Dbfetch

ID   CP000838; SV 1; circular; genomic DNA; STD; PRO; 374161 BP.
XX
AC   CP000838;
XX
PR   Project:PRJNA12997;
XX
DT   29-OCT-2007 (Rel. 93, Created)
DT   16-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Acaryochloris marina MBIC11017 plasmid pREB1, complete sequence.
XX
KW   .
XX
OS   Acaryochloris marina MBIC11017
OC   Bacteria; Cyanobacteria; Synechococcales; Acaryochloridaceae;
OC   Acaryochloris.
OG   Plasmid pREB1
XX
RN   [1]
RP   1-374161
RX   DOI; 10.1073/pnas.0709772105.
RX   PUBMED; 18252824.
RA   Swingley W.D., Chen M., Cheung P.C., Conrad A.L., Dejesa L.C., Hao J.,
RA   Honchak B.M., Karbach L.E., Kurdoglu A., Lahiri S., Mastrian S.D.,
RA   Miyashita H., Page L., Ramakrishna P., Satoh S., Sattley W.M., Shimada Y.,
RA   Taylor H.L., Tomo T., Tsuchiya T., Wang Z.T., Raymond J., Mimuro M.,
RA   Blankenship R.E., Touchman J.W.;
RT   "Niche adaptation and genome expansion in the chlorophyll d-producing
RT   cyanobacterium Acaryochloris marina";
RL   Proc. Natl. Acad. Sci. U.S.A. 105(6):2005-2010(2008).
XX
RN   [2]
RP   1-374161
RA   Touchman J.;
RT   ;
RL   Submitted (25-SEP-2007) to the INSDC.
RL   Translational Genomics Research Institute, 13208 E Shea Blvd, Scottsdale,
RL   AZ 85004, USA
XX
DR   MD5; f2978c55c5f74900466debf49a768e3a.
DR   BioSample; SAMN02604308.
DR   EnsemblGenomes-Gn; EBG00001236568.
DR   EnsemblGenomes-Tr; EBT00001581807.
DR   EuropePMC; PMC2538872; 18252824.
DR   RFAM; RF00080; yybP-ykoY.
DR   StrainInfo; 373281; 0.
DR   PubMed; 18252824.
XX
CC   Source bacteria from Marine Biotechnology Institute Culture
CC   Collection, Marine Biotechnology Institute, 3-75-1 Heita, Kamaishi,
CC   Iwate 026-0001, Japan.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..374161
FT                   /organism="Acaryochloris marina MBIC11017"
FT                   /plasmid="pREB1"
FT                   /strain="MBIC11017"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Acaryochloris marina"
FT                   /db_xref="taxon:329726"
FT   gene            join(373616..374161,1..174)
FT                   /locus_tag="AM1_A0001"
FT   CDS             join(373616..374161,1..174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0001"
FT                   /product="glutathione S-transferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31510"
FT                   /db_xref="GOA:A8ZK10"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK10"
FT                   /protein_id="ABW31510.1"
FT                   /translation="MKIVSFKICPFVQRVTALLEAKGIDYDIEYIDLSHKPQWFLDLSP
FT                   NAQVPILITDDDDVLFESDAIVEFLDEVVGTPLSSDNAVKKAQDRAWSYLATKHYLVQC
FT                   SAQRSPDAKTLEERSKKLSKAFGKIKVQLGESRYINGDDLSMVDIAWLPLLHRAAIIEQ
FT                   YSGYDFLEEFPKVKQWQQHLLSTGIAEKSVPEDFEERFTAFYLAESTCLGQLAKSKNGE
FT                   ACCGTAECTVDDLGCCA"
FT   gene            241..381
FT                   /locus_tag="AM1_A0002"
FT   CDS             241..381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31511"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK11"
FT                   /protein_id="ABW31511.1"
FT                   /translation="MLINPEDKQVEIYRPGQDVELLQSPSTISGADVLPEFSLNLEWIW
FT                   R"
FT   gene            388..525
FT                   /locus_tag="AM1_A0003"
FT   CDS             388..525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31512"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK12"
