agtcacagct tccagaaaat tttcaagaca     54840
     aactacctac gatagaacag ctagaaatgg aaataagcag tgttgttgag gacattgaag     54900
     acaatgacaa tagcactagg ccaaacagct aaacattccc gattcgaaca atgcctaggg     54960
     taggcgatgg gctagagtca gctagtgttt gatgactcat gattcccttt atcagggtga     55020
     tagagttgca aataaagcca acttttgcgc tattgctaca tctctactgg caaacattta     55080
     cattatgctg ccagtttttt ctagtttctc ctagtggtag ccatatcaac tttttttctc     55140
     atccgccact caaacgcttg ccctagctgc tcaaggtcga gtaatccata ttgccaaagg     55200
     atgatgtgga tccgaccttt tgagggtcta gatgacgcaa ggctaaatct attgctgcac     55260
     cagaaatggt taattcatct tgtatctctg gatttccgta aactttcgga tacaggatac     55320
     ataagagatt atttactatg gggaaataaa tagataaata tatatggtaa taagtaacta     55380
     tgtcacagtt agagacagac aatcttccta tagatgaaac tgatatcttg cctgaaattg     55440
     acgagctaga tgatgtagac cttgatgata tgctgaaaga tttacaacaa gactgaggct     55500
     tggaaatatt aatcgacaag attaaccata catggatcca aataacctag ccgtttggaa     55560
     aaacgtggag gctcgtctgg ggactccttt cagaaaaaat atggtggatc tcgtgttgga     55620
     aatggcccga gatcgcacca ccgatccgca tcagatcgca acttggatgg tgacgacctc     55680
     tacctacatc tgctctgcca tttttgggac taacgatccc atgcctttgc tctttctata     55740
     cgtccgggca ctagataccc aatacccaga caccatgcag gaaatttatg aaatattttc     55800
     taatgaaggt ctagagaaat atgctccctc atctcttaaa cgtggcgact taacaagtat     55860
     cctctgggct gctggttcga cctttgccaa cggtgaatta aaactgatag acgacgagat     55920
     ccatatcaac ccaaaaggtt tacagcgact gaggtcaatt tggcaagcac cttctagaca     55980
     gaccaacaat cgtcaaagct aatcgttatt gatgcagact cagatactta ctcacggagg     56040
     ctgttccaaa cttgaaggtg tgatgcagaa tctgataggt tgcccctaat cctctgagta     56100
     gaatttaatt atgtctcagc aatctgagtc cccacaatgg caacccatta gggtgatgca     56160
     cgagtgtatt ccgatggtcg atggcatgtt ggaggaggtg caaagccagc acagcaatat     56220
     gctggaagcc cagaagaaac cccatacgat ggatgatgcc accattcaac gggtgattga     56280
     cgtgtattct gagcagcatg aattcttgtg ggtctatcgg gagcagttct ctcgttggaa     56340
     acaggaaagc ccctcaccac aacagttgaa ggatatcatc aggcttgaac aacaggtgga     56400
     aaagattgcc caagcgctca cgggcattct gaacattgtc gacgacatca aggacaaaac     56460
     catcgagagc attctgggta aaagcgacat ggaactagca atggacgtgc tgatgggcaa     56520
     cctgaagatg cccgagtagg gttgctagca tgagtttaga tgattgaact ggggagatat     56580
     tccaaatgcc cagcactcaa gagcccgtca gaggtattcc tctgaaagaa aaaccagaag     56640
     gcatatctcg gtgtgggatg tctcatgcaa cgattgccca gaatattttt acgagtcgtt     56700
     ggtatgagat atctgcgaac gggcaagtca ttggttcggc tttggatttg gacttttaca     56760
     aacaggatgc tactcaaggg caaaattctg ggtctacagt caaaactaag gaattatcga     56820
     aggtttaagg ctgagttact aacacaatcg ctcatcctat ttcagttgaa gcttcttatg     56880
     taaaaattcg atatcccata tcaccctgac tgatagggtc ggttatccgc taaccacaaa     56940
     ccaaaaactc tatgcaatca tttagtggtt caagtgatac tgtcagagag attttttaac     57000
     ccatgccgag aaagaaaaag caaactaaac ccttaacagg aaaagactta gtagccaaag     57060
     taaagcaatt gagtgattac actcgtgaag aaaaagcgaa agcttgcgga tacatttctg     57120
     ctgataaaga tggctctgaa cgaattaaaa ctatcgcgtt tctcaatgct ctattggatg     57180
     cggaaggcat cgatttagat agccaatctc ctaacggaaa cggcaatagt gggcgcaaag     57240
     caagttataa agtcagcgtt caatccaatg gcaatatttt ggttggccgt acatataccc     57300
     aagcactaga actcgagcct ggggatgaat ttgaaattgc tgtcggtcgc aaacatattc     57360
     atttgaccaa ggttgcctag aagtcttaat tgtttatcca aactcctctg ttaatttttt     57420
     acgggggagt tcaacactct gatgagtaat gaatgatata cctgggaaac ctggagtgtt     57480
     ctccaccacc tctttcctga ttcaatcaaa atcttaatcc tcaagaaaac ctcacataga     57540
     aagcctaaaa tccagtgctg acccactctt taaggtatag ccatgaacaa aggcgaatta     57600
     gttgattcta ttgctgagaa atctggagcg actaagaaac aggctgatgc tattctctca     57660
     gccgttaccg aaacgattat cgatagtgtt agctcgggcg agaaagtcac tctcgtaggc     57720
     tttggcagct ttgaggcaag agaccgaaag gccagaaatg gacgcaatcc acagacaggg     57780
     aaaaagctca caatcccagc aacaaaagca cctgtattta gtgctggcaa ggtcttcaag     57840
     gagcaggtga aagactgata gactgggaat atcgctaaag ttttaacctc attccgacat     57900
     ccaagctggt ggatatttct atgattctgc cagcttcttt ttgcatatct tgaccttaag     57960
     aaacatcaat tatccttccc ataacgggcc attcgaggta attctctacc agtgacgttt     58020
     gcgaggtgat gtgatggcta cgaactatga cagtcttcat tactacctcc aagagatggg     58080
     ccgttaccca ctcctatccc atgaagaaga aatcgagctt gccagacaag ctaaagcggg     58140
     aagcctccga gctaagcaaa ggatgattga gtgcaatctg cgtttagttg tctctattgc     58200
     caagaaacac cagaacagag gactaccact cctagacctg attcaagaag gcagcattgg     58260
     gttgagcacc gcagtagaca aattcgaaat agcccaaggt tgtcgtttca gcacctatgc     58320
     ctactggtgg attcgacaag gaattacggc tgccctccga gcaaagtcac gtcctattta     58380
     ccttcctcag tatcaatggg agatgatcaa caagatcaag aagcactacc gagaactcaa     58440
     tcaaaagctc ggtagagaac catccttatc cgaattatcc gaatccaccg aaatcaaacc     58500
     gaagaccatt aatctgaccc tgcaattatt ccaaaagata tcatccctgg atcagcccgt     58560
     tggacctgaa caaaaagatt ctctcctcga tctattgcca ggagataatc aacccacgct     58620
     ttatatggaa tccctacaac gtgacgagca actgtttcat gtaatggctc atctggatga     58680
     acgggagcgc ttagtactca gtcagaggta tgggctggag gatgatcagc ccaaatcgat     58740
     gagggaaatc ggtgaacaga ttggattgag ccatgaaggg attcgactga ttctcaagaa     58800
     aattatgaag aagctagaga gatacgctga gtctgcttag agcagtaatc atgggtatcc     58860
     aatattgatc aagaggcagc gcaaattcaa accaatgcgg agagaatatt aatgattggt     58920
     agactgagat actagatgac tatttcgttc aaatacctca ctctttgatc acatacaaag     58980
     acactggtct gcaccttaaa ggagctgcca atgtttttat agataacgac cctcgacagg     59040
     tccagaacgc ccctacaaca cagcatctcc ttggggtata caggtaagaa gttttagatc     59100
     atagatacag gaaggctctg acaaaacctc attcaaatca gttcacttaa ttctggggaa     59160
     accctggagg ctgattgcat tcttgatggt ttaagggtat ttcagttgga ctgagagtac     59220
     tccctcgctt tcagtatcgg taattcttta tacaaagaat tgtgttctgg tttgtaagcc     59280
     atttttttat ccagtgcctt cacccctgcc tggctcaccc tccaaaagga ctgatttagg     59340
     agttctatca atgagctaca aaattatcca acctactgag ttcatggatg atagcagtgc     59400
     caaccagata cgctatgaaa ttagcaaggc aatggctaat ggtgtgaaga cgattcttgt     59460
     ggatctgcaa gaagtcgcct tcatcaatag ttccgcaata ggtgctttag tggcaaccca     59520
     taaagtagtg tacgaaaaag ggggcaccct ttctttatgt tcactgaacg agcaggttaa     59580
     aatcttcttt gctttaacca aaatggacca tattttcgat atttttatag accgtcatga     59640
     gtttatgcag aaaaatggta gcgccaccaa ctagccatat ccaggcgaga tgactcccac     59700
     cgaagccttc tacaacggcc cccatcctga ctgcctaaca gaagtatctc aaagccttta     59760
     ttttcatggt ttctaagaaa agagtgggtt gacatgtgag gctagactta accacaaatc     59820
     agcgttactc aaatgtcagg ctccacccaa atttatcgtc aactgcttat ttcaaaatct     59880
     atagcgatac ccacggacat cttcagggtg atctgtgtct atctcgggtc acattcacca     59940
     ttcagcaatg cctcaaacgc ctgctagcag gacgatatag tggcgaagaa ttttccgcat     60000
     atctcgactc taacaatgcc atatcgtctt ttttgccagt gcttggaaat ctgacgtttc     60060
     atctgggagt tctaattcct tgaggggctg acccaactca tagagtgagt ttctagtttt     60120
     aacataaaca tggcctgcac cgccgaagta ccgctgaatt gtggaggtcg tcatactgac     60180
     accaagggga tgttgaggat ggccatatag tttccctctg atcaccgcta tgccatcttt     60240
     ttctacatca atccaagact caataatagg gatattctga gtatcttctt gtggggtttg     60300
     gccagactta taagaggcgt tctccacaaa aaagccagtg atatcttcaa tcgtcaacat     60360
     ggaaatttgg ggttgcaaaa atatacaaaa tagaaaataa gcaatttaga taaattatta     60420
     ctatatatat aatttaatta aaatctagtc atattaactc aggaatatta ctgagtttca     60480
     ggatgtctcg gcaatttata atcacagcaa atgtattccg ttaaaggagt aacatgctct     60540
     cctaaacgag agagctgcat tatggtcagc aatgtgaatg gctagagcct caatcagttc     60600
     ttgatgactc atttcagatg attgatttaa tgtctgttta atcatgaaat cagccattgg     60660
     accaatatga atagccagtt cttgtttgca ctgactgata aactcctcat catcattggc     60720
     tagttccaag gcttgctgag ttgccatttc aggaggtgta gacggcactc tcttttgagg     60780
     tggcttttga gtagctggag tcaccttaag tgattcaagc gaagttgata atttttcctc     60840
     ggacttcgaa gaatgcagag attgagcctg agtagggagt gcagcctgac gacatcgcca     60900
     agtcatcaag taagtaggga actcaactaa tatatacttc acccctttag tacaagcttc     60960
     ctcacaaaac tctatggctg tctgacgcca cgatttatga aaagacggac ctggcacaaa     61020
     actttccccc tggatttcca aggaagatga ccgatcatgc aagaatcctc gtgcttctaa     61080
     ttcttcagat ataaagatgg acgccacttt ttccttaagt catttgtatc tcgcgataaa     61140
     aagctaggtc ttaagttcat ctgaactgac tgtggatgaa ctcgccttga taagccacta     61200
     ctctcaggtt gccctaaagg ctgattgcag ccatcaaaaa taggtatggg ttgatcaact     61260
     cttctataca gatcaccaaa agaggatcag acctacaatt tgtgcgatcg gtctttaaat     61320
     tgacaatgcc aaagaaaccc tccaataaaa tctgtcaggc acacccaaaa caacggggaa     61380
     agacatgaaa atcattaaaa aagggaataa taagctctag gcacatcagt agcttgacat     61440
     gacaaatttc acacttcaaa catcagatct atcaccagaa attgctgcgt tgaagatgca     61500
     gttagcaatt agtctgcaat ttcatcacag gaaaacaata gagcgtttgc cactagaagc     61560
     agccatgcaa gtgatggctg aagtttggga tgcttgcgac catcaacgaa gtagctaaat     61620
     ccaatgaaac ccacccaagc cttctacaac ggcaccccca tcgccccacc ctcaaaccat     61680
     ccgacgatag aacagaatat ggagctactg gactggcatc cgattttcac gggacggtgc     61740
     cccaactgtg agaggccgat ccggaagact acgccaccga ggagtcactg ggactgtggg     61800
     agttgtgggt ggagggatga ttcagattaa cgatacaact aacctgattc ctattttttc     61860
     gtgagaacta atcgatatac ttgatgtact ccagccagca tgagatgact caatgcagcc     61920
     tgacagttat cctctaattg cgctcaagat actactctgc attggtctct gtactgcctg     61980
     tactagaacg aactcagaag actttgttat tgccttcacg ggcgagcaag ataagaacaa     62040
     cagagatatt tttctcatga cggctgatgg ttcaaaccgt aaacggttaa ccacacaccc     62100
     aggagaagac tggagtcctg tttggtcgcc agatggcact cgcttagcct ttatatctga     62160
     ccgaaatggt caatcagacc tctatcttat taatttagat ggtagtcagt taacacgcct     62220
     tacttcacat gctgctaggg atgaagatcc cgcgtggtct cctgacagtc aacacattac     62280
     ctttgtaagc aaacgcgatg ccaatcaaca gcatccttac aatactgaga tttatctact     62340
     caatatcaag gactccgaaa tcaagcgtct gactgaacac gtgggggaag acagtagtcc     62400
     aagctggtct cctgatggac agcagattgt attttctcgc aagatccaag acaatgcaga     62460
     tttatttctg atgacccctg aagggacaga gttcaaacaa ctcactgatg atccaaatga     62520
     tgattggaat gctgactggt ctcctgatgg acagcagatt gtatttacct caggtcgaag     62580
     taataatgtt gacctttacg tgatcaatgc tgatgggtct aatctcaagc gcttaaccca     62640
     agatcctgaa gacgagaacc aagggcgatg gtcgccctca ggccatagga tcgcttatat     62700
     ttcactatcg caaaatcaat gggatcttta cacgattctc ccaaacggca caggacggac     62760
     tcgtgtgacc aatgatgatg ctttggaact tgcctttgac tggttaccta acagcaataa     62820
     aattcttttt gagagtaagg atggtatcta tcaagctaat gtcattggat ctaaaaagca     62880
     gcagatgaca gataatccaa aagatggttc tcctacatgg aaaccattat ctaaagcttt     62940
     taaataactc tgtttcacga caaaatcatc tttagccatc tcatattctt aattttgcaa     63000
     gtcgtttaat ggacttcagt cattttggag tattgaatat cgaagcaccg tcaaccgcaa     63060
     ctagtcagcc aatagtattg aatctgaacc aacgtcagaa ttaccatctg aaaccatcga     63120
     tccatcaaac ctttgctgaa ttccatttcc ttggctactc tcatccttcc actcctgcgg     63180
     tatatctcta gcatcggccc aactaccaat tgatgaccaa ttggtttcag gatcaaaacg     63240
     gatattgaga aggtctgatc tctcaaaatt agctccttca agatccgcac cagaaagatc     63300
     cgcttcatag agattagcct cacataggta gacttcacaa aggctagctt gactgaggtc     63360
     tgtctcacta agattggctt tgtaaagata ggctctacaa aggttagcac cacggagatc     63420
     ggctttatag aggttgacgt tatagagatt ggctttccag agactagccc tacacaagtc     63480
     agcctcaatg aggttggcct ctttcaggtt cgctttactt aaaatggcac cacgaagatt     63540
     ggctttccag aggctggctt cacaaaggct ggcctgattg agattagcac ccgtgagatt     63600
     agccccgatc atgatcgctt tatgaaggtt agccccatgt agatccatcc cagtcagact     63660
     ggccttgctg aggttaatcg ataccttgag attttccttt ctccactcgt tccaaacttc     63720
     aacaccctga ctcagcaagg ctatctgttc ctgattagcc atcgttagtt ctcaagaatg     63780
     ctctgaagtc aattctctta tcccatgcat gatagcaatg ctatcgggaa attttggaaa     63840
     gcaaacatga gattgaaatc cccatattcc cagtaaccca gaaacatcaa agaaaaggtc     63900
     ttggaataac ttgagacaac tcatctaagc tactggggga attcgttaga ctagggagta     63960
     aggcttgcaa actgcaatcc tcacaccaca ctaaactgac agttacccat aacactgtca     64020
     gtttttcata gccaacaccc ctcaccaggt ccaaaacaga aagaccccct taaagtacgg     64080
     gggactccag ggggtagact gttaagaact tttggttcat agatacagga ggttctgagg     64140
     cccccttcag aatctatcaa gtaaatctga ggaaatttgg gggcaacccc ctctcgcata     64200
     ctcccaaaca tgtttaccag agcgttgttt aggacattct tattaactta aggtgctgaa     64260
     ttatatgaag gtaattgagg tcggttcgtc tccactcagc acaccgaccc aaccaaaacc     64320
     aggacactca agccaaccat agtaaagacc ctagagaccc caagccctaa ttctaagata     64380
     gagacaaaaa tctgattgat gtagctctcc taacagttat caaaaacgaa gagctacatc     64440
     taagggacat ccctccataa ggaaacctga cattcttagt atgcccaaaa tctagtatcc     64500
     gacagcttac aaaccctttt caaaaactat gcgagctagg tttcaagcat tcctttcaac     64560
     tcaacaatcc aaccataata ctcttcgttt tgctggtttc ggggaaggtg gctttgtagt     64620
     tggatcaagt ttattagctc ttgggctcgg cttaacttct gctctggtat tctcgaccaa     64680
     tcaggattgg ctgcaaactc ttcaatgagc aacagtgaca tctattttta tccttgccaa     64740
     ttgaaatttg catcgacact ttatgacaga tatcacccat caaactgtat caatttcaaa     64800
     tagctattca gtgataaaaa tcacagcatt actcttcttt taagcagaaa taaatcgtat     64860
     ttttatgttt ttaattaaat acctctgtaa atcgtgccat aaatgcttat aagcactttg     64920
     aggccagagc tgcctggccc tcgccaagac ccaggacagc aaaatacctc ctaaagcatg     64980
     gtctcttcag gaggtataca gtccagtcag caacattctg caatagagat ttgtgtgaaa     65040
     cctctattgc agaatctacc aatcaaattt ggggaaattt gggggcagcc ccctccgaca     65100
     tactccctaa gcgagttaat taaagcgtag ttttagggcg tttttgtcaa cttaagatcc     65160
     tcagatgctt aacgtgagag aacttgaagg ctccgaaact tcatctccag cagcaagaaa     65220
     cccctcaatg ctcaccagta gcttcaaggg gtgatcctgt attcaaggat atcaacaggg     65280
     tcttaaggaa tgctattcaa aatctaccaa gcaaatctga ggaaatccgg gggaacgtaa     65340
     gcctcatcct tagcagcaga atccccctaa agactcgcac tctagaggga ttctagtctc     65400
     agcctctctc ctagaaccgc ctgaatcctg ggatattggc tgatctttta tttttaatct     65460
     accaatcaaa tttggggaaa ttggggggaa ggtaagacac tagcctaaat gcttgccata     65520
     attcaaagat gactcccacc caagccttct acaacggcac ccccatcgcc ccaccctcaa     65580
     accatctgac gacagaacag aatatggagc tgctggactg gcatccgatt ttcacgggac     65640
     ggtgccccaa ctgtgagagg ccgatccgag agaccacacc accgaggagc cattgggatt     65700
     gtgcggagtt tgaagctagt cagggagaat gagtgcttga gatgctcaat tggatgacaa     65760
     tagcaatact ggaattgcga tcacaaaccc caacccatga tcacttacac cagaacgacc     65820
     gcagaccgca ttctccagct ttgccaccga gttttacggc caggtttgcc catcgctgag     65880
     gtcatctttg cagaagacca gggccaggaa acacgccatt atggagccta caaagtgcat     65940
     ttggattttt tttttgacgg acaagatgcg accgttttct cttggcgagg ataccaagac     66000
     cgatggtcac gatgcttccc aagaaagtac taggctcagg aacagcaacg atctcatttg     66060
     aggtagaacc gtcaaatatt ccgcacagtg agaatggaga atcaacacag aattgttgtc     66120
     ttggaccaaa gtaatacgtg ttcaacgggc caggaccagc agagtaaccc tggtcaatgg     66180
     cgtttcgatt tggaactgaa gcactaatcc cttcaataac cccggtaacg ccatcgccca     66240
     aaggaccacc atctaagtca tagacaagac caaataagtc tccaaatcca taagttgtcg     66300
     gtggtgttaa ccgattccca gaaaaggaga ctctaaagtc tgaaacttca ctggagtttt     66360
     gaagtcctct gaaatacgca atttgaccat cgccattcag gtcatcggcg atgaaaaaac     66420
     cttcagcgta agcgccttca tcaaaaccat cttgcctgaa gttataggta agggaggctg     66480
     ccgttactgg gggtgtaaag cccagaatca agttacagga ggtatacgca caggccacta     66540
     ttgccaaaaa ctttgagttc ttcatgtttg aatctcaaat tttcgataat tatagaatca     66600
     gtagatcgaa aaaaacaaca atatttcagt taatgctcta tttctagtag aaattatttc     66660
     cttatagtta ggattgaagg aacatagttt gaaagtttga gcagtccatc atttacgagg     66720
     aacaattcca cactaaaatt catctcagtg gctcagtaca taagttgaca aatatgggca     66780
     ctctacactg agaccaacaa tggtcagtta gtagaatctg cacttccagc gatttgggtg     66840
     atgatccaaa ctacctccat cttcgtattt aggcgttacc cactggaact tatggcctta     66900
     acaacggcta tttccggagg caactatgga tggctacact ctcatttggt tcttaatctg     66960
     gcagtctatc tacttctcta tgttcttaca tttcttcctt agcgatgctt tgaggagtca     67020
     cccagaagaa caatgacttt gtagaaataa aagcatgttc tcgcaaggta ccgctatttg     67080
     cgatcttatc cacgtatcga cataccccca gcccgcccct catacttgtc ctcggactct     67140
     cagggtttcg tctctggcac ttcagcaggg ccgcagcgct tctggtggtg gttcgggtgg     67200
     tggggtgtga gggagctggg gtatcagttc tctgcacgtc ttgggccaat tagaccaatc     67260
     aagtttccat caggatccat cacctggcac atatacttcc catcttgtcg atctaatggg     67320
     ccacgataga gcttggctcc taaattgagt gctcgttcaa gaaccacatc gaaatctgca     67380
     acttgccaat aggcaacatg tcccgctgct cctgatggta ctttgttatc cgattgatga     67440
     aaccatactt cttgattgcc aacttttata aagaagtgct ccaatttctc taaccaggta     67500
     acctcaatgt caaataagca tgaataccac gctgctgccg cataacgatc agagacaaag     67560
     tacataactt cagcaacaca ttcaaacaag ctactcacat acctctttaa tcatcggcta     67620
     tcagtcgctt gccaaaactt actaccttat cttctgagaa accaatgcac tcatagaatt     67680
     ttattgcttc caaattatct tcgcgaattt gtaggttgat ttttgggcat ccaaaatcct     67740
     gaagcagacg ttcagcctcg ttcatcattt tgcgccccaa tccctgccgc tggaactctg     67800
     gatcaactgc aagataatta atccaacccc ggtggccctc aaaaccagcc ataacggttg     67860
     aaacaacttc tagatcaaca attccaacca aaaaccaatc tgactgtaca agaagcttac     67920
     gagctatatc cttgtacgga tcattccatt gtcttaataa gccacaccgt tgccatagat     67980
     caacaacaac ttctttatct tcagaattgt gaatcagttg ttctatttct cttctactaa     68040
     attttcaatt ttactaatta tcgctttagt tttaaggatg gtttccccat actgttcaac     68100
     cctaacatta atagtgtcac gggtttctaa atattttttg ggaaatgtaa ggtgagcagt     68160
     tatctcttgt tctgaatcta tttccattgt cactaataat tgattaacac aataattccc     68220
     tgaatcgtca ttatcttcta tataagtacc atccttttta tattcagtcc agccgatgct     68280
     ttggccgcta ataatccaat atatacgctt attaataata ttttgtttta gcccatctgt     68340
     agtagagtga ttttcacatc ctcgttcaga tgtcggggtt tcaagtattt gagcttcagc     68400
     ttctaatata cttccttgga taggaagagt attagctatt tcaccgaagc taaatccaac     68460
     agaagaaata gtaaggcaaa taagaaattt gtagttcatt tattaatatt tttatgatgt     68520
     gacggctaaa atctatttat tgattagcac aatcttaatc tagaatcccg aagaatatat     68580
     ttggtccctg cttcaaaaag tattctttaa gacttttact ttggtaaatg tgtcatttaa     68640
     actagcggtg catcacagga ctccccccat gaaaccccca atcatcagcc tcaaccccaa     68700
     gcccatccct cagaccaccc caggccaacc caagcccgcc ccttccgctc aaaagctcct     68760
     aagcaaaaca gcattcccca agaaggcacc ggagggtaca tggccaccta agcgagaacc     68820
     aagacatgag gaactgggag gaatacgtca cagttctagg cgaacttccc ggacaaccag     68880
     accaaagaaa gtacctcagt cggcatcctc agaaaacctc caggttagtc aaccgcgaac     68940
     tccaagagaa tcagcagagc ttgagagact atttcgcaat ctggagctga gtcagaagga     69000
     ttttgttgag caagttaaaa agggagggga tgttgtcgtt gggcaccgtc agaagaataa     69060
     ggggatgagt tggtctgaga gaggaagtcg agccttaggc atactgaaaa ccgtggagct     69120
     taatggtcaa tgggaacagc tttggttccc tcaaaccatt gcagagtaag aaaacccgga     69180
     ataatttaca ggtgggattt ttccagacat ctattcgaca agtgtgtagt agatcgcaag     69240
     tctcaaatat atgattccaa ttcatcaagg atttttgtaa cttatggcaa ccagcacccc     69300
     tccacctatc tatcctgatg aagcacttgg ggctagcggc cttcttggca tctggcagtt     69360
     gctcaagttt tctcgaaaac cgattgaatt ttcggtcaaa tctgcacaag aatatggaga     69420
     cgcggcaaga attagcattg gttcgattca cgtctatatt tttcatcatc ctgacctgat     69480
     ttccgaagtc ctcagcaaaa aaaacgaaca ctttattaag gacattagct atcgttctct     69540
     agcaggattc cttggtaatg gacttctact tattgatgga gaacattggc agaaacatcg     69600
     acgcctcatg caacctgctt tcactcaaga taaggtatct acctatagaa ctcatttgag     69660
     atcttttgcc taatacgcga aactgctaga agcgttctat ttcaattgtt atggcctact     69720
     caagcagtct gactgatgcc gaatgggaaa tcctcaaacc actgttacca gaatttctac     69780
     cccccaagaa aaagacaagg cctctgatct ggagttacag agagctgatt gatgggatgc     69840
     tttatcgact caaaaatggg tgcaactggg aggacctgcc caaagacttt cccccctcct     69900
     caacggtctt ttggcactac aacgtgtggc gcaaagcagg ctcgattgag acattgatga     69960
     cgctgctgca tggacaggtt cgtgagcagg taaaaaaaag tccaaatgga caacgttgat     70020
     aatggcagac tcgcaagcgg tgaagaacac ttgcaatgcg agggtggagt cgaaagggtt     70080
     ctgtttctac aaagccacca atggaatcaa gcgccatcta gctgttgata cccttggctt     70140
     tccattcttt accctttgca cccccgcaaa tgtctcagac gatatgggct tactgatgat     70200
     gttgaccctc aatattgagt acttcaaagc caagccggtc aatatcccta aaatcacttt     70260
     tttgttggac aacggctatc acgtggacac cttgactcag aagcttgggg caatctatcc     70320
     agccatcatg agaaagatca gatttgagct atcgccgaaa ccctcaaaag cagaaaaagc     70380
     ggctcaaggg aaaacgggct ttgttccggt tgcaacccgg tgggtcattg agcgttccaa     70440
     cgcttggatg gagcgctgta agagcctgac taagaacttt gaacgaacgc ttgtgaatgc     70500
     aaaagcgcaa atggatttgt gcttcgtcag gcttatgctg aagagacttg cggctaattc     70560
     ttaaagatct caaatgggtt ctatattgca acggctatag aagagactaa caaaatgctc     70620
     ggcacttgga agactggaga aatccatgat atccatcaag atatgagcca gcttactgtg     70680
     aaggtgatta ccaaagtact ctttggcgtt gatatcacac aaatggcctt agagattggg     70740
     gatgctctag aatcaatctt gcttcagtac tatcacaagg cacagactag cttcttgcta     70800
     ccatcttggg tgcctacacc gggcaatctt agagctaatc gggctataga ataccttaat     70860
     aagctggtca tcgacatcat tgaacagcgt cgagaatctc cacaagatga tttgttatct     70920
     agtctgctct tagctcagga tgaagatggc agtcagcttt ctatgaaaga gctgcgtgat     70980
     gaggtgatga cactcttact cgcagggcat gaaaccactg ccacggcact gacttggaca     71040
     ttaatgttgt tggctcaaaa tccagaggtt gcacaaaagc tagcctcaga aactcaatcg     71100
     gtcctggagg gaagggcacc aggcatcaca gacctaccgc gcttgccata cacagagatg     71160
     gttctcaaag agtcgatgcg tctgtatcca ccagcttggg cattgagtcg agaagtagcc     71220
     caagattgta tgattggccc ttatttcctg aaaagaggaa catctgtttt ttttagtcaa     71280
     tgggttgttc atcgagatac ccggtttttt gacaatccag aacagttttt accagagcgg     71340
     tggcaggata atctagagct aaatctgcca cgctgtgcat atttcccctt tggagcagga     71400
     cccagggggt gcattggcca agctttttcc ataatggagg cgacgctaat actggcgatg     71460
     attttaaagc aaaattactt caagcttgtc ccggaccagg ctattgagct gttaccgtca     71520
     ataacattgc gtccaaaata tggaattaag atgattttgg agtcttccaa cctctaacca     71580
     tgaccaaccc aatcatcagc ctcaacccca agcccatccc tcagaccacc acagaccaac     71640
     ccaatcccgc cccttccgca cccaagcttc taagcaaaac aaccttccca aagagggcac     71700
     cagagggaac ccgaccagcc aagcgggaac cagggcatga ggagctggga ggaatacgtc     71760
     ggattgttag gcgaactccc cgatcagcca aacctgagta cactcccaag acccggacct     71820
     cagaaactcc ccagaccagt caaccgagaa cccctagagt gtcggcagag ctggagaggc     71880
     gattcaggaa tcttgagcta aaacagaaga atttggtgga gcagaccagg acgcgagggg     71940
     agctggagta tctggctgtt gccaagaatg gctcagggag attctggatt accgtggcag     72000
     gaacggggaa accctttgtg agggaatcgt ttgctacacc gggattttgc tgggagtgcg     72060
     cggttgagat tgaagagagc tttgagattt tgcaggtgat tgagctgcgg ccaggtgaga     72120
     ctatggagcg gatcggggag atgatcgggg tgtggttgga gagggagcgg gtgagtaggg     72180
     tttgggggtg atcagcctga gaccttttgt ttcaatgtga aggtggagta agacaatagt     72240
     ctcaagctgt tcaaggggtt agaaatatga acaaggtcct cacagattgg gtcacagtca     72300
     aaaacttaga tatccaaaac cgttccttat tattccgtgt gggagggcaa gatcgtgctg     72360
     gagtagtcgc caaagttact gggttattgg aactccagca cctatatgtg gaagccattc     72420
     agtttaatct gattttgccc gaacaaaacc aatttgagat ggaaattctc gccaaaggag     72480
     ccctagaaga tttgacctgc attcaaggtc gcatccaatc taatcaattt ttgcagcctg     72540
     tctctgctgc ccaaaacacc tatctctatt ggccgcaggc ttacatgatg catcttgcct     72600
     taaacacgcc agaccaagaa ggtcttattg ccagaatttc gaatatcgtt agtacccctc     72660
     gcgataacaa caatccgttt agtgcaggga attttgtcta tttagcaggc attacccata     72720
     attcagatgg tcctcaggga ggcaccgcct attttagtgt acgagccaac atagccagtc     72780
     agtctttgga agtacaacac cagattcaga atcatctatt ggaatgggct aaagagagtt     72840
     gtattgaaga agatatatgg atccgtgatc tcaatccttg aacgaggtag cgataatttt     72900
     ttgtctaagt tttagtgaaa ataagatatg ggtcgaatat tttatgttgg cgcagtccga     72960
     ttttccgatt tagtagagat caaagagggc taagacaaat ctttcaaact gctctagggt     73020
     caagtaggtg tgaatccatt gattagacta ggtttgagat atctgcactc ctaatcgaac     73080
     gtcaaactaa aggctggagc cattttagtc tgcgtcggtg tgatgtttga gtctatcact     73140
     ggctaatcac ctggtctgtc tacatggaag tgtctgaaga ttttcaaagg ggtgaggttg     73200
     ttgaaccgct tccaaaatga cattagatcc tccagcaaag ctgactcata attttacgtt     73260
     ttggtcagtt tttggtaatc acaatttaga atgataatca ttatcataat gaaaaacctc     73320
     atccctctca ttatttgtga accatcggat tgatattgcc attattgggg caggtcccca     73380
     ggcgctcacc ctctttactc agcaattgga ggacaccatt gactaactca actgcaagcg     73440
     ttcaaacatc ccaatccctc gacatcaagc tgcccaaaaa aggcatgccc gttacgatca     73500
     ttacggggtt tctaggaagt ggcaaaacca cactcctcaa ccatattctc aataccagcc     73560
     aagacctgaa ggtcgccgta ctggtcaatg agtttggcga tattgatatt gacagtcagc     73620
     tgttgaccac cattgatcaa gatatggtcc agctaaccaa tggctgcatc tgctgcacga     73680
     tcaatgatga cctggtggag gcggtctatt ccgtcctaga gcgagaggaa aaaattgatc     73740
     atatggtcat cgaaaccacg ggggtggcag atccgctacc gattattctc accttcgttg     73800
     gttctcaact gagagactta acgactttag attccgttat taccttggtg gattcagaaa     73860
     cctttacccc ggaatgtttt cagagtgagg cggccctgaa tcaaattacc tttggcgata     73920
     ttgtcgttct caacaaaacc gacctagccg ctgatcaaaa ggtggaagaa ctagagcagt     73980
     ggattcgtga gcaaaaatgg ggtgcgaggc tgttgcgatc tcaacagggc caagtccctc     74040
     tacccctgat tctggatact accctctttg atcccaaagc atatgaagag gaagtcaaag     74100
     cctttgcgga gcaggggact catcatgatg aacatgacca tcaccatcat gatgaacatg     74160
     accaccacca cggcgaacat gaccatcatc accatggcga tcacgatcat caccatcatc     74220
     attctgagca cctcaccata gatggatttt cgtcaatggc ctttgaaagc gatcggccct     74280
     ttgttctaga aaaaatgcag gctttcatta ccgatcagct accagaagat gtctttcgag     74340
     ctaagggttt tatgtggttt gagaaaaata catcccgcta tatttttcag ctcagtggca     74400
     agcgctatac gatggacagc gatcagtggc ctgatacccc aaaaaatcag ctggtcttta     74460
     ttggccgcaa tattgacaca gctcagctaa aacaactgct aacggattgc ttggccccct     74520
     aatccttgat gtcgctataa ctcatcccga tttcatagcg cggtagatat ggcaattcgg     74580
     tttgttgcat cgttatccag gactgcaaca acactttttt agagtcagat tggaagtttc     74640
     gctgggacag gaatcaatag ccttatacct ctgaaattga ccacttgcct tctaataaac     74700
     agctcagtag catagcttat tcaatttaac ttcactgagg atatacagaa gaatggttac     74760
     actcaaagac gcacgccgga tcattgcagc tgctgagaaa aaggcagagg aaattggcca     74820
     accgatgaat attgcagtcg cagacagtgg tggcaattta gtttctcatg taaggatgga     74880
     tggagcctgg attggtagta ttgacatctc aattaaaaag gcctatacat cgcgggcttt     74940
     cgacatctcc accaaagact tagctgaaca tagccaatct gggggacaat tttttggaat     75000
     acatgcttcc aacgggggac aaatcatgat cttcgctgga gggatacctc tgatgcaaga     75060
     tggtgaagtt gttggcgcta taggtgtcag tggtggctca ggagagcaag atcatgctgt     75120
     tgcagaggct ggtgcagacg ccttttaagt gaagaagtta gcgcggttgc gaccgacgtt     75180
     attaatgctg atgagttggg gtttttttat caaaaaaaac agtactgtga gccggaggag     75240
     ttgagtgttg gcgactgtct ttgacaaaac tcagcttcaa agacagtcgc ttggtactca     75300
     gtgactgtat tggataagta tatcgatgac ttagctaaag aattgattga gaataccgca     75360
     ggcaataccc catgtttgcc actctcgatt caagaatgca gatgcccaac gagctgaatt     75420
     gacggagcat gcttgggaat ggcgaggttt agtatcctat cccaaattta ttggggcata     75480
     atcatcagat cttcaggcag caaaggtaaa gtcatcggca ttgagagacg ttgtgcccat     75540
     cagtcgagca atagttgttc caccgatccc aatttcggta tcgtctccag tgactgttag     75600
     ggcaagaccg tcaaatttta gatctccttg cccagagata ccaattatgt caaggccctg     75660
     ctcaaagtca acgatggtgt tggtgccctc cggcaattca ccgttaacaa tccagaaggc     75720
     atcagagcca gcacctccag acagcttgtt gtctccgcca atttctgtga agaagctatc     75780
     gtctccgtct ccaccaagag cgcggccatt gcttcccagg aagaactgat catgtcctgc     75840
     cccaccggag agtctgtatc ttgaagcttc agttgcctca aatatgtcgt ctccagcacc     75900
     accaaaggct ctatcgcggt ctgccacaaa cgtaatgtca tcaccactgc cgaggctgat     75960
     gcgattatcg ccagctgtgc ttccagcgat cgctgtatca acgtcgtcat ttcctgcccc     76020
     agcaaaaacc atgtcactaa caccatcaaa gccaggtgta atagatgcaa acagatcatc     76080
     ggcttcgcta ctgcctgcca caatattgga gtctgtagga attagttccg tatccggtag     76140
     cgggactgtt tcattttggg gagaaatcaa agcataagtc cctgcaatat cgcttggagc     76200
     ttggatgaag gtcagatcgg gatcttcaag ttgggcaatg acatcgccgg atagtgttga     76260
     gatttgtaag agtgtgaagg tttctccgcc aaattccact tcaatattct cgaattggta     76320
     attttcaatt gactttgcca tgatgagttg atcttctttc ggatcaaaat cgcctattaa     76380
     ggcataatct tgatcacctt gcccgacata aaaatcagtt ccatcatttc ctagcaaaat     76440
     gcggttaaca ccaaaggcac catggaagtg gtcatagtca ccacttccag ttgttgcagt     76500
     ggtgatcact tgggtggaag gatcatagga agtgatcggc attcctgcga tgaccgcatt     76560
     tcccaaggca tagaagaaag agtcacgacc cactacacca ttgaaaaacg tgagtcgctc     76620
     ttcgttaatt cctgccgcga gaaaatgatc ccagccagaa ttatagtcac ctgcatccag     76680
     caaagcttct acatcaggat tggctgccag atatgctgtt tcattgaaat agggtttact     76740
     acggctcgca tagaaagaat tttcaggtgc aaacagtaga attccgttac tggtaaataa     76800
     gccatctgga atgagctggg gaacatcttc gataatgcct atcagatctc catttctaga     76860
     gatatggaca ctgttgtcga tggtctcaaa atcgtagtct tcaggattgc cagccagata     76920
     aatagcatcc tcactgaagg ggtcaaaaaa gcgaattaag gcgtagtcgc gatcgccttc     76980
     tcccaaataa aaatcttgcg ggttctcttc tgcattatcc cccaggtaaa aaatgttgcg     77040
     tcccggtgaa cctagtagcg tgtcaaactc ccccacacca aatgactcaa cttgagcatt     77100
     gaccaatctt cttcctgatt taatggattg tacaggcacc ccaaatatcg aggatgtttg     77160
     tccagagcta tggataatgt cgtcacctgt cgtgccgttg aaaattacac cattacgctg     77220
     ttgaaattgt ccaatctgca cgtattcttc tagtccagaa gcatatagac cttgggctac     77280
     tgcttcagca acttgtgggt tttgatctag atagattgcc tcatttaaaa aagaattgct     77340
     tgtcatgact cgcctctttc gatgcgttga taaactatga gaatgattat cattctcatg     77400
     gctggcatgc gagttgtttt taagcctttc tttaaaactg acttcggttt ttatttattt     77460
     aaactgaaat atgggctttt aaacctaata tgaataactg aaaaagatta aatgggcaat     77520
     ttcatcgtct cactttgaaa atcgccacta ttattccgtt tgccaggcac gacaaaatgg     77580
     atctccgtct tggagaacaa taaatccttt gatttaaagt tgagactaac cttggtaaaa     77640
     atgtcggaga ttgatcatgg tgtatgccaa gcttttcaac gcataatgcc gttttctgat     77700
     tcgcttaaac cggagcaaca aacgcttgat tttatcctct ttctatcatt ccctgcgtta     77760
     gccatcagtc acctgttaaa ttgaattccc ccgcgggctc agcctgcgga ggaatttccc     77820
     caagaataaa tggaagtaaa agagttaaga actagttccc actaaggtct ttgcagattc     77880
     ttctgttggc agaggcccaa gcttgactcc atcaggatag tattcccaac catctctgat     77940
     ctggatgtct ttatcccagg gtaactggta ctttccttcc gccaagtcct ttacccaagt     78000
     caggtaattt tcacgctctc caccaggttt acccacgtag cctcggcaac caacattgaa     78060
     gacattgttt tcaagagccc agtttttgcg ggcctcatct accagtcttg ggaataattc     78120
     agccgtcaca atttcccaag gattacgatg gccctgctga agtacattgc catcgtagtt     78180
     gcaaacagtt ccttcaccaa agtagtaaaa cacaccgtca taacccgcca agttgacgga     78240
     gatggtgtac atcaagtttt gccaagcatt agtttgattg gtcaagatcc actgatcatt     78300
     gacctgagtt gaatatcctg agatgcgaat ataaacgttg caccctttat aggcagcttc     78360
     tcgcgctaat tcagggaaca tcccatcatg acaaatacaa actgctagtt tagagccttt     78420
     cggtccatca catacgggca tcccataatt acctggatac cagggctcaa tcggtaccca     78480
     aggctgcaat ttgcgatagt gaagggcaat ttctccttga tcattaatga taattgcagt     78540
     gttgaatggg ggaagtccag gtacatcatt tttctccata agagaaaaga ctccccaaac     78600
     tttgttgcgc acacaagctt ctttgaactg atcaatttct ggactatcta ctgtcaaaag     78660
     catttcgtca tatgtccaga tttttgtgtt aagtccttga gtggagtact ctggcatcac     78720
     aatcagatcc aagccaggat aacctgcttt agtgttgtca acggctttac aaatttgctt     78780
     gacctgagtc tgaatatctt cggggccagt gataactgga accggatatt gaatcatggc     78840
     cactagcaga gactcggacc atgaactgac acttcctgta ctacccatat cgaagtcctc     78900
     ctgaggacag tggtatatga ccagcatcat atgggggcag atatgtgagt tatgtatatg     78960
     cccacacaaa tgagaatgat tattattccc acttcatgac atgccttaat agctgaatct     79020
     gtcgaggtat taagagatta tggaatgctg caggtaaata tcactgagta ctgctcataa     79080
     ggagtctcag cgtttcagac caggacgtag ccgttttaac actgtgttcg ccggtgcagc     79140
     ggataactgg agtatgcagc ggatgctctt ggtttacttt gggagttgta gtcatgactg     79200
     ctgaggaatt gttggagcga tatgcttctg aagaaaggga ctttgctggc gttgatttgc     79260
     ttggtgccaa tttggctgag gcccaattaa ctgaggtgtg cttgaatcaa gctgatttaa     79320
     ctgacacaaa tctggttgat gtatgcctaa ttgatgctcg gaattagcta aatttattta     79380
     tttcagcaag acctaaatat gcctgtaggt gttgagaccc gcaaacttag ttccaattat     79440
     tcagttattg ccgggcagaa cctcccccag ggcagagcca cagactgagc acaaactatt     79500
     gttcatgttc cgccagttag atggtgatca ggtagtcatc atggtttctt tgtggcagca     79560
     atggccagtt tcgcaccttc aatttcgcga atgcgatcca tcaccgtcac gacgcggcca     79620
     tgactcactt ggtcatctgc atgaatcacc accactacct tgtcagctga atcagttagc     79680
     tccttcactt ctgcctcaag gacgttgagc tgaatgggtt ctcgattgag agctaaatcc     79740
     ccctgcgcat caatcgtgac cgtcaccttg gtcgatagct gtggttttac tgtctttgcc     79800
     tggggcaaat taacaggtaa ggcatcactg cggttgagga ataacgtggc aatgataaaa     79860
     aaggacagaa ttgcaaaaat aacatcaatc atcggcacaa tattgatttg agccgatgga     79920
     ctgggatcat cgggtaagcg catgattcac cctgcctctt tcatagcggt gacgataaag     79980
     caactccaac tgccccccat gctcttgaat aaaggccaac tggcgctgat ataaactgcg     80040
     aaacatattg gcaaaaatca gggttgaaat ggcgacaatc aatcccgcag ccgttgaaat     80100
     tagggcggta cttattcccc cggtgacttc tgctgattca ctaccgccga tattgcctac     80160
     atctagggag gagaaggagt tgatcaggcc caataccgtc cctaataggc cgagtaaagg     80220
     ggaaatacta atgatggtgt caaacaccgt cgtaaatcgt ttcaatgtcg gcaattcagc     80280
     ttgagcttca ctttctaatg ccaatcggaa ttcttccggt gtcgggtctt ctaaggacaa     80340
     ggcagctaag aatatccggg caatcggaaa tcttgcttgc tcttggagat acctcaaggc     80400
     gtcatagaca ttatcttggc gataaagctg cagtgcctgt ttgacgatcc gcaactggtt     80460
     gcgattcacc ctcgtccaaa agatgaggcg ttcaaaaatc agtgcgatcg caattaacga     80520
     aaaaaccatg agcgggagca tcaccactcc tcccgcaata atcacttggc caaactgcat     80580
     tttgttgata cccctccatt cattacagcg acaagagaag accgattact ctgaccgtaa     80640
     ccacagcaaa cggcattagt tctgagagca taaaactgcg aataaataca ccaagaggca     80700
     ctgatacagc aaccaccctt gctgcacgct gagcctataa agcgatgtcg agatttcggc     80760
     ataatcggcc atatatgaga cattaaatcc ataacttaat acaaggattg ctgccgcttt     80820
     aacatcagcc aaatcaggat gggggcaccc agcacagcca tcactgcatt gaggggtaga     80880
     acggactgac tccctggaag ttgagagatc gcatcggcaa tcaaagctaa gatggcaccg     80940
     agcagagcca cagctgggac taggatgcga tgatcgacgg ttcgaaataa actccggcac     81000
     agatgcggga cagcgactcc cacaaatgca ataggtccac aaaaggccgt aaccgatcct     81060
     gataataagg aagaactgaa gatcaaaagg catcgggttc gattgacaga cagccctata     81120
     ctttgagctt gcgcttcccc cagtaacagc aaatttaaag ctttatgcaa cagttgtgat     81180
     cccccaagtc ctaaggcaat gacaggcaac aacaagggca tctgttgcca agtcacattc     81240
     gaaaaactac caaaggtcca gttgaggtat gcctgggtct gagtaagcaa actgaaatgc     81300
     aaaaggatag tcactagagc agtggtcata tacccaaaca tgaggccaaa aataagcagt     81360
     gctaaagcac tacgcacccg ttgagccact agtagcacca cccccatgga catccctgcg     81420
     cccaaactgg ccgccccaat aatgctgatc tgaacaaaac cattgccagc gttagctgtc     81480
     cctctagtta aaaccacgag agcggccccc aaactagcgc cagcattaat gcctagcaag     81540
     gaaggccctg caagtggatt gcggaataat gcctgtagct gtaatccgct cgttgctaag     81600
     gcagaacccg ctgcgatcgc agttatcgtt ctaggcaatc gaaactggag aataatctgt     81660
     tgccaggtcg gattcgtggc ctgacctccg aacaacacag tgatcacgtc tgatagggga     81720
     atcgagacag atccaaaagc caggctgact agcaccccca ttaacaagac actacttaga     81780
     acccctaaac cagcgtaacg gctgatttgc ggccttccat gtagtgggtc gggaagatgt     81840
     ctatcgttcc catcagtcat cgctgaggac atatccattt ctcactgctg tacatattca     81900
     acccgttgta cccaagtgcg atgagtgcca ttaggatcaa gagataacag ccgaaaccca     81960
     ggcagatgag tatgatcagt tggtacaggt ggattcacct gtaaacaagt ggaaggacaa     82020
     ccgtagaagt aaatcggtga gggacgttgg ctgaaaacat gctgatactg gaagtccaag     82080
     tggatatgtc caaacagcac cactttcact tgtgggaagc tctccaacag ggtgagcaat     82140
     gcatcagcat tttgcacctg catttgatcc agccagtcga taccgattgc cacaggatga     82200
     tggtgtaggg caatcaccgt aggtttatga ggatgttgag tcaagactga ttgcaactgt     82260
     tgcaaggcgc tgactgataa atacccttca ccaaactgag cagaaggcaa cactgagttg     82320
     agtgaaataa gcagccagct ccccagatga attgcctgtg gcccatagag ttgaggagac     82380
     tgcagttccc gatgcatggc ctcaacttga tcatggttac caggcagcca gtaagctggc     82440
     atcttcaagg gtaagattgc tctcattaaa tgctgataag caacgacact cccttgatcg     82500
     gctaaatccc ccgttaagag aattccatcc agttgatctc gattcacttg ctgcagaaca     82560
     gcctgtaagg attgccaagg attagtccct cgtagcagtg ccgttgtatc tgccaacaga     82620
     tgggtatcac tgatttgtgc aagcgtaatg ggggccgtca tgagtctaat ttttggtaat     82680
     aaatcagttg atgattaggc aataactctg ggtggaaaat cttgatcaag tctgctagta     82740
     ccttatgggg gtttacaacc ccgctttccc aataatcgtt gccgccagca gcattgaccc     82800
     gagccgtatt attgaagacg cgatcagctt ggactgcaga cagttgaccg tagcgagcat     82860
     cggttgagat cgcatcttgt ctcgatctcc aatcttggct gacattaacc cagaactcag     82920
     ccttcactgc tcgattaaac actgcttcaa agtccagggg tagactccct cttgcatctg     82980
     actctgacca gagatagttg gcacctgcat cctgcaagag ctgggacaca taacttttgc     83040
     ctcccggcat ataccaggtg ccattgtgac taaaccccgt aaacaccgtg ggacgttggg     83100
     ccacagattg agccaactgc accatcgatt gatactcttg ggctatatcg gaaaagacct     83160
     gttctgcctg cgcttcttga ttaaaaaata gggccgtata ctttaaccac tctgcttgtc     83220
     ccagggggga ttcctccata tattccccca ccagggcaac gggtagacct gccttgacca     83280
     gacgaggatg actatctgtg tctgggttac ccgttccata ggtcatcacc aaatccggtg     83340
     ctgtcaccag cagccgctcc acatctaagg tattgccaga attaaactca accagttcac     83400
     cccgatcaat tttggcccgc acctttagac tattcacttg cttaaactgg ctgacaccga     83460
     caagggtatc tagctgacct aacagttcca agtgaggtaa ataggtcgtg gatagcacga     83520
     ctagactgct aatcggtact tccaccatcg gcagatcttc aaagcctggg ggtttgggtg     83580
     ttccacactg cactagcaga tactgaaagg tttggtttgc ccctttccag ggattctgaa     83640
     cggtaactat tttgtagtga cggtgatact ctaccgagaa acccacggca tagtcagact     83700
     ggaccttatt ggggaaataa tcttgagtag gatcgtacgc aacaggacat tgatcggcag     83760
     aagttggtga agaatcagat ttcagggctg atggtgattg ggttggctgg caaccaactc     83820
     cccctaggaa tccaacgaca gccaatcccg ccgttacttt cagcagtcga atccagccag     83880
     aagtagcgta gtcactgatg gatgctttgg gttccttcat cctgtcgtcg ctagggctat     83940
     acagaggctt gagttttgat cgggggatag acatgggctt gaatagggcg gccttgagcg     84000
     acatgctcct gaacaattcg gtgggcaatc tcaggagtca cgcgggtata ccaagtgcga     84060
     tccccggaat aaaacaccac tggcccagca gcacaaactt ctaaacagcc agaggttctc     84120
     acggcaacct ccaaacctga ctgctgtaca gccgtttgta atgcctcaat aatgggctgc     84180
     acatcctgag agggatagca gcggctggat cgacagactg acagataggg tcgcttgagt     84240
     ggattctcag tatagggaat gggacgagtt cccaatacat aaatatcgcg caacgtttca     84300
     tagaggctca gtttatccag ttggggtgtc ccttccggta gcaagttctc gtcggcatcc     84360
     acaaagggat tgggtaaaaa gagattcatc atcttttctc cagctccatt ccagaactga     84420
     atcccccaac ttcgtgcttg gccgcgatca ttgaagcggc ggtaaaacga ggctcgctgt     84480
     acctgtcgtt ttcgtctcaa cgctggaggg gttttgccga ggggaccacc ctgatgttct     84540
     tctaggcata gatgcaaatg ccatcctgcc gtcacaaccg tcagatagcc atcgtacaaa     84600
     atacaagttt taggggcttg ggtaaattcc agctcaagaa cgctcccctc tactacgtga     84660
     ccaatctggg tttgttgcca gcactcttga aacagggtgt aaagcagagg ccccaggacc     84720
     tcaatggtgc aaggaaaatc ttcatactcg atctgtcctc cagtcgctaa ggggtcaacg     84780
     gtacggtagt ttaaagggac gacttgacgt gaaaattcag acatcttagt taagtcctac     84840
     aataagtcct aaaaagtggc actcacaccc aggcgaaaac tccgacccac tgccggaaaa     84900
     cctggaaatt gttcataatg ctgatctaac aaattgtcta aactgcccgt gaaggcaaag     84960
     ctatccccaa tcgggaaacg aagcttgaga tcgagcgtgg tatagcccgg caaggattct     85020
     gtattcgtgt tgttgacaaa gtaggaactg agatagcgga caatggcggc gatatagaca     85080
     ccttttgcat tctcataggc caaaccaaca ttgaggctat ccgcgccgcg aaagctgagt     85140
     tcattacctg taatcgtagg gtcgccatcc tcaataattt caggctcatt caaggtgtag     85200
     ttggcaaagg catacaggtt tttgagcagt cgcacattca aatccgcctc taaacccagc     85260
     gtccgcacct tgccgatatt ttcataggta ctaggggcac caaactgaaa gttaatcaag     85320
     ttagagatgg tattggcaaa gaaggtgagg cgtaacaagc cattctcccc cagggattgg     85380
     tcaatgccaa tatcaaaact atcgccccgt tctggctcta aatcagggtt acccaccaca     85440
     ttaaaggcag ctaagccttc taggttgacg atttgaggtg ctcgaaaact cctggcataa     85500
     ttcgcccgta aaaccgtgga atctcctatg gcaagacgag cccccacact aggagaggta     85560
     aaggaaccat tagctaaact attgaaatct tggcgcaaac caaaattgag attgaatttt     85620
     ggcgtaatgt tgacgtcata acgggcaaac aaggcccctt gatcaatgcc gccatcatag     85680
     ttaacatctg tggttcccag accatagcta aaagtggtgt tccgagactg ggtattgcgg     85740
     tagtcaaatc cataggtcag ggtttggttt ttggcgactt tccagttgtg ctggacttgt     85800
     gccccaatag agcggcgatc aacatcatct cgtgtgccaa aggctgcagg gtctggatta     85860
     tcaaagttgg agtccagcag atccgcaaaa atccggctgg tgagttggga gttgcccgcc     85920
     tggtccagtt gggcttgcca agtcagatct aggaagagtt cttccgtggt ttgccgggct     85980
     aaaggggtca ggctattaaa ttggccaata ctgtcgggaa ttggcacacc cccagccgag     86040
     ccaaaatctt tgttcagata gagggcgctg aaggttacct ggttgcgatc gctgagtttt     86100
     ccttccagct tcagattcag attgttgtac aacacgtcgg cgttgttccg atctgcttgc     86160
     aatccaatcc ggttaatctc aaacggaaag tcattcgtcg cctgggtgcg ggtatagcca     86220
     acgctccacc ccaaatcccc actgcgcccc cgagcctgca cggcttgctc attgagccca     86280
     aaacttccag ccgcagctct gagggtcacc tccggttttt cgtcagcagg agcacgagta     86340
     atgatattaa tcacgccccc taaggcatcg gagccataga gggtcgatcc tccacctggc     86400
     aagagttcaa tccgctctat attgtccgtc gtgaaattcg atagatcaaa tccacccata     86460
     aaccccacgt cattaatggg gcgaccatct agcaaaatca aaacttgagc tgtgttactc     86520
     ccccgaataa actggctact cagagctcct agttgtcccc cagctgtgcc gtccctcaga     86580
     attcctggga gatatttcaa cgcttcttgg accgttctcg cgccttgggc ctcaatttgc     86640
     tcgcgattaa tcacatacac cgggcgagac gaatcacgca ccgtgccttc tcgccgaaag     86700
     ggggcataaa cgggctgatc taagatttct cccgtgactg taatttctac ttcttcgtcc     86760
     tccactatcg aagaaggtag ggcctcctca tcggtagggg gattcgcttg tgccaggcta     86820
     gctcttgaag tgtagctaaa ccaggcagtt aaactgagtc caaaaacgaa tatgagcttc     86880
     ccaatgacag gaaacccaac ttttacacct ttcatccata cctcgcagat gttgtaagtg     86940
     agtaataact cggcgggcgt tctgactctg aggacaaagc ctcatcacag ttgcgggaca     87000
     gcgccggatt ttcaccggac tttccccgtt tcctctaacg gctgttctcc gttagaaccg     87060
     aatctataaa attgtttctg caccttatca caggaatgag atgcattaga gagaagcgga     87120
     aggcacatag gaatttgcca atatcttgga atagattgaa ccgcttgaat aagtttttat     87180
     actgagaatg ataatcatta ttattctttt ttgcaaacca gcccccaaca ccaccaatcg     87240
     tcgattgtcc gcagtcaagt caatggtatg gatggtccat cgccttgata tgtgcgattg     87300
     gatgttggct gtagtggatg gacggacggt gaagctctac cgggatactc gggggatttc     87360
     gtcatcgcat gctgatatac atcaatcagt ttcccctggc tgggtctcgg aactatgcga     87420
     tgacgacact gttctgggag gctggattgc gacggtctga gctggtgaac tgcgatgtct     87480
     gccattttga cctggagcag aaacggttgt ccattttagg gaagggacgg aatgaatgag     87540
     agtggattga tctgacggtg agcggcgttc aggggatttt caggtggttg gagctacgag     87600
     gggaatgtgc ccctactgat ccattattta tatcgttgga tcgggtgata gggagtcgta     87660
     gttatcggtg acatcgttat gtcgaatagt ccgggcttcg gctaagaaga tgggggtaag     87720
     tgaagatttt ggcccccata atagtggcac aaccacatat ttagaaatga cgggtgggga     87780
     tttgagaggt acccaggcat actctcggca tgccaagctc aagtggatca acgaaccatt     87840
     caggttcctg tattttctag gaagggggag aagactggag ctgaccaacg taaaggcagg     87900
     ctgttttcta cacaataccc tttcgtcagg tgaaaatgca ttaaccgctc tgcaccttca     87960
     aattcagcaa tttcagaacc ttcccaaatc acgtttgcag cacctgttaa gtagagcaga     88020
     tctccttgag taaaatctat aaatagcagt cctgctctgg gatttacctg taggtttcca     88080
     aaggtattgt agtgccgatt accagcaaaa tctggaaccg tcagggtatg accaccatcg     88140
     attcgaataa atcctggttt acctccacga tgagaaacat cgacaccact cgctgctcca     88200
     gctgcatctg cctgataagc cgtggcgata aaaaaggtat ccgctgatgt aatcagagtc     88260
     ttttcttttt ctgataaaac agaaacctca ttgattgttc tgggcgctct tgaatcaaat     88320
     tcacccagtt cagacgtgcg agcttgaata tattgagggc aattgccaaa gctctgccta     88380
     acttgtactt caaagccctc tctatgagtt tttgtgacaa caccattcag ccgatttcga     88440
     cgacgggtat gtagctcaat ccctaaaaag ccaatgtcaa tgcccaatgc cagcgtcatg     88500
     gctaagggat cgccgggtaa gggcgaagca ttcacgttta gagtatatcg atcgggtgta     88560
     gagagaaagc caggctctcc aactagaata gacgcccagg ggttgcccat tgcatctact     88620
     gtaccaacgg tcacataagg taattgcgca aagaatcgac gaaattgttc gggcagatat     88680
     tctcgaatga ttcgtcggcc ttgcttatca atctgtgttt gcacattcaa acgcgattga     88740
     atcgctaatt caccttcatg gaaaggggat tcagtttttg tccagcctgg gattaccata     88800
     gtaactttcc ctctttttag ggggtataaa tcgacctata gacctggcat agagataaaa     88860
     ccgggaagct gtttcacctg ctcgatccag ttcaaaatat ggggataggc atccaggtca     88920
     attttgccat cccttgacag agcaacatag ggaaagacag caacatcagc aatggttgga     88980
     cgctcaaatt ctaaccaggt acgggtgctt aagtgctgat ttaagtaagt cagaacatgc     89040
     tcagattttt gataggtgcg ttccacgttg atgttactaa cgccgaaaaa gtgataaagt     89100
     cgagcacttt caggaccctg acgtacttct cctgcagttg taaataacca attgatcact     89160
     tgaaccatag gcagggtttc tgtaggaagc cactgttcac ccccatattg ttttgctagg     89220
     tataccaaga tagattgggc atcagtcagc ctagtctcac catccacgag cgctgggact     89280
     tgccctaatg gattgacggc taaatactct ggagatttat gttctccatt cactaggtcc     89340
     atctctttcc agtcataatc aactttcaat agttccagaa gcaatcgcac cttgtagctg     89400
     ttgccagaca gatgaaaacc gtaagcctta accattttga gcttctcctt ttttgatttc     89460
     tgttttagtt ttttcccagg gacaataaaa gtttgtgacc aatggaattg caaagcctaa     89520
     tccaattgag aacccgcaag gcttcattaa accagcacct cagtagagcc caatagctta     89580
     tccaaagcgc cctgtcgctc taatgcgtaa aggtcatcac taccaccgat gtgttggtcg     89640
     ttgatgaaaa tctgggggac agaacggcga ccattcgttc cacgggcgac catttgatct     89700
     cgggccgctt cgtcaccatc aatttggtat tcagtgtagg ttgcgccttt ttgatctagg     89760
     agttgtttgg cgcgacgaca aaacggacag gtactccagg tgtaaatttc aatattggcc     89820
     atgatgaata tctcctgtta ggttggcgag attgagtacg ctcttatgca gcagtgcgac     89880
     gggtgccttc ggcgcggcgg atgtcacgcc agatttgagt agccgcgttt gctccatcag     89940
     cagcggcaat gacgacttga ttcataccga ccttgagatc gccaacggca aagatacgag     90000
     gatgggatgt acggttcatg gaatctgtga ccaggttgcc accgttatat tccaactcaa     90060
     tgcctttgag atagtcagcg tggtaattgg accccattga gatgagacca gcatcaagtt     90120
     ctacgacgga actatcatcc agctcaacac ccgacatttg atggttttca ccgaggaact     90180
     gacggatggg ccgttcattt aaggtgtagc ctgcttcggt gaagcgctct cgcatctcat     90240
     gccccacttc aaataaacca tttgtgaata gggtgatatg tggagtgaac caacccagcg     90300
     ggaaagcaac ttgtagacta ccttcactgc tgccaaagac accaactcgc tggtcgcgca     90360
     tttcgtagcc gtcacaaatc agacagacat gtaagttgtg tccagcgtag tcaaacacgt     90420
     ttttcatgtc ggcgagctga ggcagatggt caatgatgcc actgcctgcg atcagatagc     90480
     gactgtgaaa aacttcatag gtcggatttt ttcgaccgat acggactttc acagcaaagg     90540
     tttcgccttc atcgataatc tcttccacat aggcgttcaa ataatcaccc tctagagaga     90600
     gaaagtgttc tttaccttgc ttaaggactt ctcgaccggg cgtgtctgga ggcaaaccca     90660
     agtaattgtg aagttcctgc atccaaaatg agcgagcttt acctttatcg ataatcaatg     90720
     tggagagtaa gtaacgctga agataaatac ccgctgacaa gccagcagca ccaccaccaa     90780
     ctaccaaaac atcgtagatt tggtcggtgt gttgattaac agtttgtctc gtcaattgca     90840
     tctgaacctc ccaaaaatca aagcttatag attgcatcag tcccacaagg agaagcgtcc     90900
     aagtaaagac actctagatt tttatgtaga acgctctgtc tacttgtatt atttagacag     90960
     gtctgtatat tgtcaagtct ttttttaagt tcttggcaaa tgcgtttaag gtctgaggtg     91020
     gaaagagatt agccgctgct ccagagaaaa gcttgaatgg tagctatctc ctcgttactt     91080
     gctacttggt ggataactga aataatattt agacaggtct gtatatatct gaagtatgac     91140
     tcgcccaaaa tcgcctcgtt cctcagtccg agatcggatt cttgatacgg cttctgagct     91200
     gttctatcaa gaaggtacgc aaaatgtagg cattgaccgc attattgctg agtcgggtgt     91260
     ggctaaaatg tcgctatata accacttcaa gtccaaagat gctctgatag cggcgtggct     91320
     gcagcagaga gatgagagct ggcgggcttg gtttcaagag agagtcgagg ctcgtgcggt     91380
     ggaaccttgc gatcgcatcc ttgccatttt tgatgtgctg gcagagtggt tcaaacagcc     91440
     cgattttcga ggatgtgctt ttataaactc cactgtagag ctggttgacc cggagcatcc     91500
     agggtatcaa gtggcgattg agcacaaacg tgcgacctct ggctatattc ttggattagt     91560
     cactatggcc gagctaaaga acccagaagt gctgacccag caattattaa ttttgatcga     91620
     aggggcgatt gtggtgtcta tgatgcaggg gaacgccgat gctgctcagc aagcaaaaca     91680
     ggtagctgct accctacttt aagtgtgctg tcgggatgtg tcgcaaatag tgtttccgag     91740
     tacaaggaga ggatggaatc gagagtgatt aaaaccaggg gagcattgat ataacgtact     91800
     tagaatgaat ctgtcagaag tgattagcca aatccctgaa aatagcgact gataccccaa     91860
     attttcctga tctttcttgt taagcagact ggaatatttc ttccagttca ctcacgcctt     91920
     tcataaagaa ctgccaattg tattcgagta atttggccag tagaattagc gaaagctagt     91980
     gagaagcctg gcgtttagat tctccaacaa agaactggct ctgggtgtct gtttcatcgc     92040
     attttgaatc gcctcataga gttgtaaaga cttccaactc agtctctaat gcagatcacc     92100
     ccagctcctc cagtaaactt tggatgtcgc ctgtttacgg aaaaagcgca ccatctgcct     92160
     aacgagaaac aaaagctgca cttcagaagc cttaatcaaa caaccgagaa tggggagaat     92220
     tactgggaat acctggttct ttgtcgagat caaaattaat cacttgccag cggggatctt     92280
     gctcgggatc agggccaaat tctatgggta gaccatataa actggggtgt ccagataggg     92340
     ttttatcaga ccagggggaa tgctctagaa aagtgttaat caacgtacga tagcgccggg     92400
     cgatgatgac cttggtcgcc cgatatcctt cgttatagag ccgatccaac gcttcatgaa     92460
     tttcgaaacg aatgccatct ggatgggtat gttggcgata ccattgccct tcccataatc     92520
     gccaatggcg tccagattgt aagtgcacta aatcttcagt attgggatcg gcttcaaatg     92580
     caccgtgacg ttggcaaaga taggtatccg ttaaggtcaa agctgacatc atttgtcggc     92640
     aatgggggca gggcgtctca ggcccaaaaa tcggatagtg catgctgaca tgtgtcatga     92700
     agtcagggag agccgaagaa cgtgggttgc cgcaaaggtg gcatcataat aaccttcaaa     92760
     gagctggcgt ttttgatcaa taatcaggtc aaatttatct tgaaaaatag agtgttcttg     92820
     cttcagaaat aattaaatac ctgctgttat gaagccaaag agatttaggc ttgcctaatc     92880
     cccttttttc aggctgaaac ctcaacttca atgcaattct gacacagacc aaatacttct     92940
     agagtgtggt aaaaaacttg aaattcctgt gtttgcgcta gttcctgctc taacttgtgg     93000
     actggacagt tcattaaggg catggaagtg ccacagttga cacaggtgag gtgatgtcga     93060
     tggactgagg caagactata aaccgcttct ccatttggta aagaacgcat ttgaactttt     93120
     ccacacttct gaaggacctt aagggcacgg taaaccgttg ccaatcccac tctttgttgc     93180
     tgcttaccaa attcttgatg cagatcttgg gcagagaatt cttgaggagt ggaaaagagg     93240
     acttccaaca cgcgccgctg atggggagtt agtttctctg gcatactcac cttcttatta     93300
     cgtcttgaac gagaacagtg tgattgcaga tctcaagagt tatcagaatg attatcatta     93360
     tcatttcata atagcggctc tactcgagaa accgtcaata tttcgctcca accctcactt     93420
     ctgggaagtc tcgtcagtta atgctgtatc aaacatctcg taagcgaggc aacccgttga     93480
     gctttgcccg taatctcttt accgattacg acgatagagt gctgggctgg tggggtatgc     93540
     aggggcatgg cggacgttga gcaatctaga atcttttcag tagatacagg atttagcaga     93600
     tacagtcgtt gtcgcaacaa gacaggtcat cgagaaacat gccttgctgg cggtagattt     93660
     ctagaggtgc agggtcaagg tctaaccgac gtgcgatcgc atcagccact accgcaaacc     93720
     gctggcgaaa tttatagata aagcaaaaaa taacatcgtg atgacggact gaggggccaa     93780
     ccacaaatag acctggcgtc agcgtagact catcttgatc attcaacatg gcataaccct     93840
     ccgaccaatc gaacagcgat gcaatctgtt gcaagctggt ctcaaaacca gtacagagaa     93900
     tcgggggatg agccgtcagc catttatggt attcgctgaa gacagcatag ccctctgaca     93960
     cttttttgac ttcctcaatg gagacattgc caatcagttc gagacggccc gtttgaacgg     94020
     ctagctttac gcgctgcact gtatagggag acaacgcaat actcggatca gtatccgggt     94080
     tgtcccaagc cccagtccga tctaaaaccc tgacgctctt ccctaaggcg actaggttgg     94140
     tcgcggcatc cataccactt tcatagccgc cgatgatcgt aaattcatcc cctggtaaat     94200
     ttttccaaga gcgaatctga gaattgtgaa tacaatggtc tgctcccaca aatggattta     94260
     accttgggta ttggaattct ccagcagccc agatcacaaa ctgggttttg atgtctccac     94320
     cagacgtctt gaggataaag ccacgacact gagaaagggg ttcaatatcc aaaacgtctg     94380
     tttctgtctt cacaggcaac tggaagtgat tggccaccgt ttgcaagtag agggcatact     94440
     gctggccatt gatatgttct cggcgaaagg cgaccgctgg cgatgttttc agggtaatgg     94500
     cattgagatc aagtaggcca aaaccatgac tcggaaacga gggggtgatt aagttcatct     94560
     ctgctggcca gcgactaaag gaggctccga cctgctgccg ttccaacagg ataaagtttt     94620
     tcaggcccag atcttgaagc gcgaccgcac aacctacccc ggctggccct gccccgacta     94680
     tcaccacgtc ataggaagaa gttgtctctt tcatggatag acttgctgcc agcaggattt     94740
     taatataatg attatcatta tcataatttt ttagaatcag ccaacgcccc catcccatct     94800
     gatacagaac ggataagcat aagctggtgg actaaattct agggaaagtc catagagccg     94860
     agatttagca tagtaaatct gtcaccatca gtcagattgg gactctaaat ggggctggac     94920
     tagcgcttca tatcgctgag caaggataag gttgatcgct caaacaccct gttaatgcag     94980
     gcgatcagca attacagaga gcaaaaaatc cgctattctt ttctcaataa aatcttcttg     95040
     ttgctaaagc atccatgtat agttagactt tcaataagct tatgttcttg agaaaagact     95100
     atgtacgacg ctaactcgct caaagcggaa ctgaacgatc gaggttggcg cctcacccct     95160
     cagcgggaaa ccattcttaa tgtgtttata gacctcgaaa aaggcaaaca tttgagtgcc     95220
     gaagatttag atactctcct gcaagaacag ggtaagccca ttagtttatc gaccatttat     95280
     cgaacggtga aattaatggc tcgcatgggg attttgcgag agttagaatt agctgaaggt     95340
     cataaacact atgaactgaa tcagccctat ccccaccatc atcaccatct aatttgtgtt     95400
     aaatgcaatg aaaccattga gtttaaaagt gatgctgttc tgaaaatcgg ttccaagaca     95460
     gccaagaaat taggatttca tctgttagat tgtcaattat caattcatgc catctgtcct     95520
     caatgttagc ggtccttact acccatctga atcaagggct tgtcaatggt gaattaagtc     95580
     tgggaaaaat tgcgaaaagt tctgggcaaa tcattggtaa tgggtcatca ctctgcgatt     95640
     gcaggatata agattaacgg ggtatctaaa cgctttttgc ctttattcgg ggtggcagcg     95700
     attgcaatat ccaccataca gcgtgatctc ataatgagtg acctgtaacc cagggcgaag     95760
     cgccttaaga tctaaatcct gaagctgatc ccaggcaata tcctcaatcg ctccacaaga     95820
     ctgacatcgg aagtgatggt gaggttcgat attggcatca taacgacaaa caccttcttc     95880
     taagagaacc tctcgaacaa gccccacttc gcgtaaggcc tggagtgagg agtagaccgt     95940
     tgcctgagaa gaggtaggtc catcttgatt cagatgattc gtaatttgct ccgcagttgg     96000
     gtggtctgag cgagctagta agtctgcata gactgcaaaa cgctggggtg tgactcgcag     96060
     gcctttcgct tttaaagttt ggataatttt atctgcttgt tgttgcatct ataagtacct     96120
     acagaaaagt gctagccatc tctaagaagg aacatctggg gtcaaaaaat agctatgtga     96180
     agcctagtat ccataactgt aagtatccat atctaaatat taatcaaaaa tcaaagtaat     96240
     aaatgctacc taataacttc tagacaagat ttattctgag aaatgcctgt gatagaacaa     96300
     cacggcttgg atcaaaaaat aaaaactttc caataaattg ccgttctcag gaaagttttt     96360
     ggaaattttc caaggatgct tactagatat agctttcaac gatcacgtgg tacttggatg     96420
     cagattcgcg atctttaagc ctaaacgaga gggctatcat gctccatcta ctgattactg     96480
     ggccaacgaa tggttacaga cagtgacttt taggctgctc cacgaaattc aaaagaataa     96540
     aatgatacga tgtatcatat catttgtttt caatattcaa tcagttggcc aaaccaaaga     96600
     cgaaccatat tgaaatgtaa tagaaatcaa tgagacatac aaacaaactc cccgtcaccg     96660
     tactttcagg tttccttggg gccggtaaaa ccaccgtgct gagccacatt ctgaacaacc     96720
     gggaaggcaa gaaggtcgcc gtaattgtca atgatatgag tgaaatcaac attgattcgg     96780
     cgatagtaca aagtgaagtt tctctcaacc gcagcgagga aaagcttgtt gaaatgagta     96840
     atggctgcat ttgttgcacc ttacgggaag atttgcttga ggaagttaac aagcttgcac     96900
     gggagggtcg ctttgattat ttagtaattg aatccactgg tatttctgaa cctttacctg     96960
     tagctgaaac ttttaccttt acggatgaag atggcgcttc gctttctgat gttgccgatc     97020
     tagacacaat ggtgaccgtg gtcgatgcag tcaattttct ggaggactat gaaaaggcgc     97080
     gatccttaaa ggatacgggt gaatctttgg gtgaagaaga tgaacgcagt gtcgccgatt     97140
     tgctggtcga tcaagtggag tttgccgacg tcattctcat aagcaaaacc gacttggtgc     97200
     tcccttctga tatcgagcgc ttaacagcca ttcttaaaac gctgaatacg cacgcgaaaa     97260
     tagtaccgat tgctcaaggc caagttaata ttgatcatgt gcttagcacc ggattattcg     97320
     atttcgagcg cgcacaacaa gcggctggtt ggctcaagga gatgcgaggt gagcatgtcc     97380
     ctgaaaccga agaatacggc ataggcagtt ttagctacgt tgcgcgacga cctttccatc     97440
     cagaaaagtt ttaccagttt ctgtccagta gagacaaata cggtaagtta atccgttcta     97500
     aagggtactt ctggctagct tcgcgccctc agtttgcggg tcactggagt caggctggag     97560
     gcatagctcg ccacggtgtc gcagggatgt tctggaaagc cgtacccaag gaaaactggc     97620
     cacaagacga agaatatctc gccgcaatta aaaagcaatg ggtagagcct tttggtgata     97680
     tgcgtcagga actagttttt atcggccagg gtttggataa agaacgcatc acacaagcgc     97740
     ttgatgaatg tctattaagc gaggaagaaa ttgtgcgggg ccacacttat tggaaatcat     97800
     taaacgaccc atttcctgag tggggtcaca gcgcatgagt tcactaatat gaattactca     97860
     cttttaacag atgtaatgaa ctcagaagaa catgatgaaa gtgcccacag cgaaatatct     97920
     gcgagctagt gctttagctg taaaggcctt aaagattgac ttgtgtaatg gccctattta     97980
     ttgaagttcc ccggagtaaa aaagcgatgt gctgtgggca acagaaatca agcagagcat     98040
     ggtgacgttg gcctctacta aaaatgcaat ttcgttgaga taaagaatgg atgctattca     98100
     acgggttatc gatcacgcag agcgacgctg taaagaaaac ggctcgcgtt tcactaaaaa     98160
     aagaaaacta gcgctatcac tgttacttaa atcgggcaaa gcactctctg cttatgagtt     98220
     agtggaggct tataaaactg aattgggtga caccatgcct gccatgtcta tgtatcgaat     98280
     tttagagttt ttaatggcag agaacttggt gcatcgcctt gatctgatca ataagtatgt     98340
     cgcttgcgaa cacataaagt gcgaacacga acatgctcag acgcaatttt taatctgcgg     98400
     tcagtgccaa aaagttaagg aagtcgcgat aagcgcacca attatggatt tgctaaagaa     98460
     aaacactagc gatgcaggct ttcatcttgc gagtccacaa ttagaaataa actgtatatg     98520
     ccaagattgt atgtcaacag aattgagagc ctacagtgtg gggaggtatt gattttcatg     98580
     ggagctacat gtcgataatt attaccgaaa ggatatttgt cgtgttggca ggtgacggct     98640
     gagtaagtct gcattagcct tgagttttcg cataacctaa agcattcgtg gatacacggt     98700
     tttttagctt cacatttagt taaatttata gcgtttttat ctcatgggga atgacttatc     98760
     caagcgagat ttgctcgtta gaaacaactt ttctccttca aacgaaaaac ttattaagag     98820
     tggttatgta gatcaaacac gcttgcgtga ggcgatttat gagagtcggc ggaaaggtcg     98880
     ctctctgttg gcgattctcc aaaaaatgac ggggaagccc ctcccacctc ggttgcttcg     98940
     gcagatcaag cgtcagcaac tctttgagtt aaaaatcctc tatggcctag agtgtctgga     99000
     tcctgagctt actcaagttg acttcgatga aattgatcgg ctgattcgca ccgttattcc     99060
     cctcgactac tgccgtcgct atcagttgtt accactttca ctcaatgaag aagaggatcc     99120
     gccagttgtt cggatcggta tggtcaatcc cgatcacctc agcgccattg atgatattgg     99180
     ctacttattg cgctccaatg gcatgacctt ccaacgggtc gtcctggatt tggatactta     99240
     ccaaatgttg atcgccaagt ttttggacgc tcaagccaaa cgccaagcca cgatccaaga     99300
     gaatttgccc gttgagtatg ggctggaaga tgatctcgat cgcttaggcg gcattgaaga     99360
     tctggccacc aatgatgccg acaccaactt agatgaagca ctgctagacg aaaatgcagc     99420
     acccatcatt tctttggtca ataagatttt agcgaaggcc ttgcagaacc agatttcaga     99480
     tattcatatt gaaccgcaag aagaaaacct gcgagttcgc tttcggaaag acggcctcct     99540
     ccataacgcc ttccaacctc ttccacggcg aattacgcct gccctggtct ctcgatttaa     99600
     aatcattgcc aatttagata ttgcggaacg gcgtctgccc caggatggac gtattcttcg     99660
     actgtttcaa ggacgtaaag ttgactttcg tgtcagcacc ttgccgagtc gctatggcga     99720
     gaaagtggtg ttgcggatct tagacaactc ttccatgcag ctgggtctcg acaatttgat     99780
     tgatgaccca atgagcctgg agttggtgag gtccatggtc gatcgtcctt ttggtctaat     99840
     tttagtcacg ggtccaacgg gttctggtaa aacgaccact ttgtattcgg ctttgacgga     99900
     acggaatacc cccgaagtta atatctgtac cgttgaagat ccgattgaat atacgttgcc     99960
     agggattacc caggtgcagg tgctgcgaga aaaaggcatg gactttgcct cgatcctgcg    100020
     agcctttctg cggcaagacc ctgatgtcct actcgtgggt gagacacggg acaaggaaac    100080
     cgccaaaact gctattgaag ccgcgctcac ggggcacttg gtgttaacca ctttgcacac    100140
     gaatgatgcg gctagtgcca ttgtccgctt ggctgagatg gacgtagaac cctttatggt    100200
     ctccgcctcc ttgctaggag tcgtcgctca gcgactggtg cgacgtctct gtcccgattg    100260
     ccgtattccc tatcgaccgt cccaggagag actggcgcag tttggattag tgacgtctgg    100320
     gaagactgac attactttct ataaagccaa tacatctacc tctgatgata ttctggcgac    100380
     ggctaacact gaagatgcct gtcccacctg ttcaggcatt ggctacttgg ggcggtgcgg    100440
     ggtctatgag gtgatgcagg tgagcgaaaa actcaaggca ctcatcacgg aaggagcccc    100500
     aaccgagcac attaaagaag tggccgtcga agaaggaatg caaaccctat tggcctatag    100560
     cttaaagctg gttgagaatg gtgaaacctc tctagaggaa gttgaacggg tcactttctc    100620
     agatagcggc ttgaaaacag aattaaaggc caaacgcaag acagccctca actgccacgt    100680
     ctgtaatgcc gcgctgttac cagagtggtt ggattgtccc tactgcctca ccccccgatt    100740
     tactgagcag catcctgtga atcagcatta agccagcccg agttgcagcc gcctatatca    100800
     agttatgaac tgtgagtttg acccatttgc aatttctaac ggaacgctct ccaccaggta    100860
     tgggtggagt tgcccgcagt acagggcgaa ttgtagcgtc tttcccatgt tggagggact    100920
     gcctcaggtg tctccttttc ataacggttg gagacactat ctctttctag ctggttcttt    100980
     agaaattgaa gaaatcagtg tcaatcccat gcctctatag cgtagggtgg ttcttttata    101040
     gcgatccaat ttaattcgtg aaaatatttt ggagtgaatc tactggttag caaggatttg    101100
     agcctcagta tacttagaac aaatcaaacc agattgctat atgttagaac tgaccacaat    101160
     caagcaaaca gccctcgatt atctcttgtc ccatctggaa gtatttccag aacattgtca    101220
     attgtttgag gtcgttggtg caacttgttt tgataatcac gagtggatga tcaacattag    101280
     tgtagtcggt ttagttggta aatattggaa tgtctttgtt gatggcaaca cgggaaaaat    101340
     ttcacaagac tgcgagtttt atacagattg cccagacttg aataagcccc atcaatatgc    101400
     ccatctgcca gactatttaa atcaactgct cgatcgccag actgcaaaag tttctaagta    101460
     aatgaaacac aaacaataat ctcctgggtg cgccaatatg tcgacaccaa aagctctccc    101520
     tacagtaacc cctatatcca aagcggcttc ttttgttgaa gtcctcgttg attgtcctgg    101580
     cactgataag ctttttactt accgtattcc ttctgatctc aatatttgcc ctggggatat    101640
     tctcaacgtt ccctttggtg cacaacaagt gggggcaatc gccatgcgtt gcttgtcgga    101700
     tcttccgcca gaactaacca ctactagaat tttgagtgtc gtggatgtgg tctgtcgtaa    101760
     tttatttcca ccgggatatt ggcagatttt agaaaaagtc gccgcctact atcaaacgtc    101820
     gttgatggcc gtcattcgag tagccttgcc accgggtttg ttgcagcgat ctcaacgccg    101880
     cattcgtttg cacacttcca tcaattccgt tgatgtccac ggtttaggaa cagctgccca    101940
     agacatttta acgctcctgc aacaaagtcc aacccaagac tatacctggc aataccttcg    102000
     tcgtcaggtc aaaaaagccc aggtcggctt aagagagctc caacagcgag atctggttaa    102060
     aagctacctc caaactcaag cgccaaccca gcctaaacag caacaggcgg tcaccctcac    102120
     gacccccaac gtaccgggct tgacgaagcg tcaacaggaa attctgaccc ttctcaaaca    102180
     tgaaggtggg gagttatggg cacaagatct gttgagactt gcccatacga gtagcagcac    102240
     cctcaagaaa ttagctagta aaggctgtat caccctgcag caacaggaac gactacggtt    102300
     ggaaacctct ccgattcagc cagatcaacc tcaaatgcta acccccgacc aagccaaggt    102360
     cctgtctcaa cttgatcggc tgcaaggtta cgctgaggtc ttactgcatg gcgtcacggg    102420
     ttccggtaaa acagaagtct atttgcaggc cattacacct gttttagctc gccagcagtc    102480
     ggtgattgtc ctggtgccag aaattgggct tacgccgcaa ctgacggatc ggtttcggtc    102540
     tcgatttggc gatcgcattc gggtctatca cagtgccctt tcagatggag aacggtatga    102600
     tacctggcgg caattcctca ctagcactcc ccaagtcgtc attggcaccc ggtcagcaat    102660
     cttcgcacca gtagccaata tgggactgat cgttctagat gaagaacatg ataccggcta    102720
     caaacaggat cagccagccc cttgttatca tgctcgcacc gttgctcggt ggcgcgccca    102780
     acaggaagac tgtcccctta tcctcggttc agcaacgcct tgcctagaga gttggtccca    102840
     aacacggcga tgtgagcctc atctatcaca gagcaaggtt cattaccttc aactccctca    102900
     gcgagtcaat gctcgcccca tgccccccat cgaaatagtg gatatgcgcc tggagttggc    102960
     caatcgcaat cattccatct tcagtcgact attgaaaaaa cgcttgcaag aactgcagca    103020
     gaagcatcag caagggctat tatttaggct ctccgggaat tagcgtggta gccgctagat    103080
     atagtgttta ggtcacagcg aatgtctgat acccattgag gtcaagagaa atcctttgga    103140
     agagtctttc aatatcgaaa ataccgtagc atcgtctttt taagactttg actcggttat    103200
     taaatccttc cacaaaacca ctggtccacc cctccaggaa atagttggtc atctcgtcca    103260
     tccaattatt gatagtggtc agaaaacaat cgaattcctt gatgtcactc ttgagtactt    103320
     gtttacacca agcacggatg gcacatttag ctccgtgctt ggtgtacctg ccctcaaata    103380
     tctgcgtgag tttctctcgg aggttgtacg cctgtttcag ttgtggagaa taagcaaaca    103440
     atcgctcaag gagttgttgc tctgactctt tcagattctc tggtcgtttt ctaaaaggcc    103500
     acatcgcgcc tttgatgctg tcatactctt gcttagagag ctctcgtcgt agacgtttga    103560
     cctcacgttt acgaaccgta tcagcacaat tacgataggc tttggtcaca tgaaagcggt    103620
     caatgacaat tttggcttgc ggcaattgtt ctcggactgc actgacaaat ccttggtaca    103680
     tgtccgtaca gacgcgctca atggtttggc gtaaatcaat gggaatcgat tgaaggaaat    103740
     ttgccactgt ctgctgttta cggtcggcta gaactgccaa tatatccacc ccatccgtcg    103800
     taggaatcgt gatcaaaacc acaaaatcac gatggcctcg tttgagagaa atctcatcca    103860
     tccccataac tttgaggtct gcatattcgc tccagtcaac ttgagcggca atccaacgat    103920
     caatgattcc actgacgata tcctcactaa cgcctagttt tctggcaaca tctgagaccg    103980
     ttgaattgat caagattcgc agaagccaac gctcatatgc ttttgtattg ggactgcgag    104040
     gttcgtgcca ttctaaatgt tgagttgttg tgggatggtc atcgcaatac ttgcatcgat    104100
     aacgcttggg ccgaatttct aagtaaacgg ggacttcaaa taatggcagg tgacgaatcc    104160
     gaaaaggctg atcatgacaa tggaggtcag taatctcacg tccgcattga tgacaggttg    104220
     ttccttgaag cgtactctca atcttgatga gccaatcccc tctctcagtc ttcgatagct    104280
     ctagaactcg aatatcagga aggttgagcg ggatgcgaat tgagttatcc attacgccat    104340
     tgctctgaag tactacctca gatcattcca tagggatgaa aaaggaaaca cactaaatgt    104400
     aggactgcta cacgctaatt cccagagagc cattatttat gcctcgtcga ggccatagca    104460
     cttttgtctc ttgccgcagt tgtggttatg tcgctgaatg tcctcactgc agcatttcta    104520
     tgacctacca ccatagccct gattcccgtc aaactctgtt gcgatgccat tattgcaact    104580
     acactcagcc ccaaccgcaa gcttgtcctg tctgcaagtc ctcttacttc cgattttttg    104640
     gaagtgggac ccagcgagtc atgcaggaat tagacaaaac gtttcccgaa ttgcgagtga    104700
     ttcgctttga tagtgacacc actcgtcgga aaggagccca tcgtcagctt ctaaatcagt    104760
     ttgcccgtgg ccaggcagac ctaatggttg gtacacaaat gctcactaaa ggaattgatt    104820
     taccccaagt tcaattaatt ggcgttttgg ctgcagatag cttactcaat attcccgatt    104880
     ttcgggccag tgaacgcacc tttcagaccc tgctacaagt ggcaggacgc gcaggtcgtg    104940
     gggagcatcc tggccaagta atcctacaaa cctatgctcc ggaacacccc gtcattcagg    105000
     ccgttcaaca atattcaatg aatacctttc tcatcaatga actcaagcag cgccgggaag    105060
     ccaattatcc gcccttccaa caactaatcc tcctacgcat cagtggtctc aatgaaacga    105120
     tggttgagaa tactgcccta gatattgcca attacctaaa ggcttatatc caattacatc    105180
     gctatgaggg cagtattctc ggtcctgctc ccgctagtat tttgagagta gcccgacgat    105240
     attattggca tgtgttagtt aaacgccccc aggctaaact gggccagtct gaacactggc    105300
     cgtttcccag acaagaatgc caacaacggt gtccacaaaa tttacgtctt caaattgatg    105360
     tcgatccttt gaagctcctc taatcccatc cattcagatc aatacaaaag cgggcttagt    105420
     tcaaattatg aactgcatcg acaacccgta tgtccacaac ccgagcctga gggatgtcca    105480
     tctgcacagg cttggccaca aaaatactga ccgccttttt gaatcgcatc actaatcgtc    105540
     acgatgcaaa gacaagactc gcaagcacat ttcatttgag taacggttgc cattgcaaac    105600
     ctccataact aaatatatga acaatcattc atgcttcaca gcctaacata tgaataactg    105660
     ctcaagtatt aaaatgtcat tagtaatgta tgcagaaagc catctagagt tgattatctt    105720
     agggtcaagc caccttcagt catgttatgt cgcactctca ccttgatatc agcactcatt    105780
     ccttgtcgga gaaaccccgg tcagagaagc cggtggtcga tcaaattttg tcttttgaaa    105840
     aggcacagcg gatggctgaa tttttaggcg tattgagcga ccctaatcgt tggagaatct    105900
     tatcggctct tgccattgaa gaaatgcggg tgggagagtt agcggcagca gttgagatgt    105960
     cagaatcagc cgtgtcccat caactgagag tcctcaggaa tacacgaatg gttcgccgcc    106020
     gtaaatgtgg acgaaccgtg atttacggat taaaagacca ccatattttt aatctttacc    106080
     gagatgtctc agaacatttg gacgaggcgg actattgaac ttcgagaaca attggggtag    106140
     aacaaggatt gcttaaatga agggtcatag aatcccaaac aacatcttaa ggtcctgtcc    106200
     aatgtttgtg tattgacaga ttagcccctt gagagcttta ctcacttctc aaacagcctc    106260
     taagttgaga ctgactttct gcctgtaaaa aatccgtgga ctgccatttt ttaagctcgg    106320
     ggcatacttc ttgctacgct gtctaggtct ccctctaaaa atttggatct acaggtaaat    106380
     cgctgaatct ttccactaga agttttgggg atactaccgg gcttgagcag ccaaagggca    106440
     tggatgtgca aatcatgctc tttggcaacc gcccgacgaa tttgagtgag tatatctttt    106500
     tcgacggtag taggttctga atcggcagtt aaggatgtgg gcgagacaaa atcattgagc    106560
     tgaggaggct gagaggatgg cttcttaccg tttttccgat agcgattgat atagtttctt    106620
     tccagttctg ccaccactat tagccgctct tcccccgctt cagtaatcga aaatgcagcg    106680
     gcacaattgg ggcgaatacc gggatagctt tgaaccacag tccactcaat atcctgagga    106740
     taatgattac ggccattgac aataatcacg tccttgaggc ggccggtgac ataaagttca    106800
     gagccgacca aaaagccata gtcccctgtt cttaaaaagg ggcctgcgcc tgtatctgcc    106860
     aaatgggcct gaaaggtttc ctcagataca tctgattgtc cccaataccc ttgagcaata    106920
     ctttccccag acacccaaat ctcgccgact tcttctgacg agcattgctg cagagtttca    106980
     ggattagcga tcacgatttc ttggtcttga agggaagtgc cgcagcccac tagggtgcgg    107040
     gcattgacat cattggcctg ggccgagacc acatgatgct gttctaaggc agtcccttgg    107100
     accgttttga gggcgggttg ggcatccggt tggcccccgg ccacgattag agtggcttcg    107160
     gcaagaccat aacaaggaaa aaaggcttct gaccgaaatc cataaggagc aaatttagtg    107220
     gcaaagtctt caagggtctg ggcactgatg ggttctgctc cattaaaggc cacccgccag    107280
     gaactcagat ccagtccttg gagctgttcc ggctttattt ttcgcaagca taaatcatag    107340
     gcgaaattgg gtccgccgct ggtggttcct tgatagcggg aaatggcttg gagccagcga    107400
     atggggctct ggaaaaacat aaatggggac atcagaacca tgggaaatcc cccgtataaa    107460
     ggctgcaaaa tcccgccaat tagacccata tcatggtagg gcggtagcca aatcaccgct    107520
     aggctctggg aactatgctc aaagcattga tgaatcaagg ataaattctt taaaagattg    107580
     tgatgagtaa tcatcacccc tttgggcgtt gcggttgaac cagaggtgta ttgaagaaag    107640
     gctaaatctt gcccctgagg atgagtctct tgccaggctt ggcggggttc cgtaacgctg    107700
     aggctatctg ttgctagcca cttaagcgct ctcaattctg gagtatcaat cagccgtcgc    107760
     tctaatttcg acagaatttg agaggtggta agggcaaaaa tggcttggga atccgcgatg    107820
     acgctctgca aacgcatcaa ggagcgattc gggcgggggg gatagatggg aactgccgta    107880
     acgcctgcat agaggcagcc aaagaaggca gccacatact ctaacccagg ctgatagacc    107940
     aatagggctc gatcgccggg gtggcaggct aactgtagtg ctgctgcgat cgcacgggcc    108000
     ttgatatcca actctgcata ggtgaaatgg agggcttctt cctctccatc aaccagaaag    108060
     gtaatccccc tccgatccgg ctggtaagca gctcgataac ggagcaaatc caccaaactt    108120
     tccaccttcg gtggatccga ttcttcgatc ttagtgtccc aatttgttgt tttagccacg    108180
     ttgtactcca tcctgagcaa agaattatag attagttctc gatttgaaca gcccttatag    108240
     gcccaaaaca accaaagctg caacttactg ccgatcaatc aactgatttc gggttttatt    108300
     tcatggttga aatgttctga aacccatacc ctgcagagta tttcatcgac atcaattaaa    108360
     atgactccag tcttttagtt tgacgtttat taggagtgca gatgtcccaa acccaatcta    108420
     atcaatgatt tccaacctac gtgcccctag aacagttcga aacatttgtc ttgtcccacc    108480
     tacacatcgt tagggaagga gtcgtaaggg tcatgggaaa atcctcttcg atgggcaatc    108540
     aacagcaaca catatggcaa aaggaatgcc atgtcaggag cattaagcag aaatcgcttc    108600
     agtaatatga tgggagtcca gtccttggcc gataaacact agttgagtca gacggggttc    108660
     gctagtttgc catagccgat cataaaattg gtcaaagcgt tgccccactc catggagcac    108720
     caaccgcata gctttattgg gaacggcgac gaagcccttg atccgataaa tttcttgctg    108780
     ctgtaccaag acttgcaacc gttcgatcag tgtgttcggg tcaaaggtct gctccaactc    108840
     tacgcagatg gagttgatgt tgtcatcgtg atcatggtct tcttcctgat catgatggct    108900
     ggggcggcta tcgagattat cttctacagc tgcgttgaaa ccgagcagaa tatctgggct    108960
     aatttgaccg tgatggcagg gaacaacttt gacacctgac ggagtctgtt gctgcagcca    109020
     ctgttggatg cggctacatg tatcctcccc ctgtatcaca tcggttttgg ccagtagtac    109080
     catatccgca caggctaatt gatcctcaaa cagttcctct attggggttt catgttctaa    109140
     actgtcatct gcctgtcgct gggtgttcag ggcatccaga ttgctgacga tacgcccctg    109200
     agccagcgca tctccgtcca ccactgtcac caccccatct accgtagctc ccgtgcggat    109260
     ctcaggcctg cgaaacgctt gcaccaaagg cttgggcagg gctaaccccg aggtttcaat    109320
     cacaatgcag tcaatctcat cgcgtcgctt caatagttcc tgcatggtgg gcaaaaactc    109380
     ttcctgaact gtgcagcaga ggcaaccatt ggccagttca acgatattgg ggccagagcc    109440
     gttaggagtc tcctcgtcgt tgcacacctg gcatgacctc agcagttcgc catcaatgcc    109500
     cacttcgcca aactcgttca ctaacacggc aatgcgacgc ccctggttgt tttgcagtag    109560
     atgccgcacc agagtggttt tgcctgaacc gagaaagcca gtgaccacag taacgggaat    109620
     tttgtgcatg gatgagaatc ctttgatgaa aagacaaact ttatttaatt cgatagaagc    109680
     tgaatcatca gcgggtgggg gcatcagtag ggagcggcgg caggataaac gcagtggcct    109740
     ctcgaaccaa gttcggacgt tccgagtagg ggactttacc atcgggagaa gtggcgtatt    109800
     gctggcaaaa tactgcaacc gccttagctc cctctgtcgg tgatatctga ctgaggataa    109860
     aggtcaattt accgggagcg gcaaggctaa cgttgcaagg gtggctgcac cccgccatac    109920
     agcgcaatgg ttctaaccga accgtatctt gtagattgca ggcttcgagt gcctggtgga    109980
     gttggttaat caggtattgg cctcccgaaa taccgtcccg acaggcttca tccttagaga    110040
     atcgacatag tgagcagaca aataatgtgg tttgggtcat gggctgagat tgcatgaggg    110100
     attcaggtca atgaaaaata gttgtagttt ggaaaatcgg gtgccaaggg tttaaacgca    110160
     tcccacccgt tacagaccac ttcgtacgcc agaaaaccac accaagtgtt atgtcctagc    110220
     gttagtgtgt tggtagcgac aaaggcttgt tgccaggtgg ctctggcttc aacagccatc    110280
     tttgcacctc ccgccagagc tgggtgctag agcgaattct gagtggcggc tacgcatttc    110340
     gtgatagcaa tcgggtgggg aaatcgctaa gttctgcaac caattgatat cgacctgccc    110400
     attaccaagg atggcaacaa gaatatcttg acccggttga taggtcatag ccgcctccat    110460
     caaacgatgg acaaaatcca tgtccaggtt atggacctcc agatagtctt ggatctcagc    110520
     cttaggaatg tattggatgc cgtattccac cagatcgata tgccagtcca gagtagagac    110580
     atcaacaacg tccacatcac aagacactag tccccgccac tgggtcaggt agccttgcca    110640
     ggcagcatga ccgatgggga gtaaatattc tcgaataaag gctgactgcc agtagcctga    110700
     atagccctgc cagacgctag tggggggtcg catcgatctc ctcccgtaac tgttgggccg    110760
     ctgctaccct gtttttgggt gacggcatga cttctttaca gcggcgtgtt ttcaaaccac    110820
     agtcaggatt cacccagatt tgctgcatgg gcagattggc aattcctgcc tcaatgtcgc    110880
     gttcggtagt gtgtaagctg ttggtatcta catcaccgcg ccaataagct tccagagctt    110940
     tcttcacttc ccgatgcata cccatgcggg tataggccag ggtcatggtc tttatggtca    111000
     tgcttgtgtt gtcctaagaa ttcatttatt tatgaagcga agggttttag taactttggg    111060
     acctataacc ctatggagtt gcttataaaa ctcaatcgac aaggcttcta agaaatccaa    111120
     cgatccagag tttacgcatg agcggatttg gggaatgtca agtgaggagc acgctctgct    111180
     gacgtgcatt tacctctacc gaatccaccc aggctttcta ccaagaatgg tcgttcttgg    111240
     tagaaagcca cttaatttct ggtcccttat catcaccaaa gctatgtagt gatgctccaa    111300
     tgacaatgca accgtgactt aattaaagct aaatcattca tcatctatac ctcgcagatg    111360
     ttgtgaaagt gagtaatcac tcggcgggcg ttctgactct gaggacaaag cctcatcaca    111420
     gctgcgggac agcgccggat ttacaccgga ctttccccgt ttcctctaac gactgttccc    111480
     cgttagaacc gaatttataa aattgtttct gaatcctacc acaagaatca agttctaagg    111540
     ttggataatt attgagtcaa aaataccatt tctaagtctg ctttaaaggg taggtcatcc    111600
     tcaagattta gccctgtcaa agtctttcaa gtttgacaaa ctgtcttttg acgccctttc    111660
     aagatttcat cagaatgatc gcttaagcct ctagtaaaga ataaaaatct gctttgaaag    111720
     tccatcaatg ctcttttacc tttcaaacat ctctttgttg gatcagcatg ggtctgacta    111780
     tgttgatagg gactaatcct taccacgctg agagtggcaa tactcgcaac acatacttag    111840
     gtaagccaga agttactcac atgcctgcac ccttacccac tgcctttgta tagcttcata    111900
     atgaaacaga ttgacctgaa acagttataa ccaaatccaa gtacagttct tgatcggtct    111960
     gtcgcagcca tttaattgat ttgatttggc cattgtaagg ggaccgcaca atcccctttg    112020
     tattcagttt gttttctatt gtgtggatct cggctatcaa cttagctttc tgcgttgatt    112080
     gattgtgccg aactctattt tgttgcttag cttttgtgag cttagcaatc gcaagggtca    112140
     gctttccttt tgcttcttga tacttccctt ccaatttccc aagctcagtc ttctctgata    112200
     gcggcaacac ccggcgggcg tagtcagtcc agggagagtc tgcatagaaa tttgagatcg    112260
     catctcttgc ctgctccact cttaatcgag ctagtttcac ttcgacctgc tctactgcaa    112320
     aatcggggac aactgtgaaa gtttgggttt gcaagtgctg cagctgctgc cgcagactct    112380
     cacgttcttg cacaagactg gtcctgatta gggaacgctc actcactatc tgcccctttg    112440
     tcactacctc attcaccttc accttaaggt catttggatg atctaaggtt agctgtagtt    112500
     tcaatcgcca aggcatctgt cgttgttgag gcgaggggcg gggcgtagtc gtctttgcca    112560
     cctccgttct aggctcgatg ttctcaacct tgaccggagt ctgagcacac ccgaccagca    112620
     gcaacgctat cgtaaccccc gctctcgctt ccatttggca atcaactttc tgacctttac    112680
     taaaaataca attgcggtga gataaagaat ggatgctatt caacgggtta ttgatcgcgc    112740
     agagcggcgc tgtaaagaaa atagctcgcg tttaactaaa aaaagaaaac tagcgctatc    112800
     actgttactt aaatcgggca aagcactctc tgcttatgaa ttagtggaga cttataaaac    112860
     tgcattgggt gacaccatgc ctgccatgtc tatgtatcga attttagagt ttttaatggc    112920
     agagaactta gtgcatcgcc ttgatctgat caataagtat gttgcttgcg aacatattaa    112980
     gtgcgagcac gcgcatgctc agacgcaatt tttaatctgc ggtcagtgcc aaaaagttaa    113040
     ggaagtcacg ataagcgcat caattatgga tgtgctaaag aaaaacacta gcgatgcagg    113100
     cttccccttg cgagcccaca attagaaatg aactgtatat gcgaggattg tatgtcaaca    113160
     ggatagaaag cttacagtgt gttgtcagtg tcccagtttg tcgttgtgca tgtcgagttt    113220
     gttgctgatt tagtgccgat gccaacgggt agctccatct ggttgatcaa ccactgtaat    113280
     ccccgctgcc gatagttgag cgcgaatatc atctgcagtt ataaagtctc gctgttttcg    113340
     ggctgtttgt cgctgctgaa ttagatcagt tattacagcc tcatctaatt tgccagttgc    113400
     ttcatccgta tcactgttga ctttagcttc taaacccaat acctgggcca gatacaataa    113460
     tgtttgccac tgctgccaga gcagctccgg actggactgg gacttgcctt catgtaccag    113520
     acggttcccc tctctctgca gcgctttggc aagttcaaac agcactgcca gagcccccga    113580
     tgtgttcaga tcatcatcca ttgcggattg aaaccgtttg gtccatgggt cttctgaact    113640
     gggttcctga ggtgaagact ggatgctagc aaatggcgac gacaatgcta ctcggtgacg    113700
     gttgccaaag agaattccgg cttttaacgt ctgccaacta ttgatcgaag ccacgatcgc    113760
     atcttttgta aaatcaagcg gtttcctata gtgcccctgc aacacaaaca gtcgcaccgc    113820
     cattggatct accggctccg gatagtctgc ccaacctcca tctagcaggt cacgaatcgt    113880
     ggtgaaattg cctagggatt tcgacatttt ttccccattc accgttacca tcccattgtg    113940
     cagccagtag cgagcgagcg gctgtccggt cagcacttct gattgagcaa tctcgttttc    114000
     atggtgagga aacactagat caccaccacc tccatgaatg tcaatggttt cgcccaatcg    114060
     cgcccggatc atggccgagc attcgatgtg ccaaccgggt cttcctagtc cccagggcga    114120
     ttcccaggca ggttcaccag gttttgcaga tttccacaag gcaaaatcaa acggatcgcg    114180
     cttcttctgg tcttgagtat catcggcaac tcgtcctcct gcacctacct tcagttgctc    114240
     aagcttacga ccagagagct ttccatactc cgaaaattgc cgcacgctat agtaaacatc    114300
     gccatcgatc gcataagcgt agccttgctg ttctagtgcc tggatcaatt gatgaattgc    114360
     aggaatgtgc tctgtcacac ggggatagtc atcagcatct agaatattga gtcggcgaat    114420
     atcacgaaaa taggcattaa tatagcgatc gctcacctcc tgcatcgtta tgccctctac    114480
     tatggcgcga tggagaatct tgtcgtcaat atctgtaaaa ttctgcacat agcgcactgt    114540
     gtatccacac cactttaaat agcgccgcag cacatcccaa gccatgtacg aacgagcatg    114600
     ccctaaatga caattgtcat ataccgtcac gccacagcaa tacatcacca ctcgttctgg    114660
     gtgaacggag ataaatggct ctttttgatt ggtgagagtg ttgtgaagag taaggttcat    114720
     gcaaaatact tttaactaaa aacactgata ggggcgcaat agggaatctg gtcagaccca    114780
     gtgctatgag aatgattatc atccatacta acggacctat cttcatttct ttagtcatca    114840
     caactgtata gaacctattt gaaatctttt atgaagtaac caactctctg aagccttgct    114900
     gggaaggtgc ggaaaaattt ggctatggcc taaatttaag gctcgttgaa attctcgtta    114960
     aagtggctgc aatcgcagaa atcgaaatca tacaggagga acatttcagg ggagtgacat    115020
     taagccctta gattaccttg atcgctcctg acactgatat ctggttttga tccaagccaa    115080
     gaattgctat attgagaaca tattggaaca aagcttttct catagtgaaa acagcactcg    115140
     tccttactag cactaccaca acaactaccc acataggagg gttgtaaggc gctgcgctga    115200
     aattggtctt actactttag ttgccctcca gacgaactct ggggggcaat gttttttcac    115260
     cacctgtatt cagaaggtca aaaggaatgc ccattttgct gacaatgtct cttgcaatga    115320
     acactgctac cgccaccact actatcacgc ctggagggac gtgacgattg attgcacatg    115380
     caactcatct gtccctccaa gcatagtttg gagggttttt tattacctca ttactcagac    115440
     aacaggagag actaaaatgg cggaccaccg tgaacttgca agggatatgg acttgtttca    115500
     ctttgaagag catagtccag gaatggtgtt ttggcaccca cagggactgc ggctttttcg    115560
     cagcattgaa gacttcatgc ggcaagttta tcaagggcat ggatttgaag aagtgcgatc    115620
     gcccatagca cttaatagat cgctatggga gcgctcaagg cattgggaaa aatttcgtca    115680
     gggaatgttt gttgttggca gcgtagaggc agatatagac gatgaatcag ccctatccgt    115740
     catcagccct gactatgcgt tgaagcccat gtcatgccct gcccatattg ctatttatca    115800
     gtcccgcaag cgcagctatc gggaaaatcc catgcgattg atggagtttg gcatctgtca    115860
     tcgcaacgaa ctgtctggca cattatcggg gtgtatgcgg ctgcggcaat ttgtccagga    115920
     tgatgctcat atcttctgcc gagcatctga tgtgcagcgt gaaattagca atttcctcaa    115980
     tatggtgcag caggtttatg ttgcttttgg ctatgaccaa ttttccctac aaatatcact    116040
     tagaccagag caacggcttg gctcagatca tctctgggat caggctgagt ctgtgttagt    116100
     taaagcggtt caatctttgg ggcatagtta taaattagct ccaaatgaag gggcattcta    116160
     tggccccaag ctcgaaatta gtttgcaaga tcagttgggg agatcgtggc agtgtggcac    116220
     aattcaagtc gatttcaatc tgcctcaagt gtttgagcta gcttttgtaa atgaattggg    116280
     agaattggag cgtcccgtca tgctgcacca ggcgattttg gggtcgctag agcgctggat    116340
     tggcattttg ttagagcatc acagcggtgc cctccccatt tgggctgctc ctacacaagt    116400
     cgcagtcgcc tctatttcta ataaagcatc tgcctgggca gaaacaattt tctttcgact    116460
     caggcaactg ggggctaggg tagaacttca caaccaaaac cgcacaatca gcaagaaaat    116520
     tcgtggactc tctaaacgca aaattccatt gattgccatt gtgggtgagc aggaagccat    116580
     gagtcaaagg ttaaatcttc ggtgtttagg ggctctaaaa caacaagaaa tgagcctagc    116640
     tgaacttgag caaaagttag ctgatctttc tatgccgtag cgagtttttt cccagaagtt    116700
     gaagatgtac gctcgcaggc taaatctacg gcggagcaga cggatgggag aacttggtgg    116760
     ggggccaaga tgatctgctg ctgcttacct tcaccattat cggtgttttc atcacgtcgt    116820
     tcaacacctt caaataagaa gcaatgagtt gatgccgcat cgacaccaag ccaagaattg    116880
     gctgaaacag ccaattcttg gtcacgagaa gtatgacttg cccaattgcc cagcgtttaa    116940
     gtggacagac tccctactaa acacttttcc cttcaaaaag aaagttcact tgaatttaat    117000
     tttgggaagg ctaaaggtag gacagcagtt ctgtaccttt ttccgaatga aatcctagtc    117060
     aaattaaata gctttttcta ttaatctcac agcttaaatc aggttcttcc cttttcaata    117120
     aaactggaag attaaaaggt tcccacgatt cccaatcagg agctgcatgt gcctcagccc    117180
     aaggaccaac tccccaaaat tcggattggt gagcttcttc tccagaaggg atatcttaat    117240
     ccgacacaac tgagacaagc cttaaacctc caacgtggga gtaagcagaa actgggagaa    117300
     gttttaattc agcaaggtct gattagtcag gatcaactcc agcaaggcct aatcgagcaa    117360
     cgatggcgaa acttggtcac gtcagtatta ttctcggtta gtacgtttgc gcccaatcta    117420
     ccgcaactaa cctctagcgt agagacgcaa acaaccctgg tgcagagcat gcgtaaacct    117480
     accatagaac tcattgttga tgacgacatt aaaagggttc acgccaagaa agggtatgga    117540
     ggaatttcta cccagtcagg accttctaat accagaacgt tgtttgcttc tgccactcct    117600
     ctccctcaaa agccgactgt agatgatccc ttgagaggtt tttgtcatcc attgaatggt    117660
     gaggggtggt taagccaggg aattcggggc agaacccacc aaggtcggat ggagtatgcc    117720
     tatgatctag caataaagat tggcactccc atctatgcca tgagggctgg taaagtgctc    117780
     gcactaaggg ataaataccc tgatacgggc ggtgggaaag aaaatgcaac tcgctctaat    117840
     ttcatttggc ttgagcatga agatggatat cggtctatct atgtccacct gcagcaaggc    117900
     tttaagtcaa aagtgaatct caaagccgga gattttgtcg aaaaaggtca actcattggt    117960
     tacagtggga actccggttg gagtaccggc cctcacttac atattgaagt gcagaaaccg    118020
     agtcctagaa aacggtttac gaactcagtc cctttcgcta tttcaggtac ctgtaaagat    118080
     accccaatcg ctgaccaata gcttaaatta cctctgtctc tgccggaggc ttattatggt    118140
     tcacccctca agggggcagg ggaataaccc ccaaggggca actctctaac atcaacataa    118200
     aggcaggttc agctgctcca agcgagcatt ttctagctcc tgattgcgaa tatatccttg    118260
     aaccaccgct tcatccaaac ccactaccga aacatagtaa cctcgcgccc aaaagctctc    118320
     tcctgaataa gttcgtcact gaaactctaa ttcgtcgatt cgttggagaa gaatataaac    118380
     ttctttaccc ggatgtaaaa cgatggcttg ctgtccttgg aaccaaagat cttgaacaat    118440
     aaagtatctg ccacgtcgtc ccagaatctg ataaacctta tatctttccg gttcagcaat    118500
     gacaatctgc tcaccaactt gaatcattgg aaattctttt gggggaacag cgcccatcgg    118560
     taaattcatt acccagttgt gccaacacct ccagctttct cgaactccaa aaggcacagt    118620
     tatatagtct tcatgctccc ctgtatcctt ggctagtcgc cttataaatt cgttgaactc    118680
     aggaagcgca tgcaactcta aaggcatgaa gtgtttatct gtggggatac ggaacacata    118740
     ccaatcccct gacttccggt ggtcattgat ctcttgccaa tagaggtctg tgaatacagg    118800
     agcatcgctt ccaggattcc ggtattcagt gcagaattgt tctgcaagtt cttgggtaat    118860
     gaagctgttc ttcttatctc tcatgagaga gtgttgagca acttccctgg cgtccatgtc    118920
     aatgagtctt attagttgag cctcatgcgt ttcggctatc tgactatagt tgatttgctc    118980
     atgaacaccc ggctctaaaa gcggaacctc atacggttca ttcaacgatg gatcatagca    119040
     aggatcgttg ttatcaaact ggggctcaat ctcttcctgg cttaatcgac aattgattcg    119100
     gtgttgatga agcaccatct cccataccgt taaacgacca gatggaatgg ctgaatcata    119160
     agccgatgaa tacatagcat tgtgttgatt ttgcatatgc tcgatcactg tctcaatatc    119220
     cccttgggtc agggttccct cagcttcagt gggttcatca atgtggtgta gcgccggata    119280
     ataaccaatc aattgaccgt tatcgatcac gttgaagttg atacccatcc ggcttgcttc    119340
     attgatccga tgaaccaact catttatgtg atggagaatg cgatcttctg cattctccat    119400
     ggcttggcgt aacccctcat ccattggcat ccgatagagc tggttctggt gggccatggc    119460
     catcacatgg gcgaagccgc tgcagttgtt tggaggaagt aggtgctggc aaagtcgaag    119520
     aagcaataga cataaaggtt tgaaggggta gataaaaggt tgccaatgat aatgattatc    119580
     attatcattg tctttgacct agtttgcttt tggattgaag ccgactggat ctcgaagtgc    119640
     cccttattcc gttccgcgtt aggagtttct atgactgtgc cttccatccc gacctttgtc    119700
     cctgcgctta ccactgaagc tcagcccatc gtctcggagg ccgaaatgca ggccgccgtt    119760
     cgtacgttgt tgctgggctt gggtgaagat cccgatcgcg aaggcctccg agatactcct    119820
     aagcgaatgg ttaaagcctt aaaatttctg acttcgggtt atcagcaatc cctcgatgaa    119880
     ttgctgaatg gggccatctt ccccgaagac ctagatgaaa tggtcttggt gcgtgatatt    119940
     gatctcttta gttcctgcga acatcatatt tggcccatta ttggcaaagt ccatgtggcc    120000
     tatatcccta atggcaaagt gattggcctg tcaaaaatcg cccgcatctg tgagatgtat    120060
     gctcggcgac tgcaggtaca agaacggtta acagctcaaa ttgctgatgc cttgcagggc    120120
     ctcctaaacc cccaaggggt ggctgtagtt gtagaagcaa gccatatgtg tatggtgatg    120180
     cgaggggtgc aaaaacccgg atcttggact tcgaccagtg cgatgcgagg cgtgttttcc    120240
     agtgattctc gcactcgcca agaatttttt aacctgatct cccattcacc agcaagtcgc    120300
     tagttacggc ttcagccggt cagcaccggg cttttggggg agtggtaaaa atactctgct    120360
     gaaccatctc tcgttcttta ggattttgtg gagtgaattg ctcaaatcct tttcaaaact    120420
     ttgttctgta gtatatagag tccataatgc cctcactcaa ttccttcgtt ccctttacaa    120480
     agatttgtcg agcgattgcc ccggtcgctg ctctatgctc agtatttggg acggtattgg    120540
     gccaagcagc ccccagtcac gctgtcacgc cgaggtcact cttgacaccg tcgttaattc    120600
     agtcaatacc aatcaccacc tctgttgcag aagccgtaaa ccgggtgcgt ggggttgagc    120660
     ccaaattctg ttgccatatg ctggcgttag ctattgacga gatccttgag gatccccgtt    120720
     ttgaaacagc ccagtggggc attgttgttg aatccattac tgggccaacg gttctctacc    120780
     aacacaattg agatcgcgcc ctgattccgg cttcgaatac caagctgctg acaacaattg    120840
     ctgccattaa tgtcgtcagc aatcgggttc ctgaaatgcc acttttccaa ttgcactcaa    120900
     cgtctgaacg gttttgttaa accttattcg ccaaaaactg atactccggt gtttacagct    120960
     ttactctggc tccagaaaga gaaactcccc gtttcggcgg aggctggtgg gcctaatttg    121020
     tactatcagc ctggctacat tgctttttac ccttggtggg ttgcatactt tagctcaaaa    121080
     ttcatcagac ttgaacgact tacaagagcg ccggatacaa gttgatgaac agcgatccaa    121140
     tgttagaaag caacgacagc agattgagaa tctggaaggt gcagccaaaa gacgtttagg    121200
     gggattagag cggaatattc agtttacgga aggtcaaatt atggaaaatg aagtcaaact    121260
     caaacaagcc aaccaaacac tgcagaaaat agaagcggat ttgaccgtag ctgaaaccgc    121320
     ctacaaagag aaacagagta ataccgttgc tcgccttcgg gttctgcaac gacaacgaga    121380
     atccagtact tggattgtat tattacagag ccaatcgata gaggaactgt tagagcgtcg    121440
     atatcggctt caacaggtct ataaagctga tcgcaagtcg ctactagcac tcaagactga    121500
     aaaagaagag attagtgaca agaaactctt agcagaaatt cagaaaaacc agattgccct    121560
     tttatcagaa caactccagt atcaaaaagc gaattacaca gctcaagcgt ctgttcaagc    121620
     tgaattggtg acacggctaa aaacagatcg acgcgcttta gaagctgctg agcagcaatt    121680
     atctcaagaa gctaataatc tttctagcat cattgcccaa cgcctaggcg aacaacaagt    121740
     ggccttccgc tctggcactc ccggatatca gcgtatattg gggacaggac aactggttag    121800
     acccgtagtt ggacccgtta ccagtaattt tggctatcga attcatcccg tattaggagg    121860
     aagacggttt catgctggta ctgattttgg tgctcctaca ggtgccccga tttttgcggc    121920
     agatagcggc accgtaattg tggctgaatg gtacggtggc tatggcaata cggtcatcgt    121980
     tgaccatggt aacggcttaa ccactcttta tggtcactgt agtgaactct acgtaaccgt    122040
     aggtcaaggt gtacagcgag gccaaaccat tgctgcgata ggttcaacgg ggttgtctac    122100
     tggccctcac ttacactttg aagtcagaca gcagggtgag ccagtcgatc cgttggccta    122160
     tttatagacg ctattttgta gaattcaagc gccgtagcca aagctcttgc aattttccaa    122220
     tcgaattctc cacctattca tcaacctggc tagcgggttt ctctgaggtt tcttcgtgtt    122280
     tcacctctga gtcttggcct ggatgtaact cgttctttag gattttgtgg agtgaattgc    122340
     tcaaatcctt ttcaaaactt tgttctgtag tatatagagt ccataatgcc ctcactcaat    122400
     tccttcattc cctttacaaa gatttgtcga gcgattgccc cggtcgctgc tctatgctca    122460
     gtatttggga cggtattgag ccaagcagcc cccagtcatg ccgtcacgca aaggtcgctc    122520
     ttgacaccgt cgttaattca gtcaatacca atcaccaccg ctgttgcaaa agccgtaaac    122580
     cgagtgcgtg gggttaagcc taaattctgt tcccatatgc tggcgttagc tattgacgag    122640
     atccttgagg atccccgttt tgaaacagcc cagtggggca ttgtcgttga acccgttgct    122700
     gagccaacgg ttctctatca gcacaatcga gatcgcgccc tgattccggc ttcgaatacc    122760
     aagctgctga caacagctgc tgccatcaat ctcatcagca atcgggttcc tgaaattcca    122820
     gtacccttga accagcagct gattgaagtc aatcgctaca gcaataacag cgaggcagat    122880
     gctctcctac gccaggttgg cggacaacgc agggtgaacc aggaacttat gcgcttgggc    122940
     ctccgccctg agagctatat ccaggtagat ggttcagggc tatcccgtag taatcgcatg    123000
     ccgccctcaa cgctgattac gctattaaaa gcaatgaagc gtcatcgcga aggagtggtg    123060
     ttctacaatt cgctgccgat cgctggggtc aacggcacct tacgaaatcg cttccaaaac    123120
     acccgactgc acggaaaact tcacggtaaa accggcacct taaggggagt gcgggcacta    123180
     tcgggatatc tagacaacgc agactatggc acgattgctt tcagtatttt ggtcaaccag    123240
     cctgggcaat cgggacaggt tttgacccaa gctattgacc aaattgtgtt gcagatggct    123300
     caagtcaatc gatgtaactt agatagctaa caaagataac catagtccgg acagaaaggt    123360
     gagagtaatg atgtgattca aatgtggtca caatcaggta acagtctgac tcagaggcag    123420
     atcagtcaga cggtggtctg gccgaaattt aaaactttga tgattgctcg aaactataac    123480
     ctgctgttga accgtgctca tacatgcaat aaaaagggtg atgcatgact aagaaaattt    123540
     tgattaagaa tgcccagcta gtcaatgaag gtagggtgtt tttatcagac gtacgtatta    123600
     gtaatgaacg aatagaacaa atatctagat caataacacc ctctggcagt gacgaggtag    123660
     ttgatgcagc tggtttttac ctgctgcctg gaatgattga tgatcaagtg cattttcgtg    123720
     agcctgggct aactcacaaa ggtactattg cgagcgagtc tcgtgcagct gcggctggtg    123780
     gtattacgag ttttatggaa atgcctaatg ttagtccttc cactacaact attgaggctc    123840
     tagagaataa atataaaatc gctcagaaac gttcggttgc aaactatgcg ttttatttgg    123900
     gagctacgga aaataatctg gaacaaatca aacgccttga tccgagtaaa tattgtggcg    123960
     ttaaagtttt catgggtgct tcaacgggaa acttgttggt tgaaaatata actgcacttg    124020
     aggatatttt tcgggaggca ccaacattaa tcgtcactca ctgtgaaagt ggcccggtta    124080
     tcgcaaaaaa tctggctcgt gtcaaagctt tcaatcgccc tactgttatt accgatcatc    124140
     caactattag agatgctgag gcttgtttcg cttcgtcttc tttggctgtg ggcttagcca    124200
     agcgttatgg cagtcaatta catgttttac acattactac tgccaaggaa ttaagtttat    124260
     ttgatccagg tccgattgct aataagtcca ttactgctga agcatgcgtt catcatttat    124320
     ggtttagcga tcaggattat gcgggacttg ggaacttgat taagtgcaat ccagccatta    124380
     agtctgccga agatcgtgct gcattaattc aagctgttca tgaaggtctt attgatatta    124440
     ttgccaccga tcatgcacca cacacttggg aagaaaagca gatggattat ccacaggctc    124500
     ctgcaggttt acctttagta cagcatgctt tactgactct ttttgatcat gtaactcata    124560
     aacgcatgtc tcttgctcag ctagttgaaa aaaccgctca taatcccgct attcgatatg    124620
     gtgtaattga tcgaggctac attcgtgaag ggtattttgc cgatttagta ttagtcgata    124680
     tggacacacc atttaccgtc acacccgaga atacttttta ccattgtggt tggtctcctt    124740
     ttatggggta tagatttagt tccagtattt tgaggacttg gattaatggt caattggtgt    124800
     ttgatggcca acaaataatt gagtgtccgg gagcctcaaa aaatttggaa tttagaggtg    124860
     tgagataaat atttaatagc cctatatttt gcatggtgaa aagcaaaaag ctacatgctg    124920
     aaggaaacac ttcaatttat gttgaggtct atatgaagct ctatcttctc tgaccaagct    124980
     aataagggca cggtgtttga gattgatgct agttcatcac aaatgtatta cgcttccgtt    125040
     ggaagttttt tatcttgcca agtaggtact cctggctgga attcatccca agtcttacat    125100
     acttgctcgt agcattgggg tggtgtaatg ggtaggtttt tcaagtaaaa gaatgtggcc    125160
     tgatcgaaag actccagcaa caagacaact tctgtggttg gagaataatt atcgaccact    125220
     tccaagatgt gattaatcat atggcaatgg ggcaaaactg ccctatcagg agcctctaac    125280
     caggccttca agaaaggcat aaggcgcgaa cgtccgacaa agtgggtttt gaatgattct    125340
     ccactaatcc ccattattgg agaatttgtg ctgcaaacaa ttgctccacg tttttggctg    125400
     agatgacctg cccaagcgtt gtagccaatg accagtaagt tacttgcaac aaattcttga    125460
     gcccaattcg atctatcagt tgcttctctc attgggtacc tcctaagcac taaagtattt    125520
     agcagcagga tggtagatga caaaagcagt ggttgattgc tctggatgaa gctgttcgct    125580
     ctcatcgatc gataacccaa tgagatcgca ccttaatagt tgcagctgtg gcacttgatc    125640
     gatgaccacc ggacaagctg gatagccaaa actataccgg gaaccctgat acctctgcgc    125700
     taaaatatcg cgaatgttat ctggctctaa atccccatag cccaattccc gtcgaatact    125760
     ggcatgactc cattccgcca aggcttctgc caactgcacc gccatcccgt ggaaatagag    125820
     ataatcggta tagctgctgt cttgataaag ttcctgtgct ttctgggtgg caatttctcc    125880
     catcgtgacg gcctgcatcg gcaagacatc aaattgattg tgttcgatcg ggcggatgaa    125940
     atcagcaatg catagccgac gcatggattt ctgacgaggg aatgtccaag tgacaaacgg    126000
     gcttgctgtt gcgggtgtta agccctgctc gatgacactt ggttcgtaaa catgaacgga    126060
     attgccaatc gccgcacagg ggaaatagcc ataaactagc gtgggttcca accagtgttc    126120
     cgtgcggatt ttttgcttcc attcttccaa gattggataa acctttgatg ccagaaacca    126180
     atcatattcc tcacgagatt ggtctttcgg tttacggaat tgccattggc cagcgatcag    126240
     tgcctgcaaa tccatgtacc agaatagttc ctctaaatct agatcgttac tctgaagaat    126300
     tttcgtcccc cagaagggtg gcgcaggacg ttcgatatca atcgataccg ctgtcgagcg    126360
     ttcggtatcg atgacagtgg gttgatcaga tttctgctgg tcaccattga gttctcgatc    126420
     taaatcttca atcgccttgc gtcccttttg attaaactga gcaaattctc ctgaaaagcc    126480
     ttcggtatcg acccagcact gctgttcttt ggcaggcatc agtcgatcca taaaggtcaa    126540
     atcagcaaat gcatctttgc cgtaaatgac ctgcccttgg taggtctctt gacaatcccc    126600
     ataaacaaat tttggggtga gggccgcacc gcccaaaatc actgggactg taatcccttt    126660
     agcattaaat gcggcgagat tttctttcat aaatgcggta gatttcacca gcaagccact    126720
     catggcaata caatctggct gatgctcttc ataggcttcg acgatggcct caatggcttg    126780
     tttaataccc agattgatca ccttgtagcc attattggtc aagataatat ccaccagatt    126840
     cttcccaatg tcatggacat cccctttgac ggtggcaatc aggaatttcc ctttaccgcg    126900
     atcttcgtcc tctccttcga ttttttccat gtagggttcg aggaacgcca ccgcagactt    126960
     catggtttcg gcggattgca acacgaaagg caattgcatt tgacccgagc caaacagttc    127020
     gcccaccacc ttcatcccat ccaacaagaa ggtattaaca attgccagtg ctttatgacc    127080
     ctcatctaac gcaaccttta acgcatcctc caatccaatc cgttcgccat caataatatg    127140
     ttgcttcaag cgttgatcga tgggcaaatc agctaaggac gcactcgccc tagcgtcttt    127200
     cgtactcacc cccgcaaaaa gttccgtcag cttcgtcaac ggatcgtagg tgcaaatatc    127260
     cccttcaaat ctgcggttgt cataaatcaa atcgagacaa acctgttgat ggtcatcatc    127320
     aatcttcgat aacggcaaaa tcttggctgc cgaaacaatc gccccatcca tcccagcctt    127380
     catcgcttca ttgaggaaga tcgaatttaa ggtaatgcgc gaggctggac tcaatccaaa    127440
     cgaaacatta gagaccccca gcataaaatg cacaccgggc agattttccc gaatcagtcc    127500
     aatggcttcg attgttgctt tggcgttttc tcaatcctct tcaatcccag ttgaaatcgg    127560
     tagggctaac gtgtcaaaga aaagttcatg gggtggaagt ccaaacttga gcgcatcctg    127620
     atacgcccgt tgggcaatct cgaatttttt ctgggcggtt cgagccattc cctcttcatc    127680
     aatacagcca atgacaaccc ctgcgccata ttcttttgcc aattgcagca ctttaaagaa    127740
     tcgctcttct ccatcttcat agttggtgga attgagcaaa catttgcccc cggcaacctt    127800
     gagacccgct tccattttgg tccactcggt ggagtcgagc ataaggggga gcatcgtatg    127860
     cttcactagg cgtgatacga gttctcgcat atcccgttcg ccatcacgcc cgacataatc    127920
     cacgtttacg tccagcatat gtgcgccttc cttgacttgg gatttggcga tcgccaacaa    127980
     cccatcccaa tcatcttcgt tcaacagggt gcggactttc ttagacccac tggcgtttaa    128040
     tcgttcacca acgattaaga aggaattatc ctgctgatag gtttgggcgg aataaataga    128100
     cgctgccgct ggcgtatagg caagaggctc tcgaatctcc cccacagtat tttgtcggac    128160
     ttcacgctct tttagtggag tgtgttccac cgcatcggct aacgctttaa tatgtgctgg    128220
     gcgcgtacca cagcaccctc cgacaatctg aacgccatgt tccgcaatga attgagtcat    128280
     ggcagttgta tattcttcgg gggtcatttt gtaatgcgcc tgaccgccaa tattttcggg    128340
     gagccccgca ttggggatac aggaaatggg gaatggcgaa ttttctgata ggtacttaat    128400
     gtgggacgtc atcaaatcgg gacccgtcgc acaatttagc cccaaaacac tgatgggaaa    128460
     cggctccaaa attgccagta ccccagagat atcggtcccc actagcatgg tcccctggat    128520
     ttccatggtc acggacacca ttaaggggag acgtgcccct tttttggcaa ataccgcctc    128580
     aaaggcacta agtgccgcct taatttgcag tacatcttga caggtttcca cgatgaacag    128640
     atcggctcct ccgtcataga gaccttctgc ttgcaccatg aagcttgctt tcagttcgtc    128700
     ataggtaata tgaccaaggg tcggtagctt ggtaccggga ccgatggaac ccgcgacaaa    128760
     tcttggtttc tcaggagtcg taaactcatc cgcacaacta cgcgccaact ctgccgcctt    128820
     tcgacttagc tcgtaggcgc gatctgccag atcgtactct gctaggacta atgggctagc    128880
     tccaaagcta tcagtctcga caacatctgc ccccgctgcc agaaaatcac gatgaacttt    128940
     cgctactgct tctggcttgg tgatgaccaa gtattcatta caaccttcat attccgcacc    129000
     accaaaatcc tcggcggtta agttttggga ttgcaggttt gttcccatcg caccgtcaaa    129060
     gattaccact ggacgatccg gattttggag ccgtcggaga aatgcagtat ttaactgagg    129120
     tttcgtcgtt tcagtactta gcataggcgt aatgatgttt gtagtactcc ggcttccact    129180
     gaaatctttt ttcatcccaa agttagtcag catggaagaa tgaaaatgat tatcattcta    129240
     acgcaagtcg atagttaatc caggctttgt caaaggagaa agccgattgt gcgtcaataa    129300
     agatattttt tgggctggcg gtggcgaagt tactgcaact taatcggcga agtcatgatt    129360
     atgcagtaat caaccttagg atgatttttt gaaagaataa ttgtcttcaa gacaggctgt    129420
     tcaggcaccc gtttcaatcc agacattctg gtcgtaaaat ccaccccgtt gctcaaactg    129480
     aaatccaccc aataacatcc ccagccagat ggacaccagc gataactgta gctcctgcat    129540
     tagctcgacc atgggtacct ttccaggcac ttgctgtaaa tacgttgaaa tggcagccac    129600
     ccaagctgac acatcctcct cgtgactgac cttcatagca accgactcac cgctttccag    129660
     ttcctccacg aacttcagta ctgattcctt gctaacatca cctacaaccg actccacagg    129720
     cttccccatg aacccctggc gtcgtttccg tgacttcggc tgacggcaca ggtccgagac    129780
     atccaaaaac atggtctgct gaaccatccc agctaagaaa tcctcatcaa gcaccggacc    129840
     ttcagagttg tatcgttcct cccaaccctg gatcattaac tctgcccgtt gaagacaaac    129900
     ctcagccata tccttgatcg catccccagc tacccgaagc tgttcatgag gagaacgacc    129960
     ctgtaaatgt tgatccaacg atgcacacat cagagaaata tcagcctgct ccggttcatc    130020
     taaagcagaa gccaaagcac ttgcaaaatc tagctcaagc tgtttgaaca tggcgcttat    130080
     ccttcagggg acagtctgca atttcgcact cagaaggctc catgcgaatc ggcggctcaa    130140