FT                   /protein_id="ABW31512.1"
FT                   /translation="MKEAGFSENSRSREGQPKLAKDAAIAKPYLVAMTAELQIMATETL
FT                   "
FT   gene            complement(533..1318)
FT                   /locus_tag="AM1_A0004"
FT   CDS             complement(533..1318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31513"
FT                   /db_xref="InterPro:IPR025643"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK13"
FT                   /protein_id="ABW31513.1"
FT                   /translation="MKTLRWLIDLHPEFPASEIVAGYLRQHKKIEPIVIDRDDVMLGRW
FT                   PDTEDWIVGYGTMFAMTRLLRHPPLSTAIFDDYSSLRCSKYYSYIYPFLGRAFLFAPFG
FT                   ALPNLPLQRMFGDNIFVRSDTNYKLFPAEVLKTQELSHWVKTFSHHQNELAVVSEVVSF
FT                   EAEYRCFCRNGIFFCGSSYPDEPYSEVPQEIRSVAESVAQALDVTGMNMLTVDIGIHAG
FT                   EPKLVEIGGVNSWGIYGSNVADFIAAMEEEAVDRWEDLI"
FT   gene            complement(1515..2012)
FT                   /locus_tag="AM1_A0005"
FT   CDS             complement(1515..2012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0005"
FT                   /product="rod shape-determining protein MreB, putative"
FT                   /note="Member of COG1077, Actin-like ATPases involved in
FT                   cell morphogenesis."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31514"
FT                   /db_xref="GOA:A8ZK14"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK14"
FT                   /protein_id="ABW31514.1"
FT                   /translation="MNLVQRLMGIFSEDLLIELTKSEVSITSFSSGATVKDKPLIAVSG
FT                   EKNKLTVEGVGAECQNMSKPGLQLINPFDHSRSFVANFTYAEKILQYLIRKLLRNRLIT
FT                   SPRVIIHQLEKNEGGLTEIEERVLRELALGAGAREVIVFQGSKINTNVDTYQTIKQRVD
FT                   AT"
FT   gene            complement(2745..3191)
FT                   /locus_tag="AM1_A0006"
FT   CDS             complement(2745..3191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31515"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK15"
FT                   /protein_id="ABW31515.1"
FT                   /translation="MTQVLTAQFLFPAKEFDTQYGPRLNAKIKVANGEEAKLWGPPGDV
FT                   ALLALRRGQTIQIAKDGKGKYSLVEQASAPGQAPVVGDAPLDDGALDGDTKSVIASYIS
FT                   NRAALYSFCYQEASRELGKHDASEETIKCAASTLFIAAQKKFGI"
FT   gene            complement(3340..3681)
FT                   /locus_tag="AM1_A0007"
FT   CDS             complement(3340..3681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31516"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK16"
FT                   /protein_id="ABW31516.1"
FT                   /translation="MDVQILEVLSIQLKVGDVLELTLVDEEFAPEQMIEIPIACKLVKS
FT                   DAILLHFHPHELELDLNTVDIHSKKDQRYLTVRSLEIVDTEKGYLATEDESGTARYQVM
FT                   WKKIANTYD"
FT   gene            complement(3724..3879)
FT                   /locus_tag="AM1_A0008"
FT   CDS             complement(3724..3879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31517"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK17"
FT                   /protein_id="ABW31517.1"
FT                   /translation="MNIYVAQIEVWNGRTFQVIDFQMADNGESLGTVIREYVAAIGLRL
FT                   VYWCKL"
FT   gene            complement(4078..4707)
FT                   /gene="ndhK"
FT                   /locus_tag="AM1_A0009"
FT   CDS             complement(4078..4707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhK"