     actccgtgat gccgtaccgc tcacggatca ctttaagtac ctggtttagg tagtgacgga    130200
     cttgagtatt ggtcataccc atacagtgga taggctcaat atcggctaac ttcttgctcc    130260
     cttgccagac actaacggcc agagcatgga gatgggcatc cttgggcttc tccttgtaga    130320
     gatagagcaa agccacaaga ggggcttgga cgggaatcga gaaggtttca gtggcttcta    130380
     tgggcgtggt tatgaccttc cgctgtgcat agtttccttt gcgcttggca ttgctttcct    130440
     tgcggtggcg gtaatgattg cgcttattgt cgcaggtatt gtccttccag cagtcatcgc    130500
     cttggggtcc gtgaatacgc ttggcttcag accgggaata atcgatgcac gctaagcact    130560
     tgggattgat gggtcgtgcc atttcggggg ccactccatt gagcgtcggt ggtgaaagcc    130620
     cataggagaa aggcttaaac catcgccagg ataccatacg ttttttagtc taaaatttag    130680
     tctaatacag ataaggggag ttatttggag taggaataat cacaaaaata cccctgctgt    130740
     cagtggaaag ggtttgaatc gcaggtttga gatttttggg gagcaacagg ggtgctgaat    130800
     tcctggttat tcgtgttgtc ttgcttcatt cactcagcag gtttgggtag gaacatgcgc    130860
     tgcttgatgg aatcccattg ctgagcagag attccactcg cttgtttact gcaatcgatc    130920
     atgagctggc aggttgagaa gtagttggtg atggcttgca catcatctgt agacagatcc    130980
     aataattctg gagagatatc cagtgatgag ctgattcctt cgattgaaac tgttgatgag    131040
     tcaaatgatt tttctagata tgagatgagg gtttgaatat caacatctgt tattagttta    131100
     ttatccaggg caaatttagc gatggcgatg gcgatggcgc gggcgcgggc gcgggcgcgg    131160
     gcgatggcgc tggcgcgggc gctggcgcgg gcgctggcgc ggtcgatggc gcggtcgagg    131220
     tcgaggtcga gggcgctggc gcggtcgagg gcgctggcga tggcgagggc gcgggcgctg    131280
     gcgcggtcga gggcgcgggc gaggtcgagg gcgcgggcgc tggcgcggtc gaggtcgagg    131340
     gcgcggtcga gggcgcggtc gatggcgctg gcgatggcga ggacgaggat tagtattaga    131400
     gtaaatactc gtttaacttc accagaatag tcactggatg catgagttgt cttagcccct    131460
     gcccaagcta gcaatctctt taacttggga tgttcagata gctcttgagt ttgtacttcc    131520
     agtttttcca agagtccgat cgcagcttca cccatcaacc ccgtaactag aaaaaagact    131580
     tctctccagc gttcacttga acggtgcaat tcaactagat catctagtag gttccattta    131640
     acaatgtact ttgcagttaa aaactcctga agcgttaagt gagagaaaga ataaacatta    131700
     gttgctctct caacgaaaat tccttgctga acttcaattg cttccaagac tgctgatgca    131760
     tcaaggttct ttggagcacc cagcgaatca cccaaaaaat cagctattga tttcatcaac    131820
     tgctcttcag tgaaaaatag ttgattgtcc tcaaatccct gataggcaat ttttgccaac    131880
     aattgtttct caaggtctgt gtggaatccc tcataaattt gacctcgccc aacccgtttt    131940
     tctgatgccc actcttttag caaaatgttc aaggcatctt catacaaagt atgtcggcta    132000
     ctgggaaccg ttagggattt gttatagacc atgcacagaa acgtcaagag caaaggagat    132060
     tgagctaact cctttgctcc tttattctct ggtttctgca acagttccca acagtgctga    132120
     gctgtctggc tctgttggtc gagttcagat gagaaccagt ttgtaataaa tttctctatc    132180
     tgctcatcgt caaattctgc gatcgcaact gtagttaccc gcttgaaata ggtatgatag    132240
     gcggcaattc gacaagaggc tataaaccga ttcttggaat atcgatctac aaaggcttga    132300
     atcttctgaa taacattatc aagattttca gcaagaacct catccaggcc gtcaaagagg    132360
     ataaggagtc gcccttttgc caaagctttt ttagtaaagc catctgggtg tggaaagcca    132420
     cagttttcaa attcagcagc gatacaggtt tccagatcta gatcgggtga ggttaataac    132480
     tttaattcga ggaagactgg aatttgttga tgcttgtagc ttccttgctc tcccttaagc    132540
     gcttctagtc ctactttcct tagaaaggta gacttgccaa ttcctggatc tccgagaaca    132600
     atcagccgct cacattcgtt agcaatatca ataccgtttc gcttgggaca gttatggtgt    132660
     ctgaatcgac ggtcgccccg atttcgatag gcttcttcca gggcttcacg agagtcataa    132720
     cttttcattg actccgtatc caacattcgg gcaccagaat atatggcatc taacgatacg    132780
     ggtttagaca ttcccaaaac ctggacttgc ccatgtcgat cgctgtagtt ttgaaagtat    132840
     gcttttgtag cattaaaaaa cagttgtcga aatgaatcat caatcttgat ctcatccctc    132900
     tcatcaaaga ttttgatacc aaggtcaaag agtgccttta tgaacgctcc tgcaactgct    132960
     gcctccaatg ccactgtcct ttagttccca aagaatattt gctccattgt gattatccta    133020
     tgggtaaaac tttggctcag ttattcatca gtattaattc ataaaagcta aaagcgaagg    133080
     atctctcaag aacgattttt tgatagcttc ctaatttcag tcttagctat agcactccag    133140
     acttccagca cccacccatt tattttggag tagaatcccc atagctaacc tccctacaca    133200
     tcacaccatc ccaacctcag caatcttccc caatggctat ccctgaagta aatctcatcg    133260
     tactggcaga ccaggccgcc acccccatcg atgctgcccg gtcccggacc caacccgcaa    133320
     caaccccact ggccgatctc cggtggatgc gagtcgaaga attcctaaga tcccgcgaaa    133380
     tccgacccaa cacccacaaa gcctatgagc gagacttgaa gcagctcatg gactggaccc    133440
     caaagggatg gcatgagatt acctccaggg acttggatcg atacaagacc tatctcaaga    133500
     ctgaacccaa ccaccggggc aagctccgca agtgtgcgac cattaaccgg agcttggccg    133560
     cattgcagag cttcttcaaa tggctgacgg ttcgggacta catcaccaaa aacccagctt    133620
     tactcttaga aaagctgaag tctgatccat tgctgcccca ggaattcagc caggacgaag    133680
     tggataatct atatcaggcc atttgcgatc gcgggtttca ttccttccga gatcgggcat    133740
     tgctgcacct gattgatcat gggttgagag catcagagat tcaggggttg aatgttgggg    133800
     actatgatgg tcagcgtgtt cacatcagag aagccaaggc tgatagcgtt gggtctgttc    133860
     cacttttgag caaggccagg agagcgtttg accagtacaa gcagtggcga gaacaacagg    133920
     gtgaagtcct tgaagatgag tcaccgttgt ttgtatccca ctccaataac agcaaaggac    133980
     aacggttgca atattggggc atctacaaga tattcaaggc gattgctgat attgccgagg    134040
     tggagaatgc ccatcctcac cgaggacggc ataccctagc gactcgacta gtgatgaaag    134100
     acatggactc gattctggcc cggaaggtta cccggcacaa atcagagcag tcttttgtcc    134160
     gttattcaga tcggggaatt gagctgaagg cagagcagca attctatgag gtgcatgggg    134220
     aagcgccagg gggcgaggat gggatcgttg aagaccagtt ggaaggtatt gagctgaagg    134280
     cggtcgttga ggagcctgcg aactggccca agattaaggc ggtgggtctg cccttgaata    134340
     cggtccaggt gaggctgacc cttgaggttt cagggaagaa gaagggcaag gtcaggaagg    134400
     agatcgagga gcgggtcttt agtccttttc agatggtcaa acctaagccg agggggaatg    134460
     agtatgagct gatggttgtg gttgagggag gcgatacgtt gtctgcaatt accgatcaga    134520
     tgaaatggga tatggagcta ctgggggaac tggatgattg cgaggtgaaa gtggcgtggt    134580
     tggatcagca agaatcgact ggagaggtga ctctagaatc tcaggaagac gagtcagctt    134640
     ttgccgagtc ttccgcaggg caacggccta cttccacctc cagcgtctat caaatgaaga    134700
     tcatgctgct gggagtacgg ccccaagtct ggcggcgcat tcaagtccca gagacgacga    134760
     cgctggccca actacattct gtattgcaag tcgtgatggg gtgggaaggt taccatctgc    134820
     accagttctc ggatagcgaa gacgaagcca tgactttagc ggagctgatc gaagatgatt    134880
     tattctcatt cggctaccta tatgacttcg gggatatgtg gcgacatgaa atcaaggtgg    134940
     agaagaggtt agagagtaaa cctggaaaaa actatcccat ttgtctggct ggaaagcggg    135000
     cctgtccacc ggaagactgt ggtggtgatt gggggtatgc tcgtctgctg agggtactga    135060
     ataaccccag acatcctgag catgaggagc ggttggaatg ggttgggagt gattttgacc    135120
     cgaaggcgtt tgacctggag gaggtgaatc aagccttgaa ggagcttgag gttgaaacaa    135180
     tgagctattt tgattgagaa ggatctttac ccacttgctg acagtcggct aaataatcat    135240
     caatgacgtt atgaaaagat tgctttaact catccgccgt ctgaccatca aatgcaatga    135300
     catcgcgaat ccccaagacg cgaccaaaga agatctgatc attagcatcg aactcaacca    135360
     cagattcata gcccttgtac ttcatctaac ccccagatac caatttgcta ctagctaggc    135420
     ggttgaggct aatcccttgt tctgctgctt ggatagccag ttgacgatgc tgctcaggtg    135480
     gaattctcac cataaatttc ccactgtatt gctttttaga cagaggggta gggataggct    135540
     catcctgtgc cactaaatcc tcaatacaat ctttgaccaa ttccacaatg ccagcgaaag    135600
     cagactgttg atcttcatcc agccagctca aacttggaaa ttcggcgcac aagcccacaa    135660
     actcctcatc ttcttgagac cagatgaccc ggtaggtata gtatttggca tccatcacat    135720
     tgactccagc ttttggatcg cggctaacac ttgtttgact tggtagggtt tgcccatccc    135780
     tttcttggat tggatattga cgaaaggatc accctgccag ggagtcttgt aaacccgatg    135840
     gcttccagaa gtctgacgag cttccccgaa gtagtgatcg caaaccttac acaaatcaga    135900
     gaacttaatc ccagcgggat tattccccat tttggcaaca attttgtcga tactggccat    135960
     gtggttaata gtatcaatat cgatactagt atagaatact cttcgatata agaccaaact    136020
     gttcgttaga gtttcactag agtcataatg acttgctaaa atccacgaat ttgcgtatat    136080
     ggatacggaa attgccatta tcgcaaccaa atcgagaaat gaagaatgaa cgaaatacct    136140
     ttggtttgaa tttggcctga aatctttgtg ggattgttct tgaaatcgtt catctaaaaa    136200
     cataaaaaca gatgaagggt agggcaacag tctttggtca acccaaatga atgattaagt    136260
     acccagcagt tatacaacag cctaaaaata ttgcggaata agtagaaata ctactttcca    136320
     aggttatcca tgccattatt ttatgcaagg tgattttgga tttagcttca gcgcatttag    136380
     aggattgggg actgtgataa aaactgttgg aatggatagg ttttatggca ccagatttac    136440
     gccaattctt tcgcgcttgc aatccgggta aaacaattcg ctttgaagac cctgaagaac    136500
     gaaactatta catcgacttt tcatcggtcc gagggggaga agtcattgaa gaactgggcc    136560
     aaaccattgc actcatggat ccagatccga cctgccagct tttctcgggg catattggct    136620
     gtggtaagtc cactgaactt ctgcgactaa aaaaagagct acaagaaaaa ggcttccatg    136680
     tcgtctattt cgagtccagt gcagatctgg atatgggtga tgtggatgtg agtgatatct    136740
     tgctagccat tgcccatcaa gtcagtgaaa gcctagaagc tgccaaaatt tccactcaat    136800
     cgagttactt taatcggctg ctcaaggaat gtgtggattt tttaaatacc cctgtggagt    136860
     tggggattga agcagaactg tccttgggga ttggcaaatt aaccgcaaaa accaaagaaa    136920
     gcccacaatt acggagccaa ctgcgccaat atctagaacc tcggacagaa agtttgctga    136980
     atgctattaa ccgagaactg ctgcaacctg cccaggagga gctgaataag caggggaagc    137040
     agggcttagt ggtgattatc gacaatctgg atcgggtgga taatcgaccg atagcttcgg    137100
     ggcaaaccca ggcggagtac ttatttatca ctcggggaga gcagttaggg gggttacgat    137160
     gccatgtcgt ctataccatt cctctggtat tgatgttctc caatgagttg caagctctga    137220
     aaaatcggct aggcggtggg gctaatccga tggtgttgcc gatggttccc attcgattgc    137280
     gggaggggaa tgattgtgag gcgggaatgg ctctgttgcg tcaaatggtt ttagctcggg    137340
     cttttcccca ggccacacca gatgaacgtt tagcttcggt gacagaggtg tttgactcac    137400
     cggagacatt aaatcaactc tgtgtggcga gtggtggaca tgttcgtaat ttgctgagtc    137460
     tgctatttac ctgtttaaga aaacgcaaga gcttgcccat tacccaagac agtttgcagt    137520
     tagcgattca agaagctaag gatgatttga ccgctactat cgatgctgaa gagtgggaac    137580
     tgctcaaaca ggtccattcc tcgaagaaag tcacgggaga agaggaatgt caggcattat    137640
     tgcggagtct atttgtattt gaatatcgca accatgccga tggtcgatgg tttgatatta    137700
     atccagtatt ggcaggtgct cgtgaattgt catgacggag acttcattta ccgtagggac    137760
     tgagcatctg gctcaattgg aagaattggc ctggaccatt gagatgtctg aggggcagtt    137820
     tacgctgatt ttagcgaact gcaattatgc tcaactgcga acggctttaa tccaacgctt    137880
     ggctgagcta tgttctgtag cgatcaagcc tgtgcatttg aatccagatg cagtgacctt    137940
     gtactcagct atccagcagc agcttggaca acaggttccc ccggctttga tggtgacggg    138000
     gttagaatcg ctagaagcct tagaacaagt tttgacatct gcgaatcaag cccgagagga    138060
     atttcgcaaa cgcctacccg tcccgatggt gctgtggctg gatgatgatt tgctgaagca    138120
     gatggtgcgt ttagttcctg atctaaaaag ttgggggact tcctttcggt ttcaagctga    138180
     gcctgtggaa ttggtgcagt ttctacaaga ctgtagccag cgcttgttta caaaaattct    138240
     cgatgtaggg cagtttgtac ctaattctga ggtattgggt aaacggaatc ggcaagaaat    138300
     tagctatgca atacaagcct tagaaacacc cgggaccact cttaacccaa aattgcaagc    138360
     tactgtgatc tttgctcagg gccggaatgc ctatgccaag ggtgatttga aaaaggcgct    138420
     tgatttctat cagcatagtt tgcaggagtg gccggattca gaacaaccct ctggaggaat    138480
     gcctgctagg acaaacgatg agtctggaag tacctctgaa atagaaaact cacgacataa    138540
     gggaattgta ctgattcatc agggctggtg ttatcaggca atggctcaac aggattcatc    138600
     ccaaacagca gcatttctgg aacaagctaa gcagtccttt gagcaaggat tggattgttt    138660
     aggggcatcg tcggagctgg ggattctgta tctggggcaa ctaggagagg ttctgcatca    138720
     gttagagaat tgggatgcgt tagatcaact ggccttaaac ctatatcaga acaccacacc    138780
     tgaaaagcac cctctgcaat atatggaagc gttggtgttg cgggcacagg tttgcaacca    138840
     tcgtcaaacc tgggagccag ctcttgattt gaccgaagaa gcactacaga tttgggaggt    138900
     gggaagtact gagatacagg tgctggccca gcagcaaatc ttgcgaatgc gtatgggcct    138960
     actcagtgcc caagctcagc aagctctggg aaagtctcaa gcagctattg acgatttaga    139020
     gcagactata gctgccactg atgcaagtgc agatccacat ttgtttgtgg agattttgga    139080
     gcagctaagg cagctttatt ttgatcagaa agactatcag aaagcttttg agactaagca    139140
     actgaaaacg acggtcaaac tcaaatttcg attacaggcg tttattgggg cgggacagtt    139200
     gcaaccccag cttggggacg aggaagggat tgatgaatcc ttggtgttgt cgggacgaca    139260
     gcaagatatt gaagtgattg tgaatgaacg gctgagccag gatcaataca agctggtgat    139320
     attgtatggt ccttctggcg tgggcaagag ttcattagtc aaagcagggc tggttccagt    139380
     tttgcagcag cgcgtgatta gagatcggaa aactttgcct gtggtggtga atgtttatag    139440
     caattgggtt gcggagctac aagcaaagct agaacaggct gcttctgtgc cacacactat    139500
     gaaaactgag atttcaggtg tggagacctc tgaagatgtg agccaagcat ccgatgttgt    139560
     caaaggtgaa acgggcacta gtgacagctt agagcagatt aagcagcaac ttaaacacaa    139620
     tgtagaggct caacgattaa ctgtacttgt ttttgaccag tttgaggagt tcttttttaa    139680
     ctgccaagag cctggtttaa gacgccgatt ctatgagttt ttacaggctt gtttggacgg    139740
     cagagccatt ccctttgtga aagtggtttt atcgttgcgg gaagattact ttcactattt    139800
     acttgagttt gggcggttca cgactagaca tgggctagag caggatgtac tccggcaaga    139860
     taatcgctat tatttgggga attttgattt agattcagcg cggttggtca cagaacggct    139920
     ggcgaaacga gcgcaatttc atgtgcaatc gcaggtgatt gagcggctga ttggtgattt    139980
     agcgacggaa ttggatcagg tgcgtccgat tgaattgcag gtgtccggcg cgcaacttca    140040
     gacagaaaat attacaacct tgcagcagta tgaacatctt ggtgagcagc ccaaaaaggt    140100
     attagctagt cgctggctgg aacaggtagt agaagactgt ggaccagaga acaacgagac    140160
     tgcttggaag atgttggttt ctttgactga tagcaaggga acacgaccgc ttcgaactga    140220
     gcaagaactg tggaatgctg tcagtacttt tgccttgttg gatactgaag attctaatct    140280
     tcaagattta cctcaatcta accctgaaga tctgacgcat ttttccttga ttttgagaat    140340
     attgcaggga tctgggttaa ttgttcattg gccccaagag caagatgatc gctttcaact    140400
     ggttcatgat tatttggttg aaccgattcg acaacacttt gacactgact tagagcaaaa    140460
     acttcgtagt gaacgacaag ctcgacaaaa agcagaagca gggcgtgcaa agctcttgaa    140520
     gatctcatta ggcggagctt ttattgccat tgcgggttta atcggtcttt tatggagagc    140580
     agaaaatttg cggtatagag ctgagcgtcg agaagctaac gctgaagttt tagctctaag    140640
     tctttcaagt aaaaatttgt tcgactccaa ctatcaactg aaatccctaa caaaagcatt    140700
     aatggctggt caaaatttac gtgactatga agaaaaacaa gagaatcgac tagagaatca    140760
     tatgtatggt gtcgcaacac ttcgtgattc cgtctataac attcgacagc aaaataacct    140820
     cgaaggccat accgatgcgg tcctagcctt ggcctatagc ccggatggga gcaccctggc    140880
     cacggcgagt tctgacaaga cagtgaaatt gtggtcgaag gaggggagcc tgatcactac    140940
     cctcgaaggc cataccgatt tggtcctagc cttggcctat agcccggatg ggagcaccct    141000
     ggccacggcg agttatgaca agacagtgaa attgtggtcg aaggagggga gcctgatcac    141060
     taccctcgaa ggccataccg atgcggtcct agccttggcc tatagcccgg atgggagcac    141120
     cctggccacg gcgagttctg acaatacggt gaaattgtgg tcgaaggagg ggagcctgat    141180
     cactaccctc gaaggccata ccgatgcggt cctagccttg gcctatagcc cggatgggag    141240
     caccctggcc acggcgagtt ctgacaatac ggtgaaattg tggtcgaagg aggggagcct    141300
     gatcactacc ctcgaaggcc ataccgattt ggtcctagcc ttggcctata gcccggatgg    141360
     gagcaccctg gccacggcga gttctgacaa tacggtgaaa ttgtggtcga aggaggggag    141420
     cctgatcacc accctcgaag gccataccgc tgcggtcggg gacttggcct atagcccgga    141480
     tgggagcacc ctggccacgg cgagtgatga caagacagtg aaattgtggt cgaaggaggg    141540
     gagcctgatc accaccctcg aaggccatac cgctgcggtc ggggacttgg cctatagccc    141600
     ggatgggagc accctggcca cggcgagtag ggacaatacg gtgaaattgt ggtcgaagga    141660
     ggggagcctg atcaccaccc tcgaaggcca taccgatttg gtcctagcct tggcctatag    141720
     cccggatggg agcaccctgg ccacggcgag ttatgacaag acggtgaaat tgcggtcgaa    141780
     ggaggggagc ctgatcacca ccctcgaagg ccataccgct gcggtcctag ccttggccta    141840
     tagcccggat gggagcaccc tggccacggc gagttctgac aatacggtga aattgtggtc    141900
     gaaggagggg agcctgatca ccaccctcga aggccatacc gatttggtca acaccttggc    141960
     ctatagcccg gatgggagca ccctggccac ggcgagtagg gacaatacgg tgaaattgtg    142020
     gtcgaaggag gggagcctga tcaccaccct cgaaggccat accgatgcga tctgggcctt    142080
     ggcctatagc ccggatggga gcaccctggc cacggcgagt gatgacaata cggtgaaatt    142140
     gtggtcgaag gaggggagcc tgatcaccac cctcgaaggc cataccgatg cggtcgggga    142200
     cttggcctat agcccggatg ggagcaccct ggccacggcg agttctgaca atacggtgaa    142260
     attgtggtcg aaggagggga gcctgatcac caccctcgaa ggccatacct atgcgatctg    142320
     ggacttggcc tatagcccgg atgggagcac cctggccacg gcgagtaggg acaatacggt    142380
     gaaattgtgg tcgaaggagg ggagcctaat caccaccctc gaaggccata ccgatgtgat    142440
     ctgggccttg gcctatagcc tggatgggag caccctggcc acggcgagta gggacaagac    142500
     ggtgaaattg tggaactttg agcttgaaga tctactaaag cgaggctgtc aatggttatc    142560
     cggctatttt attcgacacc cacaggaatt agaattacta acggtttgtc acagtcctgc    142620
     gattctgagt ttggctgcac taggcttggt caggcaaggt caagttcttg cagaagctgg    142680
     aaatatggaa aaagctcgac agaagctcca aactgcactt aaatggagtc ccaaattgga    142740
     tcttgatcca gaaactgaaa tgaaagatcg ggatgctaaa aagttagtga ttaaatgggc    142800
     tgcccctgcc aaagctgaaa aggctaaaca attagctagg caaggaaaag tgagtgactc    142860
     catcctcatt tttcgagaat tgcagagttg gcaagatact gataaggcag tagaaatctc    142920
     agcatcgtct tggaattcac tttgttggtt tgggagtttg catagaaaag caaaatcggt    142980
     aatgtttgct tgtgagaaag ctgtcgcttt tgaccccagt catgggggga ggcgcgatag    143040
     tagaggttta gctagagcct taaccaataa cccaaaaggg gcaatagaag attttgaagc    143100
     gtatatcaaa ttgtctaata gagctagcga tcgtaaaaag caaaggcaaa gttggatcga    143160
     tgccttgaaa gcagggaaag atccttttac tgatgaagtg ctggatagtc tctttgatga    143220
     ataataccct caccaccctt agcagacaag aatctataga actagtctga ctgctttgtc    143280
     tgaaaggaat tcagggtgtg tatgattggt tcaggaaacc gccattatcg taaccagtcg    143340
     aaagtaggag acagttcccc cactctattt caacctcaat atcagtagga ctatagtaac    143400
     ctttatgtta ctatagtcct actatgaaac tgcaagagta catcaaagag gatggctcca    143460
     gtccttacca aaagtggttt aaccgattag atgctatagc agcagcaaag gttacggttg    143520
     ccgtttctcg tctggaatta ggcaacacct caaatgtgaa gtggttcgat ggaattggtg    143580
     aataccggat caattggggg ccaggatacc gtatctatct gatccaagat ggcaaggagt    143640
     tgattgtttt attgggagga ggaacgaaaa aggatcaaca gtcggatatc accaaggcta    143700
     aggagctttc tcaagaatat aaaaatcgga agaagcaagc gaatatagat cctcaaaaga    143760
     agaaacaacg gcgaaagaga aaaaagaagt aaatatcatg gcattgacga gagatttcaa    143820
     agagactatc cactcccgag tgcagtcgga ccctgagttt gcaactgcct tattggatga    143880
     agctgcatac ctcatgctta atggagagcc agaaacagct cgattaatat tgcgggattt    143940
     agtcaatgcg acggttggct ttgaacaact tgctgtcgaa gcgaataagc ccagtaagag    144000
     tcttcatcgg atgctatctg ctaaaggaaa cccaacgatg gatagtttga acgcaatctt    144060
     tactgcactg cgtaagaggc tgaatgtgga tattcaagtt catgcagttt cttcttcttg    144120
     atggattcag aactggaact gaagtgaggg tttcagaaga ctgaaaatac aatattaatt    144180
     ggctaaatcg ctttacctga aagggcttca agacttgtaa gcttagggaa ggaaacagcc    144240
     attatcgtaa ccagaaaccg atatggaact cgacgcaata cccacccctc cagcttcggc    144300
     cctaaaaatt cttgaaaacg atgttctgag tgatttgctc agggataaac gatctcccag    144360
     cacccgacga gcctaccgca aagacctgac tgattttttc cgcaagatgt ttgctgaaga    144420
     tcccacccct gaaatggtgg gtctattcct ggggatggat cggcatgagg cgctgcagct    144480
     agtcgccagg tacaagggca ttttaattga gctggagttg gccgaggcca cggtaaatcg    144540
     gagactatcg gccctgagaa gcttggtatc ctatgcccgt cgagcgggtc agtgcacctg    144600
     gggcctggag gatattaaag gtgaaaaagt gattgcctat cgggatactt caggggtgga    144660
     tctggaggat tttcagaaga tgttggcgat tccagatcga gaaacgcagc tagggaagcg    144720
     ggattatgcg attctggcct tgctctggga aacagccttg cggcgagggg agctgaatcg    144780
     ttgtaatgtc ggggactggg aacccgagga aaaagcgctg tggattcagg ggaagggtcg    144840
     aggcacacag aaagaacggg tgacggttgg taacgtgagt gcgatcgcac tggaggattg    144900
     gctatcaact cggaagcact tggaggatga tgacccgctg attgtggccc tggatatcgt    144960
     gcattggggg cagcgattat ccacgacatc tatttataag gtggtcagga acatagccac    145020
     gaaagcgggt atcagcaagg tgatgtcccc acaccgggtt aggcattcct cgatcactgc    145080
     ggcactagat gccacgggtg gaaatgtccg ggccgtgcag cagctctctc gccatgccaa    145140
     gccagaaaca gtgatgcgct atgacgataa tcggaaggat cttcagggag aggtgacggg    145200
     ggttttatct cggttattgg gagaggcaga ggattgaggt gaagagtagt gattaattcc    145260
     agatctttag ttgttcttct ttaacgaata tttctgcatc atcgagactt gggaaaattt    145320
     ttggaaggcg tttgtgtaag gcggcagcta ccttgtcaca gtccctgttg cgctcaatct    145380
     tgattttatt gtggagtgga gagttgcaaa tcaatggtgg ttccttgctc tctagttgag    145440
     attggatgag atgagtctcc cgtaagtcag tattcaatag aatggcgttg ttgaggtcgg    145500
     cgctgctgag gcttgcatcg ctgaggttgg cactgaggag gttggcaccc ctgaggataa    145560
     catcgctgag gttagctctg ctgaggtcgg caccgatgag gaaggcactg ctgaggttgg    145620
     ctttgtagag gtaggcaccg ctgaagtagg caccgctgag gtcggcatcg ttgaggtggg    145680
     catggccgag gtgggctttg ctgatgtcgg cgaggctgag gttggctttg cggaagttgg    145740
     ccccgctgag gtgggcatgg cggaggttgg ctttgcggag gttggaatag ctgaggttgg    145800
     caccaccgag attggcaccg atgaagttgg cgatgctgag gtaggcatcg ctgaggttgg    145860
     catcgatgag gttggcaccc ctgaggttgg catcgatgag gttggcaccc ctgaggttgg    145920
     caccgctgag gttggcatcg atgaggttgg cacccctgag gatagcaacg ctgaggtcgg    145980
     catagctgag gtcggcaccg ctgaggtcgt gacttctcaa gtcaagctgt ttaccttgat    146040
     cctgccctga ttcgcgtcta ccaataactg ttaatgcagc ttgaacatcg ttagcaattg    146100
     gctttggtga ttttgatgat ttcttcgtta cttcagttga aggtgattgt tttgatattg    146160
     gattttgctt tgatgcctta tccttctcat tcttggatac tttatcctcc tcatccaatg    146220
     gcgatctttc aagaacataa gccgatagta attccatgat tgtccaatgg tctctcggag    146280
     aatccttagc tattctttct aatgaataaa tagctgcaat acggacagca ttatcttcat    146340
     ttgatagaag agtcgcagcc tttgaaaatc gatcagtaat cagcctctct tgtgttaatt    146400
     tccgatcctc cgttgcatcc cagacagtcc aaatcaagcc aacagcagca gatgcagttg    146460
     ccagaatacc gaacatggaa atgatgacct tgatcgcttc gcgccgatta tcatcaagga    146520
     gagatgacca aaatccaccg acataagtca taggattaat ccaccggaga tatcctttgc    146580
     tacttgtttt ctgctcaatt ttctcaatct cagcagtctc aatcgccacc tgtttttctt    146640
     gccaaatctc ataggaatta ggccctaaag catcctcaga gggcttttct cgacgaaaaa    146700
     gcataggcaa aacagcttga aacctcgcaa aaagtatagg ttatcaagtg acagtttgaa    146760
     tcgatcaccg gttattcgtg aagcttttgc taattggggt tatcgcagta atttggactt    146820
     atccgacctc caacccatgc acaacgtagg tgacaactcc ccaaacatgg aaatcagatc    146880
     catcctgaat aacaatcggt ggataatcag ggttctctgc agccagtaaa atccgaccat    146940
     tggattgtcg aaatcgcttc accgtaaact caccgtcgag aactgcgatt attaccgatc    147000
     catccacagg attcagtgag cggtccacaa taaccaagtc ttcagagaaa attccacacc    147060
     ccttcattga atcaccatca acccgcatca aaaacgtggc ccctggatga ggtataagag    147120
     cctcatccag gttaagagga ttctgcagat ggtcatcggc tggggatggg aaccccgctg    147180
     atatggcttc cactaataga ggcagacaca gagaatctgc ccactcgaca gggtgaactg    147240
     atcggacaag cattgtagtg atatatatgt actattcata tttatcacag ttatcaaatt    147300
     ttctctagga tattggttat tccttgattg aggcttaaag atggtctggc agggacattg    147360
     gtttgacttc acccaaaatc ttctgcacaa tctcacctac agccgtctca cccgatacca    147420
     ccagatcggc caccgaagca ccaggcatga ccagctcctt atgagtgggc atgacattgg    147480
     attgccattc ttgaatcaca ctagtcttcg ttctcaactt ctccttggaa tctctggcaa    147540
     tcctgcgttt catccttaga tcatctggtg tctcaacgta aatcttgaaa tccaaacact    147600
     ccagaatttc aggtagagtc aaaacgaaaa ttccctctac gatgatgaat ggatggggat    147660
     gcacctggat agtctctgct ttccgggaat tggcgatcat atcgtagata ggcaagtcaa    147720
     ccgaataacc agacctcagc cgttctagat gagcgatcat catgtccgta tccagtgatt    147780
     ctgggaggtc atagttgcca cagggcatat agcggtagta gctatcatgg ctaatcagca    147840
     aggcttgacc agacaggcga tccactaaag cttgggccaa ggtggttttg cctgcgccac    147900
     taccgccagc gatgccaatg attttagggg tggtcattcg attcagattc tctcgggatt    147960
     atgaagcaat cttttccgta cagcctgagc cgatgcaccg tattgctctg cgatcgcttt    148020
     gtaggtcatt ccactctctc ttagctcacg cagtttctct gtactgggta gcttgggggc    148080
     atatttcgat ggcgggcgat ttttcttcac tttctgcaag tattccttgt accctacccg    148140
     caaaggctcg atgttttctc gccccaactc tgcggctcgt tcgcggcgaa gacagccaca    148200
     gcttaaggac tcacctttaa cgtaccgcca cgctaaaacc ctttcaacgc cacttccaca    148260
     agtacaacga acgcgaaatt ttcgctcaga tttgcgtttt tggggttctg gctcgatctc    148320
     ttcgaggatt tcccatcggc tgtgactggg aatgatatta gatattttaa cggcatccaa    148380
     ggggttgatt ttttaagtgg gtacgagtac tattatagat gaacctctta gataccgtta    148440
     aactttgaag cggattactg tacggaggat taagaatcaa aaggggctgg atcgatgtca    148500
     gttattccca aaatttaaac atccacaaag gagctaaaaa tgtcaggcag catgggttac    148560
     gtacagcttg agcatacagc tcaagaattg gaagatatcg ttttcggttt aaacgaagct    148620
     gaaaaccttg ataaatactg gaaaaatctg tctcctgatc aacaggaaaa cttcagaaga    148680
     ttaaccgaat tcgccagtga gtttcttgac ctagccgatc aaattgacac ggattgataa    148740
     gttggagttc catgaacgag cagcctatcc acaacaaccc acaaatcctc gataaactgt    148800
     gccgtcgtat tgattaccta aatgattttc ccgcgtcaat agaaggcgat gatctcgata    148860
     atgcccaact cttaggaacc ttggaaactg atgatttcct ggggtttgtg ctgggttatt    148920
     ccacggaaga gggcactttt tcagcggatc atttccagat gctatctaga gaagagaata    148980
     tgaagatcaa gcactatcgc ttgctgaaac ctgttctgcc ctggcctcag ccaattcttg    149040
     gtatttctgt acctggtggt gaaccaggaa aagtgacagg catccatcgc gttcccgtag    149100
     tgctaaagcc ttgtggtgtt gcccaagtct ggtggggtgg agatgtggcg gttctttggg    149160
     aaggactatt agatggcgat gtcaagggac gccaggatta cgaggccctg atgaatcaac    149220
     tttggggatg ctgtgaagcg tttctgaaag gccagggagt tcgccaggtt tttacctaca    149280
     atcgagatga tgaatatccg ttggaatggt atcaggggtt cttaaagcgt cggaggtatg    149340
     ttcctgttga ggatcggaaa ataacggtga agaagatgct cggataggct tttgctgttt    149400
     ccaatgaaga tcagtatgag tttgtatttt ctgatcaatc aatattaaaa atcaacagac    149460
     attattgatt taccctagcc ttcgtctttt acttgttagc taagtgcgga agcccacaaa    149520
     ttttgcccca tgataaaccg cagagcaatc ctctctatcc tccttccccc tctgctttta    149580
     ggatgcagcc cacctcccca agccactaac accaacatca cttcagcaaa gaccaccccc    149640
     gcaaaaattc ttagcacggg tgatggggat agccttaagg tgcgatcccc aaatggagcc    149700
     tcaaccacca caagaattgg ctgcatcgat gcaccagagt acaaccaaga atatggtcct    149760
     gaagctggtc aacgactaaa ggcattgcta cccagaggag cagatatcgc gcttcggaaa    149820
     atcaccactg accagagatt tactcggagg ggaaatcagt gggtttacag ctggttaggg    149880
     aaggatatgc ggtcgtgtat caccgctacc ttgatggttg ttccgataca gcaaatcagt    149940
     atgttgacgc agagaatgat gcgagatcac gaaagctcaa tttttggagt cagccaaacc    150000
     cagttatgcc gtgggattat cgcaggaatc ggcggtaata ttggaccgag ggttaaggtt    150060
     taatacatct gatctaccat ggacttatgc gttaacacac gcccatgtcc tattccctgt    150120
     cagccaccaa gctcaaaacc tacggacagt gcccaaaatc ctatcaattt aggtatgagc    150180
     ataaattacc ttcaccaacc atattcggct ccaccaagct tggcaatgct ctccatgcag    150240
     cgttagccaa tgtctacaag gattggaact acgcttaccc tcttccttcc ctcgattggt    150300
     ttgccgtttg ttggcagcag catacgagtg aattgacccc aactcaggtc catgaggggt    150360
     gggtagcact acagctttat tatgagcggt atatttcctc actcccccaa atccgcaaac    150420
     cgctggggat tgagacaaag gtcagggcaa atctccaagt ccgtaatatc gaatttaccc    150480
     tgtctggtcg gtatgatcgc ttggattata tcgatgatgg tctggaactg attgattaca    150540
     agacaagcaa atccgttaat cctcctccat cagtggatat ccaattgggt ttttactatc    150600
     tgattctgga acagatctac aagaaagcgc tcaaacgcct gagtctcatc tacttgcgtt    150660
     ctaacgagaa actgacctat gaggtcacac ctgaccatca ccagcaagcc caatctctga    150720
     ttgaagatat ggcgatgaag ctcagatgcg atcaggaatg gaaacctgtg acgggacagc    150780
     attgcgatcg ctgcgggtat cagaaatatt gccccgcgat aaccactagg ccagaacccc    150840
     taccgcaaga tgctagagag gttacgcaag tgcagttggc tttggggttt tgattgaaac    150900
     tattcaagga gaattaggag ccagcatcag aacctgaaaa agcgattcag gcaagggtgg    150960
     catctctatc gcctttcctt gatagtggat ctgagagaac gcggcgagat tgaatacacc    151020
     atgaggaaca tccagtttct tgtctctaat ccacattcct agccgataat ctacgcacca    151080
     tccctccaga ccttccatta agtcgatcca aaagtgcaag ggaatcaact gagtatccac    151140
     ccggcaagac cctcgataaa cttggtgggg aatgttgtgc cgaaagagtt gagtatgaca    151200
     tagacgggtc ataccatcac actcagtagg agaggcatct aatgggttta atagttggcg    151260
     tagttcgtca attgtcatat caagaaagct aaggttagtc agttggagct tacgatctca    151320
     gaaattcctg attcgctaac cacaaagctt catctgtcgg ctgatcgatc atccctagtg    151380
     ccgcaaagac gcgcagttgg atatcccgtc cgcctcgaca agctagttcc gggttggtgt    151440
     ggcagatatg ctgttttccg ctacacagat actcagtgat ttctgtcgtt cgatcatcgc    151500
     caaggactaa gcctccatcc tctggagatc ggaagatgca gcttttgcac tgagcggggt    151560
     tgggttcaag gaaatggctt ctcatgattt ttcggatagt tcatttaatg cttttataaa    151620
     atcatcaaga ttgtatttat tctgctgtta gaaaaagaaa atattgctga tagggaaaaa    151680
     tgctctatct tcattgttac agcacaacat aaacccataa ttaagttcat caattccata    151740
     agatagagta aagctattcc cattatcctt aaaagataca ctggcaaaat caaagggatt    151800
     aaaccttaaa ctaaagaatg ttgcgtcgat aatctcgaaa aggcttacac cgaaagtatc    151860
     aataaatctt atgcatagtc tttcttgaga tggtgtcagc ggtttatgac taactttaat    151920
     ctttccaggt ttattcattt acataatggt gatagtgggc caaaccaata ttcaggtgtc    151980
     cctggctgca tagaccttgg gctagtaaac agtaatgggc agttactatc atcggcttga    152040
     gagtgtttag atttttgtgt aagcagcagt gtattcaata gttgaatcgt gttgggaaca    152100
     gaatagcaaa atgggacagc gccgccttcc aattcagaat tggtctggtc catcgcttcg    152160
     aaatattcct catcgctaga aacatcaatt tgtagacaga ctcttcatta gggaaaaccg    152220
     ctttggtctt aatcaccttt ctcagtgagc ggttgagcga ctcaatggca ttggtggtgt    152280
     agataacctt acggatggcc attgggtatt gaaacaacgg ggcaacatta tcccaatgtc    152340
     gtatccagat ttggctaatg ccaggatacg tctcgtccca tttatgggca aatgcatcca    152400
     acgcagcctc agactcttcc aaagtggccg cttggtaaat gggcttgagg tctgcagcta    152460
     cggctcgact ttccttccac ggcacatggc gaaggctatt acgaataaga tggacaatac    152520
     aaacctgcac ctgggtctga gggtagaccg actcaatcgc ttgaggaaaa cctttgagtc    152580
     catcacagca agcaatcaag atatcctgag ttcctcgatt tttaaggtct gtgagcaccg    152640
     aaagccagaa ttttgctccc tctcgttcag cggctcctat ccataatccc aacagttcct    152700
     tgttgccctc cacagtcact gccaaagcga catagacagc tcgcttgctg acttgaccat    152760
     tgactttgat gttcacatac agcgcatcaa gatagacaat cggatacacc tcatccagcg    152820
     gccttgaacg ccagtctttg acctcttcca tgacgctatt ggtgacgtca ctaatcagag    152880
     cttcagagat attggcccca tacagctcca ccaattgggc tcgaatatca cgggtggtca    152940
     tgccccgagc atataaggcg atgattttct catcgagccc tgcgatgcgt cgctggcctt    153000
     taggcaccag gacaggctca aactcgccgc aacggtcacg aggaatcgat aggtccatct    153060
     ctccttgttc agactggacg gtctttttcg agtaaccatt gcgactattt ctggggccat    153120
     tagaattctc atcacctgac tgatcgttgg aggattgctg caggtgatga gtcaattcac    153180
     ctgcaagggc tcgttccact aggcgtttgc tgagtcgttt aagcagtcct gattcgccca    153240
     gaatatcttc cggttgaggg ttctctccga tgagttcatc taacagttca tcgactcgat    153300
     tgggagcttt tttctttcta gacatcgtac ggtctcctga tgtgtttgga tcctagaccg    153360
     cttacacaaa actctgaaca gtccctcggc ttttgaacta cttgaacttg ataggaccaa    153420
     agcagttcct ccaaaggtaa ttagacccac gaaaatcata caaatattgc caaatatatt    153480
     ccttatgtgg attccgttta ctctgactaa ctgctctaaa gtcattccgg aaagtctgac    153540
     ccctaaattt attgatcgct taacctgcca tcagctgtca attttctgat ttgtcatcac    153600
     ctcctttagg gaccgtagcc cgttcagaaa tggccggcag atccaaatca atttttcgac    153660
     ctttcaatcg ataggaagcg ccagttagct tcatgtactc accatggtga agcgtccggt    153720
     caataatggc ccgagccaac tcttcatcat gcaaaactct tccccaatgc ttgaggggtt    153780
     tattggtggt aaacaaaatg ggcttacctt tgagatagcg ctggtccacc acttgaaaca    153840
     gaacatccgc tgcgcccggt ccatagccga gatagcccat ctcatcaatc accagtacat    153900
     tcggttgaag ataaggtttg agggcaaggt tgagatcatg agcaactctc aagtcattaa    153960
     tcagggcagt cgccgttgta aaacgggctg taaagccgtt ctggattgcc ttataagcaa    154020
     ttgaaacaca taggtgtgtc ttccccgtcc cgggtggacc ttcgaggatc aatgagcggt    154080
     gctcactgac taattcaggg cccagaaatc gcccaagcat ttgtcgtttg agatcactct    154140
     tgaaggtgaa atcaaaggtt tcaatcgtgg cctgaaacgg aaacttggct ttggccacct    154200
     gattggcaat tctattttct gctcgttggg caatctcctc agagaccagg cgttcgagga    154260
     actgagtata agaccaagcc tctttctcag cgataggcgt cagttccggt aatactcgtt    154320
     ggactgtact caaccccaat cgcttcagca tgatgtctaa cgtcatggag cagtacctcc    154380
     ttcggaggtg ttctggagaa gatgagagtc ggcacaagcg tggggatgtt caacaaactc    154440
     caagagatat tcactgccaa tacaacgggc ttctactgcc agttcaatgg ctgccaacaa    154500
     ctctgtgcgc cccactttct catacagctg ataagtcaga tctacatcct ctgcccaagc    154560
     ttggggacgg cgatgcacca actccgtcag ataaggctcc actgacggat ctaaatccaa    154620
     caagatctga cgctgggcat agggcttttt gtggggagag gcaaaaaact cttgagcatg    154680
     ttcactcagg acactggact tgccgttttc cggaaatctc ggatggacgc ccaaacagcg    154740
     tttcccttga tagatgctca cttgctcttg ctgcaaatgt agagtcacgg tttgacccac    154800
     tgtatggcca gggacggagt attctatccc tcgatagtga acccgcgccg tgagccggac    154860
     gacgacactc actttaaagg cataggtttg agcattgtga ttcaacggtt gtagaggttc    154920
     acgcttgagt cgcacagcag gaatctcacc agtggcatca caaggtcgct gctcattaac    154980
     gtgattcatc catgcttgca gctgttgatg aacatcctcc atgtcctgaa aggtccgacc    155040
     acaaaagaag ttacctttga cgaaccccac cagattctca acagaccctt tctcttgtgg    155100
     acgatagggc cagcaagcga ggggaatcaa gccgcaatca actacgaact ggccgaagcg    155160
     ttctgtccaa tggactttga cgctgccatc ttcttgaatc tctcttgatt tgactgcact    155220
     actcatattg tcaaacaccc ccatcatcgg cactccacca aaatgctcaa aggctttgag    155280
     gaggctacga acgaccgtct cttgttgttc gttatcgacg atctggatat cgacaaatcg    155340
     agagtatttc agtcgggacg caaagaagcg aaccagttta cgagtgccat ctgcaaaggt    155400
     aacccaacgc tggccaaagt catgctggga aaactctcca ggtaatccct caaaacgaag    155460
     gataggcttt gggggggcct tgggtctgag gcgtctaact aattcataga cagctgtttt    155520
     gccaccggtg taacccgctt gtctgagtcg agccagaatc tcttggcctt tgatgaggcc    155580
     atcttcaggg gcacgaggct cttgaaacca ttccaagatc tgctcttcat attggctaac    155640
     tgaactgggt ctgcccatgt ttctagattt ccggaaaccc tcttcatcaa tttcggtgat    155700
     ctcgggttct ttctcaatcc gttgaatact tttttcacta atgcccgtga ggtctcgaac    155760
     ttctttttgg gagaccgtct tctttctaag tttttgcacc acgtaacgct ccaattgctt    155820
     gtacatctgc acttgccact gattgagatg actattttca tcctgctcag agagtggcaa    155880
     ttttggagac agacttaacg gaatgagtgc agtcggagtt tcaggaattc acaccttacc    155940
     ctatgattcg tttgagcctc tttgactgct aggtttaatt ctcggatttt cttagtcatg    156000
     attagtcatt tttaagatga ttaacagatt cctggtagaa actgaagtta gttttcctgt    156060
     cgctgaagct ctgccacatt atccatggcc tttcgtgcga tcagcctcca atccgtccgc    156120
     tcatcccacc gctgaaaaat tctctgattc cccaaccaga ccgcacaaaa aagaacttta    156180
     tcatcatcgg caggaatggc ctcaatggtg atccgctgtt tgagttgttc gggtgtcaga    156240
     tttgagatcg caatcaaaaa acccttcgca aaagtcgagt catagcccgc ctccaaagta    156300
     cagggacgat gagcgttcat cttgaaccgt agtttgtgag aaggtttacc tttatacttc    156360
     gtgggaacga attcgatact gatcaggtaa cctgtcaacg caggtttcag tagctcaaca    156420
     ggttcagagt ctttatcaag ggtgtaccaa gtattcgtat tggcacgatt acagaatata    156480
     gccaaagcag atggactatc gccaaatccc agtgcccttt cgtggctaaa atcttggggt    156540
     tggaattgat gggcctgtga tacggtttgt aattcagctt tgggctgcgt tgcgggggtt    156600
     actgtgtttg tggttgagtt catttttcgg tttccatcga gattttaata gttttgtgca    156660
     tttgttcaac gagaccccag cagtgatcgc aaatttcagg gtagtcatcg gcagctcctt    156720
     tacaccaagg ctgaagatag ccacaggctt ggcactcgta gtactgtcca ggttcacagc    156780
     cagagcaaaa ggacgggctg tgattactca gacaccccaa tggctttagt tgcaagacac    156840
     ctcggcctct ttgcatgaag ttccacattt gtttattcat gacaaatcct ccaacttcac    156900
     ctgtccaaac cattcctgct ttgtgtacgc attggctttt cggaatggcg catcaaatct    156960
     caagtggcac ggggcacaga gggccttgag attgtctgga tgattattct gaggatcttg    157020
     gtcaaggtga gccaccgtga gggtaaatcg ctggggcttt tcttcctcgc cctctgaagt    157080
     cattgggaac cattcagggt gcgtaatcat caaccagaaa gcaaagtgca accactcgac    157140
     gcctggcttg cgacagggtt tgccacactg ggtacaacgc cagttggccg catccttgac    157200
     ccgtgttgca atctcatccc agttatcggg gtaacgtgcc cggatcatcg gcatcacaga    157260
     acctccaatg tttgctgctg gggggctggg cacttccaat caaggaaagc cttgatcaca    157320
     tcacagtgac agggtttggg atgacaccag cccagcaacg ttacttcaga cttctggccc    157380
     agcgcctcca gcgctgccat cattgcacct cgaccgaatg gtttataact accgctgggc    157440
     ataatcttgt gctgctcagc aatcctgcga atcaagtctt ggctaggttc atttcccaga    157500
     atggcaacct catacaagaa gactcggaaa gccgcaatgc agcgatctcg ctctgattca    157560
     gcgaacatat ggaaaggatt gcctaaagga gtcccccgat cacatcgaac accgggttga    157620
     agctgccggg actttctcag attggcaatg tggatagtgg gcatgatgaa tactccaaat    157680
     ctctagctgt tggggattag caagcaatga cggtcatgtt ctcggccatc tcatgagcaa    157740
     gagcgaccct cagccgttgc tcatccgtga gtcctgcatt gaacgcttct aagacagcct    157800
     cagcggcttc catcctgcga gaataagggc cgaaggactg atgtctgagc gtggtgccga    157860
     cgtaattgga ttgaccctgg ataaagttga tgtagacata cccgatcaac cgactgccga    157920
     aaaagacatt gagcttgcgg tcgttctcac cagtcggtct ggcatggagt tcgtaggaag    157980
     gcagagcaat gctgtcgata actagtcggg gaagagttgt atgattcatt ttgaataacc    158040
     tcgttgaatg gttcgttcaa taaaaggcat cgtttgactt gtcctgagct tggcgatgcc    158100
     ttttactgtt ctgaaatgga tggcacatcg acatagccgc catggatcag tgcctctagc    158160
     atcagtgccg tctccatatg tttgagggca tcgacatgcc gccgttccga tctcagcgtc    158220
     gtcgcctcgg ccatcagata ggcgacacaa tcacggaagc actgggcttt ttgtcggtca    158280
     aagggaatgc gctcaatctc tggttctagc tggggccaga ccgctggatt aaacagtttc    158340
     tgggcaccac tgagcaataa ctcctgggat tgcatcaggt tttttgccgt tgctaccgtc    158400
     atgactgcca ccggagaata ggcgaggtta accgtaggcg ggttgagtag aaattctggc    158460
     aaattaaggt gatgggcttg catggttttc tccaaaagtg atgaggaaag gccagccccg    158520
     attgctgggg gggatcgcca cagggctgac ccaggtacag acagggggag agggttaagc    158580
     tgctttgcta acctgctcaa gcaaatggtt gtgtgcccag tcccaccaag agcgacgttc    158640
     ccagttaatc gctttgatgt cttggccttt tgcttcgttg tagaggggca caatcacagc    158700
     gtcgaggtct tcaaccgccc caggagaaac ccccgagagt tcatacacgg tatcggccag    158760
     agattccagt tcagttcgct taatggcaag ttgcttaaag aaggtctccc agctattgat    158820
     gcgagtgacc gtgagttgat ccatcagttc gtttagggca acgatcatca aaatgtcttg    158880
     gcctgctacc tgcttaagca ctttgaatac agcctctttt aggggagagc atttggcctt    158940
     attagttttt cgctgttcta gacccgtcgc ttccagggtt agcaatccga agagttcaag    159000
     gacatgatca cggtttcgca gattgcgatt accgtgatgc agctcccagg caaacttggc    159060
     gagtttgtct tgtcctgtgg ggtcatcagg tttgtactgt ttaacgatgt attttttgat    159120
     gttgaccttc tgagacttgc ttggatcgat gttttcttta gtggcgatat gctccttgat    159180
     ggctttagtt agagcgttgc gagtggcgtt attgtctaga gcggcagtca tggtttatct    159240
     ccaaaattga atagatattt gaacggttaa atgaaacgta ggcagattgc cctctcagca    159300
     gcaaatgaag tcctgaccat cagcctcaat ctctgaacgc acggaattca gtagctccac    159360
     tgggtaagag ggcttgggat tatctggtag agcagcgagg gctgcatatc tcaaagaaga    159420
     aaagatatct ctgggggtgg aatgttggaa ggtgtggata taggggttaa gtgacagcca    159480
     cagatcaaga gcttcgtcat cggtcaaatc tttgctactc agcaccaggc ggttgagaat    159540
     tgctgtctgc tggtcatgga gttcaatcgt ggtaatgaat cggactcgtg gaatgagttt    159600
     gtatcttgtt gtgggtttca tggtttgccc tctgaagcga atgggatgaa gaaatagaga    159660
     aagagtgaaa agtagatgaa ttgccaaaac aagaaccaga tgagggtgta accgttcatc    159720
     gttgccccct aagttttcaa aatctctatg gaatctgaac tgcttggatg attagtggct    159780
     cacccaggcc agggagatta atgctcagac ggcagcagca caacgccgta ttccacatac    159840
     agcttgattt ctggcaggac gaaatcagtg aaaggaatat cttgggtaat gacagggctg    159900
     caagtactgg ggctgtcttc gtagcaggct aagacagcgc tatggtcgtc gtttacggtc    159960
     agcaaccaaa gctggaattc ttggaggttg ggattgtact tgatgagtcg cactcgttga    160020
     taacttgcga tcgcgtcgag gagccaaaag gattcccctt tctctgcgag tgttttgacg    160080
     ccttctgtgt atcggatgcc cagccaatgc tgatagtgag attcactgca atgacaatgg    160140
     gcaagttcag cttgcagttc tgaagcggtg atcatgatat tcagtcccct atgtagcgag    160200
     tgggtgtaag tgaagcggga ggggcagagg tgccccagaa tattcctaga attcttcgtt    160260
     ttcggcttta atctggcgag tggtggggat ggtgcgccaa tcagctagcc agtggtcatc    160320
     accatagaaa gttttgaccc aactctctag gcgaggctgg atcagacctg gcttagattt    160380
     gacgggtgca tagacttcaa ataaatcgcc accctcacgt acaccggggt atttttcaat    160440
     ctgcatctcg actgcaatca cttcaggatg aaggggatca gtgacttgag agtcaacaag    160500
     ctgaagcagt tcagtgacgg tggtgggtgc ttcggttaaa gttgtcatag ttattgcctt    160560
     tgattgggtt ttaactaggg catccgagaa cttaccaggc gaccggatgc ctttgtttgt    160620
     atgtaataac tatatcacac tgagtgtgta aaattacaca ctaaataaaa ctatagactt    160680
     attgcgtgtg tataaaaagt acactatgat gcaagttgtc tagcactaat gcatcataga    160740
     tgtgtggtgt tggaatagtt gctatgacga ataaatcacg aatgacgcga attaacatca    160800
     ctgtcccgga agatttactt gaagagttca aagaatactg tgactcgcaa gtaagatctg    160860
     tttcttctca aattcagttt tttatgaaac aggcagttga gtctaatcag aaacagaaag    160920
     ggaatgaaag ttcttgatgc tgctgaataa tcaataaaag caactattac caagtggtga    160980
     gataaatgac caacagcaac ccccaacgat ggaccgatga tcggcttgat gcccttgcag    161040
     cttctactca aagcttactt gctgcaaccc aggctaatac taaagctatc ggggaaaatt    161100
     ctgaactcat gcagaaagtg attgaaggtc agctagcaat gcagacttta catggtcaat    161160
     tggcagagca gactttgcag ctcaagcggg ctgttgacta cttgctgagc aaagatggag    161220
     ggcaatcatg atcaatggaa tctgaagaga ttatcatccg ctactatcgc aatcctattc    161280
     ctgtaatggt cgatcctggt cagaatcatc cacgacatga gcatgattta ttactgggtt    161340
     ggatttgtca gggtaaggat agaagccccg tactcaagaa cttccctaat gctgaaatag    161400
     ttgctaaggc taagtctgag gctaagcctt atctaaccct agtgaagcaa tagtcttctt    161460
     tatcctgtct tttcccggtg cccacttatc cccggcagta atcctcacca cttcccccca    161520
     agctttaagc tgatttgccc tcgatagttt caccaatggc cgagcagcac tctcagactg    161580
     aggcagcaca ctaaaatgct cctgcaagaa caatacgagt tcagccgctt gaatacagcg    161640
     aaaagcatgg atgtaggtaa ccccaagatt ttcttccaca tacaccttga atcccttaga    161700
     gtctggtaaa tacagtttct tatcttgaat cgttttcaag gccaacccag aagacaacag    161760
     agcatcagat ccagtatcag ggggttccaa aaatatttct tccagatcag ccaaactctt    161820
     atcctgaaaa tctcgtaaat ccatcgcacc cagagtttta aggtttcaaa gccagatgaa    161880
     ttatagcaag ccctccattg tctgaaatct ttactaggca atatacaatc catagagaaa    161940
     gtgagttttt ctcatgacta aactaatcag taaattagtc tcagccaaga cctcagaccc    162000
     acaaggcgac ttgtcagcta actcccagat tgataccgct ccgcaactct cagttgaaga    162060
     tatctgggat accctggcag accgtgacct gtatcgactc tcaatcgaaa ttgattcagg    162120
     cttaagactc tcagcccgtc tagatgccga agacttgggc ttagatcctc atgttgtcga    162180
     tgagctagcg ggaggctacc gcaaagcctt ctcagaggca ttcactaagg ctcgaaatca    162240
     actctctggc ctacagaaaa agttcaacaa gaaattcacc atctacgtga agcccttccg    162300
     gtttattgat ggaagcatca tcaatgacgc cgttgacttt gcccaggaaa tcaagaaaga    162360
     agcggcatcc ttacgtcaag gcttagtcga tacctacacg gatcagctca aaaccttctt    162420
     agtggagcta gagcagaaac tcaatgaaac catacccgga aaaaagaagc agattgaaaa    162480
     agccctgatt tactatgctg gagaattccc cagtattgac gatttctcag gtagcctcca    162540
     ggtgattatc gatggcccgg tccagctcac ctccctgaaa aataagctca aggccgatgc    162600
     tgatttgcaa gctgagttag ccaaaaagaa acggctgaca gctaagcaaa agaaagaagc    162660
     tcaggagatt caagagcgga tcaaaaccag tcagcttatg ctcaatggca ttgctcaagc    162720
     agtgcaacag tctcgtgtgg cttgcctgga tgagggctgg gaactgctag ctgacctgat    162780
     cgaccgcttc ggtgctagcc ctgatgggaa gctcacaacc aaggaccagt ctgcgattaa    162840
     ctctaccttt tcccgactgg agctactaga gaagcacaac ccagagatat caaagcactt    162900
     ggccgaggcc cggaagctgc atgaagtgat gcagggcact cccaccccag agcaggccca    162960
     ggatgcctat gataaattct ctggattcct cgcccagcaa tccaagtcag cgagtggaga    163020
     aggggctgag aaacttcaga aatcccttca gtttaccaat gattacaaag cgttggtgac    163080
     caagttagag aagctgatcg aaacacccga tgccgagaca ttggccgaac tagaggcagg    163140
     gcaactcgcc aatattgaaa ccacgctcac ccgccgagtg acgaacctca aacgcctcac    163200
     caagaaagct caagagtcag ccaaatacgc caacgaacag gcagtagccc atgggggagt    163260
     ggaccccgta gtagggtttt aaaagttact tcgcttaaag cataccaatc tcttcaagcc    163320
     ttgtgcgtat ataagtctta tccgtaacct tacaaaaatc atttacctta caaagggttt    163380
     actcctgaga gactgtttta agaatctttc gatagtttta ttatcgctgg ctaaattaga    163440
     ttttaataat tttgtttaaa actcatatca ggaaaaatta tttttctata ttcgattttt    163500
     ttaaaaatat tttgcatagg agcattccaa tagtaacaga aaaatttgcc cagcaggcaa    163560
     caaataatat cgtaaaagct agttgaaata aacatttcaa gacttctgta ttttttatgt    163620
     ccttactctt tgaatggtag cttctgaata agctgtactg tgcgatcttt acctgtaatt    163680
     gagatattac aagcctgtaa ttcctttctc ttaagggttc caaggtagaa gctcataatt    163740
     atcctaatat tctaaatggg acagtccgac ctctactggg taaatttttc tgatgctatt    163800
     ggaaggccat aagaatagat aaatatttaa atcaatctca tacctatgtt tatgatcccc    163860
     aattgttcaa ctattgcttt actctctgaa tggcccatta tccaataaga ttttggcatt    163920
     ggggatcaaa tctaaaaaat cattaaaaaa ttcgcttacc ctaaaaatgg tggtgctaaa    163980
     gtattcacaa ttaaataaac aagttcagtt ccgggactag aactcactat tgatattgga    164040
     ggtgagttta atgctgaaaa aaaattactt ctgggtgata ttaaaggcaa ttgtaaatat    164100
     aattctttat acaatagaga attatataaa tgaacgttga ctagtattta tcgtattaag    164160
     gctagctcta cagaagttag agctaatcaa tctctttggt atatctggca agggatttag    164220
     tgataaggag taaaacgaca taaaaattat cccaagcgaa ttgaagacat ctgaaggttc    164280
     tgaaaatcaa tctcttcaga tgtcttctga tagcaagaag caattgtaaa aactactgat    164340
     atatggaaat ataagaccca ttcttactta ccaaatcatt tagtataaga gtatatttta    164400
     tataaacaac ttttggtaat caaaaatatc aatcgataga tttatcttgt tgaaaaacca    164460
     taatatcaac tctatagata ggattttcat gagattgatt ttatattgaa gcttgttttt    164520
     ttaagagctt actaatattg cctaggctat acaaattctg tagagaaaac aaaaatctaa    164580
     gctcatgact gtacttcaac tcaagcttca gacgctacga aaagaactca atgccgctca    164640
     cctagagcgc aagtctgtga ttgatggctt gctggctaca ttgttggcga accaaaacgc    164700
     cttgctgtat gggccaccgg gaacgggtaa aagtttgata cttagagaga tttgctctgc    164760
     gatcgcagat gcgaatttct tccagcgctt gcttcacaaa gccatgtctc ctgatgaagt    164820
     cttaggccaa atcagcctta aagcattgaa acaagacatc atgaagcgca acaccagcgg    164880
     cagacttcaa gaggctcact tggcttttct agatgaagtc tttagaggca atggggtatt    164940
     gctcaatagc ttgctggagc tgatgaacga gcgcacctac gacaacccag acaaacagaa    165000
     aagccccctt cgctcgatag tcggtgcaac gaactcgatt gactcaggga gcgacctaga    165060
     agcgtttgcc gaccgcttta tttacagacc ctggattttc gatctaaaaa acccccagct    165120
     ctactaagaa gctgttgggt tggactatca aaggcaatcg gccccaggtg agtcaaggtc    165180
     tgatttcatt agccgaactc gatcagatgt gcgctgagat tcaacaggtg aaattcaccg    165240
     atgccatggt ggatgctttt actgagatta tccatgctct gatccgggat ggctttgtga    165300
     ttagtgcccg ccgcagagta aagttgctgc agcttgttca gtgttacgcc tacatccaag    165360
     gggacgagca agtatatcta gagcatttgc atgagttatt acctcagtgc tgctggaaat    165420
     caaagattga ggaaattaga gaaatcaaga agctgattga aacctcagca cccatcgcga    165480
     aaaagaaatt agcggatatc gctaaagctg ctcagggtga agtctcaagg ctggaagagc    165540
     aactgaataa tcaaatgtta gaccataccc atcatgtcaa tgccgctgat tttgcccgga    165600
     cgcaacttac caacttatcc agcagcttag acaaggttca ggccgaccta tgccgcaatg    165660
     gagccagcca gaaagccaaa gctgagaccg aactaaaagc ccaatcagac cgaatcaatg    165720
     agctagttga aggcttgtat taatcatgta caccgaactc aaggcacagg acctaaaccc    165780
     catcaccacc gaagtcagcg aaacctctaa gctgttttgg caagactatc tcaactcaaa    165840
     tcctgcaatg gtggaggtga cctcagagac caatatcaaa accctcaata gctttgctct    165900
     agaagtcttt caccgtctct attactcccc cgatcctgaa tggttaccgg aaaagccaga    165960
     acatcaatgg gcgcgagtgt tgcacaacca gcttagtgag tctgaagaat tccaaaatct    166020
     aaccctgaca tgtgcgggtg atccattggg ggcagcaatc gccgcgcaat ccatgatcac    166080
     caatctgtac cgacagcttg aagaggccag cgacgaacag gaaattgatg aactggatac    166140
     cctgagagcg caggcccgac aagcgaagcg ggatggtagg gaggatttgt ttcagcagct    166200
     tcaagcccaa gggcaggcca tgtcccaagc agcccaagcc tttgcccaaa agctggaaga    166260
     gaaggaaggc gaaggcatcg gcgagagtgt tgaggatgcc gagggagaag tacaggagaa    166320
     aaaagacgag ctagaagcat tgggaatgag ctgggggaat gagtcgggtg accgcaatcc    166380
     cactcccacc ggagagaaac taaagcttgc ggctttgatt gaacagcggc cacaactcaa    166440
     aaagatacta gccctcgctg gaaatgcctt ggagacagcc aaccgcaaac gccgacaaca    166500
     ccagactgag acgggatatg gtgaactagt ggggattacc acggggaatg atgtctcaca    166560
     gattttgcct caagagttgg caaggctttc agattccaga cagaaactga gtttttatcg    166620
     agactttcta gaaggtcagt tgtttcagaa tgacttacag gccccagagg agaagggcaa    166680
     aggtccgatg gtgatttgcc tggattgctc tggatcgatg gttaagggca accgctttct    166740
     ctggtcgaaa gccctgatcg ttgcgttggt gaagttggcc aacgagcaag aacgggtggt    166800
     ttcgctggta ttgtttgagt ctatttgtta cgaccctatc tatttccatc ccagagaaga    166860
     tattgaccag ctgatccgat tgctggtcac gagtcccacg gatgggggaa ccgagtttca    166920
     aagaccactg gaacaggcca gagacatcat tgagcaagac gaggactaca gcgaagccga    166980
     tattgtcttt atcacggatg ggattgcgcc attgagttct gtgttcttgc aagagtattc    167040
     agattcccta gaaaaattga aaacagatct ctttttatta gagattgagc caaagcaggg    167100
     atggtcaaac gaactcagga cgttggcgag tcagtcatgg gtaattgatg cgaatggcaa    167160
     ttttgaggag ttaggggctg tatttacggc ttgttagttg gtaaaaaaca cggagacaaa    167220
     atcaataatg cacactagca aaaacttatc aatttcgtcg tcaatgatta gtaattgcta    167280
     gtatccgacc cttgtaatcg aatatcaagg aatttatact gattctataa gcaaggttcc    167340
     caattacccg aaattggcga gaaggcatct cgataaacgc ccgaccccgt gatcgttaga    167400
     tcgggccgga atgcggatcc accgcaacac tacaccaatg gagcatttag acaatgaaac    167460
     tatccgaaat caaggaagct gttatcgttg cctttgcaaa acagcaccaa atttctgtaa    167520
     ccaccaccgc agaactcaag caggctgcca aacagctttg gcctgagcag acctacaact    167580
     tccgaaaagc tcaaacctgg cttaacttcg ctgaaccgtt gggagtggac atcggggatt    167640
     attccgcacc taccccgagg catgatcgaa aactcagcga tattaaagcc gaggtttgca    167700
     agcactacga ggttaaagat accccggcac ttaaggccaa gttgaaaagc tggggaatcg    167760
     cttatgacaa actcagcacc cgaaaggctt gggaggagct gcttgcgggt tgcaaagcta    167820
     gtcagaaagg ccagttgatt gagctaatcg atcctttggg tgtggcagcg taaaactcga    167880
     cttatctatt cccctgactg taacggttag ggggtggatt tagcacgtag caacgggttg    167940
     gccagaatta tacgctataa gctctgaggc atttgcactt aaaaaaatgt tccccttctt    168000
     atcacgaatc catccttgtg cttcgacgat agtaggtggg gacgctgagt tggaagatag    168060
     attattgttc tctacccccg aggatccggg tttcacaggt aacttagaag aaggcgattt    168120
     ttgcttcaat aattgaggtt gtcgtaagtc ttgccaaaca gagggtggtg tttgtaagtg    168180
     gtgagggcct aatggaatac caccgcgtcc aatatccaca aaagtgctgt tccctaaagt    168240
     ttgacctgga cgacactttg tagtgatggt tttaggaaca acgattgttt cggggagttt    168300
     tttcaagcca tcagggaata aaattgctac aaaaccgttg atttgaggtt cattctgaga    168360
     aaaagaaaca atatcgctga aattagttaa ctggccactt gctcgaaaac caaacagttc    168420
     cttggcggta atgataatct gaccaccttt gcccactgaa gagctagcaa agatatcact    168480
     attttcagag ggaatcgcca caattttact agcagtaatc ttgatgtttc ctccatcatt    168540
     aattcctctt ccttctgcag ttattaagct gttgttgcgc atcagtaaat aatttctaat    168600
     ttgcaaatca atatcaccac cttttccagc actggatgtt gccgaaatat tcccttgatt    168660
     ttttagcaaa atttgatctg cgttgatatg caaagtccct gcgttgccta tttcatcgtt    168720
     tctaactgta atttctgcac catcgcttac tcttagagct ttggtttgga tcgaaacact    168780
     ccccgcttct cctgtgggga tgggagaaac ttgaaaccca ctttgcaatt cggggcttaa    168840
     ctgaattgtg gacgaactaa tcaagctggg atcctggctt ccttgatcta ctccactaac    168900
     tataatttca tccacagcag tgataatgac gtctccagcg ttaccgccag cgaaagtagc    168960
     agcatccacc cgagccccat ctttgattaa caagcgcttt gtctgaatga ataaatcacc    169020
     tgcgttacca ctcgctaaac tagaagaaga taatgcattg ttagcaccaa caagcacgat    169080
     tccatctgaa gccgaaacct ttatattgcc tccttgacca gcggctaatg tggctgatgt    169140
     aactaatccg ccatccttta ccctgagatg ctttgttgtg ataattatgt cccctgcatt    169200
     tcctacccca aaggtgcttg tactgatgaa gctcaataaa tttggatcaa atgatgttcc    169260
     aattacatca ataaactcag tagcattaat gactagggtt cctcctgagc caaaacctag    169320
     ggtattagca gaaataagtc ccccttcttt tagtatcaga tggggagtag acagataaat    169380
     atcacttccg cttcctgtct ctagagacgt agtaattaaa ccactactag taccagtggt    169440
     tagattcgta ccaatgagct tgatagaatc agcagcctta atcaccaaac gtcttccagt    169500
     ctgatttcct agattgccaa ttcgtataac agaaccatcg gttatggaaa cttgaccacc    169560
     ctgtacctga ataaaaccag taggtcctcc ctccatacca gtgccatcaa ctaaagcaag    169620
     ctcagaaagg tgaatatcac caaatctttg gacattttgg taatcgaagg tccatcccaa    169680
     tggagaagga gatataccta cataaccaga tttcactccg cctaattgta tgctcccgcc    169740
     gggtgctgta agtatactgc ccctcaaatc aagatttgtc cctagcaaag ccagtgtttt    169800
     gttaggttta acagtcaaat caaactcttg gctacctgta cgtcctgaaa aagtaacgaa    169860
     agggttcgtc gatgtcaatt gaaatcttgg acctttcgca ataatatcgg cagatcttga    169920
     gttgaactgc aatcctagtg gcacgccgat agttaaatta ggaagatttt gaggattttc    169980
     tgcactaaac tcaatatctt gatcaaagat caggctgctg gctgtagttc ctatgaaaga    170040
     gccattgagg tctagctttg aatgcgggcc aaaaaatatc cccgatggat tcatcaagaa    170100
     caagtcagca tcacccaaaa ctcccaaagt accaaagata ttggagcgat tgcctccagt    170160
     gactcgagtc agaataaggt tgatattact ggggttattg aaataaactt cctgaccagt    170220
     tccaacactt aattctttaa ggctatggaa cagtgtactt ccccttgaag caccaccttt    170280
     gattaaaatt cggttattct gtagctcaac gactgaattt tctctcaata atgtctgatc    170340
     agaagtgact tgagctaatc ctgatttaaa caataaactc cagattgata aaacactaat    170400
     caacaggact gatttgttca ttctcatcca catcacagtc agtgatttct atggttgctg    170460
     tttcaaaaaa aaatcgcgca gatccctagg aaagttgtca gagtaaaaat gttattttgc    170520
     ttgaattctt acaaaaatta atcttttcct ggttaaattt ttgtggttac ggagacaata    170580
     ctcctattac taggtctagg tagggtagac actgaataat ggttgtgaag caataccaga    170640
     atcgagatcg caaccccacc caccatgatc accttcacct ggacaaccgc agatcatatc    170700
     ctccaacttc gccaccaagt tttgcggcca ggattaccca tcgctgaggt cattttccca    170760
     gaagaccaag accaggaaac ccgtcattat ggagcattca gccagcaggg agaagttatc    170820
     tgctgcgtca ccctcattcc ctcaacctgg catggtgaac ttgcgtggcg actcagggca    170880
     atggcgacag ctccaggctg gagaaatcag gggattggca caggactgat ccgatacttg    170940
     cttgaggatt tacaagagtc caatcaagca aggccgattt ggtctaacgc tagggtcagc    171000
     tctgcaaggt tttaccggga gctaggttgg cgggaagtct ccgagcagtt tgagaatggc    171060
     aatgcgggtc tatcggtgac gatgctaaaa gaagagaaga cgctcgccgc agggcatgtt    171120
     ccgggggctg gtgttgtgtc gaagattagc ttgagatgat gcggaagtgg gcacccccga    171180
     aacgagcaag agtgtagcgt acctcagatc ggcaaggtcg ccatcgcaaa gccatggctt    171240
     ttctctgctc cctgccttta cttggggatg ctgcattgtc ggaattttgc gggatgggtg    171300
     cgggttttgg gattggtatc aggagtgaga tcgcaaagca atccgtgacc tttcttcctg    171360
     ggtcaattaa tcactcatct gctaattttc aaaatccata cagactttat attgtctagg    171420
     caatacagaa accacagaga atatgaaaat ttgggtatga gttccatcgg ctaatttcac    171480
     gtaccagtcc cgatcagagg ttgctcggtt gaactgctcg aatacgaatc tctcggatcc    171540
     aaaccttcgt gaattgtcct aaccctttcc ccggactcat aagctgttca actccctcac    171600
     cgagttgggt gataatacct tgccgccatc ggtcccaatc aacttgagca gggaaatcta    171660
     ggtcttcaca atattctgtc cagctcgatt gctggaactc tgaagcaagc acagaggctt    171720
     ctatctctct gacctggatt agatggatat caatcagctc ttggataaat tgaggatgca    171780
     cgaccggagg ctcgtcacca tcgaccaccg gaaactcata aaagagctgt aattcctcca    171840
     cagaattctt tttggctaat cttaggagtt ctaattgttg atgagtcaag gatggaatct    171900
     gagtcatgat tgaccgtttt gcaacagttg ctcaattcga tccaagcgtg tattaactcc    171960
     ttcaaattga gaattcatat ctttgcgtaa tagctcaatc tcaatcctgt tatcagcaat    172020
     tttgtcaatc aatctgcttt cgctggtagg gacaatagcg gcaacgctgg tattgatcag    172080
     gaaaaacaga ccaccgatca gaagaccaat cacagctaaa acaggaagca agtctttgga    172140
     taagtccacc aaagaagaga agcgggttgg ggtagtgtcc tggttgtctg aggtcatctc    172200
     aatccactga aattacatat caacggaatt ttaagttgtc tagtgtctaa attataacat    172260
     aaatcgaacg tatacattca tttataatga taattacttc ggcaagagcc actgaaaaag    172320
     acgatgttta agttattcct tatcattctt gggccaatca atagaatcat cagcaattgc    172380
     agcgttaaca atcgctgatc gtagccattg tggcctattg ttcatctgcc gaacgatttt    172440
     atccagactg gcgggtaagc gaacactcaa aggcgtgtct gctaatagct cattagagtc    172500
     tggagctgtt ttgccaatgg tcaagttctt caagctattt ttattgactg ccatggatag    172560
     agctaactaa tcaacgactt caagaatagc acagcaaatc gaatgtatac atatataata    172620
     aaatcctctt ggttgaatgt atacgttcga ttaatgctat aatactttca tgaaaacaaa    172680
     ggcaccgccc ccgactacca atctgaagcg atgcccgagt taaaaaccac aaaggaagtt    172740
     aactatgttc aatttaactg atgttgaaac ccccatcctt cgctttggta ctgagtttat    172800
     cgatccaaac ctattggttg cagtcgaagt ctacgaggac accctaggcg acggtgaagc    172860
     cagtcagccc gcaacaggga ctaaagccca cactggctac atagatggcg tttgcgtggc    172920
     ctaccgctca gacggcaccc cggtaagcat tgaataacgt ctttggggca cctctgcccc    172980
     tactcatttc aggaaaattc agaggactaa gacatggaaa ttattcaatc cacacctcaa    173040
     accactatcg ctaagctaaa cgaccgtttt cgccaaggcg atcactccct cggtaaaatc    173100
     tgcacgaccc aagccgttaa cagtcttccc tcagccgatc agcaagaact ctttcgccta    173160
     ctccgcacct tcaatgactt cactccaggt aatgaccctt atggagagca tgactttgga    173220
     agtattgaat ttcagggtga gacctacttt tttaagatcg actactacga caaatcattg    173280
     agatacggca ctgaagaccc cagtgatcca gcaaagacga cccgagtttt aaccctgatg    173340
     cattcaaggg agtactagag aatcctgcag cctatgccct gtcttaaatc agggcatttc    173400
     caaaccaata ttggtacaat gatattaact agggaaaaag aaatgacaac gacatccccg    173460
     gatagattag atcgcattga atctcttctc agtactcttg gagaggacat gcaaactgtg    173520
     aaagctgata tctccacagt caaagaagat attagtgaac taaaagagca aaccaccaaa    173580
     actaacgaaa aggtggaaac ttatcagaaa gctagtcaac aggttgtgaa tcttgctttt    173640
     ggtcttattg tcactgctgc tcttgcgatt attctcccag tggtcacaaa tcactagtct    173700
     ttcaccgaaa attttagggt ctgaagcccc gtacttcagg acggtattgt ctttgtttct    173760
     caaaggtact agccgacaca aactagtaca attgaactat gaagctgcgt tatcgctatc    173820
     gagtttatcc aacaccagtt caagccaatc gactggccca gatgtttggt tgcactcgcg    173880
     tagtctggaa cgatgctctt accttttgcc aacaacagta tgcacaagga ggtaaatacc    173940
     ctggctctac agccctaatg aaacagtgta ttaccaaagc caagcaaacc gaagaacgaa    174000
     gctggttgtc gtcagtatct gtcgttccat tacagcaatc tgtcagagac ttagaggctg    174060
     tttgagaagt tttagtgctc ctgcgctagc cttcgaacca tgagtcgaat catcgccaca    174120
     taaacaagcg cttcagccgt cctagtcagc acctcataat ctttattaag acgtcgagac    174180
     cacaacaacc atccaaacgt ccgctctaca atccatcgtt tgggaataac ctgaaacccc    174240
     gctagattat ctgagcgttt gactacttcc aagacatatt gaaaacggtc cattacccac    174300
     ttcatcaaag cttgtccttg atagcctgca tcagcccata tccgaactag acgggacaaa    174360
     ctcgcacctt ggcgttgagc tttccaaaac agtattttgg cccctcgttg gtcagagata    174420
     tttgcagcgg tgaccatcac catcagaacc agccccaaag tatcaacgag cacatgacgt    174480
     ttacgacctt tgaccatttt cccaccatca aacccaatca agtgacaccg aggattgccg    174540
     actttgaccg attgagcatc gcagatagcg gcactgggac tgggatgacg gtcttcactc    174600
     acccgcactt gcatgcgtag atgttcattg atttgactcc aagtcccatc atcgcgccac    174660
     cttcgaaaat agctatagac cgttgaccaa cagggaaaat catgaggtag ttgtctccac    174720
     tgacaacctg taaccacgag ataaaaaatg gcattgagaa cactgagcat atcagtggtg    174780
     cgaggtctac ctccaggttt agcagcagga atcaaaggct caagtaattc ccattgcagg    174840
     gtggtgaggt cgctatcata tgctgtaggc attgctctct aggtcctgtc cagtgtttgt    174900
     gtattgacag attagtacct tgagagcttt actcacttct caaacagcct cttagacgtt    174960
     gctttccgca acttcttcag ctctgtatca ggtaaacgca aaggtccaaa agtgcggatg    175020
     ccccggttta agaaacggca ttcaacccag acagctcggt ttaccctaag ggggttttca    175080
     gtgggcacga agctgtatct agctaagatt ggctccatta aagttcagtg gtctagggca    175140
     ttaccctcag agccatcctc agtaaccatt atcaaagacc catcaggccg atacttcgct    175200
     agctttgttg tcgaaaaaga gccagagtta ttgctctgga atgatacatc catcggcatt    175260
     gatttaggga taaccacctt tgccaccctc agcacaggcc agaaaataga agctcctaag    175320
     ccattaaagc gatatctcaa aaaactagcc cgcttacaaa agaccttgag ccgctgtgaa    175380
     aaagggtcaa atcgcaggca ggctgcaaaa ctcaaggtcg cacaactcca taatcggatt    175440
     aaagatattc gaaccgattt tctgcacaaa ctcagcactc agttgatcat cgagaaccaa    175500
     gagatcaatc tagaagactt gaatgtgtca gggatgctca agaatcgcag attgtctaaa    175560
     gcgatcagtg atttaggatg gcgacaattt agaaccatgc tggaagctaa agccatcatg    175620
     tatggtcgtg atgtcaacat catcagttgc tgggaaccca ccagccaaac ctgctcatgc    175680
     tgtgggcatc gagaaggacg taaacagttg gggattagag agtggcaatg tctcaattgt    175740
     ggcgttttcc acgataggga tattaatgct gcattgaata tcaaagccgc cggggggcac    175800
     tcggaggcga taaacggatg tcggagagag tgtaagtctg aagtcaattc agccgttctc    175860
     agtgatgcgt caactcgtct agtagataag cagttagaac tgtttgctag ctagggaatc    175920
     ctcgtgcctt taggccgagg aggatgtcaa agctctattt tagagagaca gtaagcaatc    175980
     aaatctttac ccaatcaccc tataacatca gggaacaatc caggattcga aatgatcaag    176040
     atggcatttt taggaatggt ggcgatcaac tgatcacgga gcttacccat gattcggcaa    176100
     cgggagccta tgcagggata tttaatgttg gccttgaact gagataaagt ctcatctggt    176160
     aaaaggccag ggttatcctg cctgacattg agagaatggt tcccggatga agtaaagtgc    176220
     atctcgtccg tcatgaaccc ctccctaccc tccggggttg aggaaggggc ttgattggtc    176280
     tcagccgatc actaagtcgt gactagacca tgagctgaat acaggtacgt aggtccgggc    176340
     gtttcccaaa ctcggacact ctgcaagcct tctgagaaaa ggcgtagcgt aacggctaga    176400
     aatcctggat tcagtggtct tagggacata caactcatta gaggattatc tccaacaatg    176460
     attttaagag tgccagtcat atcaccagag ggtcagcctc taatgcccac caaacctagc    176520
     cgtgcccgtc gcatggtcag agatggtaaa gctgtcggca aatggaatga tgctggagtc    176580
     tattacatcc agctcacagc agatccatca gacacccaga cgcaacccat tcatttaggt    176640
     tgtgatcctg gcaagtccta ttcaggtatc gctgttcaat ctgctcattt caccctatat    176700
     accgctcacc ttgttctacc tttccagcgg attaaagaac gcttgggagc tgccgtcatc    176760
     aagaacggca aagttatcaa aaatgttcgg ggtagggcat tacaacgtcg agtcaggcga    176820
     ggacggcgca tcaaccgcaa ggtgccgttt cacttaagag cacatcgtca gaagcgattt    176880
     aacaatcgtc gccaacccaa gcttcctcca tcaattaaag cctcaaggca gatggagctt    176940
     cgagtgatca aggaactgtc aaagattttc cccatcactt cgattgtcta tgaagtcgtc    177000
     aaggctgatg tagacagaac atcaggtcgc aaaggtgcta aatcagggaa aggcttctcc    177060
     cccgttatga ctgcacaata ttgggcgatg gaacaactag aagccattgc tccagtcata    177120
     aaacgtcatg gctggcaaaa ggatggcaac ggcactagcc agatccgtaa gcacttgggc    177180
     ctaatcaaat gtaaagacaa gaaagctcag gcacctgagg cccatgctgt cgatggcatt    177240
     gccttggctg caagtcagtt tactcgatat caagctagtc aatctgactc catggattgg    177300
     gttggttcta tagatgttac gccttgtcaa ttcagggtga ttacccgtcc tgcctatttc    177360
     aggagagcgc tgcactttga taatcccggc aaagggggga ctcataagcg aaagggcggt    177420
     actgttaccc cctgggtctt tcgctctgga gatttagtgg tgggcgaaaa agcgggcaag    177480
     gtattccgtg gatgggttgg cggctataca aaaaaagcta aatccgtatc cctctatgac    177540
     cataactggc gacgaatcgg gaagtttgtt gtttctaaat gcacactact tcggaggtca    177600
     aataagttat gcgtagccta gaagattgcc agccttcgtc tggccgctat ccccctccgt    177660
     cttgcttcgc tgaagacgga gatccacgcg gttttgttgg gtcgatgctg aacacaattt    177720
     acgccaaagc atcggcaagt aacttttggc ctcactcggc cagcgctggg tgaggcctat    177780
     cgccagtttc aaatctgaat cgctcgtgaa ttttctgata ccgacacatt ctctttaatc    177840
     tcaataacag aaggttttta tcatggctaa caacctgctc atcattgacc cggcagaact    177900
     tcagccagtc aaccacctca ggcctcgaca agccttgcta gcagctttaa ggacaacgca    177960
     caaggcaggc tggcacctgg caatgatttc agatcaatcc aaaatcgcaa aaggagagcg    178020
     cagcttaacc gaagttctag attgccatca agccgcaatg aatcgatatg accaattaat    178080
     tggcgtaagt atgttcacga caaaccaggg cagtgaaatg gttgtaacac ggtgtcaaat    178140
     ccctgatatc ggcatattca atactcaatc gaccttaact cagaagattg caaagtcctt    178200
     tgatgcaaca atcacaggcg attggttttt accgccaaac cccggcttgc taatggcttg    178260
     catggcgtta cacagttcca catttgagac gactgtaatg gtcggcactg gcagatttga    178320
     tgccttggct gttcgcaacg gtctgttgtt aatgcatcct gaaaccttcg aacagaaagg    178380
     ggtcactgtg gggcactccg ctcattcagt acaacaaaca accctgcaga taagggacat    178440
     gttagggcag aactattctc taaccgaaaa ctagtcatcg taatagctct atcgccctgg    178500
     ttgttacccc agagttttaa gccagggctt cattcaattt tttaaacctc agtaatcttt    178560
     tcaccagcaa ttttgttgag gatatatatt gataggaatt gggagtgggc tatttattct    178620
     agctgtaaaa tcgctttcct tgggtatttt cctaagaaaa aagtcaatag aaaactaaat    178680
     attctatttc tatccctttg gttttcctaa gtcagtttgt ttaattggag gcttagtagc    178740
     tgatgaaaca aaaaaataac ctgtaacagc ggtaacaatt ggcgttaaga atgtataaag    178800
     cctattagat gttgaatcca ccatggcatt tgccttttca ttcaattgaa tttcttgttg    178860
     atgaactaaa ctgattgttc catcttcttc tagctgaggt ttgagagaag atatttcatt    178920
     agcaaacttc ctagaagcct caaaatgtga ccatgctaac attcctagaa gacaccaaag    178980
     actaagagct aatattcctg atccccataa tttcacattc gatctaaatt cttcaggttt    179040
     ataaaagttc tccatccagt ttctataaaa ttccaaagaa ttttccaaaa tattttgatc    179100
     ttctaaagtt gaagcatcgt cagtatttat agaatttttt ttatggccgc ttaaatcttc    179160
     ttgactcatg tattcttacc tgaattgtaa ataattaaat aagtgtaatt acctgaattg    179220
     acttgggtca cactatcaga aatcaaccaa ggctgacaag aattagtgtt tgattattta    179280
     caatttggac ttatctctaa tcaactacct ggtaagagaa gaaaaaaacg ctcgccactg    179340
     ggcaggttcc gggggcttgt gttggatcga ggattagtct gagatgatgc gagagttgcc    179400
     cccgaaacga acaagagtgt agcgtacttc agatcggcaa ggtcgctctc acaaagccat    179460
     ggctttgctc cactcactgc ctttatttgg ggatgctgca ttagacctct tgcataattc    179520
     cactaccgat atggaaaagg actaaaaatc caagccagat cgcggtattt tttgcgtaac    179580
     tagcacatca tgaaacgaat attgcaagag gcctattatc ggaatcttgc tggatgggta    179640
     agagcttttg ggatgctatc agggatgcga tcgccctcat tagtaagtct ttaactcttt    179700
     caggatgcac ttaatagata acctaaacct agccctaaac cagcggaggc atacagcaga    179760
     aaacctcgga caacataatt tagagtccct tccaagtttt gtgcagcgag gtttaatgtc    179820
     atccaaaaac ataaaaccat aaaccatcca ataaaggggt taaaaccaat cgaactagct    179880
     gtataaatcg caagcatcgt cagaaaacta ccgaaacaaa ataaacccac tcttaacttt    179940
     ttcaaccaaa cgacatcact taaagttggt agtgaaatac acccaaccaa tgcagcaatt    180000
     cctgttaact ccactattcc aaaccataaa ggtgccaggt gatagcctaa taccacgcca    180060
     ccaatggagt taaccaatag ccatacaatg atgctgctca tagtcgataa tttgagcatc    180120
     aagacttagt aagcagccct tcattttcag ccccgatcct cgcctgttgt ctcaaccaag    180180
     ctgtaagctc tcctttgcct ggatacttgg tggcaagggc ttcatatact tcttcttcca    180240
     accgaatact cagcgactta gcaagcttac cagtcgtatt gtctgccctt ggtaatggtt    180300
     ccaggtggtc aaaagtaggg ttaggatttc ttcccatatc tgaatacaca tagttacgag    180360
     acaagcctag cataagcatc agatatatgc ttgcattcaa gcctatatat ctatggaaac    180420
     ttaatgctca aagtatacag aaataagata taaacaagtg taaacaatct ctttatatgc    180480
     ttgaatgcaa gcatataagt gttataatgc ttacatgcaa acaaaggcac cgcgcttccg    180540
     accaaagact cgcgatgccc tagttaaaac ccaacaaagg attaactatg accactttac    180600
     tcaaaactcc caccaccgtc actgaacttc ttcagcttgt tgatgctcaa gtcactgatc    180660
     cactccatcc agaagtcatt gccgttgaac tgcaaatcga gcaatacccc ggtgtacgtg    180720
     agggtggcga cttgtttgaa gtcctcgctg ccgtcaccag caagcctggt cttctcggtg    180780
     atcgtctccg ggcatgggtt cagtctgagt atggcaatga ttaccgctta gcagattggc    180840
     gcaccatccc caccactcgc cagatcgaag ctgagaagaa ctttgaagac gaattctaag    180900
     cacattcggg gggcaacacc gccccccaag ggatattgcg caataatgat aataagggag    180960
     agacaaatga attcatcaga cacaactcaa atgccccaat ggctggatgt cttagcaaag    181020
     cttgcaacga tagtcatcgc tattgtcgct ctgatttcag ctctagctag tgtcaatttc    181080
     ttcgttgtta gatctgttgt tgcagaacaa attacacctc aattccagca aatagatcag    181140
     cgatttcaac aggtcgatca acgacttcag caaatagatc agcggttcca gcaggtcgat    181200
     caacgatttc agcagatgga tcaacgacta gagcggattg aaatcaagct agacaaaatc    181260
     acgaattaag tttgattttc tccaagtacc ttagtttgaa gccaaggtac ttggagattg    181320
     tttgtttatc ccatctcgtt aagcttagtt acctaggtaa cataaatccc ctgaagaatc    181380
     tgagatttca tagcttcaaa atcattcaac ggtatttcat aggaaggatt gcagagcctt    181440
     ctaagcagca tttcaagcat gggattatcg ttgttgaact caacttcagc cagtagatta    181500
     gaggccgaga aattgtacat aacaacccta gttttttcag gccactcttg aatcagaaac    181560
     cccatatttt tagcttgatt gctaaacaat gattcattca gggcaccaac actatttttg    181620
     ctaggagtat cagagtaaga agccagctca aaccctgaga aatcaccgtt aattatggtg    181680
     ttggcaacat tgagtgaccc gaagagtcga tccaagttca tcgttttgat tcatcttcaa    181740
     taaataggta atacagattc tctacagaaa ttgaaatcta ggaagatttc tgagttttca    181800
     aatcattgat ggtttctcga atgcgatcgc ggcattccaa catccccgcc agcgctgtaa    181860
     gtgctttttc ctccgcattg cccccctgag cggaatcctc agcagggcct gaatcaacgg    181920
     ggttcggtgg gttatctgtc atggaaaaac tctcattttc tctacttgag aagcaaaatc    181980
     caggcaataa tccctaagac ccaaccaatg gggcctgcga ggagcaataa gggggtaatc    182040
     aggatcagga gaacgatcag gcaacctttc attagttttt ctccacaaaa tagttttctt    182100
     ccaataatcg ggcgatggtt ttaagatctt gttctggtta atctagggtt actctcatgg    182160
     tcaagcctct gtagattagg taatacagaa tccagcaaga atctaagtta ttccatctat    182220
     cctcaaagct gctcgtcatc tgatgaacaa gctttccttg aggcttccaa agtctgaccg    182280
     ccgacccaaa aacatagcaa aacagaggac tagacggcgg taaccattcc tcgtttttac    182340
     ttttggttga tttgtaccac tggggcaggg gtgtcgctag gtttattaag ggacaccccg    182400
     taaagagtgg cccatacacc gatagcaagg ccaagcgcta tatgtgcagc cctaaacagg    182460
     taaccttctt ttcggatatc gctattaact cgtttaatcc tttgggcacg ttcggcctgg    182520
     tcttgctcct tttcgatcat tttccaatgt gcatatcgtt gctgaatggc agcatcatta    182580
     tcagcaagca agctctccag tcgggctatc agctggtgct cgataatagc ggtatagtcg    182640
     tcgccgctcc agaaatttcg ttcgccgggg gcttttttcc ctccatactc cgctgcaatc    182700
     tcaaggtgaa ttgtgcttta aattctggat cacgtaggct tttggcaatt tcttggcggt    182760
     agcaatataa gaaagcctgc tccaatcttt cctgttcctc tgcggcctta tcggcaaagc    182820
     cttgcattct agaaagggta atggttgccg ctgttttccc cccttcatta atgaatgtca    182880
     gttcttcagg gctaaggcct gctagggggt tgtcctcgcc atcggcaggc ggtagatcat    182940
     atgcctctgt gagcttcacc ggcttatctg cggggggtaa tactgcctct tccgcacttg    183000
     caccgccttt aaatcgctgg caaatatccg cgaaggtctc gcggtactct ccgagagtcg    183060
     caccggcttg agtgattgct gaggccaatc tatcgtactc ctccggtcct aagccttgct    183120
     gatcggctac ctttcttaga taactttcta cgtagctcca gccgttcgcg ttatggccct    183180
     cgttaatggc aatcagtatt tctgactgct catcatcaaa ctgtgtaagg ccttcccagc    183240
     cgcaagcttt tagaattttg cctagggttt cttctgagac ttctaacagt tggaggatat    183300
     cgtctagatt gtgcatggct tggtttacct tttagctaat cgcggggaag ccccgctttg    183360
     tactgcaagt gaaacgaagc ggtcaacgtc gggatgagga gcggtgaccg cagggaacaa    183420
     ttctagggac tacataacac ctccctagaa aaagctataa taagaacatg ttcaccatga    183480
     cgtaccgcta ccggatttac cctagccttg agcaagagac acggatgttg tcttggcttg    183540
     agacttgtcg ctctgtgtac aactatgcgt tgagagagcg aaaagattgg atcggtagcc    183600
     gtaagtgcca gatagacaga tgttctctgc agtctgagta catcattcct gcagatgctc    183660
     cctatcctgg ctattaccct caaaagaaaa acctgactca ggctaagaaa gtcttgccac    183720
     acctgaagga tgtgcattct caagtattgc aagatgtttt gggcagggtt gatgcgtctt    183780
     ttgaggccat gaggcaaaga ggtcacggtt ttccacgctt taagaagttt ggacaatacc    183840
     gttccttcct gttccctcag ttcaagacca gcccagttca gggtaatcaa attaagttgc    183900
     ccaagattgg ttgggttccg attaccttgc acagacccat acccgatgat tttgatatca    183960
     agacagtacg ggttgtccgc aagcattcgg gctggtacgt cgtgctgtgt atccaagctg    184020
     atgtctctat ccctgaagtc ccacctcatg ggcattcgat tgggattgat gttggtttgg    184080
     aatattttct gtctacaagt gatggcgagc aaattgctag acctcgcttt ttcaacaagc    184140
     tccaccgcaa gctggaattg ctgcaacggt gcttgaagcg aaagcaaaaa aggtcgaacc    184200
     aacgcgccaa gctgattcag agaatagggc gagtgcatga acaaattgcg gcatctcgac    184260
     tggactggca atttaagctg gcccatcacc tgtgtgacca agcccaaacc atctttgctg    184320
     aagatttgga cttccgaatc atggcaaaag ggatgctggg caaacatact cttgatgcag    184380
     ggcttgggca attcctgaat gttgttctgc cttgggtttg cttcaagcgt ggagtttact    184440
     atgtcaaggt tgaccctaat ggcacgtctc aagaatgccc tgactgtgga gccagggtaa    184500
     agaaagactt gagtgttcgg attcatgagt gtcatgagtg cgggtccgta aagccgagag    184560
     atgttgccag tggtcaagtt atcaatgccc gtggtctatc gggtgttcaa attgcaagtg    184620
     gacgggatct atcggggttt caggtgactg atgctagaca agaccggacg aagcttgaat    184680
     atttcaagag caatcttgag aagcccgcgt tgtatgcgta gcatcagcgt cgggagaagt    184740
     cacagtgtgc ttacttgttg gataggggag tttcagccga ggccaaaatc aattagagtt    184800
     tgcctggatc ggaagcttgc gaaactcggc gaggggcctc tctcggccaa tcaaatattt    184860
     ttgctgagct tccatcgttt cgttatcttc gacagggatt tgttgaactg ctgccagcac    184920
     tccaaaaagg gcagtgcagc taaaggagag ggcgaaccct accccaagag caacactagg    184980
     cttgtaattt ttgccgcttt tgatggcccg tcgaaggaag gctattgaga gcgcgaagga    185040
     gcagcccgat cctgcaatca aataaatgaa catgtttgag tccttatcaa tgcacctact    185100
     tttttaatag gtgggttttg gcttgggtca aaatcctgta tcgacattgc gatgctctcc    185160
     gagcggcctt aggctatcgc atcgctgtat ctcgaaataa ttaaccgaat ggatcaccag    185220
     caataggtgc tgatggtaaa tcgtcgtcat cgttatcgct gtcggcttcc caggtatcta    185280
     aatctggggt tccttcgtca agctgagctg tgagacctcc gggaactgga cccgccgcaa    185340
     agttcccgct ttcatcacca cttgcaaggg ttagtgcttc ggcttcaagg gcaagtttaa    185400
     aatgtttgcc aaccgtagaa agccgttgaa cctcgtcgaa agaggcacca tctagtgcgc    185460
     tccccactgg acccaatacc gcccatgcag cctgaaagaa cacctcgcta aagtcagctc    185520
     cgtagtatct cctcaaggca tgatactgac gagtgtgaat agagtcatga gggtatcgcc    185580
     tgccgactct aattaattct tgatccgttt gattagcttt cataggtgcc ccctttgatt    185640
     agtagatagc tatcggtaaa ccgattcttg tagccgctaa attcaggcgc actcagatcg    185700
     gggaaggccg ctgacatttc ctctaattca gtttttaggt atcgcagctt cggcccgaac    185760
     ttggccttaa gctctggacc ccagaccgga tggctacccc cagtcacata aatcttggtt    185820
     gcagtggtga gcgggcgaaa gcgatcaaac ctctcggaaa tcttaggcca aaccttagcc    185880
     ttagcgcttt ttaggatccg ccttgctgat tgcaattctt ccttgtccga gaaggcaagc    185940
     ttgagaccgt tcttgtttcg cacttcacga caaatcagcg tagccaaaat cagctcatcg    186000
     gaaacatgga tgccgcattc gttaatcaat gcaatcatgc ccattcccgt gagagtcaaa    186060
     ctctgcttgg tgataacgcg accctctcga acataaagaa tcgagatgtc tttgtgacca    186120
     aacatgattg caatggcttc ggcatcttga atctgagatg caatccccga accttcaggc    186180
     agtacccgga cccgtcgaac tttcacgttt ggcttaagac cgttgaacgt ggatccataa    186240
     atacctttct ctaagttcgc ttccaaggtc ttgaaatacc gtccttctcc ttgaggaagc    186300
     agcaccgtta gatctacata gccctcagta aagttctcag tctcgattgc tttgcccagc    186360
     atccctaatg ctcttaagct tgcttgttcg gctttttgtt gatggatatt ggtctcataa    186420
     atcccattcc ccgcactagc ccccacggtc caggctcgat ccttgtactc aatcacgcaa    186480
     ctatccgctg tcaagtctcg gatcttctct tcctcaaccg cattatcttg agcgatccaa    186540
     tgcaaattat tgtcgatgta gtagcatccc ttccccaggc ttgaacccaa gtcagtgcat    186600
     atcgtcaaat ctcgatccat gtatcgaagc tcctatgttt gttgttctta cctatgtaat    186660
     agggggcttc ttcaacacac caaaatgcta tttttgtgca atcttatgta gtgcatctgt    186720
     agtttttatg tagtacttca gtgcaatttt atgtagcata cttgccacct agctgtagta    186780
     tttccccaaa accgctcaaa aagggcaaaa atcgaagtca aaaccacctt aaaacctttg    186840
     tgtgtctacg tttcaggctc cagaaacacc cgatttctcg aaaaagtgat accacgacac    186900
     gccacactga gccacaccga ttgattttgt gccacatcta gcgactttgt accacggacc    186960
     tgctcaccaa tctctataac ccttgcgtgg tcacggtttc agaggccgaa aatctttctg    187020
     tggagagaag ccccccaata tacgcctaat cgccattaca tgggcctgga tcggttggag    187080
     gcgaaaattg cgtttttcag gattttttgt cacacgtttg aaacttttgc actacagaaa    187140
     tgtagtgttt ttgaaatatt tatgctacat acttcagcag taaatttgaa aaatgtggca    187200
     agagggtaaa agggtaaagg gctactgaag aggcctgggc gcagaacaaa cgactcgaaa    187260
     accgagattg ctgctgaggc tcttggggct gtcgttgttg cggtaagcag agcggcaaat    187320
     cctcggatag tgtttccagg agccgccgcg acgaatccga ccagcgcttt cattcttaga    187380
     caaccaagca ctcccatctg tgggggcacc tttgtaactg tcatgccaat ggtcttggca    187440
     ccattcaaaa acatttccat acatatcact cagaccaaaa gcattggcta tgccgaagtg    187500
     atcgacaggg gttgtttctt cgcccacata attagcgaca tcattagtga tggtttcccc    187560
     aaaatagtaa ggagtggtgg tgcctgctcg acaagcatat tcccactctg cttcactagg    187620
     taatcgatat ggacgcttcg ttaggctatc tagtcgattg cagaattcaa cagcctcata    187680
     ccaagaaact tgttcaacgg gacgattttc gcctttaaag taagaaggtt ctgattttaa    187740
     agaacgctct actgtttcta attcagctac cactttccac tgagcttgag tgacgggata    187800
     acgtgacata aaaaacgccg gaaccgtcac ctcatgttgt ggatcttcgc ggcccaatcg    187860
     atcaggctca tcttctggag aacccatcat aaaggtgccg cccggtacga gaaccatatg    187920
     gagaggcaaa gcattgggaa tctctaacag gggttcaata tatccactgc cagtacgagg    187980
     ggtgcgtcga agggtagggg ccatagcagt tttttgtagg agggccagct aagttttcgg    188040
     tttccctacc aaagtagcca gcccaggttt atttttggac agcccaacgg accatcactg    188100
     gaataggctc tggactcttc tggggcacac ccgacagatt cccatctgcc agttctggcc    188160
     tgctattgct agcggtagaa gagtgctggg cgcagaacaa acgactcgaa aaccgatatt    188220
     gttgttgcgg ttctcggggt tgttgttgtt gcggtaagca gagcggcaat tcctcggatt    188280
     gttgttccag gagccgctgc tttgcggcct accccagaaa ttagcataac tggactgacc    188340
     ttattgatgg caaggatact gagtttcttt atgctgaatg gcgtcctttc tttgatcaca    188400
     tctaacgatg aatactgaat tgcccatcat ccagaaaacc tacgacctga ttaaatggta    188460
     tgtcccgatc atcaatcgat tgcccggagt tcatcggttt caactgggag aaaagagcag    188520
     accattaaaa ttcgtaaaag ggtaagaggg tataggacta cggaagagac ctgggcgcag    188580
     aacacactac acgaaaaccg atactgttgt cgcggaactt ggggttgtcg tagtagcggt    188640
     aagcagagcg gcaatacctc ggattgaagt cccaggagcc gccgcgacga actcgatatg    188700
     cactgtcatt ctcagatatc caagcacttc catctgtggg gccaccatca taatcatgcc    188760
     aatggtcttg gcaccattcc cagacattcc catgcagatc actcagacca aacgcattgc    188820
     ctccaccaaa gtgatctacg ggagtcgttt gttggcggta ttctcctttg gggccaccac    188880
     cataggaccc tgacaagccg atagattcat caccaattcc atcgtaattt gctaggtcag    188940
     tggtaatcgt ttctccaaag tgaaatgggg ttgtggtgtc cgctcgacag gcatattccc    189000
     actctgcttc cgtgggtaaa cgatattgtc gatttgtgag gttggtgatg cgatcgcaaa    189060
     actcaactgc gtcataccaa gacactttct caactgggtt gaggtcacct ttgaaattcg    189120
     atggttcaga atctagctcc cgattaactt gttccatcgc tgctaccacc cgccattggg    189180
     cttgggtgac ggggtattga gccataaaaa accgagaaag ggttacctca tgctgcggtc    189240
     cttcaaagtc tgagcggtca acttcctcat tcggagaacc catcagaaaa gttccagcag    189300
     gtatctgcat catccgcaaa ggcagcacgc cctcagcaag aatctcgtcg tagaactgga    189360
     gtggggcttt ggttttggtt atcgtataac tcactggaaa attcttaaga aagtaatagg    189420
     gtaaaagggt aaagggctac ggaagagacc tgggcgcgga acaaacgact cgaaaaccga    189480
     taaggttgtc gcggccaccg gggccgtcgt tgaggcggga agcagagcgg caattcctcg    189540
     gagggccgag ccaggagccg ccgcgacgca tccgacgagt gctttcattc tcagacaacc    189600
     aagcactccc atccgtgggt gcatcatagt aattgacatg ccaatagtct tggcaccatt    189660
     cccaaacatt tccatgcatg tcactgagac caaacgcatt ggcaaaacta aaataatcta    189720
     taggtgttgt ttctcctctt ctttcacctt ttggaccatc tacaaaagca cttccgctgt    189780
     agttagcgac atcagtagtg atcatgtcac caaagtggaa cggggtagtg gtgcccgctc    189840
     gacaggcata ttcccattcg gcctccgtgg gtaatcggta ttcacggccc gtgtatctag    189900
     aaagacggtc acaaaactct atcgcgtcga accaggatac tttttctatt ggcctattat    189960
     cccctttgaa tctagctgga tcagtctcta gttcacgctc aatctgaggt tgatttgcaa    190020
     cgactcgcca ctgagcctgg gtaatcgggt aacggcctat aaaaaaggac tcaactgtaa    190080
     cttgatgctg aggaccttca cgaacaagcc tctcaggttc agtgtttggt gaacccatca    190140
     taaaggtacc agcaggtatt gataccattt ctaaatctat tttatctagt agccgctcta    190200
     tatatctatt tgctgactgt tggtgttgtt ccgtttccca ttttttctgg ctcaaaatca    190260
     acttagcaac tgtaaaatca aaggattcca cattgatcgc atcagatata gattcctctg    190320
     gctgcaacct taaaatcgtg aaatctcctg tttgcaacgg tggcggaaag atatcttgtt    190380
     gagaaggcgg tacaaggagt ggatcatccc aaaggaaggc tagatcccta gcccaatgga    190440
     ataatggatt atcctctgtt gctgcaagac gaacggcgaa caccttcatg ggaatctgct    190500
     ccattgttcc gttgaggatg ttctcattaa gaaactgttg ccaattatca gtgatttttt    190560
     ctttacgact ccacaataca attggagtac cattttcaag tactcctcta acttctgcac    190620
     tttggaaacc agagccaagg gtcaagccta atcgagagcc ttgacttaac gagatcagat    190680
     cttcaggttg accaaagggc caattatcaa atgcatcgtt ggaattatcg ttccaacgtt    190740
     cttgcaactg tgcccactgt aattgcaatt tttgggtata ttgaagactc tcaacgcgct    190800
     cttttaagcg caacactaca aaattacagt ccctgccaat ccctatagga tcatcggtat    190860
     ttgatagaga ggggatgccc atctgttcta tcggtaaatc tagtaaactc tggggaagaa    190920
     acagatggat agtgaaaaca gtcttttcag tttgggtacg ggcttgctct aataagctgg    190980
     ctaaaacact tggaatatct tgaaaggtaa tcccctcaga taatctagag tcgctactac    191040
     catttccgta tcgattgata tccaaggtag ataaatactg aacaccttct cctgtctggg    191100
     cattgtaatt cttgggattt ggcaccaacc aagcgtcgac aaagtactga tcggccttgg    191160
     gactacgttc atcaaacgag ataagtaaag tagtgagggg cactttcgga agaatttcta    191220
     tgtcattggc aagtacccct tcatcaaact cgaatgcttc gagttcaggg aagttgatat    191280
     attctgaaac ttggtaggtt agggtctcat gggtgaaacc ttccaaccaa gccacttcat    191340
     tttgacgatt ttctaagcct gaatcgtctt gcctctgttg actctctaat tggcgcacga    191400
     tttcagcaaa atctgaccca gctgtacgta aaatctgagc cgtcactttg gcaaaggctt    191460
     ttaatccata ttggtctacc tcatctttca gatcaggaga tagtaagaga gcttggaaat    191520
     cagccagtgt acaattcaat cgttctgcga catgttgaga tactttttcg atcacctcaa    191580
     gcttgtctac attgggtaga acatccagca ggcggttgcg taccgtctct ggaaaaagat    191640
     attgtacgac ttcagactct aactctggtg gttgttcagg tgctttggtt agtagccctc    191700
     ccaaaaacac ctcggccaca ggtagggggg atgaaccagg taagaactca tctgaagcac    191760
     ggataagtcg cattacaggc agagttataa caggtgctgc ggataacaac gcagctaatc    191820
     gccgagcttc tggcgttgcc cttaaccgaa agtcttctag caagccatca acaatttctt    191880
     ctgactccaa ttcgctggat gttggggttg cggaccatcc tgttgaaggc aacataaagc    191940
     ctggagctga gtagcgtcga tctcccgcta acattcggct ccaagcacca agatattcac    192000
     tatcactcgt gatgatagga atacagactg gtgatgagga ttgggtttcc tgggtttggt    192060
     ctggttcttg atcactccga cggcgaccac gattcacagt tgatcgcaaa gacatataaa    192120
     ttggggttag tttggtgttt tttgctcccg gtgttcgact acgaacagcc acatactctc    192180
     caatccctaa tgcagttcgt ttccacatcc aatcgggtaa cacttgccag atcgccgtgg    192240
     gtgttgaatc tccccaaagg gacaatattg gctgcaacga accatcccac cagtagttgg    192300
     ctgtgcaatc actaaagact aagatcaatc gccgagcatc gggagttaaa agtgcgttag    192360
     gagagcgtag tactggatct ggggcagcac agatgcccac ttccccctgc ttcacattga    192420
     gttgccaaac tcgaaaatca cgaaaagagc cataacagcg tagcaacctc cttatatctt    192480
     ggattaacct ctgccaaaga tccatcgctg ggctgctatc aatgaccaag gccacttcat    192540
     accacggttc ttggtccggt tctaggatcg gggaccagat atcagtttca gcaatgcgct    192600
     caactgtctc agcttcattc actgaactgc aaaactggga atcaatttgc ttcaagatag    192660
     gcttcagtgc cctgactagg ggtaaggttt catccagaat gtcagggtca ggaatagaga    192720
     tgggtaaagc tttttgggga agtttccccg aaggcaactc cggtgcaacg ccaaagtccg    192780
     gttcgtctac ctcgtcattc tggttatcat tgtcgtcatc ctcttcgttt cctgcatcct    192840
     cttcgtttcc attttccaag tcgagattgt catcatcaac atcctcaagc tccaggttgt    192900
     catcaggatc tttgttctct tgatcgacat cactaacatc aaatttctct ggttcgcgca    192960
     atgccagcca taggatttca gctatttcag tagggtctag cttatattca gtcagagcgg    193020
     acacaaattg ctcagtactc atttacagcc agcctctcag gtcaaacgcc ttagcaaaat    193080
     ctgtttgagc atttcaagtt cagtttcttt atcctcttca ctcaaacccg aacccgatag    193140
     ctgagactgg cgaaccatgt aaattaaatt gaggagctga tccgttgcca aagaagactg    193200
     tttacgctga agatccttgg caaagttctc aatcaattgt gcaacttttg gttctaattc    193260
     tgaccagggc agttctgtct tagggcggtc tttccgctca aaatgagcac ctactatatg    193320
     ggttaaaacg gcactgtcag aaggatctgg catcgtgatt cgcagacagc ggcgcaaaaa    193380
     ggcgggggga aagtcacgtt ctccgttact agtcataatc accaagggga actcataaca    193440
     agtaaccttg ccttgctcaa tgtcagcagg gagaccttca tcctctgtac ggactggaac    193500
     aggcacatcc gttttgtagc ggacgagttc aggtatctca aaactacctt cttcaaagag    193560
     gttgagaaga tcattcggta aattcagctc gcttttatca atttcatcta tcagcaatac    193620
     tcggggtaaa tgggaaggta aaaaagcggt acctaccggg ccaagttgga tataatcgcc    193680
     aagatttcta ccttgtttta attcatcaat tttgttgtga tctaatggct gatcgtccga    193740
     ctttgccagc agcaactgga gttcaagttc cgatttatca aattgggtgt cctgcaaacg    193800
     ggcaatcgca tcatagcgat actgggcatc agaaagcttg gaacgagtgg taatgggcca    193860
     gagcaaaact ggccccagtt gtaattcata ggcgatcgca taggctaaag aggtcttacc    193920
     tgaacctgga tttcccgtga taagtagtgg acgtcgcaat gccaaggctg agtttatagc    193980
     tgaaataatt tcagattgcc taccttcaga ttgacggata cgaaagcttt cgccacgttc    194040
     ttttgaacga gtatcaagac gatttgagtc tcgcaattgc ttccagcgag ttttactagc    194100
     accagcccac ttatcctcaa agattgcttg tgacataaac tgccgccatg cgggtcgctc    194160
     ctgaataggt ttcagggcgg cttggcgggg tgtcctatct tcattgggtt gggctgtaaa    194220
     aaatttccag tcagtcatag tggaatcacc aatcttttgg gcttttaagt cggttgcgtc    194280
     aaccgaccgg attcattgac agctaatgta ggtaagcacg gtatccgggt gcaattatca    194340
     aataaaaacc ccagttcttg aatctttttt cggtgggtca aaattgactc tcccaaggca    194400
     gcagattccg taaaattctc gggtttcaac actttatcca cagtcttttt gaattcatcc    194460
     ccatttacag gagtttcata agtccacaac caaagtggca ctttctcttc aatcactcct    194520
     gaaattaagc ttcttaattc atctatatct tctggcaatg tctcccaaag tttaaagacc    194580
     agtttctccg gtaattcgtc ttcaaatatt tcatccgtga aacactctac gcaacaggta    194640
     tgttgatcta gaggttgttg catagttttt aactgctgca ttctaacctt taaatcttta    194700
     atccataatt cagaccaaag tggatctaat aatcgatcta atgagcgaac aacagtgttg    194760
     tatggaaatc gccaaagtgg cttacgacgt gtttttccta aactcgtcca aattttccat    194820
     ttgtgaacag gctgcccaaa atgttgccaa gacaagaaaa tctcaaccgc tctcacttcc    194880
     cccgcattgg gaattacttc tgataagtgc tcccatactt gttcaatcga gcatttagga    194940
     taatcggtta ataaacttgt tcttgtttgt tctccgcaaa catagagttc cgccaaaatt    195000
     cgaacggtat ctaccgtagc acttgcatca ccaggttccg tatctacaac aggctctaat    195060
     gtgaccagaa gatatttctg actcggttct tgctttgggt caacttcaag ctcggtgggt    195120
     gcgttagcgt cataccatac ctgccattca ggttttattt cacattcatt ctcattgtta    195180
     ggaaagtctt gtaacttttt gatcagatga ccgacccaag acactgccaa cacctgatcg    195240
     tccaaccgaa taagggcctg cttcaacgcg gcgaaggttt caatcgagcc tagtaaatcg    195300
     tctttacgat tgtctaaaac ctccctcagt gcagcttcaa gaaaatctag atcataatct    195360
     cccaagcata taaataaatc gtcccaaaac ttagtctcaa ccttataaga agttttccct    195420
     actccaggaa ttctgggttt agggtcataa tttgccaaca ggtgaaaagc taaagcactg    195480
     gcatgatgag aagccttttg ctgacgctta tcttcagatt tttgcccctt gccatcattc    195540
     ttatgatcaa tcaagtctga gatgccccga atcacaatag cggatagtgg tttgtcacgg    195600
     gcattgacag cctcaaggaa tccatatcct tccatctcca cggccaaagc atcactataa    195660
     ttttttcgca gcaatttata aacgttcgac tcttttgaag ccactacctt ttcgccaaca    195720
     gcgattggcc ccaccctaag gcgaggggtt gtattataag gctgtttaac tcttgccaac    195780
     caatttggtg cttcacttcg ggcttctgcc ttggcttcct ctaccaggct gaagccactc    195840
     aagccaatgt gaggtcgtgg tttgaattct tcctcagcct taccggattc atagccatag    195900
     atttttgtag acgcaacgac atcacctata tctacatctt ttagacctcc cgctacaccg    195960
     acaaagaaaa caacatcagg atcaaaatat gtaatggccc gttctgtttg tagggcagat    196020
     cttgagtcac cagctccagt ctgcacgatg cctactgtcc atatgcgacc attcgcttta    196080
     aatgtcccct tctcatatcg atttccttca ggatgaataa tgcgcgtggg atcggcgaca    196140
     aactttctta cttctttaaa ttcaacgggt aatgctgtca gaatgacggc tttcaaggaa    196200
     tcctgaacca ttcaaatttg tgattttttt agggtttcta gtctaatgct cagtagaaaa    196260
     tacaagtata gtgattaggt aataccatat ttagaataat ggatcgaact gagaaaacat    196320
     tacaaatatt tttggaagaa tatcgtgtcc tcaaagctga acaaaatagt cgaatcggat    196380
     ttcgagacaa tctactctat gtcacattag gtctttttgg tggaatcctt tcttttgccc    196440
     taacaaacga taacgggaca aacgcattac ttgttgttcc ttgggtctgt atagttatgg    196500
     gctggaccta tgtagtcaat gatgaaaaga tttcagcgat aggtcgctat attagacaca    196560
     atcttgaaaa aaggatttct aatctcattg aagggtctgc agattccgaa tctttgtttg    196620
     gttgggaaaa agctcatcgc agcgattcta aacgaacaag tcgcaaatac ttacagctat    196680
     tagtagacga agttgctttt gttttttcag gcttagcagc aatagttcta ttctgcttat    196740
     ccagtactaa ttgcccaacc ccaatcatca ttttaatagc ctttgaatct ttcttcctca    196800
     ttagtttagg aatcacaatt gctatctatg ctgatttagc aaaaggacgc tgaactagcc    196860
     agatttccag tcattataaa aattgcaaga gggaaaaagg gtaaagggct actgaagagg    196920
     cctgggcgct gaacaaacta ctcgaaaacc gatatggctg aggcggctct cgggggagtt    196980
     gtaggagcgg caagcagagc ggcaatccca cggatagctg taccaggagc cgccgcgaat    197040
     aacgctagag tcatcaattc tatccccctc ccaaaagggg ctaccatctg atggcacgtc    197100
     aaggtaatca gagccgtagt agtcttggca ccattcccag acattgccat gcatatcata    197160
     taacccccaa cgattagggg aataactttc aacagcactt gtttggccta tcatttcatc    197220
     ttctaagtaa tttgccagtt tgggagtgat tttttgccca aaatgatatg cagtctgagt    197280
     ttcagctcta caggcatatt cccactgggt ttcactaggt aagtgaaaat tttttccagt    197340
     ctttgatgac aggcgcttgc aaaattctac tgcttcatac caacttaccg actctacagg    197400
     gaagtcatca ctttcgaatg ctgaaggtga tagatctaca gttccatctt gttcttcata    197460
     cccggctact acccgccact gttcctgagt aacaggtgta gttcccatca aaaattgagg    197520
     taattggata catttttggc gttgtttatc ttgggtgtca cctgattcat tttcatcatt    197580
     actaatccac aattcccctg caggaataag cattaatgtc agtggcacat catcaccgag    197640
     atctatggtg tagctctcat tcgtacactc atattcaaag agggtgaggg aatcaacagt    197700
     attagccact gacctagaga gaagatgtta gtgattttta agcagataca taatttgata    197760
     tttgatcatt gttgcaccat ctactatatt tttggccttt cataagaatt tgcctatcta    197820
     tataaatata ggccaacaat tttttgagct agtctatgct aaacattacc accatcaact    197880
     caaatatcaa ggatggggcc aagtactaca ccaaagaaga gagttactac agccaaaaca    197940
     aagaaattca gagcatgact caaacagaat ggtttggcag catggcaccg gatgagcatt    198000
     actctgccga gcttttcacg gagatgtttt acggcaacct tcccaacggc gggcgtatgc    198060
     gaaatgaggt caagggaaag ggccaagaac gcttagctta cgaccttaca ttctctgttc    198120
     ctggtaaatc tctcagcatg tctatccacg gacctaacgg agataagcga ctctggaatg    198180
     cccacgttga gactatcaag gaagtgctgg ccatcgtaga agaacgctac gccgccgcta    198240
     gaattcaggc caacaatgat cgccaagttg tgaagacaag cagcatcgcc gctgccctcg    198300
     tccaccacca tgaaaccaga gctggggatc cgcatgtaca tacccatgtc gttcttttca    198360
     acggcaccct atgcccggac ggtgaatata gggctatgta tatcgagcct ctcattagaa    198420
     gcggtatttt aggcgatctg tacgaccaga agatggccct caaagtccaa gagctgggct    198480
     atgaaatccg agagacaaaa acaggctttg accttgccgg ggctacagat gagcagatta    198540
     aaaaattcag taagcgctca acggaaatcg aggattattt aaaagagaaa ggttggagca    198600
     acaccccaaa aaatcgacag aaggcaacct ttgagactcg aatcggcaag gatattacgg    198660
     agtcattaga gcagaagcag gaaagatggg gagaagagat ggcctcagtc ggtttccatg    198720
     gcctaactcc ttccgatcaa cctatcaagc ctgaaagcca agagacaccc agagagcttt    198780
     tagacgctgc tatcgaacat ctaacagaac atcaatcctc gttcaatgcc gaggacatac    198840
     agcggtttgt gttctctcac ctccgaagtt ttgatgagaa gcccttgaac accgagatat    198900
     ccaagcaccc ggacttgcta actgcctggg atggccgact gactacacag accgctgtcg    198960
     atagagacca acgaattcta gatatcgtcc tgtttaagga tagtaaggtt gaaccgctga    199020
     acccaaccgc tgactttagc gacacgatgt taaacagtgg tcaggccgaa gccatgaaac    199080
     gcttactcag cttttcagat cagtaccaaa tcctaaaggg actagcaggc acggggaaga    199140
     caactgctct cggccttgca agagagcagt tacccccgga tgtcgatatc aaagtttttg    199200
     cacctaccca caacgccaaa catcaaatca gtgaggcctt tggacttaag ggggcaacca    199260
     tagccagctt tgttgtcagc ccacccccag aaggggctaa ccagctttgg atatttgatg    199320
     aagcgggcat gtttggcagc gcagacatgg agaagatact tcagaaagcc gaacaggtgg    199380
     gggctaggtg ttggtttgtc ggcgacacgg gtcagaatgc ctctatctct gctggtgcgc    199440
     ctgtacgaat gctgatgaat agaggggtca cagttcaccg ccttgaccag atcattagac    199500
     agcaaaacaa agaacagctt agggccgttg agcttatcgc cgatggtcac ggggttgagg    199560
     ctctcagagc cttagaaaaa aatggaaata tcagagaagt cgaggactcg gaaaccaagc    199620
     tcacaagtgc cgttgcctat tacatggaga agcctaaaca tcgccgagac aaaactctcg    199680
     ttgtggtggg gaccaatgct gagcggtttg gttttaccaa actcctaaga gccgagctta    199740
     tcaaggaagg ccagcttacc aagaatacag aattcaccca gctccagcga agaaacctat    199800
     ctaaggccca aaagaaacgg gccgagaact ataacaaggg cgatttactg gtactgcaca    199860
     agaagcaccg actctatacc caattgcaga cccatgtccc ttataaagtc ctcgccgtgg    199920
     agggcaaaaa actcaaggtc caatcactgg gcggtcggaa tttcaccatc aatcctgcag    199980
     aacatgagtt aacccaggct tatacgacaa ggcgcaatca aattgctgtt ggtgataagc    200040
     tccggttcac ttcaaccaac atgaaaaagg atattcacaa taatgctttt ttgacctgca    200100
     ccgatatcaa agatcagatt gcaacggtca aagacaaaca cggtcgagtg catcacttag    200160
     acctcaccaa gcccctacag atagatcatg actgggccac taccacttat agatcacaag    200220
     gtagtaccaa ctcagaaacc ctctatattg ctagccttaa ccctacctca gctagagaat    200280
     ccttttatgt tggcatctcc cgaaacaaga ctaaatacct gaccgtattt acggaggacc    200340
     tgagtaagct ccaagagtgg gttgcacagt ccaatgctca agagaacgca ctagagatac    200400
     tatttgaccc ccatgcgggc tggagtccaa cctatgacaa ggaagaacgg ccctttggct    200460
     tggatgagga cacatggacc gagatgaaag gtagcggtat tcaccccaac ctattgacct    200520
     cgaaccatct ccgaagtgaa gcccccgatc cttatggatc tatccgtgat aacccactag    200580
     ttgcagccct cttggaggct gagtttacca agtccaaata cggcaaaggc caggaagtta    200640
     ctggcaaaat gaaacaatat ctacacggtg cttcgacagt ggaaggccat accgtctatg    200700
     accatgaaaa agaatatggt cggattgctc aaggtggggg ttggattggt tatggtggcg    200760
     ttgatttgct ttcagtcatt gagggcaatc ctcaaccatc ccagtattgc caggtcaaac    200820
     ctaaaacccc ccgcatcttt gacggcaaag agaataagta tgaaacgccg aaaggggtag    200880
     atcaacaagt cttcttacct catattcccc atgagattga ggaacggatt tatcagcgta    200940
     acggtatcag tcccaccgca gaggagcgga ctaaaggtat ctggtctgtc gcggacaaat    201000
     acaatctgcc ccttgtcatc acagaaggcc tgaaaaagac atgggcatcc ctcagccaag    201060
     gtcacctaac cgtaggcttg cccggtgtga ctgccttgta ccgggctaag aatgaacatg    201120
     acgagcgact accccagcga gagcttacgg aatacggcaa ggccttggct aaacctggca    201180
     ggcaaatcac gttggccttt gatcaagaca cgaaagtatc gagcatccta aatgtgcgcc    201240
     gagatttggt gagaacaatc gagctaatgc agactagggg agttgtctgc aagattgccc    201300
     aatggaagcc agagctaggt aaaggcctgg acgatctaat tgtgaaagct ggcccgaaag    201360
     cctataacct tgcgatcgca aatgctgtta ggcctgatgc tgaaattaag cgtcactata    201420
     gaacccagta caacgccatc accaagcggg ctataaaacg cttcggcgac atacctaaag    201480
     aacggctgga catggaagtt tacagctatt gcctatcacc ggataacggc gcaaccatca    201540
     atgatgccca tcggttcttg tccgcttcgg atcacatgcg atcggctgaa cctggggact    201600
     ataagcgcta tatgctggct atccacaaaa cccatgggat ctatcaggat attttggcct    201660
     ctggtaagcc acctaatgaa ttggtgacaa agctggtcga gcattcggtt tatgaacagc    201720
     tagccgaaga actcaaagag aaagacctac tctatccaga gcagaccctt tcagataatc    201780
     aatctcaggg ttattcagtt gggttctagg ccggttcttg ttccttagct ttggccttag    201840
     cccgcacaag gttcctcacc ttcaagccaa caagacccat gccaacaatc acaaacgcaa    201900
     tccccacaac gggaatcaaa ggaaaggaag gaccggcgac agcgacaggc gcactaactg    201960
     ggctggctgg ctcttccacg ggtatataag cgggggaaga tttatctctg gtctcccctg    202020
     gcaccggtcc cttgttgatg gcttctaggt ccacttttcg gtcaaatctg aaagcgacat    202080
     caaaggaggt aatttcaacg ccgcattctc ggaaatctgc aaagggaatc cttagtcgag    202140
     tggagttttt cgcgaaatct tcctttgtcc attcgcacat tggttttggc ctcgctggat    202200
     gttggctagc gaaaaggggc gacacacctt atcacccctt ttttaccatt agtctacgtt    202260
     ttcttgctag aaactttgag agactgtctg atcttgttgc tggctgtgtt cttgccgttg    202320
     agcttgatcc tgctgaatat caggcctagc catcagcagc tcatcagacg ccgattgaat    202380
     aaggtcatgt gctgtatcac gggccatatc tgggccatgt ttgctctcga tcgctttaat    202440
     gtgtgggttg ttctccagca acatcgaggt aatttcagcc tgtgaatgcc cgttatttat    202500
     ggcattctta gcgatatcaa ccacctcatc aatgcccgta gattgtacgc cctcagaggc    202560
     cttctgataa aacccttgtg ttgtagtctc tgggatggtt tcagccggtg ccgtcatctt    202620
     aatttgcaac aagtcttgaa ctttttgcat tggatcgaaa acttggccgt ctataatcga    202680
     cagcaacagc ctattgccct gtctaatctc aagagtgcct ttgaagttag caggatcctc    202740
     tagtgctgcc ttgaacgccg ccatctgttc attagagacg ctggtatggt ttaggtctgg    202800
     ctgaccatct gacagtctga atacctcctg attattaaag aagaaccgca ttccatcagc    202860
     attcataccc ttgccggcta tctctgaggc cagggcctga aaatagtctt gggcgatttt    202920
     gtctggttct tgcttggatt ttgttaagaa ctctgggatg ccatcgtcta gatattctgg    202980
     ggtttcctgt agatctgcat caggtgcctg tttctggggt tcatccctta aggtttgctc    203040
     tggttttttc tcctgtttgg cctgggtcgt ctccggttcg atctgggttt cactattact    203100
     tagtaccgtt gccggtgcat ctaccttgtg accgttttgg gtttgaggtt cctgggagac    203160
     gttctgctga ttagcttgct taggatcttg attattactc aacttattaa gctccttttg    203220
     gacaaatttt tctgcatgaa tcccatactc tctaatgttt tgataggagc tgtggatcca    203280
     atcttggacg tttgagaata tggcctgggt ttggtcaatc gttcgaccga tggccgtaga    203340
     gattggtagt tgggtcacat atttagccac cattggccca gcgtccatca ttgccttacc    203400
     tacagccgta ggggcgagat aacccgctaa tggccgggtc agcatgtccg acttgcctaa    203460
     caagtcagca cttcggagtg tcgcccaatc atcaaaagcc cgttgccgtg cccagtaagc    203520
     aaaaccgggc tgtatgtttt gacgcatttc tgcaaagtgc tttgtgagct gagcctccct    203580
     aagaccatgc agattgtttt ggataaaatc agtcccctgg ccgatggcac cggctaccgc    203640
     tggaccggct aaaggtaagt gagtggcagc accagcaacc aaggcaggca tggctaaagt    203700
     ctgaatcaac ggcttaccca cctttaacag ggggtactcg tcaaaaatct cttgctctgt    203760
     tcgcctgagt tcctggtatt tatcgtttat aggatttgcc attgcagatc ctcataggtg    203820
     tacacgtatt tgataggggc caaacctcaa acatcaaaaa ctctggcctt gggattgagc    203880
     tggggcctgc tgttgttttt gcattaaatc caacgcctgc ttaaactctg gggtattctt    203940
     ctgctgttcg actaatagat cctgtttagc gtcggcaata acatcttgtt ttaggccttc    204000
     cacgttttcc gggtactgtt gggccgtcat ctgcacagct tgatgttgat ccataaagac    204060
     gcttagggtc ttgtcgtcag taccaacggc taaagcatct ctgacgttgt taaataaatc    204120
     atccggtgac gtgtacgaaa ttttcacctg ttgctgtcgt tgttggtaca ggaaatagat    204180
     cccttccacc agcaatctaa gtgaatcttc taccgccttt tcgcttacct ggcctgcctt    204240
     atgaccgtcc tggcttaggc tgtggtcgtc cacgtatctt tgtgataagt tgtccatatt    204300
     tttctgcctt cctttgctac tttcttgctt tatagaggca gtacagtaac gggcttatcg    204360
     tcaccctgtg cttgggcctg tgcctctttc tcggccttct ccttggcttt cttagcggct    204420
     aactccctag ctcttactac gtcggggtgt ggtagcaggg aattggctac tcgctctctt    204480
     aaggcgatct catcttcaat ggtgacggtg gttactttcc cggtttcggg atctgtaaaa    204540
     gaggtttgat tgcttgcgtg ttcttcctgc aaagctggta acagtttttc ttcccaagcc    204600
     tttacgcatt gtttctccat tttggccgtc ttggaatttg gatcgtaagg aatcggctta    204660
     tctagaaagc taattgggtg agggtatgaa gcgcttgata tcacgcaacg tcccgctaat    204720
     ttctgctcgt ccagcttttc agcgggaact aatggaacct ctttaagctg atcacttgat    204780
     ccggtagtcc tattattcga gctgtgagac gagttggccg tattgataac gatggtcttc    204840
     ttacctaagc tctcagaaac gattttgtga taatcgtgtt cacccgtatt gaaataggct    204900
     ttgttcttca ggttcgcctc aattcccttc cattgagctt tgccgtaggc ctcttccata    204960
     gcgctgtttt gctggtaggc aagccagaac gtaccgcctt tcttccgagc caatttagcg    205020
     agtgcgctta agtcaggcag aatgaaaaag ttagcctcat cgctaatcag ggtaaggttt    205080
     ctgtctctgt ttctttgagg gtcaagattg tagttgagcc ataagtgcaa ggctgtagca    205140
     actagcgggg aagtagcttt aagctgagtc cgatcgagcc gacaatagac gatcgacggt    205200
     cccgaatgct caaggggaat tgtcgagggc aggaaggcct tagctacttc aggatcaatg    205260
     aactttgaga acatattaaa cgcgctcgac tggatcgagg ctgaggggct gtctcctttg    205320
     cccttacctt ggcttgcaac cgctcttaag ccagcgctgg actgtttagc gtagaacgaa    205380
     agctctttgc caagccgccc tgttttagct gcgatgtcca acctttcggc taagtccggt    205440