FT                   /locus_tag="AM1_A0009"
FT                   /product="proton-translocating NAD(P)H-quinone
FT                   oxidoreductase, chain B, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31518"
FT                   /db_xref="GOA:A8ZK18"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZK18"
FT                   /protein_id="ABW31518.1"
FT                   /translation="MKPQSLEANIINPITPLEVTQELSDNVILTALDDLYDWVKMSSLY
FT                   PFMFGTACCFMEFMGAYASRFDMERFGMIPRATPRQADLLITAGTITMKYAPALVRLYE
FT                   QMPEPKYVMAMGACTITGGMFSADSPSAVRGVDKLIPVDVYIPGCPPRAEAVLDAITKL
FT                   RKKIANESLQERDTTQQTHRYYSIPHKMKVVPPAVTGQYLQSHEVA"
FT   gene            complement(5074..5418)
FT                   /locus_tag="AM1_A0010"
FT   CDS             complement(5074..5418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31519"
FT                   /db_xref="InterPro:IPR022243"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK19"
FT                   /protein_id="ABW31519.1"
FT                   /translation="MATIEATHASTIAELNDEFRQGNHSLGRIFTTHGVDALSSEDQQE
FT                   LFRLVRTFDDFNPSNDPYGEHNFGCIKFKGEVFNWKIDYFAPNLIHGSVDPSDLTKTTR
FT                   VLTLMHSSEY"
FT   gene            complement(5483..5776)
FT                   /locus_tag="AM1_A0011"
FT   CDS             complement(5483..5776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31520"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK20"
FT                   /protein_id="ABW31520.1"
FT                   /translation="MNTTLTQMEQWIDERVTDPLHPEYSLLYAQVEFWPGVREGGALEE
FT                   YYIIIKNRVGSVGDRLRDWVLKQFGVSARLADWETIPSPRQLRAESQYEDEF"
FT   gene            6129..6497
FT                   /locus_tag="AM1_A0012"
FT   CDS             6129..6497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31521"
FT                   /db_xref="GOA:A8ZK21"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK21"
FT                   /protein_id="ABW31521.1"
FT                   /translation="MLNRIKELLDNRPDPVSGTDKTTPYRFWQDTGVGRDTAYRMYNDP
FT                   TYIPTSSALNKICEAYKIQPGDFLAWEPDSLSQDSAAQTESPEIPSSQAKKSDKQNQQK
FT                   NSGRNSLLKILPTIPKTA"
FT   gene            6836..8581
FT                   /locus_tag="AM1_A0013"
FT   CDS             6836..8581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31522"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK22"
FT                   /protein_id="ABW31522.1"
FT                   /translation="MQWSRLLWAFFGQMAPYSLHLGATAMTYSKTLTPTCRGNPCDLCG
FT                   DITGKCRKADNLNLCMTLSGQIEGYRYLGQSKDGLWGKYVLDDGQDLSQEERERRWQEQ
FT                   RILREQRAQAEAQHHAQSLPATERDQHYRQLLDQLTLHPADRADLHRRGLTDEQIKAWG
FT                   VKSVEQWQSLSGELPHTLSGIGLDGQSLITPRPGYLCPIVDADDLIVGFQVRARTAEGG
FT                   RYYWLTGKTKKRPHGPTPHLPNGELPLSVHRPEQTTRDAIALVEGTGAKPHLLAHRLGQ
FT                   ITIGAAGGLFAASPETLKASLAQLGTNSIEFYPDTGAIQNKSVLRQYRATWKLLKDWGY
FT                   TITVAWWKQTDKRIHADIDELEDLSQIQYLSVAEFERIAAQCNGLLHKLQQVLSKITRP
FT                   SSPAQGFAPPNEQQTQIPNPRGTKRTSSDDECLATQPTTSRRAKRARRRTARLLAAHRR
FT                   HGYISKLRLENYRRRIRRHTSRATHARGSSLQSRSGDNRTLDPTTPLVQEYQPGQRLQT
FT                   WETLISSGFPYILDQSQPGTGKSYDSGNVTPIGFGMEQVIYLSDQHRNPTVSTLDRGNY
FT                   WMSTP"
FT   gene            complement(8739..9470)
FT                   /locus_tag="AM1_A0014"