     agcgtaatga tggcccaaac catgagcatg tcagggtatc tggatccttt agccaacatc    205500
     agggccgttt ccatcagtgc atcactctgt ggcccaaaat aggcatggcg tttttgcgtg    205560
     tcctcttggg tattgacgtt gaggcctctg ctaatctctt gggccttcgc tttgtcgttt    205620
     ggatgcctca tcacttccag gaagttaaac gatccgccaa actgtacaag cttgccaagg    205680
     ggtgataggg actgaacgcc aggggcatag gcgtagattc gacctttgta accgttagcg    205740
     tgagcgtatg ccgctgttgc tttaatcagc tctccttcaa cgtcagtgac aaaaattgaa    205800
     tgcttttgct tgattgccga tctgagtgtt gggattataa aattctttga tttacccgta    205860
     cccgatagac cagggaaaac gccgcctgga ttactgaaag caaatgtgat gccggtttct    205920
     gggttcagct caaatgctgt ttctgttaat tctcctttgg caatttgccg ccgtgcctct    205980
     cggttccctg ctctgatctc atccttggtt gagaaacgag cattaggcat tccgtcaggg    206040
     atctcagtct taggcttgcc gttcaggata aacacacaaa cgacaaggat cacgactgcg    206100
     attatcggac caacgaaagt ccctaagcct tgctgttgtc ctggctgtgg tggccttggt    206160
     ggtggctggg tagaagattg cacaaaatta ccccatatag attgtctcta ctaggggtat    206220
     aggggcttgt tgtggtgggc caaaattagg gagctgaatt gccttgagct gttggcctag    206280
     ggttgcctcg tcgcgacact actaggctta tcaattgccc tttcgtcttc tgtactcttc    206340
     ggtaatctcg cgctcaaggg cctgattttg tttggcccgt tcattatttc gagctgttgc    206400
     cgctggcact aaagctttga agacagggcc aggtaagact tcctcagcat ctcgcccgcc    206460
     ccccgtaggg ttgtagtaag cagcttcaca gacagatgaa ttttccttta tgactacggt    206520
     tgtttcccgg cctgcctcat ctatcaggta aataagatgg tacgttgcgc cgttgtattc    206580
     ggtctttgca acatgatcgc cgcccgtgaa tgcccacggg ctgaacacta tcctttcttt    206640
     aattagcttc tgagtgcagc tattaacgtc agctctggcc gacaaaggga tggacacaaa    206700
     cagcaagaca aggggtaaaa gcagtttgta tttcatggag tcaaatatcc ttatcaatta    206760
     aagttaacta aaaattcagg attgattgtg cttcctttac ggggtgtaac accattgact    206820
     gtcctaatga tttcaaagtg caaatgaggg ccagtgcttc ggccagtgtt gccactgagg    206880
     gcgattggtg tgtttttagt gaccttttga tttactctaa cttgagcctc gctcaggtga    206940
     gcgtagaggg tggaatagcc gtttttgtgg ttgataatga cataatttcc gtatccaccc    207000
     gcttggtatc cgatttcctc aacgatacca ccgtcagaag catttacagg ggtgccaaca    207060
     ggtgtaccga gatcgatgcc gccatgccaa cctaagctcc tgtgaccaaa gcgactagtg    207120
     accggatagc cagggttagg attaccaaag tcacccgtag caatgccgtt accctctggt    207180
     tgaataatcc cagtaggcac gccctgagaa ctggctaacg cgccaatttg actgcaataa    207240
     gccgctctat tcgccaccgt ttgaaccgcc gccgcttcaa tagctgcgat atctgcggcg    207300
     gtggtctcaa tccctaagac ccctagggtt gttgctgcaa cactggcgtc cctcgactcc    207360
     tgcagatacc agttagcccc gacattcccg cgatatggat caccgggttt gctgttgtgt    207420
     agtaactttt ggcctctaaa atccgttgca ccgcctaaaa atatctgaga tgctttaatc    207480
     tgatttgggt cattgagggc agcttcaagg gtctcatact cagaaatcgc actttggatg    207540
     ctgccagtct tgagggcaat ccgggcgatc gcttcttctt tggtgtttac agggctaaac    207600
     ccgaaattag gttgatactg tttaggctga taaacaacgt ctgtaatcgt attgggatgc    207660
     ttcggtgata caaccctatt catgatcgcc accgcgacat caacttggtt ttgagtcccg    207720
     gtactttcta gagccgaagt caaaattaga ttgtggatat ccttactgct gccccatgcg    207780
     gactgtccca ccgtctgagc ctgtttccct tgggttgatg cctggtttga tgtctggcta    207840
     gggacttgag cgctagcaac agggccaagg tctggtcgtc cgggtatccc ggataaagta    207900
     ggggctaaag tctcaccagg tttagaggcg cttgagaacc catcattgct tagcgtttga    207960
     ctagccgcag gggatgggtg cgttataccc gtgtaattga atgtgattga atttccttcc    208020
     tcttggacct ggaagccgta agtacctgcc tcttgcttaa cccaggatat ggtggctaat    208080
     tcattgtttt ggtcaatcaa caacctccct tgggggtctc ggtcaatttc aatacctatc    208140
     gctgaggatg cttgtttgaa ttgatcgaag gcctctttct ctccttttgg cgggctacta    208200
     ccggcatttg cagtttgagg gctgtcgctg gtcaaaaagg ttggaacctg acagaaatct    208260
     actgttctgc tcgttgtatc aacaccgggg aagtaatctt gaattcgccg ccgtgccagg    208320
     acagggaaca agctaccgtt ctttactttc cagggcgtct tgaaactaat aatgtgcgcg    208380
     gtgcagtgct tggtgaagaa cacaacgata cacttctgga aatcaaccca gaccctagat    208440
     gtagagggac cgttggcgtt ttcttctagc tctccaagac taaatttaac aggtgcgctt    208500
     ttcaccggct taataccggc tgattcccac ttaccaaaaa tgcagaggat tcctttgcat    208560
     cctggcactt tttgagttcg gcccatccat tccttaccaa ggatcggctc acctccaagc    208620
     aggcccccag gcacagcggg ccgcatttcc catctaggaa aacctttctt aggatccttg    208680
     cttttgctat cggtgctttt gataccaggg ataactttaa acttattgtc tggagtgccg    208740
     ccgctcaaag gccttccaag aaactcttct gggccttgct gaccactatg caaaatatcg    208800
     aacttagcga acacgtcacc cgcaataaag gccgtaatta catcacccag taatgccccc    208860
     accgggctat cacctaatcc agggactgca gagagaaact tatcttcaac tcctggtata    208920
     ttctcaatcg ctaaatcggc aatctgaggc aacgactgat ctaagggctg attagcaatg    208980
     ctagcaatag agcctacagg gactttctga aggtctggaa atcgctgtaa ggcttcatcc    209040
     agcgtcagat cgtaaatctc atttacagcg tagtcctgag cctgttgacg gactgctgca    209100
     aaatccccct caatcacaga aatggtcaag cttccaatgg gtaaccgctg aatatgttcg    209160
     gggagatcgt ctttgagttc ctttaacaac agcgcttcgc cctctgtgat cgtgcctcgc    209220
     caatctccat ccaagatttt ctcaagggga acgtctttaa gggacttctc ttttcttagg    209280
     cgattgagca acgctttttt agccgtagac aaagcgtttt tttgcaactg cttttgtgcg    209340
     ccttgagggt caaaaactac acctaccaag gcttgcacga cgggaaggct gtctttaatc    209400
     ttaatgttgc cgttgttata aatggtcttg agctgctgaa ggttcaaccc attgaccagc    209460
     tgaacgtctt taagcgggac gccaccgata tcagccccaa cattctgatt aaaatctcgc    209520
     aacgtgtact ttgtgaaccc tgcaaattga gggtttacct ttggatctaa atctctgaat    209580
     ttaacgacat ccgtgatggg tgcccctgtt ttccatgctc tggactcccc cggattaggt    209640
     gaaatgatat tacccggtgc cgttgcccct ggaatgctat taaatgtagg gctatacgcc    209700
     tcagccgggg ggtcataaat tagccctggt atattccgaa gctcatgagc tgggtagtat    209760
     cctacagtct gctgagtctg ggctaagact gggaaggact gagatagggc tatcaataca    209820
     gaagccatca cccccgttgc tcgtttggtt ttcacaaaaa aagatccctg tatcgctaca    209880
     aggattagat aggggctttt ttcagaggat caaaatcagg attttgcaac aatatcgaca    209940
     ttgcccgaaa acttccagta ttggccggtc ggccctcgct gctgccctct aggcaccaag    210000
     ttagaaatgt gactgccgcc ccggacattg cctaactgat ctgacgctac ttcgccgcca    210060
     acggccaacg cagctcccag gattcgattg ccaaagctag taccgccttg ggtcttgtac    210120
     tgggccaaaa gataggtggt gttcttctgc tcgatcatgt attgacctgg cccaactggc    210180
     tgattgttga gctttgtcag ctctgcggtg aactgagttc cattgagaga tgtaatcttg    210240
     gcctctgctg actgcccctt gtgcggccca ctagtgatcg tcagtggaat aatgaccctc    210300
     tgagcctcat cctgtgatct ccattccaca tgtctgacaa ccttagcgga cattttagaa    210360
     actgtaggcg tattggatga ggtaggcgaa ttagagccgc taaattcctg atcgtattga    210420
     tccatcgttt ggatctcacc ggccaagaag ttgacctgat gacttggctt agctttgact    210480
     actgagggcc tagcgtaagc agttttaatg ggtcgcttat aaggcgtcaa cttaacgggt    210540
     ttaatgggct tgggagtggt gggcgttggt gttgtctgac cgagtgtgat cggcttggtt    210600
     ggggcttgag tcttgatact aatccgatgt tttgcacaag cagggacatt gataccgcct    210660
     tgcaaaaact cgacacagtt ttctaacgtt ggcttaggct cagctttgag cgctgtccta    210720
     ggcttagccg gtgcaacagc cggtctatat gctctcactg gagctggggc tgtatagcga    210780
     ggtctgttaa ggcgaactgt gtttcgaggt gtcaccgtcc ttctagcggg cactctcgcc    210840
     ggtcctctgg ggggtgtctg gggtgctgtc gttgtcgtcc ctggtctagc cgctggattt    210900
     gttgctattc ctggctgttg agccgttggc ttacccgtgg cattggggtt ttgctgacct    210960
     tctaaaggta tcgactcaaa ttgcgcccct tgggtcaacg atgaattatc ccccaactgc    211020
     tgggacttct cgctctctaa ctggcttatc tttgccttta aacctgcaat ttgttcagtt    211080
     tcaccagcca ccacaatctt aggcttacga ttgccggtaa atacccgatg aaccccaata    211140
     gccgaaacgc cgacaaaaac taggatcaca gctccataaa agtaggtact cttaaaccat    211200
     tcatgggtct ttcggccttc tggagcaata cccgtctcaa ttgtcgagat aggcctatca    211260
     tcctctatcg gctgggccaa ggtttcgata acgctatctt gctcctgggt agtgaaaatc    211320
     tctctccctt cttgtgcttc aacttggctc atcgaacttc ctctctgtat tcaataattt    211380
     tcaaaccgtc tgtttggaat ttgttcaagg cttgggttag ggttgattgc tctagacccc    211440
     actcatggcc tgttctaggc tgttgctctt ggatacgaaa agtaaaactg agcttttctt    211500
     tgaatgctgc ccctttggcg tttttatcag tagctaccgc cacccggacc cccctcacat    211560
     cgacttgcca ttgggacttt gaaagctttt tgacctgggg attaccgctt agctcaaccg    211620
     ttgacaggta tttacccttg aggaacttat cgaagctaaa tccttgacgc tcatagcttc    211680
     tggccctcgt taacagccag ttttggcgta aatctgactc catatcgaag tagagcgagg    211740
     ctaaatagaa gtttcgagga tagatctctt ggccttcctg taccatttgc cctggttgcc    211800
     agtcgtaccc cgacttaatg agatttgcag caaatgaggc aatgcgggct tgggcttcat    211860
     tcggatcaat ctgctgagct tcggcaccgt tacgcgcccc ttgagattga ctaaaggctt    211920
     gataatcgcc gacatccggg ttagagactc gttgaagaat taggaactgt aaaagcacca    211980
     ccacgaaaag aaacgcccgc ttaggtgtca caaatttcct ggtaaacccg aggaaggttc    212040
     tagaacagcc ctgaaaaaaa gtagttaaat gtttcaccgt gatcacccat gcatatcaac    212100
     aaaatcaact actgctagac catcagacca aaagcgttcc atgtaggggt ttaacgcctg    212160
     atcggctaag gtccaatagc tttgagtgtt ggggtttatc gccttaacag caaacttaaa    212220
     atgcagcttt tcttgcccca aaatcttttc cttgccatcc gttgcaaacc ggatcgcccg    212280
     gacttcgaca aaccaaagac cattcccctg atcctcgaca accggatcac ttgttagcag    212340
     tgcgtatgag ttctgcagtg tctgggtgcc gccctgcact ttcccgtact tcgtagcgaa    212400
     gtcaatgccc catttaagca atgtgggctg gtcaaagaga tggcccacag cggcataagt    212460
     ggcgggaaac aggatttttc tatcctctac atactgttta gacgtatccc agcggtatcc    212520
     cagcgttaca aggtcggaca caaaccgggc cacaacagca tccgatcgat aataaccggg    212580
     cattgcttga gcttcgattg tttcaccatt tttgagctga acaaatcggt aagttgcgcc    212640
     cccgactggc gtattgccca ccgttgccag ggcgttgacc tgcattagta gaatcagcac    212700
     cattgctacg gcccaagctc tgaggtgctt tctcatcccc cagagcttca ccgaccattt    212760
     ctcttttctt gccatttctt tttccttgac attctctata aaaaagaccc ctacaccgtt    212820
     gttatagggg ccttattcag atgtccaaaa tccatatcat tccagctcgt acagccctcg    212880
     cccgtggtgc cgataccgcc aaaagttgcg ccgaggccaa acggcaccaa ggggtatcag    212940
     cagagtggca agaaagccca ccggcatcaa aaagataaaa acaatctggc tccaagcgaa    213000
     gcatgaggcc aagcactgat acagtccaaa agcaaaaagc gatttgttca agccctcgcc    213060
     gaagctcaca cgaaaccggg gaagtttaca gtcacagcat ttcaggccta accagtacgc    213120
     tatgaagctc caaaagaagt taagacgggg tgcaaaatcc acgccttgcg taaagtgctg    213180
     aaaatagtta aggcctgctg gggcacaaat cgccgcataa attagcgctg tagctgccaa    213240
     gagcgataag ggattggctc ggtattcgtc tcggattgag gccatgacca ccactaggcc    213300
     aacagccatg ataatcattt gagcctttag gacatctgga atgaacatct ctttacctcg    213360
     ccaactgtct ttttgaattt gccttatagg caatactaaa cgctactcct gagattaccg    213420
     acagggcagc acccgcagca ccgatcgcag tgcctctgta ggttcgggcc atctgaaagc    213480
     cgctcactcc tcctgatgct gccgcaatca atggagccgt aattcccaga gtaaacagga    213540
     ataattttgg cccaaactca tggaattgcg gttgagagga cagcaccgcc accatgccga    213600
     taataatcag gtaaacctgc tctgtgatta tcaaagacag catcgttaca aaccaatcaa    213660
     gcaaaacctg acgcttacca gggataacgg accaagcaac cgttatggga aagaacatac    213720
     cacctagtaa gaacaatatc tcgattgagc tggtgtacaa ggtattaccg aattctacga    213780
     gacccatgta gagaaagtcg ccgatacctg atagggccga ggctactaga tccccgatag    213840
     ccgaaaagtc atcttgaatt agcaagggat cgggaatacc gccgatctga tcaaaacctg    213900
     gattgctacc agggcctaga tccgcaatca gcctacgtct aatcttctta gtgccgtcac    213960
     cgacctgacg agccaatccg tctgcctttg cttcgacaat ttcacaactc tgtagcttag    214020
     ccccacactg ttgttttagc tgcgcttgat tacgcttaat tgtctcttca agagtagtca    214080
     gacaatccag gaaatcatag gtctggccct cctccaactt aacgccttct gcccccgtgg    214140
     gtcttactgc ctggggaacg cgaacggtag ggaaagggag gccctgacag attgctagtt    214200
     gatcgctgac ctcctgccca aattgcacat tgaaaaactc gttggcgatc gcctcagtaa    214260
     aaacttggtt cgcgtgaaca acagactttg tattgttgcg catattgttt ctaaaggccc    214320
     aggtcgtatt ggcaatgtca taagccctta caaactggga cgctaacagg aaaacagcca    214380
     gaatcaccca aaagaactgc ggcgcagcat ctaagaccac cgcaaccggg ccatctttcg    214440
     cagtcttaaa acccaatcgg ttaatcagga ccactgaaac cccgataatc ccaatcacaa    214500
     aaagcagatt caccggagct tccactgttt ttgagaccag attgctgctg ccgagagtgt    214560
     caccaccgac aacatagcgg cgggccgttt cccaaaactt gatgtgatcg tcagataact    214620
     ctaggctctt agtgccgttc aggtcagcca gatacagagc atttaggaaa ctgttgatca    214680
     ttgctggccc cctggagtgg tgttggccgc attggctgtg ttagtagtgt tgaccgtttc    214740
     atttacggga acaatcaagc cgccaatgct tcgccctctc cgcttcctag cccttagatc    214800
     ctttctaact tcgtagttgt gcgccctatg aactccactg ttgatgtttg ccagttgccg    214860
     accattgagg gccgtcatta gttgcatggt ggtggttttg ttaagctgtg ccctttgcat    214920
     tcccacaatt gaggccatgc ccccaagctg ccttaaagag ctatcgttaa gctctgccaa    214980
     agctgcgacc tgcatagagc cgaggttggc ttggatgccc gctaatgtgt ttaaatcctt    215040
     gacggcctgc tgggtagact tccgtttctg tgcccctgtt gcgacttctg cggaggttgc    215100
     cgcttgtttt tggctagccg cttgcagttc acgaacttgg atagcactca aggcagcatc    215160
     actgatcaca gcctccaagg cctccgctga ggcgtccgag aactcatctt cctgtttaag    215220
     ctgttcttgc ccttctgggc ctaaaacgat gtcagggcca gtctgggctg ccatagaaga    215280
     gattgcatcg ttattgacgg tttttacgta ccactgttgg ggtgtaacag gattcccgag    215340
     agctgctttc ttgaactttt gggatctagt cgttgcatta gatagcgtgg ctattcgctg    215400
     gctagctgtc gaagtcgcca ccgaagccac cgccgcattg ggatctataa ctccatacag    215460
     ctcaaggatc gatcggactc cccccacaag actgccagag ttccgattgt taaaggcatc    215520
     tagaacactt cgacccaact tgtaagtctt taaccctttc tgagctttac cgagaatatc    215580
     aaaaacctta actgtagtgg gatgcaacgc tctattgccg ctggggcctt gcagtagatc    215640
     cttcagaaag ctgggctttg agtccttgga ctgctgatag atgtcgtcta cttgatagag    215700
     gccagacggg ctataactcc cagtatctgg ggggccagag tttgaagtat agatatcagt    215760
     gcccaagttg gtcgcttgat tcagcggagg atagttactc tgcaagggta aattattggt    215820
     cgaaaacgag acgtttccac tagggttagt gacggactca aaaaccgact gagccaagat    215880
     tacctctgga gctgcaacgg tcaaaaatag ggctgtgaga aaggcttctt tgtgtttcat    215940
     ggtgctatcg gcaaactacg gtttctgggc ctctaccttg tgaataggcg gcgtagaggg    216000
     aattaccaaa attttgataa ctcttgatca gttcttcggg ggtatcgcct ttgatgaatt    216060
     ggcgcttggc taaaagctcc ttgggctggg ttgcaccgag ggacaacagc atccgggttg    216120
     tgtaatacaa aagctccatg tgcagatccc cccgctttag ataccactga gaggacatat    216180
     cggtaaggtc tggatcctgg gtatatcgct ccagaatttc ctgtttcagc ccaaaggagt    216240
     gaacaaaatg ctcaatgcta tttgtctccg aacggcccac cagaacattg tcaaaattac    216300
     ttagaatgtc gtcacagtac ggagatttca gcaaagatcc gacatcagta gccagtaaga    216360
     taccattgcc gcctttcttt cgcccttctg ggaagatacg cgagaactta gaagcaaagg    216420
     cctgcattgg taaaagcgtg gttccttcgt ccaatccaaa aacgctatgg tcataggtgg    216480
     acgtgatccg cttcataaag gctagagcag ccaaggaata gactaggcct tcttttgagc    216540
     cgtttttgac atccgttaag cctagaacaa ggtatcgaac actgggatcg aaggaggttt    216600
     gagcattgag ccgtttgccc caaggctggc ttaacattcc cgtcaaccga gatcggatca    216660
     ttgcaacagc ttgcttctcc tgttcactgg gttcaaacgc ccccagacct tcaacaccag    216720
     ttgttttagc tagatccaca tttcccgcta ggtagtcccg agaccagggg atatactctc    216780
     gtaagaaatc gcctacaagt gggtcttttt cctctcctga tgtcttccgt gcaaagtccc    216840
     gataggccag ggacagaacg gttaacacgt cgtcagctaa agggtggtga gggtcatcgc    216900
     cgatcactgc cgcttgcaac gtttccacat gggtttctac cagggcgtct atctcccagg    216960
     aattacggcc caagccatac cggcccagca tattgaagtt ttgctttttg atatcttgat    217020
     acgcacaatc cactccgcaa gcctgccaaa gatcgatagc tggggtgtaa gtactagccg    217080
     ctacctctcc ggtagactgg tcagcaatcg ggggcgagtc cataaacaca aatggggtat    217140
     tcgtcgcaat gcactgagat agaatctcaa ggccctgcat cgacttaccg ccaccacttt    217200
     ttgcagaaat aaaagtgtga ttttttttgc cgcaaaaatc gataaaaact tgggctgaaa    217260
     tatgtttgcc gatatacccc acacctcttt catctaaggg ttgaggctga gttaggggca    217320
     caaggggtac tacttgagtc gcttcatatt cgattcgccg atctgggtca aagcacattg    217380
     catcccaggt atagggctga ctgtcgatcc agtactgctc gatagagttt tgtaccaaag    217440
     tgcaatggtc aacgcctacc cgacccatca ctgtcgtggt cttgagcttt agttgatctc    217500
     gcgtatcggc atagatccaa atcagggtgc tgctggacat ggttcgacca ccggcccgca    217560
     gagtttgagc tgcgtccatt agttcgtcta catcacccag agaatctgta tcaaccgttt    217620
     gacggcctat tgcagcattt gatcgcttgg tccggttggt caggcccttg gctatctcct    217680
     gcttctttct caggggatta acagcctcaa tctctgtgat gatttcaaca tcagacaggc    217740
     cttcaagcca cctaaaagta ttttggacat ggccgatggc gtgagagccg ttaatgtcgg    217800
     cgtatccctc catctgatcg acacggacgc aagcactaaa aaggcctgct gggttgcctt    217860
     cctggttctt tttgcccttg agaggatacc agatgtcgct acgggcaaag ataggaatag    217920
     ggggcacgtc gccaccgtcg ccgaataact cgcccaagat atgacgatcg tcccctaact    217980
     cgttgcgctc aaagaatcct tgatcggtta ctcggatgta ctgagggcag gtatccaccg    218040
     gcttatcatg gatcttggaa tagtcccttt gataaagctc atggaccgtt aaggggcgag    218100
     ttctgatctt gatgccctta ttcagggatt gcatgggcag tgtgcagccc gcttcaaagg    218160
     caaaatcaat tgcctgcatt gccatttttt gcttgggctt atcgccaaaa taacgagcaa    218220
     cctggggagt cagcttttga gaccatcgat ctttccagtc ctggggcaca aaattctctt    218280
     gccctagggg agattgaacc cgagcataga cataaagagt aggggctacg atcctccccc    218340
     gcttctcgcc atcgacagcc caccgccccc gagccttgat aatctcaacg gtcaaggcat    218400
     cctgatcggc ctgctctaac agccgttttt gttgcaaaat ttgagccgat gcatcggagg    218460
     gaacagacca gacaaaccgc aatttgagct tgggataatt ccgaaaggtc cggtgaatat    218520
     ccttcatcac ttgcatacac tcttgatgat ccatgcaagg actgaaacca gcgaccttaa    218580
     agccaaagac tagataaacg ttgggtgatg atccccgatt ttgatagtaa aaaccagcac    218640
     tggaatggtt cttctcgtaa gagccataaa atcgcagatg actgaacctc tgctcgatac    218700
     tataaaaccg tcgatcgcct cgctcaatgt atgactcatc cttgaaaaca ggacggggaa    218760
     ggccgtctga gccttcccct tttgtagggc cttcactgta gaagtcccga gtcttggtca    218820
     tccgttcttt ctctagggcg aagtccttac cgccccaggt gatcaagctg accagcagaa    218880
     ttataaataa gaggcccgcc acctctattc caaacaaaaa attaacgatg attgcaagta    218940
     ctaggcaaac taaggccgca atcacctgag acatggtgta aggctggagc tgcaaggacc    219000
     caatagaaag gtttaccatc ccatttctaa gggcctcgtt atcagccgcc ttctgttcgt    219060
     aggttgtaac acccattttt cgaccctccc tgcgtaactc ctccttcctt agatgacacc    219120
     gggggcacgt ccagcattgc cgctagtacc accagtaaag aacgcaacga agatcacaag    219180
     gtagatacaa actagtccga ttaaccagcc catgaaggga gcaaaggctt ttttgagggg    219240
     ggtctcgttc atgtggtgat caccaaggcc ccataggatc atccccacca tgagaatgat    219300
     cccgccaatc accacgatat tgatcacctg acatacagac tcagcagcac cacccagacc    219360
     ggcgaaagct gtagcaataa agctatacag gtctgacata aaccaaaagt cttgcccgca    219420
     ctgggcaccc gtaccccccg cattttggcc cgctccattg gttaatggcc cgcctgggtt    219480
     ttgagccaga acgttatgag gtagtaagat cgcaccccaa aaaaagctga aaatcgttaa    219540
     ggcctggaag cgctgtaggt tcgttagccg gtaggttgca atagtgttta gaccgttaag    219600
     tagtttgatg gctagagtat tcattattct ttcctgtagg taatggggct aattagtctt    219660
     gaaatcgttt tggaatgagc cgagaaagga ccaccaaagc accgattgac agcgcaaaag    219720
     tggtaattga aaagagggtc atacttatgg aaccgtctag acccgaaagt attgcggtgt    219780
     agttgtttga gagtgaaagc ataatctctt ttttgcagtt tgcagattga aaaaattacc    219840
     gacttacgcc gccatggcct aacaagtcgt cataggtctt ctgaggtaaa tgtgaatact    219900
     tcaatgcctt ttcgactgat gcccctcgtc ttaggtatcg ggccgctgac tgagcttgcc    219960
     agtagagttt gtgattgcgg tttatctgtc gcaatcctct agcccggtgc aatcccctaa    220020
     tcaggtaatt ggctaaggcc ttgttgtcca acgtcgatcg gtcaatcagg atccgtcccg    220080
     tggttgagac cttggcgact cgccgaacca gcttcggaga ttgtctaatc tgaacaggcc    220140
     taggggcctt agcactggga tctgatacct tcacaggaaa actagaccgg gggctggaag    220200
     gcttgggggg cttaaccgag agagtcaccg gcttattaat cggtgcgttt tcctggcctg    220260
     aatgaacgac ttccaagcga gggaactgct gaaacccctt attgaccggt ggggcagttg    220320
     ccactaaagg ctgggctggc cccgctgtgt acatggtcag gatgttatca ggggcctcgc    220380
     cgacccgagt aatccggtaa cgcagagatt tagtgcccaa tggtcccgag accttcaaca    220440
     ccaaagaggc cgattttgcg gtactgcctt tcacccatcg gaggactagt tgatctctct    220500
     ctgcctgaga gggagctaag gccctgaact ccgtatggtc acttgaacgg gcctctagaa    220560
     ccgtgtagcc ggtttcactg agatcaagaa agtgatccgt ttccccggac acttctagat    220620
     tctgtgcctt attaaaggcc tcgccgatca ccaaagaggc agggttcgct agtccgggta    220680
     atgcggttaa tgccactagg cctaaagtcg ataatgttgt tttgaacata ggttgagtac    220740
     ctgtctaatt ttttggatgg ctgggaagaa cggatccgtc cttcctttgt ggttggccct    220800
     cttacgctgt cccttcggag gacatgaaaa agcccggtgg catagtgtac ggctcccttt    220860
     aagaaaccaa aggcgaaggg taaaacccca gaaaaaccag gcagggaaga gaggatccgt    220920
     tcttccttgg tggggtctga agtgggcata tctgcagatc ggccctcgaa aacggtctct    220980
     aaatccagac cgagacctgg ccgatttatg cctgtttcac tctgcttaag cagggggcaa    221040
     tctaccagag catcaaccat cgactgaacc ggcgtaacaa cggcttgaat ggctcgacca    221100
     atccgaccgc ccagccgtac agcatccaca cgaggcaata ttggaaagac ccgtctaaca    221160
     actacttcag ggattgccag gacttcgggg gtctctacgc tggtatcgcc tgctaagaat    221220
     tcgtggacag tacttttggc ttttttgatg aactgacgga ctctctcagg tcctacaccg    221280
     tgtctttcac caatctcctt agcgctgtac ccttcaatcc gactggtcac tgcatcaaca    221340
     tgcttggact ctagacgccc gctctcttct aaggcttgaa gaatatcagc ctgttctgtg    221400
     gatagagcat aggcccaagg atcgcagctg tgatcaacta atgcgctctc atattggatg    221460
     gtggaatctt catcaatcaa gccactgagg cttagggatt gggtaaagtt ctttgccatc    221520
     agggcattta agaccgtttg caccgttaaa ttgctttgtt ctgcaatctc ttcgacgctg    221580
     ggttcccgac ccaaggcatt agtcaaaaat gctgccgcct cattaacagc ggatacatta    221640
     cgggacactt cccgactgat gcccgcttca ctgcaatacc tcttttgaat ctcagtccgc    221700
     agaacccaac tgaaataggt aataaaacga tgtcctttgg actcgtcgta cttctttgct    221760
     gcaatgtcta ccgccgcctc accagaacag actaaggctt gacggtctat gctccggtca    221820
     taacgctggg atgcagtgac gataaaccct ttatattcct tgattaactg gcgtaatgcc    221880
     cgaggattgc cgactctaac tttttggatt agatctagtt cctgatcgaa ggttaatcgg    221940
     ctatctgatt ttggttcttg cgtaaatctg cctatcatat ccatgagcct tgaattggta    222000
     gtaggtttga ggctttcagg ctttggcggt gtcgagatcg tcgaggcctg tttttgttcg    222060
     gtaggttctt ccttgatctc cattgaagaa acataggcag aatggccctt aaggtgcaaa    222120
     tttgccttaa tggtgagggt ttcagcgatc gacgacaccg tgatctagga agtcatcaaa    222180
     ggtcttttga ggcagtcggg accagcgcaa caatttctca atggatacgc cgcttttgag    222240
     gtggcgggat tggcgagggc cgacgtggat gtgatcgcca acagtcccag tgacattaat    222300
     gtggttttga tcattttcta tgtggccgat gagctacata ggaagggtag gcagaatggc    222360
     ccttgaggtg caaatttgcc ttaacggtag gggtttcagc gatcgatgcc accgtgatct    222420
     aggaagtcct tcaatgttgt ttttggcagt cgggaccagt gcaacattgt ttcatcctca    222480
     tatcttgcca gggttaatgc ctgagtcttc cgctcaatcc gctccaccaa gccctgctta    222540
     agggcctgtt ttgctgctct aatttgactt tgcttaaaag gagtaaattt atccaaagat    222600
     ttgacaaccg tgaagatagt ccatttcgat ttcaactctt ttatgaatta agaaaaaata    222660
     atcatttcta ataaaacaaa ctgagattca ataataggat caatgagaca taaaaattta    222720
     tgcaatgaat ggaattatta cagcactaat aggtgctctt attggtggag caataggttt    222780
     ttatacatca ctttacatga agtacttaga gaaaaaggaa tttattctac ggaattatat    222840
     taatcactta aaaatcgcta atgaagaatt atttatcaga atcaatgtat tgctgaatct    222900
     gaggcaaagc agaaagctag aaattattga catttctagc ttccaagaat tagaagataa    222960
     aaatactgaa tggtataacg aagaaggtgc attttttggc accacagcct actttttatg    223020
     ttggttattt ttttctatag atcttataaa aagagagata ccacatttca agctaaggaa    223080
     agtcaaatca aatatagtaa tgaattctct ctttgattta caacatgttt ttttaaaaga    223140
     ttttggaata tattatgcca ttcaaatgag cataggtcgt gagatggaaa acccagatgg    223200
     acgggtaatt agctacagac aatttgtcga gaagctccaa gactataatt cacgaatatg    223260
     gttcaaacgc atagtttgtt tcatccttga tttcaaaaat ggaaacagat ttaggcaatt    223320
     tcaagaaatc tataaatatt cctatgagtt agcaaaagtt cttgacgcga ttacagaatc    223380
     tgaaggaaca cttgattcca ggctctcaaa agaatcattg cctttatttg ggactaaatt    223440
     ttaggttatt cgtattgaca tctctatttc tatcaccccc agatccgagc cacactctct    223500
     cgtcccagat acactcccac catctcctca atccgctcaa tagtttcccc tggccgcaga    223560
     ctcaatacct gcaacacatc aaacgtgtcc tccagttcca gcgcgcactc aaagcagaac    223620
     tcaggacttg caaacggaat tctgatgaat ggcttcccag tcccttccac ggtaatccag    223680
     tattgccctg aattgcttcg ggaaacggtc aagtactcaa gctggccctc tagcttgatt    223740
     ggctggataa gattctgttg actgcgctca aggcgtagaa tttggactca aaggctctgg    223800
     atactctggg atgtcgggct ctgcttgtag tttgccgagc tgaaaaagct catttctgtt    223860
     gactggagct gttaaaattg ttgcaatact aacagctcca gtcaacagaa aacgatggtt    223920
     tattttgccg tagaaatata aaccaaaatc tcctaatttt aatccatacc aacatcttca    223980
     ggaatcagct ctgatatctt ttaaatctat ttgaattttt tcaagtaaga gtttttgatc    224040
     aataaactta tctaggccat aaggcaaagt tggtccaaaa tgtcctaaat ctggaataga    224100
     ataacctcgg aatgtagaca taagaataac ttcactatat gaaaaactaa gtgaatcatc    224160
     tacataggaa gggcttctcg aaaatagttc tttatataaa tctctcgtaa atattttttt    224220
     aacccctatt tccttagaat ctagtaacag gtcttctagc aggcgaatag catttttttc    224280
     tacaaggcaa attttgcgct ctgtgagttc ttctacagaa atgccccagc gttctgatat    224340
     ttcgctagct gagtagcaac tcctgtaatt ccattcacgt ttagctgaat aatattcagc    224400
     atagagcgag taaaataatg cgctggcata aagctcaaca cgtttgagag aagtaatttc    224460
     ctcttcaact tcttgaagta tgggcggtaa ctcttcaata tcaataacaa ctaaattttc    224520
     ctttttccct aacaataaag aaaatttaga cttattttta atcaaataat ctacaagatc    224580
     ttcaggaatt tcaacagtaa cttttacact gccttcttct acatcttcta tagaaatctt    224640
     tttgacatcc actcccaaaa aaccagcaag ggtatacttg agtttctcat cacattgcaa    224700
     ttctaagaat ttttctaact ctagatcaag agttatccta actttttttt tcatggattg    224760
     atttgatgct agattctcta tgtttgctga gcttgttaat tggaagatgg aacccaagat    224820
     ccctgtctta atcagggaat aagtaaatgc tgccgcagca ttacacgcat actctgtcca    224880
     ttcagaacta cgcttataac ctacaatatc actcaaagac cgtatagcaa ggacaggata    224940
     tattcgttct cccctccaag ctgctctata aactccacct agctccattt ctacgtttga    225000
     aacagaacga gcacaatctt gccactgctg aataatatca atatttttca cgagaaagtt    225060
     actactagct gtaggagcta ctcgatagat tggttgacgt tttgtcgatg tatcacaaaa    225120
     atgatgtcta attgattcat gaactttttc tttccattca agatcaccat agtatgcatt    225180
     atcgttaata tcttccggaa cattaacaac aggcatctct tgagaaatag aggttactga    225240
     attccattct ccaagttgat tcttgtatgc tgatataact tcaagaatcc tactgacact    225300
     agggtgtatc ggccctccac tagtattatt ttctatagat ctatctggat ttattgcaga    225360
     aacagagaag tcataaaggc gacttgccag aattatgtca cccaaagtgt attctattgc    225420
     tggaacaccc cccgcgatac ccactaaaac tagtaatttt ggctttatat cttcaatcag    225480
     atcatttgta atctgttgcg ctgcaccctg accttgctct aggcagcgag taaggacaat    225540
     actatattca catccaccag gagtagagac ctggctaaaa atatatatat gtctacctcc    225600
     agctacacca gtccaggatt caaatcgaca gagaactgca tcaaactctt cttgcttaat    225660
     tgtaataatg gcaaaatcaa cattgttctt aatagattca atcttcataa attactgtaa    225720
     ccatcaagct taaggtttgc ccaattttga tttaatttat ctcagcctaa aaaatcaaaa    225780
     tgggatcatt gaagcattat ttcctgatag agatcataca gcttattgtg actgacaaac    225840
     tctgatattt cacttcaaac cgcagacaaa gctatttaaa agacaaaaaa tggattcgaa    225900
     caagtatctg tagatctatc ttttagttaa cacccaaaaa cataaatagt actgccaagg    225960
     tacaagcgat ctagcctcta aacatataag ctagaggtca attcaaataa gcacagaatt    226020
     aaaaattgaa ctttaaatca aggtcaaata catcggattt tcaacccgtt ttctcggtag    226080
     agtccaaagg ggaaccatca tcacccccct caagctgccc gagttcctga tcatttccct    226140
     gaccaaatcc atcaatttca gatcgcttat caatttctgt aattagatcg tcctctttct    226200
     tacagatttc acaacttggt ctatttttct ccaatctctg attccatttc gcctgaaatg    226260
     ccttcagcat ctggtctttg tacgcttcat tacctgaata gcgaatcaca tacagactca    226320
     cggattcctc actgcccacc ttcaccagct catgggccac tctcttgatt aacttgttga    226380
     cgatggcaac ggcactctgc ccttcactga tgacattcct gaagtggcga tagatttgat    226440
     agcgatattc caacgccttc accttaatat cttccaaccg ctgatcatcc tccgtcatca    226500
     ccatgatttc catccgcatc cgggcctcca cctgctcata tcgggcctgg gtaaacgcct    226560
     gagactgctg ctcaatggcc tccaccaaac cctgcttctg acccttgagg gtctgcttct    226620
     gctgttccaa ctgctccagt tcccccttca gcgttgcctt cctgggatgg gcctttctgc    226680
     ctaacgccgt caatttggct tgaatgacct tctgctcctg aatgatttcc ctgatctgcc    226740
     cagctaatcc cttgacttcc aatctcaaag actgtcgttg acgctgcacc tggcgaccct    226800
     tttccaacgc tttgtcgtag gcttcataat cagcgctggt gacattgtag gtatccacta    226860
     aatcaaatac ccccaagtca cgaagtaact gtacctggat gcgattattg gttaaccgat    226920
     gagtcaacac gaactgacta ttgagctgtt tcataaaatt cctccggtct aattcctcag    226980
     caacttcagg gtgaaagctc atccaatgca actttgtggc actcttgagc cgtcctcgat    227040
     gctcgacaca gacttgatga atgaattcat ccgtgaggtc cacaccaggc aattcatctt    227100
     gcagcaagac cttcttggca tccaacgtat ctttataggt ggcagaagaa ctccccatca    227160
     ctcggatggc ctgctccacc gtgaaccgtt ccccatcagc cgttcccagc atcacggctg    227220
     tctctcgctc catctgcttc cgcactttac tgaaggactc gacgatatcg gcattgcgct    227280
     ctctcagctc ctccatctca atcgaatgtc catgatcttt caacaacagc atcaaggact    227340
     ctctgagggc taacagtgac gcaatggagc gggtctgata ccgagcaaag ctgacgttgt    227400
     gacagttatt gggattctgc tgatatgcct tcagtgctgc taactgctga gccgtttccg    227460
     gggattggtc atgaatgagc tgctgttcta aatcaatgga ggccgcaacg tcttgtccat    227520
     acttggactg aagcatgatg acctgttcca cggacttaat cgaagggata tctgggatat    227580
     gggccttcct cgtcacatag atttcacgag tgacttttgc tctgtatctc cagagctgct    227640
     gatagacact gcgggcatgg ttggatgagg catagcagaa cactcgactg aaatagggaa    227700
     tcaatcgggg ttcatcaata ctgaccccac tctcggctgt agggctgagg aatagtgccg    227760
     tgggtcgata gtcttcgaca aactgagtgg gattggcctg aaaggttttg ttctctggtc    227820
     gttctgaggt cttcctgtca tggcgcaaaa tgcccttggc aaactcaggg ttcatttctg    227880
     cgatgattcg ctcaagcttc tctaggaatt cttgcgatgt ggcgacgaca ataaactttt    227940
     catcagcagc tacggcattt aggattctct ctagaaactg agaggtctgt cctgagaaca    228000
     ccttcgtggg aaagttatcg tcaggcttat attcattgac gataatctta gtgttgtact    228060
     tcccgcctgt gatgcccttg atatagtcaa tgggaatttg agacagggaa tcttccaaga    228120
     gaatgatatt gccttgggtt tctaagaccc ggtttgcgat cgcatggaaa tgctccaaga    228180
     tctgattctg ccgatccccc aaggtttgac cactgaggac atggaataaa gcagcatcgg    228240
     cttcatcgag gatgatgcag ctatcaggtt caatatcatc aagttctatc ttgagtaggc    228300
     tatcgaagca aaggagaata gaccgttcag accgaaagcc catgctgata ttgccctggt    228360
     attccttatt gagtcggaat aggtgaatca gcttgtagag ggtattgccg ttggcgtcag    228420
     tctcggtgaa tcggtcctcg gtattaaaca gcaggttatt ccggtaaccg ggcataatca    228480
     cctggccctt gacctggccc accagggact tcagcatctc cgtcttgcca gtgccacaca    228540
     tggaagcaat ggcgaccact gaccccggat caatggtgcc tagatctgag agttcgatgt    228600
     agcgcttgtt gataaccgtt gtggctttat ccgatagacc attgagcttt agaaagagct    228660
     gacccaactc atattccaga cccaagctat tgaaaaacca agtgggcttg aatacgattt    228720
     gggccaattc cacttgagtg agttcatcga tatcgcagga attctccttg taggtctgcc    228780
     cccaccaggc cacttccacg gcatagcccc attcttctag taagcgaatg actcgctgat    228840
     attggtgaaa gacattgagg ttccgcacgg cacccgcatc aggatagagg gtgatgatcg    228900
     gggtctgttc agcagatttc gataagacgg tcagagtttc tcgtaaggtt tcaggcgatg    228960
     aggcccagag tccccccgct gcgccaatcg tggggagctg caatcgttga gacaagagat    229020
     agggcttgac ccccgttcct tcaacgaggg ctatccgaga gtagggacca aaggacttgt    229080
     agacggctaa gggaatttca ccgttgacat gaggaccatt gccgttagga ttgcggcggg    229140
     taaaactgga caaccagatg tagcggttgt cagtatcaac attccgcttt ctgagctgca    229200
     acgctgttat ttgaccgtgg acgttgtaga gaggccagag atagcccccc tgtgaattga    229260
     ggaagccatc ggggagaaca ccgggcaagt ccaaagaaaa gtctttgact cgctgaaatt    229320
     gacccacgga gaaggcttgg aagccattga tttcagcctg ggacatgcac cgccgaacca    229380
     agtccccctg atccattgag cagagagaaa gatccgagag gagttgtcga tattgctgat    229440
     cgcggagttc aataggcagc tctctggcaa ttcgctgttg ccgtttttct tccgcttgct    229500
     tttcccttaa ggctttgcgg gtttcccaat cgatggcgtt gaaatcctcg cccgtgtggg    229560
     gtgcccagat gccccagaga tagttcttgg tgagtttgcg gaatttgtag ccgttgacgg    229620
     tgccaatgtc ctgagtctcg gacatgcaga gaacgatgtc gccaccgcct cggcaacggc    229680
     catcgtggga gtcacagacg gggcagtgat ttgctcctcg gaaggggacg agctttgatg    229740
     gggttcttcc cggtgtacca aagccaagtt gaggtggatt cagagtgagt gaggccgtgg    229800
     aggtcatggg cgacctcctt gatgcagggg tatatgagtt gattcccgaa cgttttgtgg    229860
     ttcggtaaat aaaaatatag aaagcataaa aagaccctct atcggttgtc ggtagcgaga    229920
     tagagaggtg tagctaggtt aatttaaatt aaagaaatct tgccagcaca aagtcggctg    229980
     ctctaaaata agaacacacc actcagggat gactaactat ttgcctatcc aaagcttctg    230040
     ttagttcccg ctctatctga aaaatatgat ttttcaatct ccgccctagc tatgtccgta    230100
     gctggggttt tgagacttaa gggtttattt catcgcacct cccaaagaaa aatacagaga    230160
     aacttagtga accatactac gcccgaaccc tcaataggga aaggctttaa aacaaaagat    230220
     cataagggtt tagggatctc aggcagaatc gtttgtggac agaaaacttc tcccctcatc    230280
     ctcgactcag acctagatga tttgttttat ctcttaggct gattcctatt ggttttaagg    230340
     agtaatattc ggcggtcgcg ggtgtactat taggtgtttc atcccaagga atttaaagat    230400
     attagttgcc atagaatgca tcgttgatct ccttgtatgg gttatatagt tttcctgaaa    230460
     tcctctgata gccagatata cgagcgctaa tggcagcaga aatacactta gaatttcttg    230520
     gccgatttcc agatatcctc cccaagcgtc ttgaatgcct cccaatccac agcatcgctg    230580
     attcgttgag gaaggttgat accccgattt aggagcaatc ctgtgattgc tacaccgaca    230640
     aaaagccaaa ataggtttcg caacattagc tagtcctcct aattgacagt taaattcctc    230700
     ctttgtagag ttgaaaatct gattgagggc acggccaatc tttccaccta gccgtggagc    230760
     atcaacacgt ttcatgacag gtttcttaac ttcttcgggt tctttggctt gaagtggctg    230820
     agggaatcga accaagcaag cgccgtaagt gactaggtgt tttagatagg cgagggcttc    230880
     tttaaatagc tgcctgatcc tttcacctga aaggccaaac attcttccaa tcgcacgata    230940
     actgtgccca tccctcctgg cccgaacgat tacgttatat cgctcgggga gctgtgctat    231000
     atattccttt tcgtcgatat tttccgcgta atcccacaga tcatcgtcac cctcaacaag    231060
     atcaatctgc tctgccttaa gattttcgcc aacagggata tttagactgg aggtttcaac    231120
     cactctcgct ctgtccaaag tgctggtaat gattcgctgg gaatatccag ttcgctctga    231180
     aagttcttct agtgttggct gacgctctaa ttcccactcc agtttttgtg atgcttgctt    231240
     aatatctttt aagtgtttag caatttcctt ggatagtccc cgctgatcgt taagaaactg    231300
     ctgaatttca gttcttatga ctttcacagc gtaactgctg aacttgcagc ccttagaaac    231360
     gtcaaacttt tcaatagcgc gggctaagcc ccagttcccg gcagtaacta aatcgttcca    231420
     gtcatctagt ccgcgatacc gatttgcttc cttgaagacc aatcgctgat tctttcgtat    231480
     aaaacggtct tcagtccttc tatccccagc ctgagcgagt agaatctgag ggtactggac    231540
     ctcgttgcta aactgttcgg atctttgggt ttgtgggttg cgtgaagtag tgcctatcat    231600
     agacttaacc tcatgtattc tttacggttt ctgaggttgg tggctctcta gttgtttgac    231660
     ggcggttaga gagccacgtt gagattgatt ttttactttt atcgagaata gtgtttcaag    231720
     agttatgagt ttctgaggtc agtggctctc tagttgtttg acggcggtta gagagctaat    231780
     tgaattgtgg gtaatctggg tagcaagctt ctaaataatc gtttgatggg tgagttatgt    231840
     cgttggagtg aacttgggta tttccttggc ttactctgct ggctgttgcc gatcctgatc    231900
     ttcgttgggt ttggctggtg atcaaggtgg ttggcgtggg agagccaagc caggatgaag    231960
     ttgagtaatt gctgtgagat agttctttcc cagtctgctt cagtgcgtcg aatattactg    232020
     aaatgcttat gggtaaaagg aatttgtggg ttgaagtaga tactgcctat catttagcta    232080
     taaacctcct atttaggttt atttactgct ctcctggctt ggcatagctg tggggagcga    232140
     tttttttgaa acttaaaccc ttaacttaag acttgatttc ggaatgagca gaaaattcga    232200
     cgtgtatatt atatacggta tacgttaatt tagttagtta gttcaatata tttactttaa    232260
     gtatttatat aggtggttaa ttgaaaaata gcatatttag ctactaaaca aagggtttta    232320
     gagagagaac tacagagggg atttgtcgta aaatctgagg attattcaca tgtgtgaacc    232380
     taaattgatt acctggaact taagacaagt aatggatgag cataagattc agcctgctat    232440
     tttggctgaa catatgcaga caaccccagt tgcgatatcg agaatgaggc gtcctaaaat    232500
     gccaagaatg gaggaagata agcttaatca tttactaatt tgtttaaacg ccttacgaaa    232560
     atctgggaca ccaccgatag gcatagcaga tttattggtc ttcaccttta ctgttgagga    232620
     agcagcgaaa gcacgaatca acgaatcgtg aattgtcttt agaagctcat cctctgtggg    232680
     caatcgcggt aacaggactc tgatggtttt ggttagagaa taaccaaaaa gaatgaatgg    232740
     tctacaactg gtgccaattc gctgcgtttg tttaccgtcg ctctgagaat attgcgaata    232800
     tgtttggggc tgtgaatttt gctgagcggt ccagcccaag aacaagactt tgattagacc    232860
     caagacttgc tttagaaagg tggtttgtgt acttaggtcg attctaccta tcattttcat    232920
     ataaacctcc ttgttaggtt tatctattgc tctctaatgg ctgtaccaaa gccttagaga    232980
     gctatttttg cttcaggtag ctactgcaat cgtgtaaacc ttgagagttg attcttcaag    233040
     acttacatga gatcgacgta tgactgaata aaagacaaga atgttttcag ttaaataaat    233100
     gtatgtattt gatgttttat accccatatc tataacgatt tcaaaccttt gacataaatt    233160
     tgtgaaaatc aatgaacata tagaggagtg aatgtcataa atttatagat tttatataaa    233220
     taaagtgtaa agtagattta attggccctt taaagcgtta ttttggccga aaaatggaat    233280
     ttgaaaaagc taaaagctat attaacgagc tatccctcat taaatgggga aagaagttgg    233340
     gtttacccgg tgagattgct attcaagcag cttgggaagg tattacgatt gctcaagcta    233400
     ttaaggatca cccgttaggc gcatcaacga gtgaaggata tgtttcttgt cgagtggggc    233460
     cagacctttg gaaactacta tctcaagaac tgggtataga ggtaaaaaag aagaacttac    233520
     gtctcgtctt tgaagaacta gatcagcagg gtatgtttgc cactaccact agcgatccca    233580
     ctccagaaca agaaggcact aaaaaaactt cacagcaaat agataacaca acatctataa    233640
     caactgccct aggtcaccac cccccaaaag tccctcactt ttacgggaga gatgaagact    233700
     ttctacaact gtctaccaca ctagcccaga accgttttgt agccttaatt ggtgctgcag    233760
     gaattggtaa gagcgcgttg gcctctatct acgtgcagcg catgaactca aaacctcaac    233820
     ctgattttaa gaaaatcata tggatgtcgc tgcatcacgg acagacagtt agtgggctaa    233880
     tggagtttca cttcaaggag tgtgaattta cagctttgat tcaagaactt agctgtctat    233940
     ttgtaattga ctgtggccct gtagagtttg aggaggataa aaattttcag gctatagctc    234000
     agcaattctg tgttggaaga catcaaagca ctctgttgat tcttagccgc aacactgtga    234060
     gatctgttca acaattagcc agaattcaaa gaccagcagc aacaatcaaa ctaagtggat    234120
     tacccgataa agatgcactc cgaattctta aggaacaagg gattcaaggt gaatcggatt    234180
     gcaagaaatt aatcaaatcc tatcggggaa atcctcagct ccttctacta gcagcagaac    234240
     gtatcaatcg attttgtggt ggcaagcttg ttgagtcctt tatgctgcat aaaacatcat    234300
     ttgccagtga ttatgtcaga cgagtgattc aggaatacag aatgcaagaa ctgacaccga    234360
     ctgaacaaag aatactagat atattgatcc agtcagacaa tgatgctccc aggtggatta    234420
     cgtttagtga attaatgatg gaactatctt ctggtggggg taatgcttca atgtcagagt    234480
     tgattgaagt tttagagaag tgggaaggaa tgtcattgat tgaatctgac aacgaccaga    234540
     acactggaga agcaacgttt atgcttcccc cgaccactcg caaggtactc atgcggaata    234600
     ctctgaacag ccttgtttca ttttcgcagc ctgcatgatg aaattttgta ttagcccatg    234660
     gtgttctcag agacaaaatc cagacgaggc cgagatttgt caatcctgcg gaacacccct    234720
     gctaattaat gatcggattc ggttgattcg tcctttgcgg gaattagtgg atttgatccc    234780
     ctcagaggtc tttgaggtag aggatataac cgggtcgtat gcaattcctc ctggccgacg    234840
     agttctcaaa accctgagaa cagtggatgc taaacgagtc gaaatgatgg agcgggaagt    234900
     cagggcgctt cagatgctca atcatccagg gattccaaaa gcggacctgg gtgatttttt    234960
     tgagtttcaa ccaaattcgg ggttcccttt gtactgcatc ctgatgacca agctagaggg    235020
     tcaagatctg gataagtgga ttgaagagaa tggacgcatc tctcaagaaa aagccttaga    235080
     ttggctgaag caattgtttg agctgctgca tgaggtccat gattgcggct tctttcatcg    235140
     ggacatcaag ccatcgaata tccttctcaa agaagatgga acactcgctc tgattgattt    235200
     tggtggtgta agagaagtca cagataccta ccttgctaag ctttctggaa ccggtgaacc    235260
     cactggtttt gacaaagagc atgaaatcac aatcgtacgc actccaatgt tttcgccgcc    235320
     tgaacaggtt aatggtcggg ctatccctca atcagacttc tatgcagtcg gtcgtacctt    235380
     tgtagtgctg gtgactggac tagatttatt cgatatccct ctagatgacg ataacaaaaa    235440
     attgctttgg aggaagaagg cacctcatat cgatccacct ctggctgatt ttctggataa    235500
     gttaatgagt ctatcgccta agcaacggcc aaaaacaacg ggcgatattt tagatcagct    235560
     caatcaactt cccaaacgca tccgttggca tcgtcgcgtt aaatcagtac catttcgact    235620
     tagcgcaata ctactaacca ttctggttgt agttggcttg tttcaaggtg gcaagatcgg    235680
     tctttctaga tattttttta gaatggcggg tgagagtgaa gggagaaatg atttagaggc    235740
     cgccaaacaa aactataaac tcgccgttca atttgatcca ggtgattatg cagcctacaa    235800
     caacttggcg gcagtctgtc aactattgaa aaaatacccc tgtgcgattg aaaattacaa    235860
     aaaagccctc caacttaaac cgaataatga agtcgttttt tataacatag cgagtattta    235920
     tgatgatgct caagacttca cggaggcgcg tttctattat cagaaatcaa ttgaggctag    235980
     ccagggaaaa tttgtcgctg ctattaacaa cgtggcaagg ttagatattc tagacgatca    236040
     accacgaaaa gctgtaaaaa gtatttctcc agcactcaaa aaagtcgaga atattcggac    236100
     taaagcatcc ttgtacaaaa acctaggatg ggcatatttc caactggaac aatataagaa    236160
     atccgtcgtc aacttagaaa aaagcgttga aatagaggca aatgaagcca gcacccaatg    236220
     tctactcgct aaagctaaga accaattgaa tttgccatct aaatcgaatt tacaattgtg    236280
     cttgttctta agttctgaat taccagaagt ttggacatgg aaacaggaat ttgttgatcg    236340
     actggaatga taaaactaaa tatagtaaga tatcttaaaa atttatttta gaaaaaattt    236400
     ttatattaaa tgtactcatt caaaaaagtc tttttagcgt tgttcgtatt attctctttt    236460
     tgtagaatat ctgagactgc ttacgctgaa actggggaaa ctccgtccca ggctaaccgg    236520
     tgtcttacaa cggtggcacg gatcctctcg tcgggtgatc aacgccatgc taagggacgt    236580
     ttgctttgtc ctggggatca ggtccgcccg attgcaggca aacaaacgct cgttctatgc    236640
     cataacggca agtcccttac aaaaggtaaa gagggggaag tgggccgtct ctgttcttct    236700
     ggtccgaaaa gacttcagca aaaaggccgc ttgagatttc taaagtcacg ggggacaacg    236760
     gacaaagaag ggaaattaag cattgttcag cctttaggga ccatgatcat gcaacttcgc    236820
     cctgattttg catggaaacc cgtgaaggga agcacccact atgaagtgac ccttcaaggc    236880
     ccaaacagta agtgggagca gaaagtgact tcagggcatc gtctaaacta tcccaaaagt    236940
     tggcctgcat tagaatatgg caaagcatat tatgtgacag tttacgccta tcaaaacgag    237000
     aaaattattg gttcagatcg gacaaagctc aatctcctgt atgaagaaga aatcagcttg    237060
     gttaatgagg ccgttgcggc aattcaccaa ctctccttat ctccagtcga ggcagcgaaa    237120
     gagctagatg ctgtttatat gtctttcaaa ctattggatc aatcgattgg ggttctacaa    237180
     aacctgaaag acagtggaca gagtaattct caacttaatc gattactggg tgatcgttat    237240
     taccaagtcg ggcaacctga gcttgcaccc agagcggaag aagctcaact cccgaccagt    237300
     atgaagttac cccaaaaata agggtgccaa tagtctttag atgccaataa ttttaactga    237360
     gcttgttgca aagcttgagc cttggatcgc ccctccttca ggccctgata aaacgctgta    237420
     atcaattcag tcgttgctcg tgactccgct aaccagagag acgctagggt attttttgat    237480
     ccagcttgaa tggctaatcc agtaataccg agtgcagatc gcctatctcc tttagcagtc    237540
     tcacaagcac tgagaataag tagttccagt gtggcttgac ccagctcact tttctggttg    237600
     attaaatcat gaaactgttg agcattaatc ggttcgttgt aggccaggag aaaagttttc    237660
     tgaggatctg agctaaattg cccgtggcta gctatatgga tgatgggggt ttcttggtaa    237720
     attgccgctt tcaaacgatc cgccgtgaaa tcacgattga cgagagaggt gaatctctgg    237780
     gaaatctgct taacttctcg tagttcctca tcaacttcag gtagggcggg taggcccttg    237840
     ggaacatcgg gtgaattaaa gctaggagat tcttgagata gccctgcaaa taagacattg    237900
     agcgacttaa gactcttggg ttttctggtt tgtagatagg tattgaggga attcgtgacg    237960
     ctgtaattct ggattaaata cccttgacca tcgtggagca ggcttaaggg aaggttttga    238020
     aacttgctat cgaggacaaa gagtaaatca cctgtagggg gtaggtgatc actaaggggg    238080
     gcaatcagct cactgtagag aatctgtgca ttcctcaaaa aatgggcttc agaaatttct    238140
     tccacggaat ccccatcaaa gagggttagc agtttaaata actcctgctg aacgatggtt    238200
     gaatcaggct ggtgccgata gatgccctct ggagtttgag caatgatttc tatttgacca    238260
     ttgagatcca agatatggat tgtggcactg taggacgcca gctgttcact agattgagcc    238320
     aagagcttcc cgcattttag atagttctca agctcagcga cttgaagctg ttggtgggta    238380
     tccaagacaa gctgataact tggagtggga gaagaaagta gaagcttgat gtattcctgg    238440
     taaacaggct caacactgtt cttgtagctg aactgaagat ctgaactcgc ggagatcaac    238500
     atcgttcgca cctgatccag gtgactgatc gtggtattgt aagctgcgat cgcatgggtt    238560
     cgctggccgg attgttggta tatctgcgcg agctgccaag accattgata ggcaaggcta    238620
     tcgtcattgg aagactgagc gagtttcaag gctttactaa agaccttctt tgcatcccct    238680
     aattgttcag attctagata gattttgccg agggttccaa aggcttggga tcttaaactg    238740
     gaatcttgca gtaatttggc cctatcaagg gctgatctag cgtggtgaaa tgcctctcta    238800
     gtcattcctt gttcgttgag tagcccactc aacttaagtt cgagattgac cgcatccacc    238860
     tcatgaaatt ggctgaaatc agttgaggct aaattactga tataaggctg aatgaggtgt    238920
     tgggattgct gatatacagg gcttaaatta gacgacttga ctgttttgag atgttggatt    238980
     agttgaaggt tatttagttg agcatggacc cgatgagaag gtatagagtc aaggcttgtg    239040
     tataaggaaa tcgcttctaa agccttttcc tgggctgtat tgatggccgt cgcttcactg    239100
     gtcggatcag ccgtcaatga gagttgatta atcgcgtctt tgtattggga ttggtagcta    239160
     ttggcgagac tgagtataat atcggggtgg ctaggatcta aggtggtagc tcgtttgaga    239220
     accgtaactg aggactcaag ctgaccaagc agttgaagat tgttgcccaa attttgaaga    239280
     gcagcaagtt gttgttccgg tgccaaaccc agcttatcca agtctggaat ggagagggaa    239340
     ttattcgatg gtctctggca aatttcgcgg tttaaggtta ggacttcagt taaaacggta    239400
     caggctcgat gatattgtcc caatcgtttt agggcaatac tttggttgat caaagcaccg    239460
     ttaaagccat tggagtgctg ggcatcttca tagactgatt ctgcattctg aaaacgcttt    239520
     agagcttttt gaggttgatt ggtattgaga tattgcaagc cttcttgaat aagactgtct    239580
     ccctgctgga ttgtggggga ggaggtgaca gccgtggctt gatatggact agaaaccaat    239640
     aaaagcagac tgagaacttg ataagggttg agtttcatat tgttaaaggc tcaggtcttg    239700
     tcacaggttg cagcttggga tgcaattcgg gttgtttggt cttgatgctc cgcgatgagg    239760
     acaagctttc catcaatctt ttgccagcca atagcctctt gaatgacggg gagatctgga    239820
     gcggtctggt tgccctcaga gttagatgcc aattgcatct gagaagcatt ccacgggaca    239880
     tcagtggtag cgatatcatg ggcttttgcc ttttggtttc ctggccccaa gacaacaaac    239940
     gagctgcgcc cttgggttgg attgcaagct gagacgactt tcggtgaacg ttcaacatta    240000
     ggagcggctg aagttgtctc ttcagcatca gttcgttgag tgttcacagt aacagaaccc    240060
     tcttgttgag ttccagaagc tgatgttgca gttatttttg tatcaggtga aagaaaaagt    240120
     cctactgtat taatctgaat atttccacct ctgttattaa ttgcattagc tgaaatgtta    240180
     ttgctcccaa gccctacaaa gacatcagca tcaatctgta tattgccacc agggccatca    240240
     cccttagctg aagcagaaat agtcccatta ttgagtagca ggaaattgga tagtaactga    240300
     atgtttccac cattacctaa agcagtagct agtaacgatg cattgtctac ttgaatattc    240360
     tgagcctgaa gagaaatatt tccagcatca tttggtccgt cattccgaac gttcactctg    240420
     ccactatctt taaccaagat agagtttgct gtgatgcgaa tggatccggg ttcgccagtt    240480
     ggtatatctg gtaattgaaa aagtgcccga aaaaactcgt tcgttctttc agaagaagat    240540
     attatttggc tactatcacg gaagtcatcg cttcctggga tttttccttg taatatcaaa    240600
     ctgccctgaa catcaatttc gatatttcct gcatcgccac tattggtagt tgttgagtta    240660
     attcttcccc catcaacgat agttagattg tccactttga ggaaaatatt acctgcatca    240720
     ccaggggaaa cagtagtagt accgataaaa ctaggattga atgataaggg taaatctggg    240780
     ccaatactaa ttggagatcc cccagaaatg gatatatcat caaaagtgac ttttatgtca    240840
     cctgtatccc caagtgacaa aggactggaa gaagtagtac ttgaggagat aaaccctcca    240900
     ccagtgatag ttagctgacg gccttgacct ttaatgcccc ctgcatttcc attcgttgtc    240960
     aaagatgtaa tggagctagg ccgaaaattc aacggaatag gtgatgttcc atcaatcaag    241020
     agtgagttat caatggaaaa gtctattttt cctccagttc cacctgcaaa attaaatgaa    241080
     ttaataaatc catagctagt caacacacca ttttgtgaag aaactttgat atttggacct    241140
     gtatagcttg aaaaattttg agatacaatt ccaccatatg ggacagtacc atcagatagt    241200
     gaaactgtta atgcggctgg atcttgcact ccctgaatga ctaaatcacc agaaaggtta    241260
     atattgattt gactgttatt attgcttgaa tagttagaac tgattacaag cgattgatca    241320
     ttgataagta agtttttacc acggataaat atattccctg atggtgatcc tgtcgcagtc    241380
     aataatgatt tatttgataa agtgacatcg gcaaagtgaa caatcttttc atcgttaaat    241440
     tgaaaccctg taggatcgag tgatatacct acttctcctt catcaacact actcaacact    241500
     aaatttcctg atggtgatgc cacaacacca ccattaaata taatattcct tccaacaaaa    241560
     gctaaagttt gatttggagt ttggaaggga atggataacg gggagtcaac aatagggctt    241620
     ccagcaggca atgggttagc tctttgtagg gaattccctg tgccctggat tgtaatagat    241680
     cctgatgaag aatctatgct taaacttaca ggtagacttt tacttaataa agagatttca    241740
     ttaatagaat ttagatcaag ttttttgcca tcaagaaaat ctattctatt tgcagtagtt    241800
     gcaataaatg atccaccaag acttaactgg ctgcgtggac caaagataat cccattaggg    241860
     ttgataagga ataagtttgc tgctccattc gcttgcaatg taccgttaat attagacatt    241920
     gaagttcctg taattctggc aagaatattt tggatactaa tatcattcaa aaaatgggct    241980
     gtccgatgtg atggcacaga aagagtatca aagctatgaa aaagattcac tcctgaacgt    242040
     gaaccacctg taattacata tttttgctga ttaacagaaa ctctagaatt attcggaagt    242100
     gttgagtcag gaattatctg agcttgtgct attccagaaa atagcaaaaa atacatccct    242160
     aatccttcag ggataaagtt atttctaaaa aacatctttt agttaatacg aagtttagtt    242220
     ataaggccat ctttaggtct gggtaggggg actagatcat actcaagatt ttgatttggc    242280
     aacagttccc aatcacattg agatattaga gaagatgcaa atattttcat ctctagcatg    242340
     gcaaagtctt tgccaatgca ttctctgaca ccccctccaa aaggaatata gttggagctt    242400
     ttaactagct ctttatgctc agcaggattg aagttctcag gattaaatga atgtgggttt    242460
     gggtaagttt ccttattgta atgagtgaaa tctatttgat aaaaaacaag ccatcctttt    242520
     tcgactttat atccaccgat ctcacattct tttaagactt tacgaaaacc agacacaact    242580
     gacggtacaa tcctcataga ctctagaagt actttgtcta gataaggcat tgaagactga    242640
     tttatatctg gattatgggg gatgttgctt tgttcctctt tacatcgact taaaatatca    242700
     gggtgcaaag ataaattcct gcataatgag caaagtgatg acgttagtgt ttcatggcct    242760
     gcaaataaga gaagcagaat ttggtgcttt acttcttcaa ctgagagctt ttctccatcc    242820
     tccaactctg catccattaa atgaaataga gcatcatcat acgtctgact gctactcaat    242880
     cgatcttgaa taatttcatc tactagctta attagtttct tcctatcgac tagagacttt    242940
     cttgtttttg taaatggaag gggtggggca atcgcaaata atccattact ccagcttttg    243000
     aagtattcac atagtttagt ttcagaacca ttgtctaaac tgattagata ttttgatgcg    243060
     atatcaaaag tatagttgcg tagctcgtcg taccacttaa agctatctgt ctttgcccat    243120
     ttatttatat agctttgtgt aatcgcgtga atcgtttcct gataagatgc tagtctcctg    243180
     ggtgaaaaag ctttgaggat taactttcga cgttttaggt gagtttcccc agtctgtagc    243240
     gataaggaat attcacctaa aagtgatttc acgttgccta cggggaaagc ctgaaaaaac    243300
     ttattttcat tagaaagtat gaaattaact tcatctcctc cacctacaaa aacaataggt    243360
     gttccaaaaa ggctagttat aaaaatattt ccatacttct tttgatggtc actaataaag    243420
     ttcttattct tgatgaattc taaagattca ccaacaatag gcaagcctaa actacctgga    243480
     ggtaagctcg cttctgtata ttctaatgtc tctaaagtca ttatgttgaa gtgaataagc    243540
     agttttcagt ttgatgaggc aaaccctttt tcctctactg aaaatattca attgacaata    243600
     tgactaaaag attagtctat actttctgaa gtaaaagata tatagaatct atcactaaac    243660
     ataactgtta ttgcatgttc gagtgtaatt taaggacgtt gaatactctt ttttactcct    243720
     aaaaaaaacg gtattacagt actgtacatc ataaccatgc aataactgta atctactcct    243780
     gtagccttct ttgaactaaa taagacttat aaggttataa gggtagattt agtacaaaat    243840
     ataaacaata ggcgaggatt tattattttt tgctcgtttt tgggttatta aatggcatga    243900
     ttctttctaa ggacaatatt cagttaatga tttatggctt gtttgcaggg aaaaattgct    243960
     gttgttacag gtgctgcatc tggccttggg aaagccatcg ttgagcgatt ttccaaggaa    244020
     ggtgcccaaa ttgttgttgc agatatcaac gaagatttag ggcgggatgt atcggcatca    244080
     ctagcttcca gccacttcat taaagtagat gtcacggatc cagcttctgt tgagaaattg    244140
     gtgaggtctt cagttgagcg ctatgggcaa atagatattc tggtgaataa tgctggaatt    244200
     gaaggtgaat tatcaccgac tatcgatagt agccttgaga attggcataa agtaattgct    244260
     gttaatttag atggtgtcta ttttggtatt aaatacggtg ttgccgccat gctagctaat    244320
     cgtaatggtg gagtcgtact taatatgtca tcaattgtag gtctggttgg ttttggtaat    244380
     ctcccaccat actctgcttc aaaggctggt gtgatacagc tttcaagggc tgctgcagtt    244440
     gaatacgctg cccagagaat acgagtcaat gctatctgtc caactgttgt cagaacacca    244500
     ctattagagc gggtcatcga aaatagtcca gatccaaaac agactcgtga gcggatggaa    244560
     aatatgaacc ccttacctgg tttacccacc ccagatgata tagctgccgc cacattattc    244620
     ctcgctagcg atgaagccaa gtttataact ggaatagcac taccgataga tggggggtat    244680
     acagctagat aaagtgatct aaaaatttct tgaacagaat ttgatgagca gtaagcaaag    244740
     acaaaaccta gctgtggagg catggtttaa aaacagggga ttttaggtta cacttccacg    244800
     gcaaaataaa ccatcatttc ttcgatggct tgaggtctac ttctacccaa tcaggtcaga    244860
     ctatgccctt tggaatcgct tgaatcccaa caactctagc cagtggggat gaggttctcc    244920
     ggttagcaat tccttagggc ttttaccctc gcgctcagga acctcactac gcatgaagca    244980
     gcggtgattc aagaagtact gcaacagtcc caaataagag tttccaaggg tacggcgtag    245040
     aaagaagtag ttgcgcagcc gggagttgag attctctact aacgaactgg ctctaggtgt    245100
     ctgtttgagg gcttcagtga ctgcctccat cagaaggtga aactttccag aaagtccccg    245160
     atacaattga ttccactttt cccagtaggc attggaagtg ggctgtttac gatgcaacag    245220
     acagacgtct ctaaccttgg ctagtgagac ttccagacgt tcagcaatct cagcaagctt    245280
     ttgatccaaa acacccgaaa atgccaggag ctgatcgcgt tgattgtgta atgctttcca    245340
     tagtttgcgc agcatgggga actcaccatc atcgcgctgt ttgagttcta ttttgatgaa    245400
     gtcaaataac tcctgacgga ctgacaagag gggacctgcc agttcgagga catcatgggc    245460
     catccactgg aacagaattt tgacatcttt ggccaaacct agaagtctct gttctcgacg    245520
     cttgaggtgg acccacttgc tcgtcaatga ccgcgtggat tcttgggcaa ggtgggcttt    245580
     agcgatgtcc tcttccaatt tcattcgcga tgtagtggcc ccattagcct tgcgcgtcaa    245640
     actcagaacc agttcctcaa actgatggag gatatggaag acatctccat tgcagggagt    245700
     gctgggcatg actgcttttt gtcctgccct caagcctttt gcagcatccg caatcgtgaa    245760
     atcagggtcg aaaccttggg attgaagttc gagtaagtac catccccagg tgtcttcatc    245820
     ccgatgctct gcagctttga ggaggtagca gtaggtggag gaagcatcta ctccagccaa    245880
     tacgggcaga gaaccttgaa agatttcatc atgaagaccc tgcttaatcg tagacaagtc    245940
     ttgcgattgg ttgatttctt ctgccttggc cgctgcaact tccaaacgat tacgaactgt    246000
     tcccaagctg atggaccagt cgaacagatc acgcaacagc tcaacaaccc ctcgataaga    246060
     ggaatggcag atcagcacca acgctagaat cagttggaac aaccaagttt tggtgatcgg    246120
     tagatagaac agaacctcgt catccccttt atcgccgagg aaggattcat ccaacgcttg    246180
     agcagcaatt gctttctgct catagacaaa cttgcgactg gtttgattct ctctagcaat    246240
     gcgagcaatg ggaatggatc ttgatagagc ctgaatgccg atatctttgc ggatctttgg    246300
     cggaagtgtg gctgcaattg caggagttga aatcatgcgg aggatcaatt caggggagtg    246360
     acattaagac ttcaggttac cttgatcgct cctgaagtgt tacccacttt tgatccaagc    246420
     ctatttgcct aagtcaatgc ctagaatttt catagaactt ctcctgtggg ttggggaatc    246480
     ggttgacagg tcaatgtttt gttcaaattg tcctggtttt ccaacccacg gcttacatgg    246540
     attctgaatt cacaagggca cagatgagat gatctgccca gtcttatcaa cggtgataac    246600
     ttctttgtta gtactcgtcg gggttaagcg atcttttttt ttcgatattg ggatcgacaa    246660
     tttcaccctc aagaatcaac ccctgatcct gatgtgggtt cagttgtcga agtgatttag    246720
     caagtagctg atccttgaga agggcaaagt ctttgtcagt ggccccaagt tgtttgagga    246780
     catcgatttt atccttaaaa ttctccagtt ctagtttctc agcctcgatc cgggaccgat    246840
     actgtctatc tttctggcgc tcatgccgat cattcaggta aagcctaatt ttctccaaag    246900
     gattgagctt acccagaaaa tcccaaaacc caggcgagtg cagctcaacc ccaatcagcc    246960
     tcagccgatc cgcttcgggg accatcgccg cgactttttc aggggtgggc ggccaccatg    247020
     ccatccacaa taggtttcgg atcggtagcc ccggattatt gcccgtgcga tagaattctt    247080
     cggcctcttc aaggatgcta tcgaagacat aggcactgtt ataggcatac tctagatctc    247140
     gcaagaatcc agaaacatca cccacatagg catccccatc cccgaaaatt cggagagcac    247200
     ttccttggga tgtttcagta gctgtgagtg ttgagaccac gcgatgactt aatcagggct    247260
     gaaatcaaga taagggcttt aacggccaag atcaagggaa tttaggagtt ttcctgatct    247320
     tctaaagacg attctttctc ttccaaggca atattcttag gatggggtac gggtctttta    247380
     ctaagcacca tgaaaacgcc atgttccttg accaatcatc gcagcgatgc tcataaccgt    247440
     tccaagttct gcctgtctgc ctactaagtg tatggaggac tctgttaaag caaaacagtt    247500
     atgcttacat ttgatttttc ttgtatgaaa aaatactcaa gtgtcagctt cgacagattc    247560
     ctcctaaagc gagtaatgtt tctttctgag catcggtcaa acctgttgtt tcagtaatat    247620
     tcattcctgc atatggctta gtaggtctaa gagtagctat gcattttccc attgaaacat    247680
     tccaaatttt tattgtttca tcctgactgc tagtgacaag taattgacca tcaaaactaa    247740
     acgatgctga gaatattgca ttagtatgtc cttccaagat tctcaaacac tgcccagtat    247800
     caaccttcca caatcgaact gtatggtcaa cactcgctgt agcaagcaac tgcccatcag    247860
     gactgaagtc catatcccaa attggatggg agtgaccttc aagcttatgg atatattggt    247920
     tcgtatttaa atcccaaagt attgctgtgt gatcaaaact gccgctggcg agtattgttc    247980
     cattgggaca aaaagcaact gagctcacac atgatgagtg gccattcaaa gtatttaaac    248040
     atttctctga ttgtatattc catagcttta tggaacaatc aaagcttcct gtggcaagaa    248100
     tttcttcttt aggactaaaa gcaacggacc atatccaatg attatgtccc tgaaatgttg    248160
     taagacatac gcctttttga gtatcccata acttaacagt ttgatcagag ccacagcttg    248220
     ccagaatttt cccttttgga tggaatgcaa gtgaccaaat acccttatca tgtccactta    248280
     ggatatgctt acactgtcca gtttggacat cccatagtct aatagtttta tcatttgtac    248340
     tactgccact tgcaataact tgttcaagag ggctaaaagc aatagctctg atagcatctg    248400
     tgtgtccagc tagagttaca cattgcttac ttcttagaga ccaaattctg agtaatttgt    248460
     cttcacctcc gctaatgatg tactgatttt cttgatgaac tgtcttagaa ctttcaaaat    248520
     gattaatcgg taatcttgca aagagggctg cccatgttgc ctgtgtatag cctaataatg    248580
     tatgcaaaca cataccactt ttaatgtccc aaatcttgat agaaccatcc tcagaaccgc    248640
     ttgcaattgt tctttgggta gaattgatag ctactgacca aacccaattc gtatggccaa    248700
     aaagagtttt caagcattgt gtagttctta tatcccagat ttttataaga tgatctgctc    248760
     cgccactaat caagtagtca ccagatggac tgaatacgat acagcgtaat gcattggagt    248820
     gccctactaa agtactagtg catgcaccat ttatcacgtt ccatagctta atggtctcat    248880
     catcactggc actggcaagt gcttgtccat caggactata agtaatagac caaacccaac    248940
     cttcatggcc agaccaagct ttcaaacaaa gaccactttt gatatcccaa atacggatag    249000
     ttccatcagc atatccaatg gccaggtttt gtccatcagg actaaaggcg gtagaacgag    249060
     cgccatgact atacttaaat attttatgac attgacctga ttggctattc cataacctca    249120
     cggtgccatc atcactacca ctaactaatt gctgaccgtc aggactgaaa ttaattgagt    249180
     aaacaacatt agtatgacct gttaacagct tcagattctc acctttttcc acatcccaaa    249240
     tcattatcgt ttgatcaggg ctaccactag caataagatt gcctgtagga ctaaaaacta    249300
     tagattgtac ccaagatgta tggcctgtta tagtgcgtag atgttgtcca ttttcagaat    249360
     cgaaaagacg aatctttcca ttaacatctc ctgcagcaat catctgatca tctggggaaa    249420
     aggcaattga gtgaacacta cctaaagttt gtgaaaaaac agattttgat aagtctgagc    249480
     cagtgaaatt aactccgtat aagttaattc ccctcatatc agcttgccag accgagagat    249540
     gagaaaagtt gtggtcactt aaatctactt gtaaatgtcg aaataaattc acaatatttc    249600
     caccaacata tcccatttct tccagagact ttccacgagt aagtgaaagt aaacgagata    249660
     aacaagatgc tacgtttggc ttactcccca aaagcgtaat tagttcatct atcagtggtc    249720
     gtaagataag atggacctgt gcttcctgaa catattcttt ggcttgagct ttaactagag    249780
     catgagttct taatagatgt aactgctgta ttttgctatc aatatcgttg ctgtagatct    249840
     gaatctcatt gcagatttgc tggataaatt tatgggttaa aaattccatc aaaacaggtt    249900
     gaagagtata accctcaatg gtcacctcaa ttaaagatct accttttaga gactcaaggg    249960
     cttcgatgag ggtctgctga tgatgtgaag ctagaaggtc atccctcagg ctgaggagag    250020
     taactggttc acgattaata gctagccagt acattagata tttctctacc tgtgataagc    250080
     gattaaattg atgttccagt aaatccctta tatcgccaaa attagctata tgatttatta    250140
     acttgggaat acgccctaaa aaaatggttt tgattgttgc agccacaata ttcaaagcca    250200
     gtggattccc ggaataataa ttcacaagtt caacagattc atattcaaca tcctgtaatc    250260
     ccttggcatt cagtagagcc ttccctacct ttagagaaat tcctgagagt tcaagggaac    250320
     gaacaggaga atttttccct tcccgcatcg ataaactttt tggtcgttct cgactggtta    250380
     acaatacaca gctttgatgg gattcgtcag caagtctacg tagtagatgg ccataccctt    250440
     catatccttt caaatatcgt ccgccaagct gaccactctg taaaacagat tcaatattat    250500
     caagaatcag taaactgcga ttcttacgca gataagaaat aactaaagaa atgcgatcat    250560
     cattgctctc tggtaagctt gaaacttgct gtttagaaag aaaggatatt agattctgta    250620
     aaaggtcatt aaacggtaaa gcattcctaa gagaacgcca atacaaacat tgaaaataat    250680
     cttgattgat ttgagccaac ttagctgcta aggaagtttt accaataccc cccattccaa    250740
     gaaggcttat tagacgacaa ttatcctcct tgatccagtt tgtaagtaga gctaattcag    250800
     actgacgccc tagaaaattt gaagtatcaa cagcatctcc ccaatctact tttagattat    250860
     atgaattgtt ctgatcggca atcaaatgat cagttttagc atctagctca tttcttttag    250920
     attggttaat agcactaatt tcctccaaca agtcgaactg attcctagta acttgcttag    250980
     atttatctgg ctgtagtttt tcccactcta aatcaaactg ctttaagtta tcagctattt    251040
     tatgcctgga gtaccagaaa caaatactaa aatgccactt atctgatcct cgtggctgag    251100
     atcgattatc ggaaagaact tttagaaatt tttctaagag cttgagtgat ttttttattt    251160
     ggtcagagct tagctgacct tgatatttat cacaatgaat cagcccttgt aaagctctaa    251220
     ttgttgtttc gatgactagc agattttcag ttttccagtt gtagcaaatt ttagatcgga    251280
     gactatcagg tagtaaaact tcatcatttg cataagtaag taaggcttct agtaaacgct    251340
     ttgtacgttt ccttgttatg ggaccatagg tcaaatggct atgacctttt tcagcagtag    251400
     agttcgatcc aaaataagtc atgaatcaat aattgataca tatctagata agacagtcta    251460
     gaaaacttat cagctatatc taggatattt acgtataaat tgtaggattt cttagatttt    251520
     aaaaaagtta agtagactta ataggttata taactctata tacgctgatt tatataggtt    251580
     tcagagaaga atagaaaaag tttgcctaga gctaagaaca tggggtgaaa atagtctatt    251640
     agttaatagg aataaaaaat ttctccaagc atctcaatca actaggcctc aaacgactga    251700
     agctgcgttt tggggcagct taagcctaaa agccatgaat agcaacagtt ttgggcactc    251760
     tcattaaata ttgattattg agaatctagt cagctcgcaa acgctgtaac gacagaaatt    251820
     ggttgagtgc tatagtgcat ttatactaaa ttgcactata ttgcagcttc cgttgtttta    251880
     gaccttttag agatgatcga tggaccaact gatgaagctc tcaaagaggc taatcaagac    251940
     tttatacgat ggccgaaggc cagtcgaaga ccattgcaag ccctaactgg ctaatctcag    252000
     ttttctgaat atggtgatag aagaactacg ccaattactg accccgctag ataaatcact    252060
     cacggaatgt gacggcatga ctcgtctttg tcataccctt cttctccaac acgacatccc    252120
     ccatcaagtt tattgtggat cttgccaggt tgagactcag ttgattccct tacatttttg    252180
     gattgactta aaaggagttc tacgaggatg gcgcgtggat tataggctga gaatgtggat    252240
     tggagacaag aaactggatg ttccgcatgg tgtattcaat ttcgccgcgt tctctcaggt    252300
     tcactatcaa ggtgagacga tagagatgtc accattgtct gaatcgcttt ttcaggttct    252360
     gatgctggct cctaattctc cttcatagtt tcaatcaaaa ccccaaagcc aactgtacct    252420
     gctgcgttcc cctagcccct tctgggagtg gctctggctc ccctgacttc gccgggcaat    252480
     atttctgata cccgcagcga tcgcaatgct gtcccgtcac aggtttccat tcctgatcac    252540
     atctgagctt catcgccatg tcttcaatta gagatcgggc ttgttggtga tgatcgtcgt    252600
     tgacctcata ggtcagtttc tcgttagaac gcaagtagat tagactcagg cgtttgagcg    252660
     ctttcttgta gatctgttcc agtatcagat aataaaaacc caattggata tccacggatg    252720
     gaggaggatt gacggattta ctggtcttgt agtcaatcag ttccagacca tcatcgatat    252780
     agtccaagcg atcataccga ccagataggg tgaattcgat attacgaact tggagatttg    252840
     ccctgacttt tgtttctatt cccagcggtt tgcggatttc ggggagtggg gaaatatacc    252900
     gctcatagta aagctgcagt gctgcccacc cctcatggat ctgagttggg gtcaattcac    252960
     cattatgttg ctgccaacaa acggcaaacc aatcgaggga aggaagaggg taagcgtagt    253020
     tccaatcctt gtagatagtg gctaatgccg catggagagc attgccaagc ttagttgaac    253080
     caaatagagt tggcgaaggt aacttatgct catacctaaa ttgataggac tgggggcact    253140
     gtccataggt tttgagcttg gtggccgata gagggtagga catgggcgtg tgttaacgca    253200
     taagcctata gtagatcaga tgtattaaac cctaaccctc ggtccaatat tatcgccgat    253260
     tcctgcgata atcccacggc ataactgggt ttggctgact ccaaaaattg agctttcgtg    253320
     atctcgcatc attctctgcg tcaacatact gatttgctgt atcggaacaa ccatcaaggt    253380
     agcggtgata gaccacggca tagccttccc tcaccagctg taaccccact gatttcccct    253440
     ccgagtaaat ctctgccact gtgcgcccat attgatcagt ggtgattttc cgaagctcga    253500
     tatctgctcc actgggtaac agggccttaa gtcgttgacc agcttcagga ccaaactctt    253560
     ggtcgtgctc tggagcatca atgcagccaa cacgaacctt gctcgatgac ccatcttgag    253620
     agcgcacttt aaggctatcc ccgtcacccg tactgagaac ttcgacggag gtggtgttcg    253680
     ctggggcaat gtcggcgtta gtggcttggg gaggtgggct gcatcccaaa aggagagggg    253740
     gaatgaggag agagagaatt ggaattgtgt ttttcatcag ttagttgatc gaatcatcaa    253800
     tccaaccaca ttccctgcaa tcgtagtgga tgggtctgct atccccaaag tttgcaccac    253860
     actctgggca ggctcctgtg aaaaaggggt gtgattccag aacctctatc cgctctgatg    253920
     aggtgagata acctgcccag tccttgatca gctcaccatc ttcatagaat gcccccactg    253980
     gctcccagtc ctcgattact tctgcgaagt cagagcaagg attctgaact gggccactgg    254040
     gatgaatagc acagactaag tactgggagc caaggtatcc gctaaagcgt tcgcatctgt    254100
     gacagaggac agtcatcaag atttactccg ctgcggtcaa gtcctcgacg ggcgcacctg    254160
     gggcattggt tttcacagag gagatgccat tctccatcgc agaagtcgag gaatacattt    254220
     cactgttgcc aatgatttgc ccgttggtgg ctttaagaac aaaatagggt tcttgcttct    254280
     tcgattcccg ccgatcatac aggttgtcat gaggggcatt cgtctggact gagttaatgc    254340
     catttatagc agcagctttg gtggtataca tctcacttgt gagaatgact tggttattcc    254400
     ctgctttcaa gttgaagtgg aattgaccat cagaagcccg tttgatttca aactttcttc    254460
     ccatatcagt caccgaaata ttagtagcta tctcatattt ttatttacgg tgagaatcag    254520
     actgaatagc tcaattgata actatatctt ttggtttgag cctggaaaga ttgactctct    254580
     acttcaagcc ttagctagag aataaactat gccgtggaga aaatagctga aactgtgcta    254640
     aacattaata gtacatatat attattacaa tgcttgttcg atcagtccat gctgtcgagc    254700
     aggcagattc cgtctgcctg cctattttaa gtgttcctgt ttcggctggc ttcccttccc    254760
     ctgctgatga ccatctccag agtgaattga acttgcagga tgccttagtt catcaccccg    254820
     cagcaacgtt tttcatgaaa gtcgagggct attctatgac aggctgcgga atcttctcag    254880
     gagatttgct gattgtggat cgctctcttg atcctgtgga tggggccgtt gtaatcgccg    254940
     ttctagatgg tgagtttaca gtgaagcgat ttcgtcgttc caaaggacag gttctgttag    255000
     ctgctgagaa ttctgactat cctccgatta cggtgcaaaa gggaatggac ttttacgtct    255060
     ggggggtcgt cactttcgtg gttcacgggt tggcaacttg aaacagcgtc taattgggct    255120
     ttgtgactgc aactcattct atgcaagttg tgaatctgcc ttgaacccta gcttgcaaca    255180
     taagcccgtg gtcatcgctt ccaacaatga tggggttgtt gtcaccgcca atgcaaaagg    255240
     taaagccttg ggtctggtca tgggtgtgcc tttgttcaag gttcaagcgc tgatcaagaa    255300
     acacgatgtc cgggttttca gctcaaacta tgccttgtat ggtgacctgt cttccagagt    255360
     gatgacgatt ctggagacct ttacccccga gcaagagatt tactccatag atgagtgctt    255420
     tatgcgaatg ccagaatttg ctgaggctac gacatactcc cataaggtgc gtaagacggt    255480
     gctgcaatgg acggggattc ctgtatctat agggatttca acctctaaga cgttggctaa    255540
     gattgccaat catgtagcaa aaaagcaaaa gcagtatggt ggggtgtttg atatttctgc    255600
     tgcccgtaat gctgagggga ttttagctac ctttcccgtc gcagacatct gggggattgg    255660
     tcgccaatac aataagtggt tgttgagtca gggaattgag tcagcgaagg aacttcggga    255720
     tgcgaatgag gggctgatcc gcaaaaaaat gggcgtggtg ggggtgcgga tgatccatga    255780
     gttgcggggt atctcatgtt tgcccctgga gctggttgct aaaccaaaga aggaaacttg    255840
     tgtctctcgc tctttcggtc agcctgtgac ggagttagca gatttgcagg aggcgattgc    255900
     ggcctatgca tctagggcag cggagaagct gcgtcatcaa gaacaagtag cagaggctat    255960
     ggttgtgttt gctcggacaa gtccgtttaa gtcggggtat tttcgccaat ctgcgacagt    256020
     gcaattcccc atagccacta actacacacc aacaattgtg gaatctgccc gtaatgcgat    256080
     ggctcgaatc tatgaaccgg gtcgggaatt tcagaaggcg ggggtcttga tggtggggtt    256140
     gtgccctgag acgaccattc aggggcatct ttgggagaaa gatgaggggt gggagaaacg    256200
     gaagcggctc atgtcgatca tggatgaggt caatgaccga ttcgggcgtg ggacgctgga    256260
     gattgctgca tcggggctaa gacagacctg gcgaatgcag tcgaagtggc gatcacccag    256320
     gtatacgacg tgttgggcag agttaccagt agcgagttgt tgagggtgat ggggtgcgat    256380
     tatagaggga ttaagtggat gattcggatg ataaaattaa ggccattcac tcctacccca    256440
     catcctgaaa gagtatggac agtcgagtga taaatgcacc aagaagaata tagccgatca    256500
     agacttggaa catgactagg aagtgaccca aaggactggc tggattggca gatatatcac    256560
     cgaaaccaag agttgtcatt gtgactacag agaaatagaa cgctctcaaa aaaatgcccc    256620
     atagattgaa agaatattga gttgattcac cggaggaatt aataatctca gcaaattgaa    256680
     tcccttgaat aaatgaagca tctaatctaa aagctatggg ggaaaggtat atcaaggtga    256740
     acacaactga gacaattaag aaggataaga ttatcctcgt tcctgcactt ccgtagtctg    256800
     acgaccacca aaaaagtcta actaaacacg accaagtaat ttcaggaata gaacgccagt    256860
     attttagctt agacatccta tacaagtatt ttggtattaa ccttgtgtac ctaggaatcg    256920
     atttccaatc cacataatat ggatatcttt catcccagtg cttctgacga atattgcgtt    256980
     tcagttttgc ctttagagtc ccattgattc tggcactatc aagaccaacc ccgctaaagt    257040
     cagtattaca gtccatttga cattcattca ataaggttgc tccatcaact attgagaacc    257100
     ttgcccttaa gcccttgatg ttagctttac ttagattcgc accactcaag tcagctccac    257160
     taagatttgc catacgtaga tcaacggatg ttaggttcgt tccgcacatt ctagtctccc    257220
     tcaggtcaac ttcagataga attgccccaa atagattcgc cccgttaagg gttgctccta    257280
     ccagttgggt ctttcgtagg tcagccccaa tcagttgagt gctacttaag tcagccatac    257340
     ttaggtcagc cccatccaga tctactccaa ttaggtcagc cccactcagc tttgccttaa    257400
     ataaagtagc ccttttcagg tcaccattac gtaggtttac tccaactaga tttaccccaa    257460
     tcagttgagt gccactcaag tcagccatac ttaggtcata tccagtaaaa tcaaaaccag    257520
     taaggatagt gttacctaaa tcaggttttt cattggagtt ttctttcctc cattgattcc    257580
     acgagtgaga ccctttattt aattcactta aatgatcagg attcaccgtc ctcctcccga    257640
     cgacacctcc gtgacttttc cctgaagttc cttccgatta tggtcgtact tcaacacctg    257700
     tcgagagatc tgctgcacaa aacgaacatt ctttactaac ctaaaacacc aacttagcaa    257760
     tcgccccctc cacctgctca tcggtgacct ccaagtaccc cgacagtgcg gtcagtgtcc    257820
     tgtgccccga aatccgctga atatgcttcg ttggcactcc agcattatgc atccgtgtca    257880
     gggccgtgcg tctgaaacta tgggtgctaa agccttccag tcccacccta gcaaaagctt    257940
     gcctcaagat tcagtctgct gatacgtcac cagatcccgg gccatcttct catgcattgc    258000
     cacttcgcgg gtatccagct atcccttagt gtgcatacgc cgagacaata ccgttagtcg    258060
     gggaccattc gcacatacca tatcactggt gagtatcttt caaacttcac tgatccgaca    258120
     agcggtataa atgcatgctc caaactatgc aataacacag gaggtctgta atcctgccgt    258180
     aaattacaga tgaacatgat tcggggacaa tacccctgct tgtccaaacc aatcctgttt    258240
     catagtggta ttctacatgc ttttttgcaa caaaggcctc ctgaaccttt taggtctatg    258300
     tgttctaatc tcgtcgattt gttgatattt cccacactga aactggcggg taaaagacgt    258360
     gcttatttag ttccaactag ctctccaact gctttccaaa aatgatcaac tgaataactg    258420
     agccattaag ctttacatcg atgaaatctt atttatagta tagtttaaaa ctaaattaac    258480
     ctataaaaag caaaataaat tgtagactaa tcattgatta tcaatttcgt aaaaaatgac    258540
     tgaactgatg cagttttcag aagagctaat aagagccaaa gcatacctaa tctaccttca    258600
     acaaaaggag aatggggttt ctacatgtga tgaacaaaac tggcaaacag ctattgatga    258660
     gctgctaaaa gaaaagaata tggtgatcaa gaacacctca aatctgagat ggcctcttat    258720
     tagaaaaata tggaaagaat tagagtatga agctgctaga gaaaaaacta aaatctttat    258780
     ttctttttta ggtctaggtg caactgttat agcagcaata gggctaggag tcaattatca    258840
     actttcagaa aaaaaactta taactgaccg ttttataaaa gccgtagatc ttttagcatc    258900
     tggaacaagt gagactgcaa ttataggagg aatgttttca cttgaaaaac ttgctataga    258960
     ttctgtaaat gatcattgga ctatcatgga actgctatcc agctatatag ttaaaaattc    259020
     atctttagaa gaaaataata ctccacctac aaagattagt aatgaagtag agttagccat    259080
     aaaaataatt tgtagaagaa aaatagagag agatcctaca gaaggtaagt tgaatttaaa    259140
     tagaatcaat ctctctggtg ctaaacttag gaatgccaaa ttcaaaaatt taaacctagt    259200
     caattctaac cttattagtg ctgatttatc taacgctgat ctgagaggtg ccaactttag    259260
     tgaaacaacc tttgataaag ctattcttaa aaatgccgtt attgataaga ctacaaagat    259320
     tgaccttaaa tggagaattg tccaccagtt agtaaacaaa aatggaatag gaaaaaatct    259380
     taaaggaaca gacttagtca atgtccaact aaatgatata gaccttaaaa aagccaacct    259440
     tgaaggtgca aatctcagca atacatcctt aaaaaatgcc aatctcagtg aagccaagct    259500
     atttcaagca gatcttgaag aggcagatct cagtgactct aaactaattg aggcggatct    259560
     taaagaggca gatctcagta atgccacatt agttgaagca aatcttaaaa aggcggatct    259620
     cagcaaagcc aagctatttc aagcagatct caaagagggt aatcttagtc attccaaatt    259680
     aattgaggca gacctagtca atgctgatct cagtaaagcc atacttaaaa gtgctgaact    259740
     aaacaagtct taccttacat ttgctaaatt gcaagaagct aacctaacca atgcccaact    259800
     aaccgaagcc tacctcataa gtacatcgtt gagagaagct gatcttcgtt ctgctaacct    259860
     tcttaaggcc gacctccgtt gggccgacct cattaattca gatctaagag gagccaatct    259920
     cagagaaacc aagcttagtg gagccagact ctatggtgcc aatctcaaag atgctgatct    259980
     cagcaaggct aatcttagtg cagataacga aggtaataaa gatgtccgcc tcattggagt    260040
     tgacctaagt ggagccaaac tctgtcaaac taagcttccc agaaaatcaa gtctgaaccc    260100
     aaatcgtgat tgcaaagaac tcggtctcga tatagaaaaa tagtttttag caaacacatt    260160
     ggtccctaaa tagaccaaag gaacattaaa tatatttata ttatatgtct catgctaata    260220
     ttttaaaaaa tttttgtatt tttatacatt aattcagttt aattagccaa aactcttcta    260280
     tttctaactt attaagttat tgcacctaag ttcaaaagtg ctgatttttc agtatcagat    260340
     atacctcgaa tattagatat tttcatgttt gaataaggtt tattgtcaaa caccttagat    260400
     ggttgtctag tatctagatc ccaaagtata atcttgtcat catgaccaca actagcaact    260460
     tctcctgttt tgctcattgt tacactgtaa acaccacctg tatgaccaat tagatcgtat    260520
     atacatttac ctgagttaat atcccaaatc tttacaagat tatcactact tgcacttact    260580
     aatctagatg actgtgagag gaaacataat gaattaacat agttagaatg accttttagc    260640
     tctaataact taactccagt ttgagaattc cataacttaa ttaaatgatc ttctccgcct    260700
     gtagcaacta gtttaccgtc actagaaaat acaactgaag taagtctttt gctatgtgct    260760
     gaatcgacga ctttacatgg cctatctgaa tcagtagacc aaaagactaa tcttctatct    260820
     tcaccaacag aagcaattat tctacttcct ggatcaaatg aaattgccct aatagtatct    260880
     gtatggtact cataaagccg atggcactcc catgctttag tctcccaaag tcttattgta    260940
     ttatcattgc ttccactgac taaaaattga ccatctgggc tgaattctaa agagcgtatc    261000
     caattagtat gtcctttcaa tattttaaat tctttgtcgc tatcaacatt ccaaattcta    261060
     ataatttcat cgtcccctgc actagctaag tatttatcat tcgggtgaaa tgataaagtt    261120
     cgaaccgagc catcatgatc tgagaacttt ttcttaattt ttccagtttc tatattccat    261180
     aacttaacag atgtatcctc tgttgcactg gctatagtag ttgaatcata gctgaaggaa    261240
     atagcccaca cccaattagt tctaccttgt aaagtctttt gacatgcatt agtgagcata    261300
     ttgcaaatct gtacagattt atcctcacta ccacttacca aaagtgttga ctttggatga    261360
     aatgaaactg atctaaccca atttttatgt ttaacaaggc tcctagatac aatattgtca    261420
     gatttaagat cccaaataag tacattttta tcttcacctg cactagcaag aaaagagccg    261480
     ttattactaa aatcaacaga ccatataggt cttgagtgtc ctttaagagt gttttcgcat    261540
     ttcccactct tgagattcca aagccttata tctgtgtctt taccaccact agctagaata    261600
     tctccatttg gagagaattt taatgctctg acaacaccta aatgttcatc aagagttttg    261660
     atacacttac cagatttaat gttccatagt tttatatagc tagaatgacc agcactagct    261720
     aaaacatctt cagaaggtga gaatactatg gctcgaacag atccaagctg ttcatcaata    261780
     gaagtaataa ctttccaatt tgatgtttgt cgaataaata tttttccatc atcactagca    261840
     ctagcaaaat attcgccact actgctaaat gctacagatc ttacagttcc agtatgatct    261900
     ttaagctcaa taactttact cctatctcga acatcccata taattatttt cctatcataa    261960
     ctaccacttg ctaagtgata atcaggcatt ggtgaaaatg caattgttct aacccagtca    262020
     gtatgaccca ccatagtcat atatgcttca ggtaaaacag aatcggattc agaaatcctc    262080
     caaagacaaa cttcgttacc ctcagcagta gcaaggaaat cgcctgtggc attaaaacta    262140
     acactaataa ctggggcaga tgatgttaca aaactagagt ttgatacatc tgcatcacta    262200
     aagttagtct ctctcaaact ggcatcaatt aaattagagt tatacattat acaattagaa    262260
     aaatcttttc cctcaagaat aaagggatct atcttagcta gaagtgttgc tgcattacca    262320
     ccagcataac caacttcatc gaaagtttta cctttagtaa aatatataat ttctagtaat    262380
     ttattgattg cttcttgctt tgaatcaatc ataggtagaa ataaatctgg aatcgcctta    262440
     gcaagaggga agtcaccaat agatttgatt attttttcaa tattctcagg cctgaataat    262500
     gtcaggcctg agatagagac tatttcgtca ttttcatcaa actctctagt gaaataagat    262560
     gaccatgagt atttagttgg gtttttaaga gaatcgatct ttgactgtct tctagctaaa    262620
     tctgtaaagt catcttcaag gatacctagt tcagaagcaa gtttaaaagc tacaaaaaat    262680
     tcagggaaag atctatgtgc aggagaatag tcaccgctag aatttcgaat taggattgct    262740
     tggccagcca tgtcatgctg ccagtgatct aaatcttttg cttcctgaac ctgtttacca    262800
     aaacatgctc ttagcctttc agggaattct ctatagttaa tagtcaactt attatttgaa    262860
     agcatttcaa atgacaactc acatagaaag aaaagcttgt ccgctattga agtaaaagtt    262920
     cgctctgcat cccaatcttt ttccattttc tgacttactg catataaata cactctagct    262980
     atatcaatag gtcttcctgc aataatatcc ggcaatgctt caagtactaa ttctgtcatt    263040
     attggacgac aagctaaatc taaaagctca ggattgctaa cgattgtctt aaccgtttca    263100
     ggtggagctt gtttagataa aacttggcta acttgatcaa tagagaataa ctctaaatcc    263160
     aaagtttcaa actgtgcata atcagaagta gctaatggat taatatccat tagtgttgaa    263220
     cttaatattt ttctcgctat atctgcgtca ggaaaatgct cagttctaca ggttaaaata    263280
     acttttgaat tgggaacagc aatatctgct aattctctaa aattctctgt cattttttgt    263340
     ttatcaactc tcgccgccat ttcgtcaaat ccatcaaaaa taagcaatag tttgcccatt    263400
     cgatttagct gctcaaatgc agcatagtta gggagggaaa gatcatgctt gcgaaagaaa    263460
     aattctgaaa ataaaggttc tatttttgag gcatttgcat agtcacggag tggaacataa    263520
     attggtagac gaggtctctc tagacctttc aattgggctt ctttatattt ttttagttga    263580
     gcccatgcat aatgtaaagc aaaccaggtt ttacctgtac caaattcacc tagaattgat    263640
     atatgttttt ttgaaggatc atcttgccac ttatcaatat aaccatcaat ccaaccatct    263700
     ttttttgaat atctgctact tccaataagc cttccagttt caaaatcaat ctcatctttt    263760
     ttgcaagata atggtatata aatatttgaa atattcctcc gatttacttc atcttctagc    263820
     catttgaagt aaccttcaaa atctgcatct aaatcaatta actcgtcaaa tgtataacaa    263880
     aatagtttag gtttaggttc tttctttaac ttttctttga cagcatttga aactcttcta    263940
     gaagtaacta accaaccaac gcttgcacca tggattgtag tagatttttt taacctattc    264000
     aggttagcta atcctatttc accatcaatg cctcttacaa ctatcttttc gcgcccgtgt    264060
     atatgaacat gtacgctaat aatccactca aaataattat tattactaaa tatttcacgc    264120
     tcaaatttat atcctattgc ttcaaaccag cctctaagta attttgataa ttttaatata    264180
     tttgaagtat ttatattaga attaatatat tttttttcaa ttgtatattt atgattgaaa    264240
     gtctcaagca aagtttctac gatattttct gattcaatca aattatcaat tttatttgta    264300
     attaagctaa tatcatcttg tagattttta atattctgat ctctaataac ctcagaaggt    264360
     atttcactta attgtgaaaa atggtagaaa actgcacaaa aattcttaat ctcttttaca    264420
     aaataacttt ttggtaagtt ataagaattg atttcataag catctgatat agagaaatca    264480
     ttaggattta aaaaatattt tttactccta aataaatttt tgaaatttat atctctcaat    264540
     atgggcaata aaattagtaa aatcttatct tcttttgcat cactatagtg aattatcgta    264600
     taagcatata attgatcaaa ttcagatgga atttgatttg agtcacctag gaattttctt    264660
     tttaatctga tgtatctttc tcttctacca atattctgtg ctatcaactt tagaatggca    264720
     ttaatgacat tatctacaat aatcatttta agtgcgaaat aatggcttta tcatttatag    264780
     accatatttc caagatatta tttgaatttt atgaaattat catcatgaaa aattattacg    264840
     taaaagttct ttaaaataaa tatctactcc tgagaactgc ctcacgttga tacttttata    264900
     tgttgtttct agctatacaa tcacctttta atacttgatt cagtaatgta tcttaccttt    264960
     tatgctatct acaacctacc cccactgaat ctccccaaac cgcctcggat tcaacatcgt    265020
     atacgtcacc gtatgctgga tattccgatg acccagccaa tcttgaatca acctcgtatc    265080
     caatccctga tttgccaagt gatacccaca gctatggcgc agcatatggg gatgacactt    265140
     aattcctagc tgcgccaact ctgcacagcg gttgatcaga ctcgtcacgg catgacgctt    265200
     aagatgtcca ccccgttccc cgacaaacag atacggatcc gggtaacctt cagcgcgtaa    265260
     atctttcaag gactccacct catcggcctg caacggatgg gtgccactga cggacccctt    265320
     gagccgagta atcccaatgg ccttcagctc caacattacc gcatcccatc tcagggatat    265380
     cgcttcactg actctcaacc catgacggaa catcagcagc aacaacgctt tatcgcggat    265440
     cgggtgacgg cctctcaact cagcggccat gatcagccga ttcacttccg ccagggtcag    265500
     atactcccga ctgcgatagt gttcgtttcg ttggcggcaa atgaccattg agtccttgtg    265560
     gttccgatct cactgtaact gataacaaaa tatatctttt gtagtcagtt atagaacgat    265620
     tttagggggt tctgggggta tgggtcattg aagacccttc aattaagttg aacttatgaa    265680
     tggtttgggg gctgaaagta ctggaaactc gttgaatagt ctgtgaatga taagttctgc    265740
     tgatgaaacg ccttttattc aaaaaatctt gccacggatg tttgtgtcaa atgagtagcc    265800
     aagagacaaa aactaaattc gttaattcct gcttgcatgc aagcatgcaa gtatgctttc    265860
     cttgaatcct gcttaaatga acgcatgact acatgctttt aattcagtgg ctgtctttat    265920
     actgatccac agataggacg atcaattcag ccaaagtctt ttcttctaag gcagcatatg    265980
     ccttcacttc gcgatgccaa ttttttggaa ctctaacaca caagttcacc agttcttcag    266040
     ccttattccc ttcatccatg cttgtagttt tacctgcttg catgcttgca ttatcttctt    266100
     ggacaacctg atgtttcttt gaaccttcaa ctgcttggtc ttcttcttga tctttctctt    266160
     tcttagcttg ttcaaatatt tcagtgtagt tagttggcat tcagaatctc ctctacttca    266220
     gtacctattg attgatagtc tctccaggcc attcgatctc ttccagtcaa gtcagcaacc    266280
     gttactcctt gagcaatcgc cttagtaaaa cccgccgcac gtctaatctg agcttttaag    266340
     agtgggattt tagcctcgat aagacaatcc ctgacagaag tagcttcttt actgggggga    266400
     ggagggcata cagtgagcaa acaacgatat acggactctt gatgcaacat tggaatcatc    266460
     gaaagcattg cttgtaatga aaaagcatct gggatggttg gcagtaaagt gatatctgct    266520
     ccctggctga tttcctttag ctcatcacta ctgggacgag ctggtgtatc taacacaaga    266580
     aagtcattac cagggataaa gctgactgct cctttttcgt taacgacctt gaacggatgt    266640
     tctataggtg atcgttcata ccatctaaga caacttcgat tgggatcaga gtcaattaga    266700
     agtgtttttc ctttagtccc gaaaaatttt gcaacatgaa ttgcactgac agattttcct    266760
     actccacctt taaaaccact tacggctatt actttcattc ctgctagcct tcttgaaaga    266820
     tatcctgctt acctgattgc atgcaagcag gatatcacct tcttttcaac tgtcaaacta    266880
     gttttcgttc tgaatctaga attttaagac tgattgcctg taataggata tagaggtttt    266940
     agatgttaat tcatggttgc atgctttaat aattacattt cttccttcat tcatgcaagc    267000
     aggaaaatct gcttgcatgc aatcctgtaa gaaggcctgc ttatgatctt cataatttgc    267060
     aagtttgctt cactgcaatc aggaaagcaa gcttgcatgc aatcctgcca ttgtaattgc    267120
     gcagacttca aaaccttcag ttattgctgc cgtgcaagac agccgataag cactacccca    267180
     tccagtagaa taaccggaac tactctgagc gatcacatcc tttgaaaaca gattccattt    267240
     tctaccgcat ctttaagacc gaccctggca tcttgtttga gttgttagat ctatcccctg    267300
     aaatagctca aggctatgaa gttgagtcgc agaatgaaga acctctctct atacctttaa    267360
     gttagaaaga tgagagtcaa tcaacaagtt tccgtgatct ttcaaacact ttaaggtcac    267420
     tgaatactcc atctctgttc acatggaacc tgttgatgac ctaacattcc taactttgaa    267480
     gcatattcat caggcaatat tgcaccacta atatcagcac ccgtgaagtt ggcttgggta    267540
     agatttgctc ctctaaagtc agctccacag agctttgctc ctctgaggtc tgccttgtac    267600
     aaattggcat tgaagaaaca tgcattctcg cagtccgctg cacttaaatc tgctcgactt    267660
     aaacaggcgt cttgaaaatc agtttttttc aaatcactgc cttccaggca agctgaagtc    267720
     aaattagcac ccacgcagac agcctgagat aaaaagctcc aactcaaatc tgattctgat    267780
     aattgagcct ctgttaaatc tgaagtagtc atgtccactt gagacaaaca aacattggtc    267840
     agattagtgc gttgtgccca cactccccaa agattagccc ccttaaagca agcgtcctgc    267900
     gcctcgctgt cagacagatc cgcccccatc aagttagcct gactgaaatc tgttcgcttt    267960
     agctgagcag cactcagctt ggcacaactg aagtctgcat ggcgaagatc agcatcagaa    268020
     aaatcggacc aatacgcctg aacccagata gcaagactcc tttgtagttt gctcgcctta    268080
     aaatttgctc cgctgatatc tgcccaaatc agattcactt ctgataaacg gctatgactg    268140
     aaatcaaagc cactgaggtt catctgataa aagttggcac ccggcaagtt agtcccagca    268200
     aattgacgct cagaagaacg gtacttttcc caaaacttct gcaggtcttt agaacagcga    268260
     agggcttttt tatcacaatc tgcctgatca ttcatgatcc aattgctgtt ttatacttgg    268320
     gggacattta aggctcctct ttctctaagc tctctggcct cctgaggtgt taaaccttga    268380
     gcatctgtca taagagttcc gcttacttga gcattgctcc agttcacatc aaacagattt    268440
     gacctctcca aattggcttg ctgtagattc actccagtga agtttgctcc tgtaaggtca    268500
     gctccttcaa attgagttcc aaagagcatc gagtcttgcc aatctgtata tttcaaggag    268560
     gctccattga actttcccca atccccttga acctgccgca gaatggcatg acttaaaaca    268620
     gattgttgga aattggcatt gatcaactct gcttgggtaa agtcagcttt cgatgcgcga    268680
     accgcttcaa actcaaccgc ttctagatca gccaaggaga agactgcacc attcaaaata    268740
     gaacgatgtc ccacactgcg ggttaacttc gtctccctaa agttggcacc actaaagtca    268800
     ccatcactca aggttgactc ttgtaagtta ctatttttga aatttgctcc cagccctatg    268860
     gctgttgata aatctgcctt caacagtgtg gcaaatgaaa gatcagcttc atgtaaatct    268920
     gcaccatgaa attttgcttg aggggcattt agttcatgaa agactccccg atcaagcttt    268980
     gctttggtca attctgcttt tctaagacaa gcccgttcaa gtgaagcacc tgacaaaata    269040
     gccaggacaa gggtcgctaa tgaaaaatca gcctcatcac aaattgattt ggctaagtta    269100
     gcgcctctta aataagcctg cgaaaaattg catcccctta gtagcgctcc cgttaaattg    269160
     atatgactaa gttcggcaca gcgcaaagat tgctgattct gagcctttga aagaacctca    269220
     ctaaccgtca actgggccat cttgattgtg gtttatcgaa ctttcgataa ttgcttatgc    269280
     gaatgatgta catctcaata ataatgtata aaattacaca gttatatacc ccataagatg    269340
     catcttgtcg tttattcgaa ttgtttgtag gtctcaactt cagcctagaa gtctgtccct    269400
     gacgtttaac ggccatcgct gtcctctgtc acttggtctg ctgaatcagc agaagtgtaa    269460
     ggcagcgctt ctgaaaaggg acttatctga cgaacatgct gttctagggt gccgaagcta    269520
     atggtcaatc cagtgccgag gcaagtgtca attaggtgcc gaagctaatg gtcaaatcgg    269580
     ggccgaacta tggtgtcaaa caactgccga agatcaggtc attttgcatc gatctactga    269640
     atctgactga gttaacatct cgattgcgag aatagctcaa aactcaagaa atagctggca    269700
     tgaaatgaag ttgtacattg actcatacag tgggctaaaa ggtgaattga gatgaaacct    269760
     aaacacactg gaagtgtaaa tggtacaggt gtaaaccaaa atttattacg aaatttaaag    269820
     caagtaaatc atttatacta caattgtata gtaactatac ttcaatgcct atgaaatttt    269880
     tgagatttag actaaaacaa agaatttctt ttttagttaa aaaatttaag aaagaattta    269940
     tcataaaccc gattctaaaa tttaagaagg aattttccga aaatccgttc gaagctgtga    270000
     aaaaacttat tataaataat agcaaaaagt atttatatca gttttatttt gtgttactta    270060
     ttgtttttat ttgtagccat ggttttgaca taaaaagcct ccctctcata agaacagtag    270120
     ttaactacgc aagtatgaat tcaaatcagt tattatttac gtggatatca tatataatat    270180
     taatactata tgccttttta attcaaaata caactagcac tttaaaaaat agtctccaat    270240
     caaaaaattt aaggaaaaag acattaaagc gattatttat aggatttata gcctttttaa    270300
     ctttctctgg cttagaatct ttaatttgga gaatgttgga attttagtta gttcactact    270360
     cttgtaaccg tcgaaatttt tataaatcat tgaagtcaaa tagacctttt gcaatattca    270420
     attcatgatg cattgcttac tcaatttatg ccgcgatctg acttgaatat atattcctct    270480
     accatatcgg taggtgaatt atgaaagagg tcaactggat acctcaaagt ttccttcagt    270540
     tttcatcacc ccaaacccta ctcacccttt cccgctccaa ccacaccccg atcatctcga    270600
     tagtttcccc tggccgcaga ctcaaaacct gcaacacatc gaacttgacc tctaactcca    270660
     aggcgcactc atagcaaaac ttgggcgttt caaacggaat tctgatgaat ggcttaccac    270720
     tgccttcgac ggtgatcaaa tatttccctg aactgcttcg ggaaacggcc aagtactcaa    270780
     gctggccctc tagcttggtc tgctgaacca gattcttttg cttgctctca agtttatgaa    270840
     atttggactc aaatgctctg gagactctag agggccgtgt tctgcctgct gtataccgag    270900
     cggaatacct tcgctgtgtg ctccgagtat ggcctaaaac gaccgaagct gcgatatggg    270960
     gcaatttagt atagatgtac ttaaatgaga ggcgattctg tcacaattac cgtcagccct    271020
     ccttctccac atggagcgct tttagggctt gataagccgt tccacaatac ggacagaatc    271080
     gatgcttgag agacgcaatc cgttcatcac aattgacaca tctgtctcga agttgcgtac    271140
     cgcaaacata gcagtattga gcacggctat gaagccagat tgaatctgga ggcgttcccg    271200
     gccgccaaca gtgagggcaa aaccgaatcc cttggttggg actaaccacc gttccacgac    271260
     agaccgcatc aagataatca ctgggaattt ggagggcagc tgctaatcct tgtttcgttt    271320
     tccgattcaa ggaactggtt ttattgcgtt ctagcttgcc atagctttgg gcatggaccc    271380
     ctgcctttat cgccacttcc ttttgggaca aaccgagcgt tgttcggaga cgatggacat    271440
     aatcacccaa ggattctcca gcttgtggaa ccgagctaga ttctaaacgc tgcattacaa    271500
     gcttactcat caatcattca tcagaggtat acttcatgcg gctgttggag ccttaagact    271560
     taacagaaag atcatcatgt ccaagccttt ggcaatggtt acaaccgagt ttttagatcg    271620
     ccctggctta gctgccagca cggttcgctc ctacgaattc accttattgc ctttgcttca    271680
     acaatatggt cagtggtcct tagaattact cgaccgacag accctagaag aatatctcaa    271740
     ttccttgagc catctatcgt tcaagactca tcatcgtcac caagccatcc tacaagcact    271800
     cctcaacttt gcagttgagc aaggatacct gcggtctaat ccaatgaccc gtatgaaacg    271860
     gcgtaagcca gatcctgcta aaggagagca tgactcagac cagatcattc gatacctaac    271920
     cccagaccaa ctacagctgc aataccaact ggtcagcaaa gatgctcgta ctgcggctct    271980
     tgtccgctta cttcatcgca ccggtgcccg catttctgag ctacttagct tagaccttga    272040
     agcactggat ctggaacagc gcaagttcca agtgattggc aaaggcaacc gacaacggtg    272100
     gtgtttttac agtgaagatg cagcggaagt tttgcagaaa tatttggcag agtatcggca    272160
     ccccggatct ccggcgctgt ttaccgcaca gcaatactta agtgaccagg tgaatcgact    272220
     cagttatcgg agtgcccacc ataattggaa gcagctcatc aagggccatc caacattagc    272280
     tggaactcgg ctccatgatc tgcgccatac atttgccacc gagagagtgg gcatcatcgc    272340
     cctagaagag ctcagggcct tgatgggtca tcagagtatt cagacaacct tgcgctacca    272400
     aaaggtcact tctgagcaag cacaaaatgc ggctcaaaga gccttcgata aactctctca    272460
     aaccaccctt taaggagagt ttggtattcc ctgagaaatt gtctttatct atgtctatac    272520
     aagaatagag ccaaatttag agagtatgga cagtactgtg caagtgcaga ctatgagtca    272580
     atttaaaagc ctgggatcct tgctaagggc tacagcaata gcgggacata catctttgga    272640
     ttcatctgca aaatccgcta tcttgtcgcg agtgaggaat gagtggagca agcgatatga    272700
     agcgtcaatg gcaaccagat gaactgattg aatccttcat tctgttgccc aatgagttgg    272760
     cgcttattcc caattatcag accaacgcca cggagcataa ccagctgggt ttcgctgttc    272820
     tgctgaaatt ctttcaactt gaaggtcgct tccccaagca cctgggcgag attcctcaga    272880
     tcgttgtgga gttcattgcc aaacaactaa agctgacgca tcaaagcttg gttgattaca    272940
     agtggaaagg ccggactatc aaggagcatc gagctatcat ccgttccttt ctcggatgtc    273000
     gtcccaccca gcgacccgaa aagaagtcat tgatgacctg gctcaaagag aaagtgatgc    273060
     ctctggggct ccatttgaat gcgattcgag agcaagccta tcaacgtctg cgtcacctta    273120
     agcttgaacc cccttccccc aaagaattga cccggcttat cagctcagct gcccacaacc    273180
     atgaacagga cttttgccaa accattgcgg cacgactccc agcagatact cgaaaaagga    273240
     tggatgcttt attagaaaca gaattcaccc gagaccatga ggaaagtcag ttccggcagt    273300
     ccgacttcaa ccgtctcaag tcagatccgg ggcgtctagg cctgaaaagt ctcttcaatg    273360
     aaatcgataa gctgcaaagt atccgacaga ttcagctgcc tacagatcta tttgcctcct    273420
     attctcctaa gctgattgag caatatcggc gtcgagcctc agccgacctg gcgggacgcc    273480
     tacgccgcca cccaaaggcc attcgctaca ctctcattgc ttcgttctgt tatcaacgcg    273540
     aaaaagagat cactgataat ctagtcgatt tgctagtcca gatcatccat cgtcttagca    273600
     tcagtgccga gcgtcgtgta gagcgagaac tgatcgctaa tttcaaacgc gtcaataata    273660
     aagaggccct tctataccga attgcggaag cggccttagc caatccagat caacccgtta    273720
     aagaggtgat ctttccggtc gttagtcccg ataaattgac taacgtaatt gaggagcgaa    273780
     aacgaaccgg cattacctac cgagaaaaag tgaatgtcaa gattcgagcc tcttatttgc    273840
     atcactatcg gcggatggtg ccggccattt tggagaccct ggattttcac tccaacaaca    273900
     agcagcatcg ccctgtcatt gaggccattg aattgctcag gcagtatcag ggcagtggaa    273960
     agcgatactt cactgaggat gaaaaggtga tcaccactgg tgtcctaaaa agcggttggc    274020
     gcgagctcgt catcgaatcc aattccaaag gccaagacca ggtcaaccgc gtcaactatg    274080
     aaatctgtgt cttgcaaacg ctgcgagaca cactgcgctg tcgtgaagtg tgggtgatgg    274140
     gtgccaaacg ctacgggaat cctgatacgg atttacccca agattttgaa gctcaacgag    274200
     agcagtacta tttagaactc aaccaaccct tggatgctga agccttcgtc acgaaactga    274260
     aactggatat gacggcagct ctgtcctcct taaatacgag catccccaac gatccacagg    274320
     tcaatattct gtcccgaggt aacggctgga ttagtgttac cccctacccg gctcaagagg    274380
     aacccagtaa tatccacaaa ctgaaacagg aggtggcgaa acgctggcca atgaccagct    274440
     tgttggacat cctcaaggaa acggacctgc gcgttaattt cacggatcag tttcatactg    274500
     cagcctcccg ccaacagctc cacggtccta cactgcaaaa acggttattg ctctctctgt    274560
     ttggcttagg gaccaacatg ggcctcaaac gagtctgtgc tgggattgct gatgaaagct    274620
     atcccaattt gctctacgtt aaacgtcagt tcctgcaccg agaacatctg cgcaatgcca    274680
     ttggtgaagt tgtaaatgcc accctcaaag ctcggttggg aaacctttgg ggagaggcga    274740
     caacggcctg tgcttctgac tccaaaaagt ttggagcgtg ggaccagaat ctaatgaccg    274800
     aatggcacag ccgttatggg ggccggggtg tgatgatcta ctgggtgcga ttcgttggct    274860
     agaaactaga cctgaatagg gtttgagggg attagccgca agcgtaaaga aggggaaaat    274920
     atcccaactg taccttgaca acttaatagc catataggtg agagtcagta tcctagaccg    274980
     ctctagtcct atcccgcagg tgcagcggtg acagcatttc ccccaggttc gcgactagcc    275040
     atcaacgcct gaagcgggga aaaaaggagg taacagggag cctagctctg aaccccttcg    275100
     agcaagaact tatgagtagc gaaagcgaag atgtggttaa cccaccgtaa tcattaacca    275160
     gcgaaattag gttgataacg ctgggagtcc caaaagggca aggatatacg gagctggcgt    275220
     gtccagtagc gaccagttag cacttccaat aaacccggtg gagcgcatca ctctaacagt    275280
     tcaatcaatg gctattagga acgaagtaac ccccgcctat ctctcttgga ggtcgattgg    275340
     ctaagagtag gtgctaacca gaagttaggc ggtgggaagg attgggtcaa aagcaaaagc    275400
     cccactgtaa tggtgaggat aagcagacag actcacggtg acttggaatg aataggaaca    275460
     agtagcaata aatatgtcta aagcacgggt caaaccgatg atggaatgga gcgcaatccc    275520
     ctggccaaaa ctagagcgga aagtgtttaa gttgcaaaag cgcatattca gagccagaca    275580
     acgtggcgat gtcaaagtag tacatagact ccagaaaact ctgatgaggt cctggtcagc    275640
     caaatgcctt tcagttagac gggtcacaca agacaaccag ggaaaaaaga cggcaggtgt    275700
     ggatggagtt aaatctctgt ccccagaagc tcgtctgccc ctagtgggtc aacttaaact    275760
     cggctcaaag gcccctccca ccagacgggt gtggattcct aaaccaggaa aagacgaaca    275820
     acgtcctttg ggtataccga ccctgtatga aagggcaaga atgacactag tcaaactagc    275880
     cctggaacct gaatgggaag cggttttcga accaaactcc tatggttcaa gaccaggccg    275940
     ttcatgtcat gacgcgatag aacaaatttt tgcagccatt aaacagaaag caaaatatgt    276000
     gttggacgct gatatagccc aatgttttga ccgaataaac cacgaagcac tgctcaaaaa    276060
     gctgaagacc tttcccactc tacgccgaca aataaaaact tggctaaaag ctggggtaat    276120
     tgatggtcat cagttcttac agacatctga aggagcacct caagggggga ctatctctcc    276180
     tttgttggca aatgtagccc tccatggcct agagtatcga atcaagcaag cctttcctat    276240
     cagaaagatt gccgacggga ataagcgaaa aagaattgct actcctgatg tcattcgata    276300
     ctgtgatgac ttcgtgattc ttcacgagga tttatccgta gttcaaagat gtcagagctt    276360
     agttcatgag tggctaaaag acatggggtt ggaactaaaa cctagcaaaa cgcatatatc    276420
     ccatactctc aaaaggtatg aagctgaaaa ccctggattt gattttctag gattctcagt    276480
     tagacaattc ccggtcggtc aacatcaatc ggggagatta tgcgggacat tgctgggatt    276540
     taagaccatc attaccccca gtcgaaagaa gcaaaaagta cattacaatc ggctcgttag    276600
     tatcatcaac gcccataagg cagcgccgca agcggcatta atccgccacc tcaatcccgt    276660
     gattagagga tggacgagat attattcgac catggctagt aaagagacct tctcccgtct    276720
     agaccattta ctgtatcaaa agcttcaaac atgggctaac caccgccatc ctggcaaatc    276780
     caggaaatgg gtggtgaata aatattggca aactgtcggg ggagataaat gggtcttcgc    276840
     gactagagta actaaatcta gaaccgaaaa attactcaaa catcgacaga ctccaattat    276900
     ccgccatgtc aaagtcaagg gggatgcaag tccctacaat ggcaatctag tttactggag    276960
     ttcaaggact gggaagcatc cagaagctcc gaagagagta tctatgctct tgaagaagca    277020
     gaaggggaaa tgcgctcagt gcggcatgtt cttccgagaa gaagatttac ttgaagtgga    277080
     tcacattctc cctacatcaa tgggaggatt ggacgtatac aagaatcttc aactactaca    277140
     cagacattgt cattatgtta aaacggccaa ggagaagtcc tctcaggcca aatggtatgt    277200
     atgacaagca ccaagccact gaggagccgt gtaaatcgaa agatttacgc acggttttga    277260
     agccaagtcg gaggagtgat cctccggctt aggttaacca cgttgaaaag aagtcgttgt    277320
     gcgtctactc gcaactgaaa aactgttcct cttctgaggt ttcatccatg ctcactgggc    277380
     tgttgcgaca caacacagat ctgaagctgg agaagaacta tgttgatact catggccaga    277440
     gtgagctggg ctttgccttc tgccatcttc tggggtttca gttgatgccc cgtttcaaac    277500
     gcattggtgt tcaaaagctc tctttgccag aggcaggaac gaaagcagcc tatcccaatc    277560
     tcaagctgat attgtcgaag gcgattgact gggatctggt ggctcagcag tatgaccaag    277620
     ccatcaagta cgcgacggca ttgaggttgg ggacggctga ggcggaagat attttccggc    277680
     gctttgggaa tgcggagatt cagcatccga cgcataaggc actgctggag ataggcaagg    277740
     cggtcaaaac tattttcctg tgtcagtatc tatcgtctga agcactcaga gtggaaatca    277800
     atgaggggct gaatgtggtg gaacgatgga atggggccaa tgactttatc tactttggtc    277860
     ggggtggtga gttcgcgacc aataagcggg agaatcaaga gctgtcggca ctggccttgc    277920
     acctgcttca agtcagtatg atctacatca atacgctgat gattcagaat gtgctcagtg    277980
     aaccacaatg gatgcagaga atgaaaacag aggacttgag ggctttgtgc cccctgatct    278040
     ggaatcatgt gacgccctat ggatggttca atcttgattt cacacaacgg atggcactcg    278100
     atgttgcctg gaggtaaacc taaatggatg taattgctta gtactaaatg gtgcgatatc    278160
     gcagcttcgg tcgttttaag cctatctctg acagtgctct caggttaggc gggtcgtcta    278220
     tctcgatggt catggctccc cctctacaag cttttcggct gcgatgtgat agtacatctc    278280
     gtagtcttcg cgctcatctt tcccccactg tttgtggtcg tactcgtcag agcggccttt    278340
     ctgcacgtac tcactgaatt cgtagtggac gtcaacggaa cccgtcacac agaacactat    278400
     tgtcccagct tcttcgtaag cgtctacgct caggtcaaag ttatcgaagt cggcagtgac    278460
     tgaggcatcg ccttcaatgg ggttgccctg gtgtccatta gcagcttcta tgtcttcctg    278520
     ggctcgttct agcacgtatt catcggtgat gtgaacgggt cgcttcatgg tttcttcccg    278580
     gggaggtggt tatgggcctg tggttgtgga atgatctcgg aaataattgt aatgttatta    278640
     gacctaaaac gaccgaagct gagatgggcc aatgacgttg ctcaagcatc gattctgtcc    278700
     gtattgtgga acggcctatc aagcctcaaa agcactccat gtggtgaagg aaagctgccg    278760
     gcaatagtgg cagaatagtc tctcatttaa gtacaaatat actaaattgc cccatatcgc    278820
     agcttcggtc gttttaggcc gattaaacgc agctcaccaa tcttaaaccc gtcagtaaat    278880
     ttaatctttt tgggactcag aagcttccac ccagaggttt tgtattctac tgaccgggaa    278940
     tgcttcttaa accttggaaa gccaacgggt tttatacccc gtttgtaatt ctcatagaaa    279000
     cgggtgattg aactccaagc tcactcagca cttgcctgcc gagccataga gttgagttgc    279060
     ttagcaaaag gaaaatcatt ggcaagaact ctacacaact tatttaagtc gtatttgccc    279120
     gtacctttgt tatccatcca aaagcgcaag cacttattac gaatgaattg agccgttctg    279180
     atggcttcat caattgcact tgcttgatgc ttactggttc ttgctttaaa ctctagtaca    279240
     atcatactat tatactagca tgttcggcat gacaacatgc tgggaattaa gtgatataca    279300
     catctctaac taacatttgt atagctggag tcttcacgca cattttctgg atagattatt    279360
     tagagggctg tagatagttc tctagcgctt cagttacaag agcattgaga ttgattcccc    279420
     gctgctgagc tgcgatcgca gcccgcctat gaagttgagt tccaggtcta atattgaagc    279480
     tgcctttgaa gggacgttca ggctcaatct cgttttcagt acaatcagca agatattcat    279540
     caacggctcc atgaaaagca gatttcaaag attgaacatc agtaccctca tagctaatca    279600
     ggctgcggat gaactcaacc ttcccaaaaa atacttcatc ctcatcactg aaattcacag    279660
     agccaaagta gccttggtat tccatcatat ttttcatagc agcccctcct gctcaagaat    279720
     gtccatgact tgttcaatct gatacttctt taatattttt tttggatggg gtttatgaag    279780
     gctgatcaca agcccctctt cattaatgaa gcgtcttcca gaaccacccg ttttacccgt    279840
     cgatacttca gagaattgaa aaaaggaaag caacaaaact aactcgtccc aggtaaagtc    279900
     tttgggccgt gtgagaaagc gtttaatcag cttctctttt cgagtcatat tggaggtcaa    279960
     aactgcttat attatctctg atgccacagg aacttgcaac taaaaatagt tgcaagcagt    280020
     caatctacct ctgacttacc cgaagagact ggctatagaa tcctcctcgc tgctccaccc    280080
     gaaatccacc caaaagcacc ccgatcaaca cagccacggg cgcaaaacca agccctcgcg    280140
     ctaagtcacc gaacaacaca gcatcctctt taccctcaag aaagtcatgg atcgcaccca    280200
     cccaagcgcc aacatcctcc tcatggctga ccttcagagc aaccgcctcc ccactctcta    280260
     gctcatccac aaattccaac acatcatcct tgctaacctc acccacgacg gactccacag    280320
     gcttccccgt gaacccatga cgttgcttcc gtgacttcgg ctgacggcag agatccgaca    280380
     cgtcgaggaa catggtctct tgaaccaacc cggccaagaa gtcatcatcc agcactggtc    280440
     cttgggtatt atgtcgatcc tcccaatcct ggatcagcag ttctgctcgt tgacagacaa    280500
     catcagcaat gtccctgatc gcatccccag ctacccgaag ctgttcatgt gatgaccgac    280560
     cttgcaaatg ctgatcgagt gatgcacaca tcagggaaat atcagcttgt tccggttcat    280620
     ccaaagcaga ggccaaagca ctggcaaaat ctagctcaag ctgtttgaac atggcgctta    280680
     tccttcagtg gacagtccac aatttcgcac tcagaaggct ccatgcgaat cggcggttca    280740
     aactctgtaa ttccgtatcg ttctcgtagt accctcagca cctctttcaa ataccgatta    280800
     acttgagtat tggtcatccc catacaatgg acagcttcaa tttccgctaa cttctcactc    280860
     ccctgccaga cactgacggc catggcatgg agatgggcat ccttgggttt ctccttgtag    280920
     aggtagagta aagctactgg aggggcttgg acgggaatcg aaaaggtttc tgtggtctcg    280980
     gctggtgctg gttttgagtt cctatccctg taatgtgctc gttgtttttc attgttctcc    281040
     ctgcgatgcc gataatgcga tcgcttccgg gggcaagtct taggattcca acaagccgtt    281100
     gtcgtttcag gtccgtggag tgagatcgct tccttttggg aaagcttcga gcactctaaa    281160
     caaagcttgt tgatagggcg tcccatctca agcctcctcc tgccagtttt cccaggccag    281220
     accatccacc cgtgaaaact cccgaacatt atccgtgacc agggtgaggt cgtgaaccag    281280
     agcaatggct gcaatttgca aatcataggg accaatggga gtgcccttcg ctgcaagagc    281340
     tgcccggatc tggccacaga ctttggcaac ctcgtcatta aacggaatcg attggaactg    281400
     gcgatagaaa agcctgagac gttctaagtt agcctgtcgt ttgacacttt tataagcgcc    281460
     atagaacaat tcactcttca ccggaacgca caatctaata tcagcaggag tgtattgtgc    281520
     taaacgcttt gcaattgcag agtcctggtt agccttaagc agttggatac aggcgtttgt    281580
     atccagtaaa taggtcatgt ccagtcctca cggatctcaa actcgccctg atcggatcgc    281640
     gtcaactctc cctcccaact gccgatcaca tctgaaaaga aacccggttg ccattctgta    281700
     gtggtggggg cagaggattc agccggagac agtagaaccg tcacctctaa atcggcatcc    281760
     gcaaactccg tgggcacctc taagcgaaga acgccatcgg cacccacatg ggagcgaatc    281820
     gaaatgggtt ggctcatcga tcacctagtt ctcaaaagtc aacaatgagg cgatggctct    281880
     gaaggtcttg ggtgaaacat gcctctgaac tagtgtacaa gtcgcccttc tgatatgaca    281940
     tattttaatg taatttttaa tgtaaataag atattagaca catattttat gttgaaattc    282000
     tctccttcaa ataaaggatg aattttcgta ggtttagaac tgagggggta ggaacatctg    282060
     ctgtcggatg gcattccaat catttaccga gaggccactc gcttgtttac tgcagtcgat    282120
     catgagctgg caggttgaga agtagttggt aagcatttgc aggtcatctt tggacaaatc    282180
     aaagagttct tgagagatat ttagagacga gctgactatt gatgtgagtc ctttagatga    282240
     agtttttaag gcatgtgatg aattttttag acatgagatg agggtttgaa gttcaacatc    282300
     taccattagt ttcttatcca gggcaaattg ggccatggcg agaacgttgc cgcgagcgaa    282360
     agcgctggcc agagcgaggt cgcttgcgag ggtgtcgtcg agggcatggt cgagggcgac    282420
     gtccagattg aggccgcttg agaggttgct tgcgagggca cgaacactgg cgaggtcgcc    282480
     aatggtggct atggctttgg ctcgttcgct ttcacgtaag ctggcgatga cacttgcact    282540
     gctggcaaag cgttcccggt cgcggtcgcg ggcaagggcg acatcgaggg cgagagcaag    282600
     gtctaagtcg agagcgaggg cgagagtgag ggcaatggtg aggtcaaaga ttaatattag    282660
     ggtaaatact cgtctaatct caccagaaaa gtcactgata gcagtagatg tctttgactc    282720
     aacccaggct agcaatccgc ttaatttagg gtattcagaa agcgcttgag tttgttcttc    282780
     caattgttgc aagaattcga tcgcagaatg tcctttcagc tcagttacga gaagaaagac    282840
     tcctcgccaa tgcttatctg cggcatgatt ctgaattaat tgatcttcgt agctccagtt    282900
     tctaatatac tcagcgcaaa gatgttcttg aagcgttagg tgagagaaag aataaatatc    282960
     tgtagcctgc ttgactaaga tccccgactg cactgcgatc tcttccatca gtttattgac    283020
     atcaagatgc ttggagacat tcaaattatt ggtcaaaaag gctgtaatct gctcagctaa    283080
     ttcatctttt tcaaaaaaaa gcttgtcttc ttcaaagcca acataggcga ttgacgccag    283140
     catatctttt tttatatcag cgctgaaatc ttgatagatt tcccagttct catccattaa    283200
     ttttgaattg gcccaatctt ttaatgagaa gtctagtgcc ttggaataga gtttggcctg    283260
     attgtcgata attgtctttc cctgtcggca gactaaacag atgaacgcca gcagcaacgg    283320
     ggtttggggt agttccttcg tataaataaa gtcaggttct ttgagttgtt cccaaatcgt    283380
     atttacatat tctgcctttt tctcacgggt cagttggggg ttgggatcag catcaaacca    283440
     ttttttgatg aattcaaaga tctgatcatc atcaagttct gcaatagcaa ccgttttaaa    283500
     tccagtgaag taagtgggat aagcagcgat tcggcaggag gtaataaatc gattattaga    283560
     gtatcggtct gagaaatcta taatggattg aaccacttga ttgaaactac cgctgagtac    283620
     ttcatctagt ccatccaaga gaatcagaaa atcacctgat ttgagggcat gatcagtaaa    283680
     ttgttctggt ttaggaaaac cacaaatctc aaactcttca gcaatagatt ttttgaggtc    283740
     taggtctgga tctcgtaatc gcttcaagtc caaaaatacg ggaattttct catggtcgta    283800
     actttccaca ttcctaagta gggctgctaa gccaacttta cggagatagg tggttttacc    283860
     aatccctgga ccgcccaaca cgcagagata ttgctctgtg ttttcaaccg ctatcccttt    283920
     ctgtttagcc tctgtttgct gccataaata tctttgatgg gcttctcggt atactttttc    283980
     tagtctttca atactctcta gaattttgac cgtctcagca tccatcatct tgacgttggt    284040
     gtagatgtca tcaaaggata tggactgcga catccctagt acttggatct gaccatgacg    284100
     cttatagtaa ttttgagcat agatctctga caagttgtat atttgctgtt ctactgatat    284160
     cagaggctga ttttcaagga attgaccaaa gactttgaga ctaatactaa caagtcctgt    284220
     tacagcagtt tctaaagttt ttccctccag tgacactgtt ctctaatccc ccaataatat    284280
     tgactttgat tattattaat tgaatacgtt gattctcata tattccttgg atttaattca    284340
     taaaaagcat gagcgataga gtaggaaaga tgtatatatt tctcttctta tttgttactc    284400
     agcctgcata ataaacctca aaattgccgt acttcttccc aataattttt atgatatctg    284460
     gctgcaatgc cattgatatg ttattacagt atgttataac gttggtattg cttggtttag    284520
     cgctatgact gataaaactt acaaggcatc ttgggccaaa attgggaatt cctctggcta    284580
     tcggatcacg agtgatttct tccgggaaca tcccgagttc gttggttcag atggggttat    284640
     ccaagtcatt gccccagaca ccgttgtctt ttcacgcgcg aagacggagg aagaaggcca    284700
     ggaggaagat gatctaatgc tcagtctcta cctggacttt ctaaccaaac aggccctcgc    284760
     taaccctgat gagttggaag aatatactca ggacatggcc gatgaggacg aagagttaat    284820
     cgcgggtgtg atcctcgatg ctgattaatg actggaatat ttactttctc aaacgcctgt    284880
     ttggacaaca acgtttggca ttaaggactg aagtaaagcg actgaaagcc actctaccgc    284940
     cagaagacta tgtacgccat ccccaggtga agctctatgc tgctaccatg caggcgatca    285000
     aagcgaaaat tccagccgat ccctttgcgt ctcattttgc gttgactgga cctctcaaga    285060
     agtttggtcg ggtgaaaaag atggggattc ctaatcgata tcggttattt tttcgagcgt    285120
     ttaaagtccc tgaaagtcag tccatcttcg tcctatggtt gggttatccc cgtaaggaag    285180
     gtgataagaa ggattgctat cgagcgtttc gaaaaatggt tgagcggggt gatttccctg    285240
     attctttgga tgatttgatg gttgaaagtg agcaaggttg atgagtaaaa attatggggt    285300
     agatatcccg gaagtcaaac tcatcacctt ccccacgacg gaagcggatc aagcaccgtc    285360
     tccaaaatcc atccgtcgag gcagaccgac acagattccc actccgatgg atatccgctg    285420
     gccgatggtt caggagttcc tacgtaacag caatttatcc cccaattctc aaaagctcta    285480
     tgaacgggag cttaaacggt tcttgggctg gacccatttt cgatggtcgg atctgacgct    285540
     tcggcatctg ggccaataca aagtctacct gatggagcta aaggtcgctg aaggaaagac    285600
     gctctccaaa aacagtctca atagtgcctt aacggccctc aagagcttct tcaaatggct    285660
     gacccagttt cacccggagc tatgcccgac caatcccacc aaaggggtga agtttgagaa    285720
     ggtgcctttg cccccggccc agaatttgac cccggaggag atgacgcgag tctgggatgc    285780
     gatcacacag cgggaacaga cccaactgag agacctggcc ctagtgcagt tgctcagtca    285840
     taaccttcga gcgggggaag tagtaaccgc caatgtgggg tcttttgatg gccgattgat    285900
     tagtattacc aaaaccaaga ataaccaacc tcgactcgtg cccctttcaa cggaagggca    285960
     gcaggtggtt caggagtatc tagattggcg aaaggatcaa caaggggaag cgttatcggc    286020
     tgagtctccg ttgattctgt cccaccacca gggctgggaa gggcaacgcc tgagttatca    286080
     cggggtctat tttgctgtgg aggatatcgg cagattagct gaactccccg atcttcaccc    286140
     ccatcagttt cgacatacaa gtgcgactga atatttgcga atggggttag acccggctca    286200
     tgcccgacga ttaacagggc atacggatga gcggtccttt cgacggtata cggtggcagc    286260
     agaacaagag gctgcgatca ctgcgtttta ccgggcggaa aaggaggggc aacctttagt    286320
     ctttgcccag tcgttggacc ggaagcagcg tcaattgctg gaggcactag cagagatgac    286380
     ggggaagcct cccctgtacc aagatgattt ggatgaaggg atcattgatt ttgctcagct    286440
     ctggcaggaa aacttacagg aacttgagct attagtggct gatgtgcggg ctttgccaga    286500
     aaagctggga ctgagaggtt ttgtgaaaaa tgagcggcag tcgacatcgc tagaagaacg    286560
     ggtcctgcgt ggcgaaatac cgaccaatga ggtgcttcag ttagatcctg tcgtcgaaga    286620
     gccttcggac tgtccccagg taaggtctgt ggagagttct catcaagtca ttcatttggg    286680
     tatgaagctc tgggttaatg ggaagaaaaa aggcaaagtt aggaaagcga ttgaggagcg    286740
     ggtactcgaa cagtttcaga tggtcaagcg gaaaccgcga ggaaatgaat accagctaac    286800
     ggttgaggtt gaggaagacg atgacttgcc agcgatcctc tctcagatga agtgggagat    286860
     ggaggttctg ggagagttgg atgaatgttt ggttgaagta aagctcaatg acgaagccaa    286920
     gaagggtaaa ccctaatgca cattgtctct ggacatctag attgtgtctc tggtattagt    286980
     gttagccctg atggtcaaac cctcttctct gcatcctggg acaagactct gaagatttgg    287040
     gagctggcaa cgggtcggga gctgagtata ctctctggac atactgactt cgtttctgat    287100
     gtgatgatca gccctaatgc tcagactctg gtctctgcat cttgggatat gactttgaag    287160
     gtctgggagt tggagacagg caaggtaagg cacaccctta ctgggcatac tgacttcgtc    287220
     aatggcatca gcatcagccc tgatagtcaa atcctcgtct ccacgtcttg ggatgggaca    287280
     ttaaaggttt gggagctaga gacgggcaag gagctgcata ccctcaatgg tcacactttt    287340
     tcagtccata gcgtcagtat cagccccgat ggtcagactc tcgtttcagc atctagtgac    287400
     aagaccttaa gggtttggga gctagcaaca ggccgggagc tgggcatcct caagggtcat    287460
     tctgactctg tatctgatgt gaagatcagc tctgatggcc agaccctcat ctcttcatct    287520
     agtgacaaca gccttaagat ttgggagtta gcaacaggtc gtgagttggg tattctcaat    287580
     ggacatactg actctgtcat tggcatcagc atcagtccca atgctcaaac cctcgtctct    287640
     acatctttgg ataagaccct caaagtctgg gatctgcaga cgggtaaaga agtaatgagt    287700
     ttttctggcg aaagtgcatt tagttgttgt gagatcgccc tggatggtca cacagttgtt    287760
     gctggagatt ttgatggaaa actttacttt ttttctctag aagatctaag tttttccgat    287820
     gagcactaga gcacttaaac tccgtcctag tatgcattcc agagataaag gtgttatctt    287880
     ttcgtgtaag tttttgggta atgcagataa gagggattat ttggagtaga aataactact    287940
     aaaataccct tgctgctata agaaggtttt tgaaacgtgg ttttgagatt atggaggaag    288000
     gaaggatgtt ctgtaactcg ggttttgaac attaaaaggc aatagtttag gtcaacagaa    288060
     taaaaacccg aagcccttta taactatttt agtttgtatc gcttgaatga catacaggga    288120
     atggatttca gtttaatcaa cctctaaaat aaaaactgaa atgagttgct agggacaact    288180
     aactacattc gtaaagggac tagaaggagt tccaggagga accaacgtgc catcgaagct    288240
     gaagattgca ttattattgt caagactgac agttgttaaa ctttccacct ggaaaggact    288300
     cctcgcagag attagattaa aatctaaccc tcctgccatt gcaacgttgg gattatcact    288360
     acgattgcca gaaatagcag cacagatggg attaacatca taatttccta tccgtaaact    288420
     atcctgtctt gcttgaatcc gtacactgtc ccgccctgct tgaaggattt tattattaga    288480
     aatagtagcg gattggatgg ctccattgcc aacaggcctt actaagatac cgtcagcatt    288540
     tttccctgac gtcgaaaccg tgtttccaga gatagtcgct ttattgatag tgctgtctat    288600
     gtatggctgg accctaatac cagcagcatt gaatctatcc gttgagacag tgttacctga    288660
     aatagtcgca acggtgattg taccgttttg ggaaggttga acgttaatgc cataggcaag    288720
     tccagttgtc gagacggtat ttccagagat gatcgcagtg gatataacgc tattagtagt    288780
     aggcctgata ttaatactgg cagttgtact aggaatagta aagaaaggtc ttaaaaccat    288840
     atcatcagaa attaatccag ctgttgaaat tttatttcca gagatggtcg tggtggtaat    288900
     agcactgtta tagccgggtc ggagcaagat cccatcagca attccagtag tcgagacagt    288960
     attttcagag atgcttgcgg tagtaatagt acttttattg aacggctcaa ccaaaatgcc    289020
     ataagaaaag attctatccg ttgagacggt gtttccagag atagtagcag tagtgatgac    289080
     actgttgtag ataggccgaa cggaaatacc ctgagagttc aatcctgctg tttccaccgt    289140
     atttccagag atgttagcgg attgaatagt actattattg gaagattgaa ccacgatgcc    289200
     gtcagattgt actccatttg tttcaatcgt atttccagag atagtaacgg attgaatagc    289260
     actatcattc aaagactgaa tcacaatgcc gtcagtactg atccctgttg ttttaattgt    289320
     gttttcagag atgactacac ggtccaaatt gatgttggat aagctgagag aaataccgtg    289380
     agatatacct ggagcagcag gatcaacaaa tatagggttc ctggtaatct ggttattaat    289440
     aatttcagca gaacctgtta tgttctctaa tttgatgcct ggagaaaagt ctctcccgat    289500
     aacaataatc tgattgttct gcaccctaac attacgaacg ttacggccaa agatgcctcg    289560
     attgcctgaa aaatctacgt tgttgggtaa aggggctatg tttaaatttg cgatggtagt    289620
     attatttccc agcaccactc catctcttcc cgtgcgttgg atgcggctcc ctgaggtacc    289680
     tacaattcga actgagcctg tagacgcact aacattgcta atatccactc ctgccatcgc    289740
     agggttatca atattaatcg cgttattgtc aagattgagt gagccactaa tgccattgat    289800
     tgagatgcca ttggtagttg aatttgtact agcaagacta ttatctataa cagtcgcagt    289860
     agtaatgttg ttagctacta atgctggggc acccgttacc tgtacatcaa accctgagag    289920
     cagcgtgtta ttccccaaac tgacggtact agtgatgcga gggaagctac tatcgccaga    289980
     gaagggaagt tgaacctggc ctagcctaag aacactctct ggccgcaatg ggaatgaaat    290040
     ggggttaaca tcaatctgct gtacagctcc tcttgaacga acttgtacct tgtcaggaat    290100
     cgtaaatcct tcaatacctg aatttatccc atttgctaca taaacgatgt cattcccatc    290160
     cccccttatc actcctagtg catcttccaa gctaggaaat ggtgattcaa aggtgccatc    290220
     gctattgccc aaacctaagt tgacatggtg aaaaaaccat ggctctcccg tggttgggtt    290280
     cattgctgca accgtttgag tctcagtttc aagaagttct gtagtgttgg gggtatctac    290340
     aattatgctg ttgttgcgaa tgactgaatc acccattcgt gccacaacat tgttcgctgg    290400
     tgaaactggg ctttgaggct gatttactga gagtgtaaag gtgatatttc ccaacacatg    290460
     ggtgccgaaa aaatcatcat gctgaattcc aattccacca ctgatattag gagtaggtcg    290520
     tacctgtaag cgcaaccgac ctccaatcgt attacctcga atactgctat ggagaaagta    290580
     agggcctagg tatgctcgta aatcacctcc attcttaaaa ctaaggagtt gttttccaac    290640
     ttcaaagtcc actccggcca aggcttcttc aaattgacgc gtaatcagac gtcgccgcag    290700
     caagtctaaa agtagaatat tcccagtaaa tcgagggtca ccattaagtt gcaatacctc    290760
     aaaaatacgt tgcctggttt ggcggcgagt actgccaacg ggccaatacc cattcaggtg    290820
     aaggtcaaca tcctttccga gactctctat acccaagctc aattgctgga aggtattatt    290880
     atcagtgtta cgaatatcaa aacctagatg accaccaaat atacgtttta gatcatcact    290940
     atactgacgg aagccgaaca gaatatttcc acctgggttg ccctggtcat ctagcaggag    291000
     acggccttcg aagaaggtca atgctcgacc cggcttctgc caaacaggaa caaaggtttc    291060
     gaggcgagtg gtggtgtttg taccactgct ggggctattc gcgccaatac cgaagcgagg    291120
     cgagaagcgt aggtcagagg cttgagttga aggttgaggc tcagcgatcg taggcaggct    291180
     ataaaaaaca gtaagggtaa tcgctgtgat ggctatgcga tcgcaaaata atgccataac    291240
     ttagctcctt aattttcagg aaaggaaatg gaacgatgct gaggggaaat tataatctga    291300
     taaatgattt cggattttgt gtgtaaccta cctgaaatag ctacttttta gtttagtagt    291360
     tagcgttaat aaggtcttga ttaagacaaa ttattaagta ttatcttgtt gatatttatt    291420
     acctgaaata gctaattaac agagtggcca aatgtcatta gattagagtt ttgagataaa    291480
     ttagggaatt ctttgaatta ttagataacc ctaaattagc taaaataatt tgcacctaat    291540
     ataggtctga tgaaaggtaa actcccatct gtaagaatta tccaaaaatt caagaaacta    291600
     caaggcccaa atcaactgcc ctgctgcaag cagacggggt atggaatacg atttgctccc    291660
     aaaccgtaga tttgaattgc aattccattt cttcgctgca agcagcgggg aatctaccct    291720
     cactagattg aagggccgct gacaccagct tcaatcaaac acttttaggg gcttgaaacg    291780
     acgcaaatac gttcgagaag aatccaaatt attactaaag gctaaagaaa attgagaaat    291840
     actaaggcct gaagtccttt ctctgtatag cttctagctt tcgttgcagt tggtatcagc    291900
     aactcttcaa ttgggccaaa gtgataaaaa tgttagtgtc cttatttatt cgccatggac    291960
     tgagatagct gaaatgcttt gataatagag aattcagagc actccttgat gaactgcgta    292020
     ttctcgtaac ctcgggatct agtccacttt tggtgatgct tgagaaaatg cacgcaaagc    292080
     tataagcagc aactacttca gctcataagc accaagcgtt tattcaaaag gtcgagacca    292140
     gccctcccat acatttggcg cttcaccatt ttcaatcgat tattttgtcc ttcaacctgg    292200
     ccattactca cttccagtgt tagggcagct ttgaccgctt cgtagtcgtc taggagccct    292260
     ttcgcaaaac tctgaaaagg tttcagtgca ctatttttag ctctgtccaa ccacgggtct    292320
     agatgttgag gtaatctctt cctgacgatg aagagcaagc tttgagccag atcaatggct    292380
     tttgagagtt caggttgact actcagctgt tccaaaattg tctcatcctc ttccgttaga    292440
     ttttccacct tgcgcatcac caaccaagcc gccctctgaa ctgtcaaagg cttttggatg    292500
     agctcttgag cctcaggaac aggtcctctt cctggtagct cattgaggga atctcgtgga    292560
     ggctgcgggg gtagagactg acgcaatttg tgagtgtagc gaacgaccat cgtataactg    292620
     cccttgaagc cctgctgctg aatctctgct aataattgtt tggaattctg acgaccttta    292680
     ttccattgtt caagcaggta ggctttgtaa gggttaagac cactccatcc tcgtcgggga    292740
     tgggttttat actcttgaaa tgtatcagca gctaggtagg tatacacagt gcgtttgcca    292800
     atccccagat gatgagcaat atctttgatc aggtaacctt gcttgcgtaa agcatgagtc    292860
     tgctcgtatt tttccaatct tcgagcccga ttttgagcct tacgagaatt aggatcaact    292920
     tgaggtttca ccacaggctg gctcattgct tctgtgtctt gatgctcagc aagtgtagct    292980
     ttcagcaggg tgtactcgac tgtcttgatt acttgggaat gagagctaaa cacgttttct    293040
     agaatttctt caaggttctg gagtagatga aagcggtctg caacctgcaa tgcatcaggt    293100
     gccccttcac ttgctcctga tttatatgcc ttggagcgat cacgagaaat gacttcgaca    293160
     ccagggtgct cgttcaacca atctgctaac gtgtctgctt tgcgatctgt taacaagaca    293220
     ataggttgat gcttttcaag gtccacaaga atggtgccat attcatggcc tctgcgaagt    293280
     gcaaaatcat ccacccctaa tattttgggc gttgtcactg agggaagtgg aagcttgaag    293340
     agggctctca acatagtatt gcgactactt ccataattga tttgataact cagccgggct    293400
     gcagctgcac caccaagggc caagccaatc gaactaaggt gttctgcaaa gcgaactgtc    293460
     ctccgagccc aaggaaccgc gacctggggt aatcgctcag taaaaatgcg acgcttacaa    293520
     gttttattgg aacagaagaa cttgcaaact tgaagcagaa tagtcagaca gaattccaca    293580
     cagggaagat ctctcaaggt ccgctcatag cgactgtgaa cccggtgtga tgtttgatgg    293640
     cagactgggc aacaagccaa agcttgagtt gaagaaacat ggaaggtcat ctgatggttt    293700
     gtggagtcaa gatcccaact gtccaagtga agggtgtctt ggcacggaag gaattgttgg    293760
     aagagttcca taaccagacc tggcaagggt ttactcctct atcctctacc gcatagttgg    293820
     catcaccaaa agaggacaag agcccgaagc tatgcaaata cgcatgaggt tagcatcggt    293880
     gaagttggta ccaatgagat cagaaccatt aaagttaata ccgctaaaaa tttctttcaa    293940
     cttcctaaag tgaagatgta gcaggatttg tgaatttttt tttcatttgt gatggtggct    294000
     acaatattga ctatatattt aggaaatatg aggatatatc tgcatctcaa ttaagctatt    294060
     aagctaaatc ttagaggatt tttaccagct tcataaatct ccaagaatgc atgttactta    294120
     agacttattt ctgtatgagt ctgtggcaac aagagatatg aagtaagaat aagataagtc    294180
     agtggttaga gtccctcata acctctaagt atctggatcg gaacgcttgc tgcaaaagat    294240
     atatttcaca gtatctcttt tattttttag tggcttaagc actgatatgg cttgatgaaa    294300
     agcatctgag taatgttcta ctcagtcatt tcttattgga agtaaataat gatgagtaat    294360
     tcgtgatacc aatttcgttt agagatgagc taatcgatat gctaaagtgg cgtatttaca    294420
     atgctttagc agttcaatac aggtcatctt tataggtaat tggtatgtgt attggtaatt    294480
     taatatcttc cttttaagga aaagaaagaa tttagattgc taatctttcc cgtcatattt    294540
     tttcaaaatg aggtgcaaca aagaaggtta ttgatcaata ccgaatgaaa gctaaacatt    294600
     ataaatttat gaagtagttt cttcaaatat ttacgaatct ctgtctcaaa tcagctcttg    294660
     aaagtaatcc gtgaatagag caaaaataat tctcacttta gatattttgg aaatggttta    294720
     tgaacatatc tgcattatta aaagtctcta gaaatgaaag agatattact tggctaagaa    294780
     aagcactgca aacagctcta aagcttgagt tttcaacctt acctccttac ctcattgcac    294840
     tgtggacaat aaatgatcgc aactcgttcg cataccagtc cattcgcaat caaattgcag    294900
     aagaggaaat gctacatatg ggactggtat gcaatctaat tgtggcaatg ggtggggagc    294960
     cagatctaac ttctagcgat ggtgtaccca cttatccagg ccctttgcca ggaatggtgc    295020
     aatccgattt ggaagtatct ttagcacgat attctccaga agcacttcaa acctttctgg    295080
     cgattgaata ccccgaaaat cctcctattg agattggcaa tgatcccaag ccagatgccc    295140
     aggctaatga ttgtgcatcg gattgtgcta aaactattgg ccagttttat accgaaattc    295200
     ttgaagaatt tcaagattta caggatcgag gcgaactgcc agagtttgat actaaccaac    295260
     aactcaaata ctcagttgat tttcagaatg accctgatcg aaaagttttt ttaattgaaa    295320
     gccttaaaga tgtcaaacgt gcgatctcag ttatcaaacg ccaaggtgaa gggacaggca    295380
     catccccaga agatacaggg gtagaagacc tctctcacta ctatcgatat ttagaattag    295440
     atcgtgaacg gcgaattcga tttataaatg gtcagtttgt ctacggtaac aagcctgcag    295500
     accaaattaa agctccagca gaagtttatt cgatggctac tattcctgag aatggctatc    295560
     agagagaaaa tgtttctagc gatgtctggg aaaaaatcac aaaatttgat agaacttact    295620
     ccaaaatgct cttagaaatt gagcgagcat ggacataccc tgaagaagaa ggtggtggaa    295680
     aactatctct ggatgatgct gttctaagaa caatgtttga gctgactaat gatgcagtca    295740
     gtattctaca agaaataatt cctaatgctt ctggggaacg ttatggacct tgttttcgct    295800
     ttgatccaac cgtaaccctc ccagatggga atgattcaga caatactgga ggtataaatc    295860
     cctttcctac ttgggaaatt gatatcaaaa acttttttac tgctggtgat attggttgta    295920
     tgaataatgt cggaaatcct ccctttgatt tggccagcta cacagatgta ttccaatttg    295980
     ctgatcagat tttagatcga gtttctttac ctgaagaaga cccccttctc atgccacaag    296040
     ggggacctcg ttggcatcaa gataagattg atacatttca aaattggata acaaatggta    296100
     agccaaaggt acccacttgg gatgataata tccgagattt atttgaatct ttagatgtta    296160
     attgcatgaa aaatagtggt tcgcgatttg atcttagtaa ctatgatgat gtcgttgcga    296220
     aagcttcaga tattttgaat agagtttcta gagctgaggg agctagtgga gtgatgcctc    296280
     cacagacaga tagacattgg ccagataatt gggttgcgac atttaaatat tggtctgaaa    296340
     atggaatgcc taaaagtaac gataatctac cagaatagcc tctaaaatct ggtgatatag    296400
     cgaattttga ataataagta gaaagtcgaa agacagaatt cttgcttcaa tctagtgagg    296460
     gtagattccc cgctgcttgc agtgaagaaa tgggattgta atccaaatct acggtttggg    296520
     agcaaatcgt attccatact ccgtctgctt gcagcgggca gttgattagt ccgacagaaa    296580
     tgttactggt ttggcacctc aagcgtcaaa gatttgaatg ttagtgcgaa gtctgttggg    296640
     aaagcagtta cataatccca atggatagga acaaaggtaa cttgcagttg ctttctcccg    296700
     tcaagatgag ctggtgtaat gatgcccgca tgccataacc tagagagtgt cggcgcgata    296760
     ttaaattgtt gggactgtac gtcctcaaga cctaaaacaa agctgcttat gtaatgctga    296820
     tcatcaatgg tagtgttagc atcagcatct ggattctcaa taaagattcg aacacccttc    296880
     aaatcctttg ccgcctgcgg ataaacgtct cgaataacta aacgggcaat cttgagagag    296940
     ccaccctcaa gatgaagttt aagggtttgc cgaacctcat ctccgatttc taactgaaag    297000
     gtgctagaag aattgttgat gatgttcata gtcatgggat cactcttacc actgttgccg    297060
     cttagatcgg ctccttcggc tcgaacatct gagtttgagg cagagcaagc tactgagatg    297120
     caactcatca aggcgatggc aatgagtcta aagatcgctc tccttgagac cctcatagcc    297180
     acccatgtga aaaatctgtc ttcaagcatt gaggtcaacc acatcaatct gaaccatatt    297240
     tggttggatt tcctccaccg atgcgaaggc attctggtca ccaaaaaggg agcgagtcac    297300
     aatcgaaact ttcaggctat tgctctctga caagcgagtg tctccataga gtctcttgac    297360
     agcttcagta gcattaagaa gtacattctt cttgtgacca tgactccaac gctttctgtt    297420
     gccgccacct tgtccctcaa agaaggtgaa gttgccgaca tatcccggtg cagatatagg    297480
     agtttcagca gtaatgtcag gccctaaaaa tacaaaaaca ccagtatttt gctgctttgg    297540
     tgtcttgaca ccttcaatac gcagacgtac aacatagtta ggtactccga ctgctgccgt    297600
     acttataaga cgacgagtcc gtagagataa atccacatta gcttcaaatg aaagcacatt    297660
     ttccacaagg atagacttcg actcaattac agattctaca acctgctgcc ttattatgct    297720
     tgatcgtgct gccaacgtct gtgttaggtt agtaatctga tcggtactgt agacatagcc    297780
     cataaccctt gagtccacag tctgaccaca cgtgaattca ctcccgacct ggtttttatc    297840
     aacatcatag aattcgttaa aggattggtt ctgccactca tcttctgaag gaggtaagtg    297900
     gcctggtcta gaaagccaat cagagtaaag gcggtctatg ttgcagtgat gcatccagaa    297960
     tattggatcc agaggagaaa aaaactgcac catattgcta ttcttcccac cgacatcacc    298020
     aacccatcga tggatgaagt tgtgtgggat tacctctagt tcaccactac ctccaatacc    298080
     tccataggtt gcatagtcgg gattctgctg gatgctctcg atcctaacgg gaccaacata    298140
     ctcttctaat tcttgttgtg taatctcctc tccgtcggga cggccacgac ctgccgttgg    298200
     tgctgaagaa caaatagact ggatcgaaat attatcgtcg agaggattgg catcgccata    298260
     gaacgaactc ggtacagtat gggtttgtga ccaatcccaa tatggcagtg caaaggtagc    298320
     gttaccgctg aagtgttgga tgagttgctc gaaatagtag agataagagc gatgccaggg    298380
     tgcaaagtac caattactat gcttacaatc ggtaaaatca ttacagttac catgaatata    298440
     agcttggaga atccatcctc gtgggtcttc aggatctgta tttatcagcc tcttcatctc    298500
     gctcactcca tcgcgcaaag aggcaagatc gccttctgca tcagggctag caacattctt    298560
     tcgcgtgcgc agttcctgtg cttgcgctac cttggtggga agaaagaaca aagccgtagc    298620
     tgcaccagca gagatcagga actcacgacg tgttttagaa gtaaacatta ctcatcctct    298680
     tcagtagtga ttaacagttt ttctatatat tttgcaagtg caaatcaaaa aaactcacta    298740
     aggatactaa ctaaactata aaaaataata tagaatccgt tcgcatttat ccagaattat    298800
     ttgatgctta taatttagtc atcacctctg attttttagg taggcaagag ttaatcttta    298860
     tcaaatgttc actactaaaa atacagtagt gaacatttga taaagtcaat tttagttaaa    298920
     tacgacaagc tgtcaaatta tagcagatcg gataatagaa caatccaaaa catgaattaa    298980
     aggctaagaa taatactagt tttaatggat tttggggcta cctgaaatcg cctatcaact    299040
     ggtttcagat ttttatacgg ttaatctaaa atataggttt tttagcctaa taatgaatag    299100
     ctgagaaaga attgataggt gatttcacta cttcattctg gaagttctct ctataactac    299160
     gttttttcag cagggtaagc tagacccatg taccagggat ctcaggtatt tatggaccat    299220
     cagtttgttg ctattacctc gtttcatgac ctgcgaaatg taggtttcag acgcacggct    299280
     ctgacgcgga tgcacaatgc tggagtgccg acaaagccta ttcagcgaat tccggggcat    299340
     aggacgctgg cggtactgtc gggatatctg gaagtgactg atgagcaagt ggagggggcg    299400
     atagtgaagt tggtgtttta gtaaggtcag tttgatcagt tcatggagac aaggattgtt    299460
     gcaaagtgat gttttgcaat taatagtgga gatattgtga ttaaaaagaa tatttttaat    299520
     gattttttta ctgagtatct agtgtataga gatgaattaa atagttaatt tatttctatg    299580
     atggattcgt ttttatgaac gggagaaacc ataattatat taagaaataa atctttaaag    299640
     ttgcatttta gttttagtaa aagtatcata gactacattc aggtgataac tttaaagcat    299700
     taggtcgagg ttctgttaac aaacataagg aagatataga cttgtaagtc tacttttatc    299760
     tcttgaatct cgctatcaaa aatcaactac cccatgcaag tagacaggta tgaaagatgt    299820
     ttccctccca atctgtaagc ttggatagga atcttttctc ttcattgtaa gaaatgggga    299880
     gtgtaccctg actaaatgca aataccaaaa atcttaatat tttcttgtgc ataaataatc    299940
     tctgtatgct gtttttttaa agaactaaaa gtaaagcata ttgaataata atacttgggc    300000
     aatagtgctg attttaaata tgtttattcg aattattcaa taactatttt atgtagttgt    300060
     ataactttat tgctgtgaga ttttttagat catttttcag gatttacctg ttaagaaaat    300120
     atgattttga gtagctcctt cctactctta ggcctgatga tttcgacgca acttaccgat    300180
     tttgtaaagc agaagatgag gagagtactt tttgaaacct cacggttatg aagtcacaaa    300240
     aatagatact actcattatt aaaatacaaa agcattttaa ggttagaaga atgaacaaga    300300
     aaaatttact agcattagct tgtatattac cactatttat tcaggctcca gtccattctg    300360
     aatctcaaca gcctagtggt agaaactgcc gccatataaa atcagtatta caattagcag    300420
     atgataataa tcttgatact gaaattctta ttaaactcca agaaaaatat tgctctacta    300480
     accattcgga taaactattt attcttcctg aacaacagac tgaaaagact tgctcagaga    300540
     taacaactat aggtaacttc tcttatgtta gcaatgatca acaatccaga gaactatcaa    300600
     agcaaatagt taatcgttca aaatttatat gtagatttga tgatggtaat ggatcatttg    300660
     attggggaaa tggtcaaaca gcgaaatcaa taggtggtac ttggtattac ccaaatggtc    300720
     aaacagcgaa atcaataggt gatacttggt attacccaaa tggtaaccgt gcttcttctg    300780
     tttctaccag tttattgcca tgggcttgcg aaaaagtaga acaagaaata tgtgatcgaa    300840
     ggttatcact agtttctaag ctacaacaat caaatgattc aactaatgaa gattatagag    300900
     aattttatct taatcaatct attattatgc tcgcttggca tgcacatctt caatagtgat    300960
     taggaactat gaaattttgc ctttatcgca tgcattactt ctgaacaaaa attattcata    301020
     ataaataata caataatttg tttgacaaaa gagggcttca ttcgcattaa tttcacataa    301080
     tttttagtga attgagttgc ttcagcaccc atagtttcaa gcataattaa ataatacata    301140
     acgctggtgt gccgacgaaa catatctagc gaatatcggg acacaggacg ctggccgcat    301200
     tgtcggggta tcttgaggtc accgctgagc aggtggaggg ggcgattgcg aagttgatgt    301260
     tttagttagg gttggtaagg cattctaaag aaaatcccat aaggatctgg ttgattttga    301320
     agtaacgcaa tgttgcaatg gtctaccata ccaattgaaa tattgattca atgcaagact    301380
     ctttacccga atcactcagc aaactcctag gtaacatttc tacagatcag caaaactatg    301440
     ttctagaagc ccgaaagcag atcttaggat ttgatgatca catcatcgaa gtggggcgaa    301500
     ccacttcaac agaatatggc cttaggaaag gagaaaagca gatctataaa accttgatgt    301560
     gtgctaaatt cattccgttt catagaggag tgtaccgtcc aaaactgttg ctattactcc    301620
     cttatccaaa gcgtgaatgg gctgggcaag gcagtggaag aacctataag cgagagaaag    301680
     tgaagggtct cacctgggta gaagcgagtc atactaaagc gtgggatcag aactcacaac    301740
     tcaaactgta tttttataca gggaagtcac aaagtcgata tagctccgtg atggacctaa    301800
     ccccttatga atcaatgtgt catctattat tgggtaagga agatctgaaa ttcacatctc    301860
     tgttcgacat catcaatctt gctttgaacg agtggaagct gcaagttgat gagcgggatc    301920
     aatgattact ccaatctgtg cttgccacca gtgagatcgc ttcagtggat acctcactga    301980
     aggcttcctc gtctgtgcca tccatcccag tggcccagtt cagcatcctt gccctgactt    302040
     cgcagaagta gtcgaggact gggaaccagt gggggcattt tataaggata atgagttgat    302100
     caaggactgg gtgggatatc tcgctgcatc ggagcggata gaggttctgg aaacacaccc    302160
     ctttttcacg ggagtctgtt caaagtgctg tgcaagcttt ggggatagca gacccatcca    302220
     ctacgattgc aacaattgtg gctggatgga tgattccatt aactgagaca aactgagaca    302280
     gataactaac ccaagctttt gcctttgcct attctgaaga gcagctaatg aactggatca    302340
     ttctgataat ttgcatgatt gcattcatcg tttactggag taaatggaga caaagccgag    302400
     gtaacctcgg cagggtcatt gactacagca aaggaaataa gggcgcgcga agggagcaat    302460
     ggcaaaatta ctcttcaagc aaagcaaagc tgattcagag gattggccgt gaagctacag    302520
     agcgtctgat cgtcaacgta cttctggata atccgagtaa atcgagaacc tggtgctcgg    302580
     ataaagcctt acgtgacctg gaacgagatc aaggtctgta agacaataac aatcccaaga    302640
     cagctactct gtattcttct ccccatagca gtattggggt gtgacccacc ttccagcacc    302700
     ataaccaacg acgttgcccc agcgaacacc acccccgccg aagttctcag cacgggtgat    302760
     ggggatactt tgaaggtgcg atctaaagac ggtacatcga gcaagattcg cattggctgc    302820
     attgacgcac cagagtcttc gcaggagtat ggaccggagg caggccaaag actcaaagca    302880
     ttgctaccca gtggaataac tatcgagctt tgggaaatta ccacggatca atatggccgc    302940
     actgttgcgg agatctattc tgaggggaaa tcggttgggc ttcagcttgt ccaggaaggc    303000
     tatgccgttg tgtaccaccg ctaccttgag ggctgttcag cgactgcgga tcagtatatt    303060
     gctgctgagg aagaggcgcg atcacagaag ctgaatttct ggagtcagag caatccagag    303120
     atgccgtggg attttagaag atctagataa cggttcggac ccataacaaa atggaagaag    303180
     cacagcacca aaacgccttt tatccagaag atctaggggg taggcaaacc ctaagcatga    303240
     tggagatccc cgaaggtgaa tttatgatgg gttctcctga aggggagatg gatcgtcaag    303300
     acgatgaagg gccacaacat tgggtcaaaa tatcaaggtt ctacatgtcc caaactccca    303360
     tcacccaaac tcaatggcga atcgttgctc aatggccatt cgtcaatata gagctacagg    303420
     gatatccgtc gtattttgag ggagagaagc gacccgttga agaaataaat tggtttgaag    303480
     ccatcgaatt ctgtgatcgc ctcacccaac atactggcag accgtatcgt ctccccacag    303540
     aagcggaatg ggaatatgct tgccgagcag ggaccacgac tcccttttat ttcggtgaaa    303600
     cgattacgac tgacctagcg aattatcggg gaacagattg ggaaaagtac aattcgtcag    303660
     gttcctatgg ttcgggacca aaaggaacgt atcgcgggga aacgactccc gtcgatcact    303720
     ttcaagtcac ccatccgtat ggccttagcg acatgcatgg caatgttttg gaatggtgcc    303780
     aagacacctg gcatagtcat tatgatggtg ccccagtaga tgggagtgta tgggttgatg    303840
     aggaagatat tgattctgat aaggttctac gtggcggtta ttggggcgaa aatccagggt    303900
     tctgtcgttc cgcatgccgc tcagggaccg atcccgacaa ccgcaatttc gatattggtt    303960
     tccgggttgt ttgttcgcct caaggtcttc cttatagcca tagatgatct cggctgtgat    304020
     catcacggtg atgattgaca cacagcggat ctgtgggaat tttggaccgt caggtcttga    304080
     gcctagctgg cctgatcagg aacatatcga tgctctaacg gtatcttctc aatcgccgct    304140
     ctctgccgtg catctcgttc cgctttctgt cgagcagcaa tcctagccct agccgcttta    304200
     gcccgcattg ccttggcatc gctgttgtag tccttctgaa tttcctcggt gttacgagat    304260
     ggggctgggg cgtattggtc ttgctctgac atcagggatg gaatgggtga atagacctct    304320
     agcaatattt agctaacgat gtgctattgc tgtcttctag aaaactgtcc tggctatact    304380
     ccaaaagcct caaggattgt tcgttccatt tcatcagcta ctttcttaaa tccttgagct    304440
     gataaatgta gctcattttc ccagtctccg tctttaataa ttattcgcaa gtcgatgtga    304500
     tagacattat ttgggtattt atcagataaa tctttaagca tttcattgag gctatcaata    304560
     agccttttag ctatcacttt tccttctgct tgagaaatcc cttttcgtct tagtgcaggt    304620
     tcaaaccaag gtccgatgaa ttcgtaatca cctatctcaa tgacagctct tccgtcaggt    304680
     gttggatatc cataaccatg taaaaatatt ttaatatctg actttgcaga tataacttct    304740
     ttaatcaaaa attcgaacat ttcataaaat actttattgg tcataaagtc aagataatct    304800
     tctttgaggt gaatagtact caattgtgat cgagagtgat gtaagaacgg ttcgaattta    304860
     aaaccattcg gtcctgcaac atcattacct acgccagaaa atagaaaaaa gtctggttcg    304920
     tatttatcta taagtgctaa agcttttaca agttgagggc tatttactaa tggatttgtt    304980
     ccaaaggtca tattttctaa ggtatcaccc gccttagcaa ctcgtaaaag atttatctta    305040
     cttcgcatat tcagttggtt gataagatca cctagcgaaa tatcactaac ccaagcagga    305100
     ggataatcaa accaagaatc accttcagca atacccttta aagcttcggg tttaattttc    305160
     attcgtagtt taaaccattc ttcattcgat tgatcacgaa agcttgaact agatgcatca    305220
     ataacctcac tttcaaatct caaatcatta agtcttgaca tagatttaga gttccttttt    305280
     tttagaaatt tctaataccg taacttggaa ctttaatcca tatgttttat ctcaaagtat    305340
     tttttaatct tgtgaattaa atcttaagga ttcagtaatg caagtggaac tgacggaaat    305400
     ggttacctaa atttctggaa cagtgattac tagctcaaat ttttatgatc tctgtagtta    305460
     aacagtcttc agatcgaagg tgtttaatta ttcagttcat tcaattgagc aatttgctgt    305520
     tctatccctc ttttatcact ttgataggag agtatctgta agcttgaaat tgtgttagta    305580
     catggcctgg tgattggatt cactctaaac ggccttccaa tagcgacatt tgctgttggc    305640
     gaatatgcta cagagtagaa attgattgta ataaaacctt ttccttggcg tgtcttaatt    305700
     acgccgctac gccgactttt ttcttgtcgt agttgtgttg cttcagcatc ttgatttcct    305760
     gagtggaaag cttccctggc tgctgtgagt cgagggcaaa tccctcagcc ttcgcgaaga    305820
     gctcgttctc cgaaggacaa ccttcaggta ggaagaacac tgcatccgac atgcgaatac    305880
     ggccgtcatt gtcgtggtcc atgtagacct gtctgtcggt gagatcgacc agataggatt    305940
     tgtcgccatc atggacccga tagatctcgt agttttcgag ccctttaccg gtccagtgag    306000
     cctctaggta agccgcacca gctccgaaat cgagtaggtt ttcttcgccg tagtcgacgt    306060
     gtgattcgat cgggtgcggg atgttagtcc gcatgttgct gaacgcgttc ggccgctctc    306120
     tgccctcgag atactcccgg aactcatcgc cgccgaagag gccgagaaga tgctcgaagg    306180
     tgaccgcgtt gacgatgtta gtaccggttg gagtaacttg ttcgggccct gcgtaattgg    306240
     tgagccattc gttgtgcatg aaccgggtag acgcctccat cacgaagttc ataaacgttg    306300
     gattgggcac cgcgtagcct tcgggccgga actcgtcggc gagctgcccc attcccgtgg    306360
     tcagaaatag ttcaccgctc gcctcgttat aggggccaaa gagctgctcc catcgttgga    306420
     taacttcctg cgcattctta gaatcgggtt ctttgaaaag ttcgcggtag ctcttgaggc    306480
     ccggaatatt cagacgttcc agaaagctgt tatatctgcc tgtaccacga tccaagcccc    306540
     gctgcacatc ggtttcaccg atgcgcgtag tgcctccggc ggttgcaagg tgggcgaact    306600
     ctggtaggta gttgttgagg gtgaatgccc caaccgaggt gttcatcagc atgtgggcga    306660
     tacggccgat gccttcacgc tggagcagtt cgtttccagt agagccgagc gtctcagtga    306720
     gggaaataaa ctctccacct gccaccggtt tgccttgctc atgaatatcg cagagagcca    306780
     tgtcgaaccc atctggctga agcgcgtggc ccaccggacg ataggtttcc gagaagtcga    306840
     gacctttaag ttccggatcc gagaacatct gcgcaatctt cgggttgccg gcgaggccgt    306900
     gtagggccgg atgggtccct ttgtgcagcg gatcgtgcac aagcttctgg cgaagcggtg    306960
     ttctgccctg taagagccca aattggttgc tgtgcagggc ccgggttgcg gtctcgtggc    307020
     caaagagcat tggcgtccaa aatgcagtgt ggaccttggc ccgggtctga atgacgatgt    307080
     ttgctgcctt ccagtacaac tgattgtcag tgagttcagg atgtcgctta gccagaatgt    307140
     cgcagaccaa attgtggaat cgcacgtaaa ccgtgcgaat gagtgtaact ccaatcgaca    307200
     tattctggtc gataccagtt tggatcgtct tagcgccact ctcgtgctcg atgttaggta    307260
     gccacttacc gtcttggagg tagattttac cgccagggag catttcgcca gtggcaggat    307320
     cggtacgcat ccgcttgacc gcctcagggg tactaccgcg gtcggggctt ccgtcccatg    307380
     cattcgttgt ggaggacaag accgcgccgg ttttgggatc tatctcgttg gcgcgaatcc    307440
     agacccactc aatgccgagc tccgcctccg gagacccgga cgccaccgga ataggtatct    307500
     tcttatgctc attgaacgcg ggcatgagaa cgtcgtgggg taggtcgaag aggtggtcga    307560
     ttgcgaacac gttgaggtgg tcggcggttt ctcgccgacc agtcgcatag agctcggcct    307620
     gtgcaatttc ggccgcagag ggcagcaggt gttcgtactt gttaggctta tcacccaacc    307680
     cgccgtggat cggaatcggt tgccccaccg cccctgcgct tgggagatcg gggtcggtga    307740
     aaaaaccacc ggggccaggg tgtttggcgg tgtagctcga actcaagtcg ctctgggtct    307800
     tcatcgactc cgggatattt cgacccgcga ggagttcatt tcggtcgctc gctagacgaa    307860
     gcaaaccaat ggtggagggg agataggtcc aaattccgtg gcgcatcgct tggcggtatt    307920
     tgccgaagcg tgagaatacg gtgtccacaa ccttgaagat acagctcgtt aacccctgga    307980
     cgagatcgaa ggcaccaccc aagagcagat tgatgccttt ccgccacaat gagggcttcg    308040
     gaacatagac cttcagcggc tcctcattaa agtccatgat gtccttgttt gggccttccc    308100
     agaattcgcg gagcactcta tttgcgtcgc cggagcggta ggtatcggtg atagggctct    308160
     tacgttcgac cgattcacca ttcatagccg cctgccctgt aacccgagcg cgatcttgcc    308220
     accagcttgc atggttggac tctgggaatc tttcccctaa ttcacggaag attttggctg    308280
     cgcccttcgg gtcaccgctt tcaaatttag caagggcgag gcgttcgatg tcggtttgcg    308340
     aggctgagcc atccgctacc ttgatattca gaagcgtgat ggcctgggca tggttccccg    308400
     cgttcattgc ctcgagcgga tcacctgtct cgaggccagg cgactgggtg ttcaactgta    308460
     cattcttgcc aaaaccgaag gggcacttgc tacctgcgga attcggatca ttcatactac    308520
     actcctgtag attgcactac tgtattgctt ggaaaaagat tgtcggtgcg ggaaattatc    308580
     ctaaactggg ctaggtagtt aactcataga tgtaagtagc caaattcact aatatggcaa    308640
     tgaggaattt taaattctgt cctcttttag ttgtgtcgaa aataatgatc tcagttacaa    308700
     aaaattcctc tgagttttat ccaagactat gcagccaatc tgaagatttg attgataaaa    308760
     gagatctgtc ctatcacatc atctttgcga tgcaaccgcc ttgtggattt ggttgtgtat    308820
     tgaaattata attagccatg attactgctc tttaattcat gcatgatgca tagtactgtt    308880
     tgtgtccaat ggcaggtagt tttgggtgtt aatatactca gataaaatct ataaaaaaat    308940
     aaaaaacacc tcaataatta ctgtcatttt gcaaaaaatt cagttcaagt tttaacaata    309000
     aaacttttct atagaactat atttactcat cattccttct ctaaagtttt atgcgaaatg    309060
     acataaaagt ccatatttag gaattcgaag tgaggcaatc atagatcaat tcaagtctct    309120
     agcaattttc ataatcttgc tacttaaggg aatatggttt accaagtcta aaaaaatata    309180
     atcttacatc ctgaaaaagc cttgtcaaaa acatatctga atatgtttaa atatttgttt    309240
     taattattgt tagtttgatt gaaataattc ttaaggctta tcgacttcca tcgcttctgc    309300
     gtcaatttga actgagtcaa agtcagagtg ttgcacgagt acataccacc tctcgccagg    309360
     tcgtttagct agatcaggca gaaggcaaat cacttgtttt cttcgcaatc gtcttgtaca    309420
     cactcactcc cactgagctt tatgactact agttcaaatg gctatttgat tacgtccccg    309480
     actaagttaa attgactcag aaacggtcct tttgcccaca tcacaagttg gcatcggaaa    309540
     agtgagcagg ccctagagca attcaaaaca taaatggatg cgatcccaaa cccaccgacc    309600
     ataatcaaat tcttctgctc tgaaccctgc ctttacttgg ggatgctgca ttattagatt    309660
     cttctaagct tggtccgagc ttgggactta gtatcgggtt taaccttagc cactatctca    309720
     acatcaggga atttcttgag aacaggtttt ttggactcac cctggcaaat ccatccgagc    309780
     aataaatcag gctcataaca ggggtggctc ctcccaggat caaccatgac aggttttggc    309840
     gggcagtagc aacggatgat gatttcatca gattccatta gggaatttga aagattatag    309900
     ttgggtctca gttggctaat tttaggtgca aatcggaggt ggtatcggaa tttgcgatcg    309960
     cactatccag ctaaggagta ctccacagtg attactgcgg taggtatgca gtcacggtaa    310020
     ataattgata accacattgg caatcacaat aacggtcaca ccgacgttca agcgagtttg    310080
     taagcctgaa caacggtgtg gcgaacggat tccttgaggg ctaatacttc ggacgattcg    310140
     aagagattga tgcttggaat tttcctttct aattagattg ttctctactc actgggaaaa    310200
     ataactccat tcagcaggat ccaaaccata aaaatctgaa agtattttgt aaagtttaga    310260
     atgattgagt ttcattggta tcggcttttc aaaaaatact tcagttgcaa cagcaaaaaa    310320
     ctcggcaagg tcagtagctc catattcatc gatgactgtt accatattgt tttcaacagc    310380
     actttggagt cttttatact catccgtaat aattttattc catgtcatat atgcatgttg    310440
     aggattgaga cagttgagaa tgggtacacc atctgcacaa ctatcttctt gatcaagctg    310500
     atgtgcaaac tcatgaagaa ctaaattttg tccatctttc cagtttaatg ctccaagctg    310560
     tgcatgtttc catgaaattc ttatctggcc cttacgagca ttagagtcac ctaaccagct    310620
     tcgacgcata tctgttacta cgaattgatt ttcaatacgt tcaacttttt tgtttattga    310680
     atcaggataa attaaaattg atgagagtaa tggatatgtt tttccttttc gattaataat    310740
     taaaaggcac gcctgtgctg atatcgttat tctaatttca tctgttattt ctaatccatc    310800
     gcagccaaag aacctcttat catctagaaa tattagaatc aaatctttta gtttggattg    310860
     taatgaagat ggaagaaagt tatagatagg gatattattt tctagaattt tttcccaatc    310920
     tgatatgaat atttttttgt gaatagtcat gcgaatcgat ttttatttta agttgccaaa    310980
     aacctatgac agttttaatc tgcttagatg acattcagga atggggttat gctatggctc    311040
     ttcatatgag ggcgttggat gctgactgcg ctgtcagcgt gtctggtggt ggcgagtgag    311100
     cagtaagagg ggaattaatt tttttagttg acaaacccag aacccttttg tgaatttatc    311160
     tattcccatg tgatttaaga cccagaggcc gaggctgcaa gctgctcaaa atcgattggc    311220
     tggatgtcct catgccgatc ctgttgtagt gcttcccata gatctcgatc ctgctgcatt    311280
     cctagccaag tacctgctgt tagtcccacg cccttctcaa ggcgaatcgc catgtcaggt    311340
     gtaacggcag cttgtcccga taccaatcgg gaaattgcag aatgggatac ccctagtgct    311400
     tttgctaatt gacgagcgct taaaccgtag ggttctagat agaactcttt gagggtttct    311460
     ccagggtggg ggggattatg catcagcatt agtggtagtc ctcatagtcc agaatatgaa    311520
     cgtcaccgtc tctaaactca aacgtcagtc gccaattccc actgacagag atggaccagc    311580
     gacctttttg gtctcctttt aaggggtgca acttaagctg aggtggcaac gtggatagaa    311640
     cctcgatacg attcagtagc tctagtctga agcgcaagga tttagcatgt ttgggctgaa    311700
     tctttgcggt gcttccagtt tcaaagaata gttgcaagcc tttatgccgg aatgacttga    311760
     tcatactcaa attgtaacgt ggtgcgctac aggcgacaaa aatagtagat gataatctgc    311820
     tcgaaagcca agcggttgtt caattcttga gtaaagtttg ggacggtatc agaatcaatc    311880
     gtctcctccc tctcctttga atgcttccgc caattgcttt agcgtcactc caagagtttc    311940
     acacaaaatc cacgtttgcc acgggtcaag ttttggcttg gttgtattac tttcccagtt    312000
     gtatattgtc tgagttttaa ctccaagctt ggctgccaca gcgaatccgt cagaagtggt    312060
     tagccaaatc cttgaaaaca gcgattagta cccccaattt tcttcgtctt tgttgttaag    312120
     cagcctggaa taattcctgg agttcactca cacctttcat gaacttcttt cttcgatcag    312180
     atagtgacac gaattctgcc attcgactgc gaggtctcaa aaagttactc acttcgtcca    312240
     ccgctttaca gaatcgatga gcagcattaa actcaccaaa tcctagggtt gggtgatacc    312300
     tgtgtttgac gggtctgtga ctctgttcaa ctgggttctc agtgcaggga cgaacctcat    312360
     tattggatgt caaccccata ggcgatgtcg cgacaaccac aaggcggatc aacccccaaa    312420
     tttgaaccgt attatttggc gtacactccc tttgcgttag ctctttttca gacctcatac    312480
     gataccttca gaacaaaacg acaacccgtg atcgaaatga caaccagtga tcgctcgatt    312540
     atttggactg ggatttttga ggttgagact gagtttgagc cgttctctga gtcgctgatt    312600
     tgcgccgata actatcggct tgaatttcga taatcaagcc atgatgaatt aagcgatcaa    312660
     tggcagccac cgccatcatc gaatcagtga aaatgtcatc ccattggctg aagggttgat    312720
     tcgctgtaat caacaaactt tttcgttcat agcgatgcgc aattaattca aacagaacgg    312780
     acgtttccgc ttccgacttt ttgcaatagc ccaagtcatc caagatcaac agatcatagc    312840
     ggtccagttt tttgagcatt ggatgcagct gcagttggag cttcgcctgt tgcagttgct    312900
     ggaccaatgc gttggctgca aagaacttca cccgcttacc gaattccagc atctttttgg    312960
     acaccccagt ggccagatgt gtttttccaa cacccgaggg ccccagaata aggcaattct    313020
     cggcgcgctc caaccaaccc ggatctgcgg ctaattgcat caagggagct ggattgagct    313080
     ggggacaatg gctaaagtca aagttggtaa aactttttgc gtttgggagc ctggcttcgg    313140
     tgagggcacg ttttagacga gcttgttctc ttcgttgggc ctccgtttcg cacaaggcta    313200
     gtaagaattc cgcataagac cagttttcct gcatggcttg ggattcgata gattcccaat    313260
     gggtcaacat gtgggagagc ctgagctttt ttaaatagag gctcaggtgc tggtaggggc    313320
     tcagcgggga ctgagcagga ggggaggagt ttgtcataaa gttcaagtga atgttgttca    313380
     atgctgagtt caggaacctg cttcatctga ggcggctcaa actgtttttt caggcgattg    313440
     agggtaaggc tggatgagcg aagctgctgc tgtaagtaca ctgctacggc ctgttcttta    313500
     tcttgaaccg cagcaatata cagggcttcc acgatgatct tggcagcctg ctccaggtca    313560
     aattgggctt tgagctgttc ccagatttgg cggtattcag gattgggaag taggtctgat    313620
     tgccaggtgc aatagataaa agcacgaggc ttcaatcgca ttgaaccaat aacatggcga    313680
     tagttgatgc aacggtcgcg acgtttgcct ttgccactga cgcgcttcct cggcaattcc    313740
     accaccgggt gtcgctccag atagccgaca atccggtcat ggtatagatg cagttccaat    313800
     tgacgaccaa tcagtcgaga agggacggtg tatagaatgc agcgaacatc gatggtgctg    313860
     cgtttgctga ctttagccgt gagcacttca tagtcagggg ttcgatattt gggcagtggt    313920
     tgtagatggt ctttctcttg ctcatacttg gtttggcact gctgattcaa cttggcaacc    313980
     tgtgcatcaa ttaaggcttg atactcagca acgctcgtaa aatctgcact gccgcgcaga    314040
     tagatcgcct gcttaattcg gttcttcaga tgaccatggg gagattcaat ggagccattc    314100
     tcatgggcta cacctttgtt gttacgagtg ggttctagcc gatagtggtc acacagttcg    314160
     tcgtacagac gagtgaggtt tttggaccgg cggccgccca tgttgcgata ggctgcactc    314220
     aaactatcag tacgatgctg tgtaggaaca cctccacagg ctgcaaaggc attttgcaat    314280
     ccttctgaga gggcgacaaa gctttcgcct ccttcgatga tctgggcata tcgccagccg    314340
     ctgtatccca gacggtaatg gtaaatcagg tgctcaaagg gtttgccggc aatggtaatc    314400
     gtgatgcctt tgagttctgt aaaatcggag aacccttgta cccctggttc atgacgcaat    314460
     tcaaacatca cttcagggct tggtccatgt aaggctttcc acgttctcac ccgacgttgt    314520
     agggtccgca ggacttgggg atactggcct ggatacttat cctgcaggta ctcatacagg    314580
     gtcatgggtt tgaggcgtgg gtctcgacgc agcattggtt ctagctcgtc ttcccacaca    314640
     tcagctaagg ggtcgggaac ggtgcgttgg tcctgaaggc ggccgcgatt aggttgatgg    314700
     gtgccggcct caattcgttg tccggttctt gtagatattt cggcaatgta agctgcatca    314760
     gcttgtttta agccgaggtc tcttccgttc atataaacac gagtatgata ggaatcaatt    314820
     cttttgttag gcacttgtac agccctctat tgattaggga tgtaaaaagt gtcttttttc    314880
     ttgagattga attctagaaa cgcgatctca cacatcattt ctagggaatt gagatctagt    314940
     tttatccttc tcaggggatg cctggtttct tcatagctat agccgacgtg acatcgtcat    315000
     taatccgtca gctcgattgt cgtctaatac ctcatgctct acatcctcac ccaactcttc    315060
     tgagatcgca cgagggtatg atgccaagcc atcagtcgcc acttttttag gtggatcatc    315120
     atgcagctca atcgcttgag caaagaaggc tttggtccct tccatatctc gactatgaag    315180
     ccgtaggagt gtcaacaggt attgttttga ctttttagca gcctaataaa tgccagccat    315240
     tttattggct aggtaagtat ctatattggc tcctttcttg ttaactcttt tcttctttat    315300
     gtataggata aggacttaac cgactatccg agtttccgat acattttgct caatcgtatc    315360
     gtctcaagag tgacatgcaa gttgtctcag gcttattcgg gtttgcaatc ttgattaaga    315420
     attagactag agatatggac aagctctgag atagttttcc ctaatgacgg gaatatagaa    315480
     atccttagac ttcctatgct aaagaaaaga gacttatgct gccataggac ctgcctgttt    315540
     agagtcccac ttctcctgct tctttaacaa cgtccaacaa aggatgagca gtttacgggc    315600
     cacagctata atggcttgtt ttctacgagt cttttgacca ccacaaagtc tttgatacag    315660
     tgctgcagcc caaggattgt agcgttgcat aatccaagca gcctcaacta acgtagctct    315720
     taaaatcctt ggcccacgct gagttatctt acccatccga ttcatttcac cggactgatg    315780
     ttgtcgcggg accagccccg catatgcacc gatctgccta gcattcttaa accgtttggg    315840
     gtcatctata aaagccacca ctacttctgc tgttttacgc cccacacctg gaattgattc    315900
     aagcagttga actctattgt cttgtttggc gatctcagtg agttttttat cgacagcatg    315960
     cagttgctcc cataaggcat ctaaccgctt cagttctaga tcgagttgac cctgccatag    316020
     ggacagtagc gaacattcat ccatgttttg agaatacttt ttcagttgct ctattctcga    316080
     aattgtccaa gccttctccc ctgcaggaat agaaattcct tgctggttaa atacggctcg    316140
     aatggtgttt tgggctcgtg tggcatggct gactaggcgt ttacgatatt tgaccagttg    316200
     ccgatattga cgggattcag cggatggcat gtagacaggg gaaatctggc caagtgctgc    316260
     taatttagtc aacttgagcg catcgtcttt atctgtcttg cgtttgacat gtttccagtg    316320
     ccaagcttca tgagtagggt tggccacaat ggtgttaaag ccttctgcct gacaaaggtc    316380
     gtacacccaa ccagagatcg tgcaagcttc gataacgacc tgctctggct gagtttggct    316440
     aagtagtgct ttaaattcac tagcaaagga tttaaaggag aaaaagaggg tgtcgttact    316500
     ttgggtatca aataaacaag cagctgaagt gtactttcca agatcaatgc ctaaaatttt    316560
     cataggtctt ctcctgtgag ttggggaatt aggtgatagg tcaatccttc tagctgaatt    316620
     gtcctggttt tccaactcac ggcttacatg gattctggtt ttgcttaatc gtacatccac    316680
     taaattgcca gcattatcaa tgccacgata aaggtagcac cacctgccct tgattcggac    316740
     ataagtttcg tctacaagcc ataccttgcc tacttttccc ttccgtttag tctgaatctg    316800
     ttccgtaaag tgaggcagaa atctttcctc ccaatctcgc acggtttcat gagtgaaaac    316860
     aaagccccgg atcaagaagt actcggccac atctcgatag ctgagtttgt agcgtactcg    316920
     aagtaaaagc acctggaata ctatgtctgt cggaacttca ataaagttga agggagtacc    316980
     agttcgctca ttgtaactcc gccgacacac tttgcatcga aaccgagcat agccaaggtc    317040
     agtcttactc tgaagaaatg agactcgggt tgagttgcaa tgaagacaat ccattaaata    317100
     cagacagagt atggctcagg gacaaggctc agcctatcag gacggtgtcg atttctcaat    317160
     tctggacaat cagccctgac aatttccatt ccctatttca gtcgagtatt ctgctatgcc    317220
     tcatccaatc atgctcgtag tgtctatcag cagctctggc gatatcgggc caaagttgta    317280
     cgtgaaatct atgtgacgcg caaggctcat atccctgata ttccttcgat taagtccgtg    317340
     gaacaggtca tcatgcttca gtccaaatac ggacaagatg ttgctgcctc cattgattta    317400
     gaacagcagt tgattcatga ccagtcccct gaaacggctc agcagttggc ggcactaaag    317460
     gcatatcagc agaatcccaa taactgtcac aacgtcagct ttgctcgata tcaaactcgc    317520
     tcgattgctt cactgttagc actcagagag tccttgatgt tgttgctgaa agatcatgga    317580
     catcccattg agatggagga actgagagac cgcaatgccg atatcgtcga gtccttcagc    317640
     aaagtgcgga agcagatgga ggtggaaact gcggtgatgc tggggacggc tgatggggag    317700
     cgattcacgg tggagcaggc catccgagtg atgggaagtt cttctgccac ctataaagat    317760
     acgttggatg ccaaaaaggt cttattacaa gatgagttgc ccggtgttga attgacggat    317820
     gaattcattc atcaagtctg tgtggaacat cgaggacggt tgaagagtgc cacgaagttg    317880
     cattggatgt cttatcaccc tgaagttgct gaggaattag accggagaaa ctttatgaaa    317940
     cagctcaata gtcagttcgt gttgactcat cggttaacta ataatcgcat ccaggtacag    318000
     ttacttcgtg acctgggggt atttgacttg gtagatactt acaacgtcac cagcgctgat    318060
     tatgaagcct acgacaaggc gttggagaaa ggtcgccagg tgcagcggca acgacaatcg    318120
     ttgagattgg aggtcaaggg attagctggg cagatcaggg aaattgttca ggagcagaag    318180
     gccattcaag ccaagttaac ggcattgggc agaaaggctc atcccaggaa gacaacgctg    318240
     aagggggagc tggagcagtt ggagcagcag aagcaggggc tgaaggacca gaagcagggt    318300
     ttaagggatg ctattgagca gcagtctcag gcattcaccc aggcccgata tgagcaggta    318360
     gaggcccgga tgcggatgga aatcatggtg atgacggagg atgatcagcg acttgaggat    318420
     atcaaggtga aggcgttgga atatcgctat cagatctatc gccattttcg gaatgtcatc    318480
     agtgaaggtc agagtgccgt tgccatcgtc aataagttga ttaagcgagt ggcccatgag    318540
     ttggtgaagg tgggaagtga ggaatcagtg agtctctatg tgattcgcta ttcgggcaat    318600
     gaagcttaca aagaccagat gctgaaggcg tttcaggtga agtggaatca gagattggag    318660
     aaaaatagac caagttgtga aatctgtaag aaagacagtg atctaattac agaaatggaa    318720
     aagcgatctg atatcaatga gtttggttgt ggatctgatc aggaaaacgg gcagtttgag    318780
     gggaatgatg atggaattga ggggggacct gagatgataa tggggtgcga ttgaccccga    318840
     aataaatttc cgttattaga attaattttt tcaacgaagt ctctaggaac taaccttaag    318900
     actagcttgg ctgtacctct attggctgca ccattgaaag aggataaata tcttgactat    318960
     tttcttcact aaatccagca atttaagaca gcacaaaaaa acacaaaaaa tcatttttat    319020
     cctgaatcat tgcttttata ctgataatag tccccctatc aggcgtttta tttgttgatt    319080
     ttagtgctag ctatatttgg aggtgctatt tgataggttg tttttgcaag ttctttgctg    319140
     tgatctagca agctggtata aaaagcgctc gaagtatact atcggtctat gctttaaatt    319200
     aatccgtgca cccctgatta aattccgttg tacggtgagt gatttagatt tttaagtctt    319260
     gagttaagag gaataaataa aaggtaaaaa ttaaaaaaat aaagatgaac gagataaagt    319320
     ttagttagga tcgtaaatat tgagttttcc tggcggctat caaatacctt atgattcaga    319380
     cttttcttgg aatgtttttt attgaattaa gtacctttta gaaaacacta aatttttgaa    319440
     ataaaagaga gtagtaacat ggggctagtc tataaggtaa aaaaagattt aaagagattg    319500
     gcggcatttg gctgggacga atggtttgcc caacatggtc tagatattac tgcaaaggac    319560
     ttgggttcag agtgtcaaaa acttcttccc gcaatacgtc gggatttacc tggccttgga    319620
     gacttttctg ttagtggaaa gcgaggtatt gaaccgggta aaccagcgct gagcttggta    319680
     tatcacgcct tggcgagtcc caatgttcat ccaacaaata atggcacccc ccataacaat    319740
     ccggatgctt atcctacatt aggtgaactt gacaatctgg aaaattacat ttacggattg    319800
     gctcgtcgtt ctattgattc cttcgacaac ccagtgctgg ctgtatttgc ctatcagtat    319860
     cgcattgcag aaaacagccc acacaaaatc cacgctgatc tgggtttttc tcgttgtggt    319920
     gtatcgagaa tcggtactga agcaccacgt tatgatgcgc cgacgagatc ctatacatct    319980
     tcacctgtta caagtgagcg aggtgctgcg gtactacctg ctcgctatgg ggcatttatt    320040
     gctgagcgtc gtgcaccaac cagtgatgat gcggtttttc gtgcttcgtc atctgataat    320100
     cagcaaatat tcttgttccc agtacataag ctatttgctg gcgatgaatg tttacttgat    320160
     gagcttggtg ctcccatgac ggttggtacg attaatttta gtgagtacca tattaacgag    320220
     aagttgcgtc gcttacacac agattctcca gataatcctg gttttatcga gcctttagat    320280
     attttcgata ttgatgcttt tccgtttgtt cgtgattcga acaatgatcc tgagctggct    320340
     tctttagaat atgtcggtga ttcagtgtta gttgtgtctc atcaccatga tcaactgacg    320400
     cgcacagcaa ctcagaaggt agacggggca gagcagttag ctcgctttca agtcccatcg    320460
     ggaacaagca atcgtttttt cagctcctta tccttgcctg ccccttcagg tagagctgca    320520
     ccggaatacg ctaatattcg ccataaattt gtgagcaatg atactacaga agatttaaat    320580
     cagacgttat cagcagatga gtttcgggag caggtgatcg aaaaaggcgg atatgaagca    320640
     gtgcatttta ttgatgattc ctgcgatggc gttattgctg ttgaggtatc tggcttgagt    320700
     gacttgccaa catcttgcgc ttattctttg gtcacggctg tcgacttttt cccattgatt    320760
     agacaactag atattcaacg ttgggtagag caactatata acgctgacat tggtttaagt    320820
     ttgtctgata tttcaagaaa taatcgactg catttcaacc aagggggccc taggccattg    320880
     agtgatggac gttttgaacg ttcattatca ggtgaggcta gtttaattca taggtcaccg    320940
     aatatgtcgc tgaaaaatcc actcacacaa gcttcagcat ttccacgcag tgatcatgct    321000
     aatttcactg tcacaagcat cattggcaga gctgctcagg gggatgcttt tgaccccggc    321060
     gaaagtccct ctcgggtgct tagctggtta ccagacgcgg cagccgatgt gtttgctcct    321120
     ggctgggata tttcaacgca tatcgtgaat ggtttgggga cctatgcttc ttatggtttg    321180
     ggcagtccat ttctggaaga tgcaaaactc tgtgctgctc taaattcata ctggccagct    321240
     gcggcaccag attcttctcg taccttcaac atctccgggt cacccacagc gcagccattg    321300
     cttgatagcg agttgggtta tcatccgaat catccgcgag ttaagcttaa tgaagttatc    321360
     agtaatcgag gttgggatgg ggaatacgga ccgttcatcg aaagagaagg cggacaagaa    321420
     tttgttaatt ctgcccatcg caatcgttct gactatgtga gtaacgcgct tgctggcaca    321480
     attgggttca atggtctgaa tcaggttgat gcgggagaaa tgatccagcg catggacgtg    321540
     ttgagattat gctttagcgc tttgtcaaga caaacggtgc ctaacaatga cctatggtta    321600
     gttaatgctg agaaagttga tgactggaat caatggaata gtgaggagtt gccgaaagct    321660
     gattcggttc tttcaggtgc aggttatatc taccgatttg tgattgttga taatagctct    321720
     gtagaagatg ttgcgacaaa tcccgtcaca cgtgaacgct atagcttgca agagatttat    321780
     gagtttcaag tgagtgctaa aaagctattt ttaaagactg ctggtcattg gaaccctccg    321840
     attgacattg atatagtaat tgaatgattg aagatattga tatcactact gatatttttt    321900
     gtggaattgc tatttacctt taaaaagcaa gtttatgggg ttccatctac ctcatgaact    321960
     tgcctaacca cttatcatcg tttaatcgtt cgaaatagag acgattatat ttaagtcaaa    322020
     ttagttgtta ctttattttc atttgtggta ttttgctaac gaacttatgg atcacctagt    322080
     aaattgcaga tggtttacta gtgtcatcac cgacgaaaat gttagccttc accatcagcc    322140
     atctttcatg aatcagatca cgtgcagcat tgttttcatc atcactccag taaggtttta    322200
     agtagggtac tgattcctac tctacttccc ataaacagtt attaaatatt tcccagaata    322260
     caatgtcctc ctttcctatg aggtgaaaca aagcaactct tttgaatatt tttcaaatga    322320
     acctatcacc tttttactct acttttcttt aaaccactag tatttattca atataactaa    322380
     gattcaccta aaaatattca atgacagtat ttgaagaaaa atggctctct gggaattagc    322440
     gtgtagcagt cctacattta gtgtgtttcc tttttcatcc ctatggaatg atctgaggta    322500
     gtacttcaga gcaatggcgt aatggataac tcaattcgca tcccgctcaa ccttcctgat    322560
     attcgagttc tagagctatc gaagactgag agaggggatt ggctcatcaa gattgagagt    322620
     acgcttcaag gaacaacctg tcatcaatgc ggacgtgaga ttactgacct ccattgtcat    322680
     gatcagcctt ttcggattcg tcacctgcca ttatttgaag tccccgttta cttagaaatt    322740
     cggcccaagc gttatcgatg caagtattgc gatgaccatc ccacaacaac tcaacattta    322800
     gaatggcacg aacctcgcag tcccaataca aaagcatatg agcgttggct tctgcgaatc    322860
     ttgatcaatt caacggtctc agatgttgcc agaaaactag gcgttagtga ggatatcgtc    322920
     agtggaatca ttgatcgttg gattgccgct caagttgact ggagcgaata tgcagacctc    322980
     aaagttatgg ggatggatga gatttctctc aaacgaggcc atcgtgattt tgtggttttg    323040
     atcacgattc ctacgacgga tggggtggat atattggcag ttctagccga ccgtaaacag    323100
     cagacagtgg caaatttcct tcaatcgatt cccattgatt tacgccaaac cattgagcgc    323160
     gtctgtacgg acatgtacca aggatttgtc agtgcagtcc gagaacaatt gccgcaagcc    323220
     aaaattgtca ttgaccgctt tcatgtgacc aaagcctatc gtaattgtgc tgatacggtt    323280
     cgtaaacgtg aggtcaaacg tctacgacga gagctctcta agcaagagta tgacagcatc    323340
     aaaggcgcga tgtggccttt tagaaaacga ccagagaatc tgaaagagtc agagcaacaa    323400
     ctccttgagc gattgtttgc ttattctcca caactgaaac aggcgtacaa cctccgagag    323460
     aaactcacgc agatatttga gggcaggtac accaagcacg gagctaaatg tgccatccgt    323520
     gcttggtgta aacaagtact caagagtgac atcaaggaat tcgattgttt tctgaccact    323580
     atcaataatt ggatggacga gatgaccaac tatttcctgg aggggtggac cagtggtttt    323640
     gtggaaggat ttaataaccg agtcaaagtc ttaaaaagac gatgctacgg tattttcgat    323700
     attgaaagac tcttccaaag gatttctctt gacctcaatg ggtatcagac attcgctgtg    323760
     acctaaacac tatatctagc ggctaccacg ctaattcccg gagagccaga aaaatttcat    323820
     tgaatatttt tttcaagatt taggttctca caaggttgct taaagctgaa attatttaaa    323880
     gttcctaaga aattaagcaa ccccagcaat aaccccaggc tatgagtgcg ccttggaaat    323940
     agagggcacg tccgatgtgt tgcgggtgat tgagctgcgt cctggggaca cgatggagcg    324000
     gattgaggag atggtggggg tgtaacaaga tcaggccgaa gtttaaaaat caatttgttg    324060
     atgagccaag atccctagcg aaattatttc ttaagtgcac tgagtaatat tcaggcgcat    324120
     gatcaattag actgaattta atatcattaa aattttttga aatgatactt gctgttgact    324180
     caaaaatatt ctgggaagaa ttaatcaaaa tatcattata atctactttt ttactcgggt    324240
     aagtagaaat attggtattc ttatcaatat gttttaattc tcctacatgt tgatataact    324300
     ctggaagttg aaaagaagat aaaggggaat taaaccgagg gaaaggaata ttcggaaatg    324360
     gtgtttcgac aagttctact gatataatta aatcagatag aggaaacttt gtaattgcat    324420
     cattattatt aacaaatctg aatatctttc cttctagttt tttgtcaata ctatcaacaa    324480
     attctgagtt tcctactttt gggcaaccat aagtgtagat tccttgtgct ttaccgaatc    324540
     tgctagcggc aagaatagca agagcacctc ctagactatg tccagtgaac cataagtaca    324600
     tttcttggtt tgtatcaatg agctcttgga gatatccttt taagtttgga cctttctccc    324660
     aaatctcatc cagagcagct ttaaaaccct catgagtttt acctattatg gaagaatcaa    324720
     ccagctttaa tcgagcatcg atgaggacat cttggacaaa atttgatctc tttatctcag    324780
     taccacgaaa agagataata gagaacttgt cattactagc tacatagcat tgagtgctac    324840
     tacctgagaa gagtttagcc ttattaagac caatcttttt gaaatgttgc tcacacacag    324900
     gttcattttc tatatatgct aaaaaagcgc tatctgctaa acgccaagca ttaactaatt    324960
     gatattcatt gctatcatac ttaaaatggt gagtatcacc ttcttcaaaa taattgtatt    325020
     catgattagg tggaattaat ctattgagat tttgaataga acctgaaggt ggttgtacta    325080
     tttccatagc tgaatattga agtttaaagc ttattaataa attgaattaa tgcttttttt    325140
     tgaaaagatg atttaacttt aacatctctg taagtaataa aaggattttg gaagtacttt    325200
     ttacatctgt tcataacaat catattacca gttagaaaag ctgattaatt aaaacaaaga    325260
     cttattcgta aatttatgga aagaaatgaa taaaatatta gctatgttga tgctatttaa    325320
     ttatcttgac tatttttcag ctttatactt tccttttaga agtttttgat atctagttta    325380
     atctgacatt taagtgtaaa tattaaaatt tttatatgtt tgcgtaaaat cttttaagtt    325440
     accagataac ttacaggcta tgtgagactt tttttgaggg attcaataaa ccttacaaat    325500
     cagataaaag ctattgggtg ttgaacattc agatgttgct caaagtcttt gtaacctggc    325560
     aaaatactgc ataagttaag gtcagtatgt ggcccaatta aaaggtagct gataccaggt    325620
     gcaatcaagc acttttaggg gcctgaaacg acgtaaaaac gttcagatta gaaatcactc    325680
     aattactgaa agttaaagga tgtcgagaaa tataaagtct tgaaatcctt gatctatata    325740
     gctttcagtc tttattgcac ctggagtcat cgacccctca attgggccaa gacgtggttc    325800
     tttcttattc ctctaaggaa actattttgc cagtatgtca ttcaatgctg aaatcgcagg    325860
     cgcaaacaaa tactctccac cagtcggcac aacaaaatct tgttgggttt taatttcagt    325920
     cgtctggtgt tcaccgggga actcgatatg ccgttctcta ttccctgtcg atccgttctg    325980
     gcctatgacc atgtcgtgcc caccttgatt tggctgaatt gctgagttcg cccaacgtcg    326040
     ttgtaaaaac tcaaactgat cttcaatact tgagttataa caaacaaaca ttaaacctct    326100
     gtctagcagt aagtcctcat cgcttaaatc tggattgcca gcgatcgctg gtccataagg    326160
     tatgccgcgg cgcaagatca ttctagctaa gttatcttct ggctttccta aatcggtaac    326220
     actttctctc ggattgactt ttctaatgtg cgcgaaatga gggcaaactt tggcgagaaa    326280
     atcagctttc gcctgtggaa acgagtctcc tggataatgg ctatcactga actcaatttc    326340
     gcttgtgttg tcgtcaaata gaaaatgatt gtttgcaaac gcgtttttac caagctcagg    326400
     caattcactg ttagggcttc gcatcaatgg agcaccacta ggccagcgac caaccaaacg    326460
     agaggcaaac tctattacgt caatgtttaa tgattccgca gtgctactaa caaaccccca    326520
     aaacgcggac acatcttgat gtaagcgtct tactaccacg taagagccaa gctttgccca    326580
     gccgggaata tttgtctgga ttcgcccttt aagatataag tgttcagtgc tttgacgtgg    326640
     ctctcctaaa agaaactgac ctggccaaac caataactgc cctggcttgg caaaataatc    326700
     tttgcgttcg tcggtaccag ccacataacg tggggtgata aaatcgccag ggcgttcaga    326760
     cagttttccc cgtattcccg gctgcgaaat gccatcttta aagccaaaat gttcgtggcc    326820
     tctaaacttg cctggtaacc gctcccctgg ttgttcatat tgcaactcga tgccctgatc    326880
     ttgcgcatgt tgttttatca atgccacaaa ttcttgcaac tgatctttgg agttcgcagc    326940
     ggtcgtgatc atcatgtcga tctcattatt ggtaccacca aaacgccaat tcgattgatg    327000
     gccaggacta gattcatcgc taggatcacc taagaaagtt gaccttttgg ccattcccaa    327060
     acgaaaactg tcatcaccaa atttattggc ttcttcatcc gaggttagtt ttgctatgcc    327120
     cgtgtatgaa aatgacaaat tcaaccaagc tgacgacaaa taagtttccc tttgacccag    327180
     ttgagctcgg cgttgccgat gtatttttcg aaactttaaa acttcataag cgctggatat    327240
     agatacatag ggggaaatta aacgcaagaa ttgtttagga gagctgccaa ctccaaaact    327300
     taaaaacaaa aagtgctcat aattggtatt aaacccgagc agtaagtttc cttgtatatc    327360
     tgacagtgtg gcttcgttgt aaataggttc gtcagccgat tgatcgtatg gactgggctc    327420
     aggtttatgc tctagcggtg tatcgtcaat atttgcttca atagttgaaa ataagtcttt    327480
     tagttccgtg aaattagcgt tgtccatctt tttaattctc ctgccctttt tgggtacctg    327540
     ctgagcccac tatgccgacc gtaatgtgct cggctagctg tgcgccatac tgaatttcat    327600
     ggccgccaat ggtcaagtca cttacttgaa aacctaaagc tttaggaacg gaatactcca    327660
     aacgcataac cttgccattg gaacctctct tgggttgcca ccactcaata ggggcaggtg    327720
     agccgtccgg ctgagcgatt ccactgttgt cccaaccaaa aatataaatg ccaataggtt    327780
     cttgaaggct gacgtataat tttttgcgca atagcatgtg gacgtcgtaa tcgactcttg    327840
     gatcgaccga tgtcgtatat gttgcaaaag ctgggttagc ctgatagttg ttggcagcat    327900
     caagcgggaa catgctcatt tcttctgcca ggccaatagc agcgccgaga gtattaatgt    327960
     cttgagtgaa atgcattatg ccgtcagttg tgttccagcg atttagaata tcatagtcgc    328020
     catttccatt cattaggtca tcttttttaa ctggtttatc tagggtgtct ttataaattt    328080
     caacgacttt atcaggatcg aatttccaca tctcttcata gtagttgtgc agctcagtgg    328140
     taaaagtaat ccttgtaatg gcgtcatcgt ctttatggac ataccattca aaatattcgt    328200
     cttgctcatg ccctctatct tttcggttcg cattgtctgc agttctatat gcttcccatt    328260
     tgttgtctcg taagtttggc aataagaccc ttcttggaaa tcccatccag ctaatggttt    328320
     tttctccaat gatatcgaca tccacctcag ctggattata aaaatgcccc ccattggggc    328380
     ctggagtctc ttctgcgata aggcctttta caaattcatg ccatttttca tagaaatcac    328440
     tatcgtcatc aaaatcttta atagacgcag gtgtgtcaaa ttgagtaatc agagacattt    328500
     cactctcctt agctgatgga aatgaagaat ggtattattt ggacgccact aaacatatta    328560
     tccaaagtaa atacacatac attgtcaaga tagacaatca ataaatgttt gtgaaatata    328620
     tgttattaag cgaaaacatt ccctttataa atttgactgg tttgtagctc tgatactttc    328680
     aaatctaaat cgttaaccaa gcttggaata gaattaagag ctccatggca tctgtctaga    328740
     cacgagtgat ccgtagcggc ctattctcat ctacaggtcc tactttaatc aatctttctt    328800
     gccccgtagt tacaaaagga tgatcctgat caaaaaataa acgtggtcct cgatcagaat    328860
     ttggaaaatc ttgcaatatg ttgcttaaag gccttagcca aagctctttc tagctatgga    328920
     ataaaaccca agtgagttgt gaattaggtg gataattttc aatcggcatt atgctcccgc    328980
     aagcaccccc cagatcagca ggttcctagg agttgagcaa tgcttcacct agagattcga    329040
     gctgatccct ttactcgata atagctatct ctatcttcac ccagctgaaa tcacctgcta    329100
     agacttagtt ttcaactgcc cccaatgcca atagtgtgtg tttttgagct ggggataaac    329160
     ctttcatctg agtaatgttc atgcctgcat agggcttagt gggtcttagt gttcttatac    329220
     actcaccagt ttgaacatgc caaagtttta tagttccgtc aaaactgcta ctaataagac    329280
     gctgaccatc agaactaaag gctactgagg tgacaccatt tgtatgcccc tctaagattg    329340
     ccaaatgctt atgtgtttca acatcccaac atctaatcgt atggtctaaa cttgcagtgg    329400
     caagtagttg accatttgga ctaaaggcaa catcccaaat ttgacctgaa tgtccttcaa    329460
     aaatacatat acaatcgtta gtcttaaagt cccaaagtct agctgtttga tcaacactcc    329520
     cactagcgat aaagtgctca tttgggctaa atgagacgga actcaccccc gatgaatgcc    329580
     ctttcagagt gtttaaacac ctaccttctt ggatatccca aagcttaaca gtgcgatcaa    329640
     aacttccact cgctagtatt tcagcattcg gactaaatga gacagaccag acccaatggc    329700
     catgtccctg aaatgtctcc aaacattcgc cgctatggat atcccaaagt ttggcagatt    329760
     gatctaaccc actactagca aggaattttc ctttcgggtg aaatgccagt gaccaaattc    329820
     cattagaatg cccttttaag atcttgatgc actgcccatt agaaatattc caaagtctta    329880
     tggttcgatc acctgttcca cccccactag caatgatttg gtcatgaggg caataagcga    329940
     cggatctgat agcatctgta tgccctggaa agtctaagca attgtggtct gaaagtgacc    330000
     agacccttag gacttgggca tcaccaccac taacaagaat ctgttcatgt tgcttctctg    330060
     tttcggaata gttaaatgaa ccgaagggag tagttgcaaa aatggcttca aatatggtga    330120
     aagtacatcc cgataatgtt ctcaagcatc tgcctttatt gtaatcccat agcctaatgg    330180
     aaccatcttg gctactacta gccataattt tttgagtagg atttatggcc acagaccaaa    330240
     cccaatttgt atgccccaat aaagttttta aacattttcc agttctaatg tcccaaattt    330300
     ttatcagttg atctgcgcta ccactagcaa ggtaatgacc agaggaacat aatgcaatcg    330360
     agcgtataga atttgagtgt ccaaacaact tctgtataca ttcaccactc tgtagattcc    330420
     ataccctgat aattggatca tcgcaggcac tcacgagcat ttgtccatca ggactgtacg    330480
     cgattgacca gacccatcca gcatgaccag ccaatacttt caggcattgg ccgctcttaa    330540
     cctcccaaat ccgaatggtt tggtcagcat atccacacgc tagttcatga ttatcaggac    330600
     taaaggcaat tgatcgggct gctgcccggt atctgaagct cttcaaaaat tgccctgttt    330660
     gactattcca cagcctaaca gtgaagtcat cactacaact tgcaaggagt gtaccgtcgg    330720
     gactgaatgc tacttcccag atgaaattag tatgtcccga taaaagtttt aaacattctc    330780
     cagtacgtac gttccaaagc ctaacagtct ggtctgggcc agcactggcc agcagatgat    330840
     tggtcggact gaaggccaaa gatttgaccc agtttgtatg tccgctacaa gttaagaggg    330900
     gttgcccatc aggaactcga agaagacgaa tctcgccttt aaaatctcca gcggcaatga    330960
     gcttgccatc tggggagaaa gcaatcgata ggatacctcc aaaatccttg gaaaagactg    331020
     actgagatag atctgagtga gtgaacttaa ccccatgcaa gttgagtcct cgtagatcag    331080
     cttgccgaat tgtgaggtga gaaaagtcgt aaccacagaa atctacaggt aactgtcgga    331140
     gcaaattcag aacatttcct gcgacataac ctgcttcttc cgacgatttt ccccgcacca    331200
     ctgaaaggag ttgaaccaag caggcttcaa ggtgtgctct actgcctagg acctttacca    331260
     ggctaacaat taagggttgc aagatcaggc gaatctgagt gtctttgata tagtctttcg    331320
     cctgtgcctt tatgagtgca tgagtacgga acagatgcaa ttgattttcc tgtctttcct    331380
     catactgttg ttgctcctga atctcggtac aaatttgctg aatgaatttg tgggctgtga    331440
     actccatcac cacaggttgt tgggtgaatc cagtctcagt ttggtcaacc aaagatcgac    331500
     gttgcagcga ggttatcgac tgcaacaggt cacctgggag aacttgaacc atcaaatcga    331560
     gggccaattg ctctaactgg gcaggctcgc gattaatggt gagccaatac attacagcct    331620
     gttctatctc tgatagcctt tcaaactgct tgttgaggag gtcgtagata tcctcaagaa    331680
     cgaatggctc catctgtgag aagctgagga aacgagaaag acttccttca aagcattctt    331740
     taatggttga tgacacaatt tttagagcta agggattacc cgcatagtgc ttgtttatag    331800
     cggaccactc tttttccgtt cctgtgaata tgcccttagt tttaaccaag gtctgacaag    331860
     cattagttga taaccctttc aactgcaagc atcgaactgg cagggagtct ccctccatcg    331920
     ctgcaattcc ttgtggtttt tcccgagcgg tcaccaaaac acaactgctg tgggtagctt    331980
     ctccaaacat ttcaaagagc ttggcatagt cttcacaacc ggatctatag cgacctgtgc    332040
     gatcaccact ttgcaataag gactctgcgt tatctaaaat cactagacaa cgtgaggtgc    332100
     gcagataact cagaagtagc gaaatttgag attctattcc cttgggtaaa tagttttctt    332160
     gttgattcga gagaaactgg atgaggtcag acaagatttc tgtaataggt ggggcactcg    332220
     caagactgcg ccaaattaca aaatcgaagt cgtattggac tttttgagca agttgtatgg    332280
     ttagcgctgt tttacccata cctcccattc cgagtaccac tatgaaacgg cagtgttcat    332340
     cgaccaacca ctggctcaaa agggtcagct cagttttgcg tccatagaac caggagacat    332400
     caatagcact cccccagtct cgatttcttg tatctaattg gagatctgga ttagctagga    332460
     acgaattgac tggtaacgca ctcgatttct ggtctgtggc ctgtttagac ttgaatggcc    332520
     gacgttgctc ccattcctca tcaaattgtt ttaaattggc aactttattg tgtcgcttat    332580
     accaaaagtt gagcgtaaaa tgccatttat tagagccttt aggttgagaa cgattgtctg    332640
     tgagaatatc tacaaactgt tctaggagtt tgagtgatat cttgatttgg tctttactta    332700
     gctctctatt agatggatat tttttactta gctcagctaa atctttaata gtagtttcta    332760
     cgactaactg ttggtctgtt tgccaattta ccagtatttg agaacggagt cgatcttgta    332820
     tttcgaattc atcattggca taggccagta taacctctag aagaaatttg gtcctttttc    332880
     ttggggtagg gccatagctt actcttgcca taattggacc tcaagcaaat ctatgtattt    332940
     tttttcttac ctcaagtatt tatcagtgat ttgcacggta tttacgcaag gagttctagc    333000
     atcctaaata aaaaaatagt tagggtatcc cttaactttg atacctaccc ttaactttca    333060
     aaggcttgat ttataaagga tttaaggtag aaagtttact tcttgcttgg tgtcagtttt    333120
     ctcgcctagt ttgaaagcat gaaacctcaa agaactaact gcatatcaat cagtaggaag    333180
     ttaaagatat tctaatatat ctgaacagca aagtataaaa tgcgaactca ttaaattgat    333240
     aacccatgag cattttatga gtaaaatgct caaaagctat ttcaattctt ttaagtattt    333300
     tattctgaaa tatatgcaaa tactagcttc aatgagaaaa gaaaaaatgg agaaatataa    333360
     tgccgatact tagtgatttc acgactatcg ttggcaatca aagaatactt attggtgata    333420
     attccaatag tagtggtttc acatcaaact ttaggactgc agagagaaga agcgatcgaa    333480
     atgcattcat ctctttcatg gtaagaggta tgactcaaac agacgaaaat gctgaagtct    333540
     ttgttaatga tatacgaatt ggaagtctag agaataacaa tggaggtaat ataaatctat    333600
     ggcatacaca gtcaataaca ctctctgggg atcgcttaaa tgacggagaa aataccttaa    333660
     gagtagacac tgtaccaata gctcctggca cccaaggagt tggaaatttt gatgattttt    333720
     ttataacgaa tgtgatttgt cattttcatc aagattccta gaaataagct tgttagttcg    333780
     gattttgtga gaagtttgct aaactctttt cttcataaat attctgaaac aggtagagtc    333840
     tatgatgctc ccactcttga tcatcattga acttcctagt taaggatgta aagctattta    333900
     ccttcttgta actaatgagg taaatcatta gaaactaatc gccaaaggaa ttatattccg    333960
     agattatctg gacagactta tagcttaata ctctagaact cttttcttct tgatttacta    334020
     attgttatga attttatgta ttttaagagg attgatggca caactttttg cgcaatatta    334080
     gcagctaatt ctagcacaat attagcaacc aactagagcg cagagtgaga tacactttgc    334140
     ttttctaatg ttctacaggg taggaataat agactaagtt gagaaaacta tgtattcttg    334200
     gcactttggc tgtcattatg cgcagacaaa taattaacta ttaggagaca atcatgacta    334260
     agactaaatc tatttcggat gcacatcagc gcgtttttaa acttgatgtg gaagaagtaa    334320
     tgaagatcgt aaaacgtggt aaacccttga cagccgatga actcgaaaag tacggacctg    334380
     atgaattcta tttagccgat caggtacctg aagagcctgc tttgcatagg aatattccgt    334440
     tacccgctga agtaggtgac cgtattttcc caaatgtggt cttagtaagt ccattcttct    334500
     gctggtgttc aagctataca tggtgtctcg aaattgatga atttgggcga ttacgttatg    334560
     tgttgaagtg caattactgg tgcattccgc agttccaagt ttcggcatag aattttgggg    334620
     ctacatgatt aagcggaaat attattattc ctttatgatt ttgatgtagt cctgaaaatc    334680
     atttcctaaa ctttagaccc tgaaaaaatc gattgatagc tatggattat ttgccttcct    334740
     gttgctctat tagatactgg tctcttaaga ggatctagat taccgtaacc cttgcgcaat    334800
     aaacatttga atcttctctc gttatttact tttaatccca cataactaaa tgattttgac    334860
     cgctctagat cctggtaata gaccagtgcc taatgggtaa ctctttctgc tgacacccca    334920
     gatacagaaa cttcaaaatg tagttgaata tcttgaacag aaagagctta agctgaggcc    334980
     ctctagttcc gatgtgtaga tgtggcaagg caaatgtttc aaactgctct agggtcaagc    335040
     aggttggaat ccattgattg gaatgggttt gggtatctgc cctctaaacg aacgtcaaac    335100
     taaaagactg aactcatttt agttaatatc tcaaattaaa aaagttagag gaacctctat    335160
     ctttgaaacc tacccctaac tttcaacatc ttaatttaaa agggttctaa ggtaaggaaa    335220
     ctacttcttg cgtagtgata gtttccttaa ctaccttgaa agtatgaagt cttaaagagc    335280
     taacttcata taaacccagt aacagcataa atttattcag atatatctga ataaaatagc    335340
     agtggcaatg caaactctat ccaatttcag ccttgtttga gagtgtaatg tttcgattac    335400
     agctttgagg ttatctgtta tgaccagtgc cattaacact aaacctattt taatagcagg    335460
     tctatctgat ctttgggtag aaactattgg agatcctcag attagtattg ctattttaga    335520
     tggtttcgta gatcaatctc accctagtct tgctgaagct aaacttacaa atttagaaac    335580
     tattgcctta aaggcttccc agcaaggttc agcagctcaa catggtaccc aaattgcaag    335640
     tattatcttt ggtcagcatc aaagtttact caagggtatt gctccccaat gtcgaggttt    335700
     ggtgattcct atctttgctg acgggaatca gcaggcaata gataacaata agttctcaga    335760
     gaccattgcc ccttgctccc aactagatct tgccagagct attcttttag cggcaaatca    335820
     aggtgcccat attattaaca tcagtggtgg acagctcacg cctagtggag cggcagatcc    335880
     gattctcact aatgctgttc gctattgtat ggagaacaac atcctgattg tggcagcagc    335940
     aggaaatgaa ggatgcaact gtctgcatgt acctggcgct ctaccatctg ttctggtagt    336000
     aggtgcaatg agtgctacag gaaccccctt aaattttagc aattggggtg aagcttaccg    336060
     gactcaagga gtcttggcat tgggtgaaaa tatccccgga gctgttcttg gtggaggaat    336120
     tacatccagt agtggaacta gctatgccac agcgatcgtt tctggcatag cagcattact    336180
     gctgagcctg caagtcaaac gagggcagac tcccaatcct caagcaattc gaaccgctat    336240
     tttgcagagc gcacttccct gcgatgatcg gcctgctcta gaatgtcgcc gttttttagc    336300
     aggccgcctc aatgtaaaag aagcgctgtc catcatttta caaaaaggag aaactatgag    336360
     tgaaaatata gacgtagaaa cggtacaacc tgactctaat ggagctgtgc aggcagcgct    336420
     gtcatcaaat caatcccaga ttccggctgt tcaggcagcg acgtataatc ctccccctac    336480
     tgaggtaatg cctcatcccg cacaagcgca aataagttta ttaactcagg taagtccaag    336540
     tgccatttct ccatctgcat gtagttgtgg agagggaggt aaaacatcat cacaagcacc    336600
     tagtcaagca cagctagttt atgctctggg acagctaggg tatgactttg gtacggaagc    336660
     acgccaagat tcgattcagg aacacatggg cgaaggagct aatcctcacg atcctcgaca    336720
     atttttacca tacctagatg aaaatccttg ggatgcagct atggtcgtct ggacgcttag    336780
     tttagatgcc acaccaatct acgcaattca accttttgga gcttatgccg aacaaggata    336840
     tgagcgattg cgacagtttc ttaaggagca attagaagag ggtgttgaac gtatttcggc    336900
     tcctggtgtc atcgtaggac aagtaacgtt gatgtctggt caaactgtgc ctgtgattct    336960
     gccaacactt cgctgcatgt atagctggac gacatcagca ttgattaaaa cagtttgtgg    337020
     tgagtctcct gatgagtctg ccgttcaagg ggtaaccaac ttcttggaaa gagtttatta    337080
     cgagctgaga aatctaggaa taatgcctca agaaagagcg atcaattatg cagcaacaaa    337140
     tgctttaaat atcgagcgca tttttgaggc agccattcta gaagagatgg atctcgattc    337200
     aattgaagtg gaaccgagtc ccctctgtcg tcaggactct gagtgctggg atgtgaaact    337260
     gacgtttttc aatcccaggc gagtgttcga acaagctaga aaagtttatc gcttcacagt    337320
     tgatgtgagt gatatgtgtc cggtgagtgt ggggagagtg agatcgtggt ttgtgaggta    337380
     actaacttca ctgctgtaat ggtttcttga atcaagatta ctcaatttat agttttagga    337440
     gaataacaag atgagaattc caaaccagtc tattggtcag atacgttcta accctgcaat    337500
     agagaaaacc gctgtctcag gaggtgtaca gccttctggc cccggtttgg gaaggctttg    337560
     taacgaaatt tgccgttctc caggaggagg aggggtttgt cctttgtgtg aatttctctc    337620
     actcgtacct ggtttctaag gtaaaacttg atcaacggtg atgttttggg tgagaggatt    337680
     cacccaaaac attctcgcaa ctgatttcgg atttttatat ggttaacctg aaatattggc    337740
     tgttaatgaa aaaacccgaa tcacaacaca tcactttctt cctctaaaac ctcaaaccgt    337800
     cttgtttgaa ttccattaaa agaggatgca ctacctacaa ctcgctatcg actgaacagc    337860
     cttatagaaa gggatataaa ctctttcagc aagcccatgc catgaatatt ttgattagac    337920
     gatatcttat taccgaaagg aaaataccat gagcaacgaa ctttttatca aaggtcctca    337980
     cgtcccgatt gaggaacgtg cgctggaacg attaaagcgt gcagtggaac tgggtgaact    338040
     tgaaaaacta ccgaatactc cgggtattcc caacgtgccg cgctacctgg tcacgtatat    338100
     gaactcacaa actgtgaata ctcagatgcg ctcagccacg gtcgtatccg tgaccaacca    338160
     gagtaattta atcaatcgag tatttgttac attctttaag ggtttcacgg acgactcatc    338220
     accgatcgga actgcagcgt ttgctatccc accacagttc acggtagatt ttgcatcacg    338280
     aagcctaccc agtgaattga cggttacaaa tgctgttcca aatccagaat taactttcga    338340
     cgagggtcgt gcaattgtat cgtcgatgtg gccggaaatt ggcgtgagcg cacgtgtcta    338400
     ctacacggct ggtgacaatg atgagcgcct acatgccatc accgactcaa aagtagtcat    338460
     ttatagtaga agcaatagcg gagactgact acagggtcta aggataacga aggcaccaaa    338520
     aacggcaagg cagcaatttt gagttgttca atctagtaga ggtagattcc ctgctgcttc    338580
     cagtgaaaaa atgggattac aatccaagtc tacggtttgg gagcaaatcg tattccatac    338640
     cccgtctgct tgcagcgggg cagttgattg acttttcctt agtagaggat atctgcatga    338700
     cccccaactc gtctcactga agcccaaacc accagccgcc ccccgctgaa accctcgacg    338760
     aacaccagca caaccatcac atacccggat aaggtatcat ttccgaccat cgctcgaaac    338820
     gatgatctgc cagtgaagcg caaggtagct ccagagcctg gagacgatga tcgcaacccc    338880
     gaacctaccc tcagatacag ccgcagagaa tccaccgaca cccagagaac acagcgaggg    338940
     tattcagctc ggcatacaac tagtagaacc cgacccccca gagtctccag agcatttgag    339000
     tccaagttca atgcccttga gcgcagacag aagaatttgg ttcagcagac caagcaaaag    339060
     ggtcagcttg agtatctgac cgtttccaaa agcagctcag ggaattattg gatcaccatc    339120
     gaaggtagtg gtaagccatt catcaaaatt tcgtttgaaa cgcccgagtt ttgcttcgag    339180
     tgcgctttgg agctagagaa tacgttcgac gtgttgcagg ttttaagact gcggccaggg    339240
     gaaactatcg agcggatcga ggaaatgatc ggggtgtggt tggagcggga gagggggagt    339300
     agggcttggg gatgataggt tgtgggcacc cagcttgttt tcctgtttta atagtcgctt    339360
     ggggagaata gcggttttag tgtaatttgt gtaatcaaga ttttggtcac acattctgca    339420
     atcatatcaa ctcagatttt gacctttaaa gtagatgcat ggttggcatg tgtgacattt    339480
     ttatcgaatc acggatgtgt tccattactg ggatagaatt attgtcaaga gactaacaac    339540
     atctcgctta gaaatttccg ggggaaatga tatgtggtca catttagatc gttctttggg    339600
     attatttagc ttaatcgctg cactgacctt agttattgta gagccattaa ccagtgggga    339660
     ttggcagtct aaaccaaagt ctaactctgc ctcggataaa atcattctaa gtcaaaaacc    339720
     tgctagctct ttatcagagc atcttctgag ataacgaatc agggaagcct aaataattta    339780
     cagctattgc cagaaacata gtaggcagtg gaaagccgct catcagaatt ccgtttgaaa    339840
     gtcctgaatt ctactttgag tgtgcgttgg aattggagga tactttcgat gtgttgcagg    339900
     taattgagct gcggccaggg gaaactattg agcggattga ggagatgatc ggggtgtggt    339960
     tggatcggga gcgggtgagt agggtttggg ggtgagggtg atgctttaag ctttatcctt    340020
     ctgcttgtcg agaggccctc caagagacac gtttattcca agtaagccga gcattccaat    340080
     gatgatcata acgatgccta catacattaa ggggattccg ctaagggtcc aattttctcc    340140
     aataatgatg gtgatcaaac caccgataat cgaccaaaaa caagcgaagg tgcggccttt    340200
     ttgacgatgc cggactattt cggcttgatc aggaggaaga cccgtttggg gtgaacgtcc    340260
     gtctatagtg agatagttgt gaattcagaa tccatgtaag ccgtgggttg gaaaaccagg    340320
     acaatttgaa caaaacattg acctgtcaac cgattcccca acccacagga gaagttctat    340380
     gaaaattcta ggcattgact taggcaaata caacaccgcc gcttgcttat ttaatactca    340440
     gactcacgac actctctttt tcacctttaa atcctttgcg cgtgaattca aagccttgct    340500
     ctaccaaact cagccagagc aggtcgtcat tgaagcttgc acgattaccg gttgggttta    340560
     cgacctgtgc cgagcagaag gctttgatac tattgtggct aaccctactc aagaagcttg    340620
     gtattggaag aacgtcaaac gcaaaacaga taaagatgat gcactcaaat tgaccaagtt    340680
     agctgcactt ggtcagcttt ccccggtcta cgttccacct gctgagtctc gtcaatatcg    340740
     gcaacttgtg aaatatcgta aacggttggt cggccagact aataaaactc aaaatacaat    340800
     tcgtgcatta tttaaccaac aaggaatctc catacctaca gggtcaagag cttggacagt    340860
     ttctgggatt gagcaactcc agcggtatgc caaaacgttg tctgattgct cgctattgtc    340920
     tttatggcag ggacaaattg atttagagct aaatcgatta gatgcactat gggaacaact    340980
     acatttagtc gataccaaac ttaccgagat tgccaaacaa gatgccaggg ttcagttgct    341040
     cgaatcaatt ccaggggtag ggcgtaaaac cgcagaagta gtggtggctt acattgatga    341100
     tcctaagcga ttcaaaaacg caagacaggt aggtgcttat gctggattgg tgccgcgtca    341160
     acatcagtct ggcgatatga atcgaatggg caagatcact cggcgtggcc ctcgactttt    341220
     acgatctgct ttagtcgagg cttcttgggt gatgttacgc tacaactcct gggctgcgga    341280
     cttgtatcaa agactttgtg gtggtcagaa aactagaagg aagcaagcta ttgttgctgt    341340
     cgctcgtaag ttattagtgc tttgttggac attgctaaga aagcaagagc catgggacct    341400
     tgataagata agtcccctag cagcatagac atttttcctt ttgcataata ggtttacgga    341460
     tttctatatt cccttgattg ggaaatctac ctcagagctt ggagaccttt cctagtctga    341520
     tttgcttcaa gattgcaatt ccgaataagc ctgagttaat ttgcatgtca ctcgtgagac    341580
     gatacgattt agccaaaatg tatcggaaac tcggatagtc ggttaagccc ttatcctata    341640
     cataaagaag aaaagagtta acaagaaagg agccaatata gatacttacc tagccaataa    341700
     aatggctggc atttattagg ctgctaaaaa gtcaaaacaa tacctgttga cactcctacg    341760
     gcttcatagt cgagatatgg aaggtaccaa agccttcttt gctcaagcga ttgagcttca    341820
     caaaatgtgc ctaacaatgt ggcgaccgat ggtttggcat cctatcctcg cgccattgaa    341880
     gaagagttgg gggaggacgt agagcatgag gtttgtcccc gaatagagaa ttcagtcgaa    341940
     cagagtcaca gacccgtcaa acaccggtat catccaaccc taggattcgg agaatttgaa    342000
     gcagctcata gattctgcaa agcggtagat gaagtgagta tctttttgag acctcgcact    342060
     cgaaaaagag aattcgtgcc tctgtttgac aaaagaaaga agttcattaa aggtgctagt    342120
     gggtagtccg ccagatgtaa ggataggtat atccaacatc caaaatccag catcacccat    342180
     gtcaacattg acctgcccta gctgtcgttc tcaaaatgtt gtcaaaatcc ttaatggcaa    342240
     gcaaaaccac aaatgtaaaa cctgtggccg tcagtttgtg gaagctcctc agtaaaagcg    342300
     aattgattca tccactaaag gcctgatcga taagctattg cttgagaaga tacctctggc    342360
     aggtattgct agggtctgcg atgtttctga aaggtggtta caagagtacg tgaactataa    342420
     gtatgcagca gtgcctcata ctgtgaacgt atcatcaaaa aaaaggccga ttaacgcttc    342480
     aatgcgatga aatgtggtca tttgtgaacg ataagagcaa taaacagtga atatggcttg    342540
     cgcttgatat cattactcgt gagatagtcg gtgtttatgt gggggcacgc tcccagcaag    342600
     gcgctcgtca gctatggaat tccttgccag gagtctatcg tcaatgtgcg gttgcctaca    342660
     cggatttttg ggatgcctac ggctgtgttt tttttcccaa gcagggacat caacctgtgg    342720
     gcaaggaaac aggccaaacc tgctacattg aacgatttaa ttgcaccctg cgccagcgag    342780
     tgtctcggtt agttcgaaag acactgtcgt tctcgaaaaa gcttgagaat catattgggg    342840
     ctatctggat gtttgtccat cactacaatg catccttaca ggactaggac tacccaaaat    342900
     gttgaggggc ttaattgaag ttctcctcca tccactgaac cccaaattgg gttagagact    342960
     gagcatccaa taggtacgat tttgccccgc cgacctttcc tgtctgagca gggtgggtag    343020
     ccaaataatc tttgacgata gtctcgaagt agttgtctgg ccagtccaca atcccattag    343080
     tcgtatcaaa ttcttcaaag tccatccaca cccgtttacc attctggagt atgggcattc    343140
     ggtagcgatc aatccactta ttaggcacat cagccaaatg ctcagcatgg tggagcaggg    343200
     tgacgtcacc aataggtgaa cccagcagaa gcacagagcc actcacctca cagagttttg    343260
     ctagcggtga acccggacca tcccgatatt gccaaggctg ttcggctgtg atccattgag    343320
     caagttcacc caccgcgacg tatgagaacg gatgacggct cctatgcgca cctggccaag    343380
     ttcggagata ttcggtgaga attcccattt ctctccaatc ggcacgagac cgagacggat    343440
     cataggctgg gcattcacac agataggctt cttgcctgtg tttgggccat cgggacaaat    343500
     cgtagggatt atcttcccag cttgccatca tcattaaagt gccagcgtct gttaggagtg    343560
     acagaatagc tgccagcaca acatctggtc cacccacaac ccatccaata ttccgaacag    343620
     aggaatgaag catgatcgtc tgcttcttac agactcctaa tttcctgaga tcttgaatca    343680
     actggctctt agtaatgagc tgtttcttct tcatgtggct catgttgaag gtgttgtctg    343740
     aagcttaaga taattcaata ggaatatcta ctgcaactcg ctcttgtcct tcagccttga    343800
     ccagagacag agctagatct tagctggaat ggcgctaact acacccaagc tgatcacgat    343860
     gagatctcac ccgtaagctt ttacaacaat ccctctccaa tcagtgagcc tagtcgataa    343920
     actggctgtg tgtagaggac tcccccccat gacttcccca atcatcagcc tcaaccccaa    343980
     gtacatcccc taaccccccc agaccaacct aatcccgccc ctttcacacc cgaactctca    344040
     gacaagacgg tattcccaaa gaaagcatta gagggtactg actacccaag cgagaaccaa    344100
     agtctgtgga gatgggcgaa atacgcctga atttatggcg aactccctga gtgcgcgtcg    344160
     agattgatgt ccattagaaa agcgctgcat tatttaccaa actcttgctg aagctggtct    344220
     cgaaattccg gatcatagat ggcatcgtta ttagcggctg cttgaatttg ctccatcgtc    344280
     aggtttgcag cagaacgcaa atcagcctgc ctgagattcg catccaataa gttggcctca    344340
     ctgagattag ctccgatcag attcgcttct ctgaggttag ctttggtgaa atcggttcct    344400
     ttaagattgg cctccactag agtggtagca ctcaaattag ccttagtgag attggcttcg    344460
     ctgaagttga ctttgagtaa gtttgcagct tccaattctc cttcaaatag attcgcctga    344520
     ctgaaattag cgctattaca gtctgctttg ttcaacttaa tagcactcag attcgcatgg    344580
     tgtgcattca tcttgatgag attagcaccg ctcaaattag cagcattcaa attagcctca    344640
     gcaaggttag ctgcttgtaa attagcattt gatagatcgg cctgggccaa ctctgcacgg    344700
     ctgaggtcag ttttactcaa atcaagctgt cctcctgata gatcattttg cacatttctg    344760
     cggctgatca cggtgagtgc tgcctggata tccgtaggca tattagtcat gcgttgactg    344820
     cgaaacgctg ccttatcccg aatataggag gtcaacactt ccatgactat ccaatgatct    344880
     gaaggggaat ccttagcgac tcgttctagc aagtagatac cacctagacg aacttctaaa    344940
     cgctcatctc ctagcattgc caccgcttta ctgaatcgct cagttacctc cttcccttcg    345000
     gtaatttgga ggttacgacg actcagatag gcagtcgtca agaaaaagag tccccctaag    345060
     gcttggatga gagtacgtcg gtgtgcgtct tcaataaaag ctcgatcccg aacttccatc    345120
     tgctcgtcta tcccattgac ctgccactta ggcaatagcc atacaactcc ccctagaatt    345180
     aataagctca gtccactcca aattgtgaac ggaatatcag caatccaagt atttctagct    345240
     tcaaaaagca tgaagtttgc tctggtactg agaatcactt catgcagaat tatagaacag    345300
     tcatacatta caactatccc acctttgggt tttatgagtt tgatcctgct tgctgactag    345360
     aagttagtaa aactgggtcg aattgtcgtc aaaccccatc ttggcgatca agctcagatt    345420
     gattacgagc tagctgatac cggatttgat ccgagagcca agcggcgacg agatatattt    345480
     gttcctctcg cgcaggaact gatacagcga attgatctag gctcgatgcg gtagttacgg    345540
     aactttcagc tggatctgat gtcattgaga gtaacagatc agttgtgcat cctaggcttg    345600
     agtatgtata gacagactgc ctggagtatt cacgaaaccc tgaagatatg cctggacttg    345660
     gtcgcagagg agtactggtt tatggacaac cttcttccct ttcaagcaat atcgccccat    345720
     aagatccgtg tgtttcaccc caagtcattt gaagatgctc aagaagcaat caacgcgatg    345780
     aaaacggatg atatgcttct agtgaatttg gcggctttgg aaaataagct ggctcagagg    345840
     ctaacagact acttagctgg tagtactttt gcgctgtcag gagagcgaat ggagattggt    345900
     agaggcgttt ttctatttgc tccaccatca ttcctgatct caagaatgat ggcatctgct    345960
     tgagatcagg aataatgata ctctgaaacg tctcaagtct tcttttgatt cttagatgaa    346020
     ccagattctg ttggcccaac atttctactc gattcaaaga catagcgcat ctgctttttg    346080
     ggtactttga gccaacgatt ctgatcaaca cctcgataca tcaaggtttt cattcttgct    346140
     cgttcagctt tatgttgctc tggggtcaat ttaccaaaca atatcaagct caaatcatca    346200
     gtgtgcatga ctttcccagg attttcctgc ataatctttg agattgcatc aatcttggtc    346260
     atcttgtcat agggtttgtt catcttcaga acagtggatg aagaacgtct tccttgtctc    346320
     ttagttttct tggccttgtt ctgagaagct atgttcttag aggttgagga ttttttggat    346380
     gaagcttttt gagcaacttg aggggaagta gcttcagctt taggctttac cttttgtgtc    346440
     gattttggtg cagaggctga ttttttggat gttggagatt ttcttttccc ggatgagggt    346500
     gacgcctttt gtgcagcttt ctttggggta gctgtagctt caacttccgg ttttactgtc    346560
     ccctttgtct ttgtagttga atccggcttc ttaggagttg cagacttctt ctttgaagca    346620
     gctttttgag tagttttctt aggcttggat ttaggttcta ctgtgttggc aactgttgag    346680
     cctggtgctt ctgattctat tgaggctgct tcaccttgaa ggattgaaag gatatcagag    346740
     cctaacaatg gatcttcaat caacgtatct agagaggtga ttttagtctt gagttgaatc    346800
     gtttgagctt caagttcagc gagtgtctcc tggtagtgag tctttagctc aaggagtact    346860
     gtggaatatt tgttgtcagc agccatagtt tgtcgtagat tagtgtagtt ttagcaaagg    346920
     taagaaagct aacttatagc attcccagaa ttaacttcct ttgtatctaa tcattaatgg    346980
     gctaatttgg gatttctggg gcgtttagaa atttttcccg tagtacttaa cccttgggtt    347040
     tggggaactt ggaaggtggc tcaaaatact gaacaggtgt atcttttaac gcctcactca    347100
     taaactctcg ccacacagga gccatccatc ctccacccgt tgccccagac ccaatccggg    347160
     cgtaattgtc attgccagcc cacacggcca ctgaaagttg aggcacatag cccacaaacc    347220
     aaacatcccg ctcggaggaa gtggtacccg tctttccagc tgcggggcga ccaatctggg    347280
     ctgctacccc cgtccctgat tgcacgacgg tttgcaacgt actgttcacg gcagcagcag    347340
     cccaaggatt gagcaccaac ttgggttgcg gggtattgtt aatcaacact ttacccgtag    347400
     gatctgtgac ttgcaaaatg gctgttgttt tggactgcca gccattattg gcaaaggtgg    347460
     cataggctga agccatctct acgggtgtta agtctactgc ccctaaggga agtgaaatca    347520
     cattggggat cgggctggta atccctaatt tgcgactgac atctatcaca ttcttgatgc    347580
     ctactttttg ccccatgaca atggcaggca cattgcgcga ttgcgcgagc gcttgacgaa    347640
     tggacatcga gccctgaaag ctgcggtcgt agttttgagg cttatatcgc tggagcccac    347700
     catcattgaa gctcacggga gagtctttaa ccatagagtc tggggtgtac ttccctgttg    347760
     caaaggctgt gtaatacacc aagggtttaa aggccgagcc aggttgtcga tacgcttgag    347820
     tcgctcgatt aaattcactc tttttattgt ccactccacc gacaatagcc ttgatgaagt    347880
     gcgttcttgg atcaaccgcg actaatgcca tttggtctgc ggcataggca tagtgttgat    347940
     gattcctgcg aacggtctcc tcagcgattt tctgcatttt ccagtcgagg gtcgtttgaa    348000
     ctcggaatcc ccctctaacc aatgcctctc gaccaaatct ttccgttaat tcttgaatga    348060
     cggtattggt aacatcagga gcttggctcc gttgatagga ggtaatttct cctagagtga    348120
     ttttctcagc ccgagccgct tcagcttcag cgggtgtaat ccatttcagc tcctccaaac    348180
     gtccgagaac gatgttctgt tgttctttgg ccaggtctaa atccacaaat ggactatacc    348240
     cttctggtgc tttgataatc ccagccatca tggcggattc agctaaggtc agatcttcag    348300
     cagacttatt gaaatagctc cgggcagccg tttctacccc ataggtgtta tggccccaat    348360
     acacctggtt gaggtacaac tgtaggattt catctttact gagtaattgt tcaattctca    348420
     gggctagcac tgcttctgcg agtttgcggc taaaagctct ttctggggtc agatagaggt    348480
     ttttagccag ctgcatactc agggttgaag ccccttgcac cgtttggcct gcctggtaat    348540
     tggtgatggc tgcccgtaga ataccgaccg gattaatgcc gtcatgctga taaaagttgc    348600
     tatcttcaat ggcgagtaca gatagtttta ggtggggcga gattttagct agagggacga    348660
     cctggcgatt ctcttcctca tgcaagcccg tgagtaactt gccgttgatg tcatagatat    348720
     aggttgtttc gttgggtgaa aagctagcta atgaagtcac atcaggcaga tcacgataac    348780
     taatcgctac ccccatcagt cctcctgcta agccagcact tcctaggagg gtcagggtca    348840
     atatggtggt caaggtagca tcgcctatcc cccttaaaaa gagggtggag gttgatctag    348900
     aggagaagtc ctgaggagaa gtggcactag atgacatggg tgtattaatg ggcaacctta    348960
     acacactaaa tttagagtgt gaggttactg ataaaaaatg actgagaagc ttgctatacc    349020
     taaagtctgc ccatattcaa caaaagtttt acgctcgttc ttaaagaacc atcatctctg    349080
     caaagtaact caacaatatg gggatttcat gagttagtta aacaacccag agtatcgatg    349140
     actatgttaa cgacccgtta aagaattgcg gaagctagtg attcgttggc cttgggaaca    349200
     cctcccaaac gccgctcaag caaggtgtat cgttgcctat ctttgatctg cctgatggcc    349260
     atgctgatgg cattcttggg gcctacgaga atcgccagtt tcttcgcccg tgtcagtccg    349320
     gtatagagca agttacggct gagcataatg taatgctgca tgtacagggg cagaatgacg    349380
     acgggatatt ccgacccctg gctcttatgg attgtgacgg cccaggctaa gccaatttca    349440
     ttcaagtcag cgagatcata ggaaacggag cgttctgcat agtgaacggt gacctcaatc    349500
     tcttctaaat tgatatcctc gatcactccc atatcgccgt tgaatacttc tcggttgtaa    349560
     tcattgacct gctgcagaac acgatctccc accctgagta tcagacctcc tctcgtcaac    349620
     tcaggcttat cggggcaagg aggattaatc aaagcttgca acacttgatt gagtttacga    349680
     gtaccgactt cgcccctcgt catggggcat aggacttgca catctcgtgc tggctggaac    349740
     ccaagttcag ggagaagatc gttgatcagt tcctggatcg cttgcacacc gttctcaggt    349800
     tcgggggcac ctaaccagag acaatctgtt ttgggcgaag gacttacgga ttccaagttg    349860
     ggaaactggc cttgattaat gcgatgggcg ttacggatga tgtgactggc ttgggcctga    349920
     cgaaagacct ccgttagttc aataatggga attctcccag aggttatcag atctaatagg    349980
     acgtttcctg gtcccacact aggtaactgg tctgtatccc ccacgagcaa gagttgagcg    350040
     ttggtatcaa tagccttgat cagggaattg gctaagaaca gatccagcat ggaggcttca    350100
     tcaatcacca ctgcgtcagc ggggatcggg ttatctgagt tccgttgaaa cttcattgtc    350160
     ttggggtcaa attccaagag gcgatgaatc gtttttgctt catgacccgt cacttcactg    350220
     aggcgttgcg cggctcgacc tgtcggggat gctaatacga tgtctttccc cattgctttc    350280
     cagagcgcta cgattgtgcg ggtggtaaaa gtcttccccg ttccgggtcc acccgtaagg    350340
     atcacaacac gctgactcgc tgccatttcc acggcttgct gctgctgttt tgagagactc    350400
     acatctgttt gagccatgaa gcggtctaac caagccctta cccgttcatt atcgacaact    350460
     agagagctgg ccagcagctg gaggactcgt cgagacaagt gaaattctgc ttggaagaag    350520
     ggaggtgcgt agcaaagcag tttcgtcgag ccctcatgtg ttaaccgttc gacgattagc    350580
     tcagcatcag agatcatggc atggatcaag tactccactt gatcgggttt gggctgatag    350640
     tcagggagag ctaatctctt caccgctcga tcaatcaatt ctggttgagg caaataacaa    350700
     tgcccttctt ctgcggattc actcaagaca tgtagcagac cacttcgata gcggtattca    350760
     gaatgaggtg agatgccaag actgcgagca atctcatctg cggtcacaaa tccaatgcca    350820
     tagacatctg ttgccagtcg ataggggtta tgggtgacgg tttcaatgga ctcatcccca    350880
     tactgcttga agatcttgac ggcataagtg gtggatacgc catgcccttg gagaaagacc    350940
     atgacttctt tgattgcctt ctgactatcc aaggcagtct gaatcagttt gacgcgcttt    351000
     ttggcgatac cagggacttc aatcaatcgt tcaatatggg tttcaataat atcgagggta    351060
     tctagcccaa agtgagctac gatgcgtttt gccgtcacgg gacccacgcc cttgattaag    351120
     ccactgccga ggtatttctc aatgcccgtg agagtcgctg gctttgtttc cttatactgt    351180
     ttgacctgga attgaggacc gtacttagga tggtcccgcc atatcccctg gagttgaagc    351240
     gtttggcctg cttggatatt ggcgaagctg cccacgatgg taattaattc acgggttcgg    351300
     ggtgctttga ggcgagcaac ggtataacct gactcatcag aatggaaggt caatcgctcc    351360
     acaaccccct gtagttgttc aatgggagga gaccctggat gagcagaact actgggcatg    351420
     ggtagctacc ttaagacttg atgctaggct tctttacagc aatatactcc tggaaggtcg    351480
     atgttcttaa gatgcatcaa cttcctctgt atcagccggt tctatctcaa cggtcgtgat    351540
     ggaatttgca gaaactttgg agcctaactc cagcttttgg cgtacttgtt gttcaacctc    351600
     ttgggaaaac tctgggttat ccagaaagta atgaatggta ttctcccgac cctggcctat    351660
     attgctaccg tcatagctat accaagctcc tttgcggaca atgatatctg tttcctccgc    351720
     catatcgacc agacaaccca tggttgagat cccctggcca aacaggatgt caaactccgc    351780
     aatccgaaac ggaggtgcaa ccttattctt ggcaaccttg acctttgcgc ggatgccata    351840
     catatcggtg cctttcttca gggtctgaat tcgacgaata tccaagcgaa cggaggcata    351900
     gaacttgagg gcgttacctc ccgtggtcac ctctggactg ccataggtga ctccaatctt    351960
     ctgtcgcagt tggttcagga aaatgacggt gctacctgac ttggcaatat tgcttgtaat    352020
     cttacgcagc gcttgactca tcaaccgagc ttgcaacccc atatgggaat ctcccatatc    352080
     tccctcaatc tcagctctgg gagtaagagc agcaacggaa tcgaccacaa cgagatccac    352140
     cgcacttgaa cgaacgagtt gatccacaat ttctaaagcc atctcacctg aatcaggctg    352200
     gcttacaagc agctctgata tatccacacc caatgctgct gcataaactg gatcaagggc    352260
     atgttcagcg tcaacaaagg cagcgactcc acccgtcttt tggatctgag aaatcgcatg    352320
     cagggctacg gtggttttcc ccgaactctc aggtccatag atttcaatga cgcgtcctct    352380
     aggaagacca cctcctagcg ctaggtctag agtcaatgcc ccactagagt tggtctcgat    352440
     ctgcatacga gtggcatcac ccaatcgcat gatggcccct ttgccaaacg tcttttcaac    352500
     gtttttcatc accaagtcga gggccttttg cttctcagtc atttcatttt tggcactcat    352560
     gagtgaatct ccaaaggtgt gaattggggg acgctagacc aatatagtaa tcttgtacta    352620
     aaatggtgtc aataagatac ttttgttcat gttttacctc cacatggtga ggttgtaatg    352680
     gcaacagata cacttgctga actgttagga ttctctggtg gctggctcgt cggagtctca    352740
     cttgatttag agtggggcta tcagtgctgg gtcattaccc cagaaagaca ggttcacact    352800
     gatggagaat tctacgtgca tagccgagtg gcattagaag caggacgctt tctcgtggag    352860
     aattccttgg aggtggagtg aagagtgaac ccatcgtcat gtcttgggaa gagtatgaac    352920
     ttatgccttg gcggttgggc tggaagcatg aatatttcaa tgggatggct tacctcacgc    352980
     ccagacagca atctgttctg accgtcatcg aggttgcccc ccgaaacgat acccctcagt    353040
     ccttcaagat ccgacctgtt gtgtcaacgg atgtacttga gctcaagcat ctattctttg    353100
     agatctttca cgactccgtt gaatattgca attatgaaga gcgggatatt caagaatcag    353160
     cccaaagctg tattgataac tatcttggcg cggtcaaagg tgaaccctca aaagtgtcat    353220
     gcgttgctat ttcaccagat agggaactca taggcatagc tctagtaatt gagcagcctg    353280
     aacggcaacc ctatcttcgg ttgttgggag tctccccatc ttggcaacgc cgtggtgtcg    353340
     caactggctt aatgacgaca atactcaacc aactcgttaa cacctctttt acccagctag    353400
     agagtcgata tttcctggcg aatgaagcga gtagaaactg gcaccatcaa tttggattcc    353460
     aggatcagct cgacatattc gtcgctcatc tgttttaccg gcatgcccag catgaattat    353520
     ggcgacagga acaacttggt caactcccga agaaagactt ggcccttttg gcatctgagg    353580
     tggagcagtg gcaggctgaa gtggaccgtc aagaagttgc ctttgaagca acttaccccg    353640
     agaactgtcc taacaggctg acttctcatc atcaacggac aaagcccacc gctctgcctt    353700
     agaatgacca aaagtttgtc cccgtgagct tcccatgcct actgccactt cagaaaagct    353760
     gaaccagctc cgagcgcagc tccaagaatg caccaaccca attgctgcca agctactcaa    353820
     aagtacgatt gcaaaacttg aagctcaaat aagctcaggc cagcccaaga ccacagcatc    353880
     caagatagcc cagcggaagg ctgcattgag gcactcccag aagcaggcca aacagaaaga    353940
     aagatcaacg ctgaaacccc cttcatcaaa gtctgaaggc gtacctcaac ataaaaagcc    354000
     cataacctta gatcaggaaa aaccaatcga acaggctaag gtgacagcgg tagtacaagt    354060
     tgagaaatct aagccactga ttcaagatgg gccacaagca acgactgaaa cgactcccaa    354120
     aaacaagaac cgtttctccc cagatgtcat taaaatagcc aagcgccttg tcctcgctga    354180
     tgaactctgg gaacgtcccc aagttcaagg catcaccatc gatggaccga cttctcgaga    354240
     cctggatgac gctatctgga ttgaagcgac tgagtcaggg gtagtcctct ccgtacatat    354300
     tgccgatgtc tccgaactcg tggagatggg ctcgatattg gataaggtag ccctctctcg    354360
     cacagtcaca cgctatttca gcaatgggaa cgcacccatg ctgccaagac ccctgtccga    354420
     aaataagctg agcctgctgg aaggtgaagc ccgacctacc gttaccgttc aggttaccct    354480
     caacccgaac gcccagatgg ttgacgtcaa aatctttgaa tcctggctgg taagtcacaa    354540
     acgctttacc tatgctgaag cctcccagcc taaatcatct actccttttc ataacactct    354600
     ggaaatggct caccaatggg cctcccatct gtaccgaaat cggctgacat caggttcaat    354660
     tggagcgacc cagacggctc aaggccagtg gctcacagaa gaaggcagcc ttatccaagg    354720
     taaacttcat ccaagccata tcctcattca agaatttatg atcctggcga acctcgccgt    354780
     cgctcaatgg ttagccgatc aggatatccc agcgctgtat cggaatcaca ccgccagagc    354840
     cattgcccca gatcgggaaa caatgtacca aacgttgttg atgttagggt caaatgcagc    354900
     cattcgtcaa cggttgcaca gttggatgaa ccgggccgtg tatagtcccg tcttgatagg    354960
     gcactttgcc ctgaaccttc ccgcctattg ccacttcacc agtccgattc gcagagtcgc    355020
     tgacctgatc aatcatcgga ttgtcaaagc ctgcctcaaa catcaaggcc taccctataa    355080
     acagtctgaa ttggcggaat tgggacagca tattgcccag gtcaaggatg agcataaaga    355140
     gcaggcctcg gagttcttca aagcagccca tcaaaaggtc taccaggagc aacttcaaac    355200
     ccccgaagac ttagcaaatc tctctgggaa agaattcaca cgactcctga aatatgcggt    355260
     tgagtctcag ggggttgatg aacttcgcag tgaactattg acccggttag gcgctgagca    355320
     actagccgta caggatctct acctgttgct ctttcagtcc aaagagcttg agctacaaca    355380
     gcaagtgatt cagtatctgt ctggccatat ctatgatgcg gcgagtgtga tcaccattgc    355440
     ctccaatcaa gaaaggaact gggaagcatt caactatctg gaagcggaga attccccccc    355500
     attccatatt tggttagagg tgatcatctc tggagactcc ttgacgacga ttcaccctgc    355560
     cactcattcc cgcaaacaac ccgctcgtca tcacgcatgt ttgatatggt tagaagacta    355620
     tctacagaaa aacttggtca atccagaagc gagtgtacag cctccgttac cagaggctaa    355680
     attatcgtct aaagattcag ctcccagtgc agcctcccta tccaaagcga tgcagactgc    355740
     tttgatgaaa ccactcagtg gtggtcagaa ttttgttggg atgttggtgg atatttgcca    355800
     gacattgaga tgggagaatc cagagtacga aatgggcagc tcagatgatt ggtttatctg    355860
     taaatgtgag ctggatgttc tgggtgaacg gctggaaggt agcggggtgg cgaagaagaa    355920
     aaaattgtct aagagtctag ctgctaaaga ggtacttgag caagtacgag agcttgcacc    355980
     tcagcattgg gaggagtggt ttccaggagt agcattcagc cagcctaaga atctgaccaa    356040
     ccaagaagat tgaggctctc tgggaattag cgtgtagcag tcctaca                  356087
//