FT   CDS             complement(8739..9470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0014"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31523"
FT                   /db_xref="GOA:A8ZK23"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK23"
FT                   /protein_id="ABW31523.1"
FT                   /translation="MLTHWESIESQAMQENWSYAEFLLALCETEAQRREQARLKRALTE
FT                   ARLPNAKSFTNFDFSHCPQLNPAPLMQLAADPGWLERAENCLILGPSGVGKTHLATGVS
FT                   KKMLEFGKRVKFFAANALVQQLQQAKLQLQLHPMLKKLDRYDLLILDDLGYCKKSEAET
FT                   SVLFELIAHRYERKSLLITANQPFSQWDDIFTDSMMAVAAIDRLIHHGLIIEIQADSYR
FT                   RKSATQRTAQTQSPPQKSQSK"
FT   gene            complement(9298..11034)
FT                   /locus_tag="AM1_A0015"
FT   CDS             complement(9298..11034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0015"
FT                   /product="transposase, putative"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31524"
FT                   /db_xref="GOA:A8ZK24"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK24"
FT                   /protein_id="ABW31524.1"
FT                   /translation="MPNKRIDSYHTRVYMNGRDLGLKQAEAAYIAEISTRTGQRIEAGT
FT                   HQPNRGRLQDQRTVPDPLADVWEDELEPMLRRDPRLKPMTLYEYLQDKYPGQYPQVLRT
FT                   LQRRVRTWKALHGPSPEVMFELRHEPGVQGFSDFTELKGITITIAGKPFEHLIYHYRLG
FT                   YSGWRYAQIIEGGESFVALSEGLQNAFAACGGVPTQHRTDSLSAAYRNMGGRRSKNLTR
FT                   LYDELCDHYRLEPTRNNKGVAHENGSIESPHGHLKNRIKQAIYLRGSADFTSVAEYQAL
FT                   IDAQVAKLNQQCQTKYEQEKDHLQPLPKYRTPDYEVLTAKVSKRSTIDVRCILYTVPSR
FT                   LIGRQLELHLYHDRIVGYLERHPVVELPRKRVSGKGKRRDRCINYRHVIGSMRLKPRAF
FT                   IYCTWQSDLLPNPEYRQIWEQLKAQFDLEQAAKIIVEALYIAAVQDKEQAVAVYLQQQL
FT                   RSSSLTLNRLKKQFEPPQMKQVPDLSIEQHSLELYDKLLPSCSVPAEPLPAPEPLFKKA
FT                   QALPHVDPLGIYRIPSHAGKLVLCGILTSLVRNGGPTKRTSSSKTCPHRSQAPKRKKFY
FT                   QL"
FT   gene            11248..13125
FT                   /locus_tag="AM1_A0016"
FT   CDS             11248..13125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31525"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK25"
FT                   /protein_id="ABW31525.1"
FT                   /translation="MEARHGGLNRVKNRLQRSAKRDAYVVPANCSRIGVLNALRDKNIP
FT                   GADTANLICGTCIAREACINADGPGYGFLNQRRNVLGAPLLRAHPDSLPDPEDYPLENT
FT                   MLIWDEPGQNFQVKQSVTVTFSDLQQTITTLIIYPEIFALVQPLLSALLPLMDGSIKLG
FT                   KYGLNHLALKSRLPDMAGVKLGEIALILMPNLGFLNTSSDYGIDLADLPKQLRKKFSER
FT                   DSEMAEQARNGVVKQWLIPLIRILQGGAGCIQVSRYGLLTLNTPNPRHRDLAQAAQANV
FT                   FLDATLSREDLALKLGCSPDEILVVRQAVPDTGNLEVIQVADMGRVGMSRGGDQTKRID
FT                   ALVQHYQDLDAVNTRTIDFKQFEKDGAWWRDSRGVNDFLTVQTLVLVGTPCRNLNDLAA
FT                   EFAITSGYYPEEEDPAFKAFVDRSILAEIHQAIGRLRAHRRPGESLQVVLISNIDMDIP
FT                   VQQIQAKDLTIEAAHKTERVRLAIESAILQLQAKGEKVTQQIVSAMTKIPRGTIARYWR
FT                   LFISLLDSFNSKVNNSKNVSEADQDCHQAIAGVLDELADLPIDDLLPSLNEVFFDWLKP
FT                   REWANVWDKVSISCQMAILEGVAMMLPVKLLEETLPEKPNQTVQLSQHV"
FT   gene            13398..14546
FT                   /gene="dcm"
FT                   /locus_tag="AM1_A0017"
FT   CDS             13398..14546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcm"
FT                   /locus_tag="AM1_A0017"
FT                   /product="C-5 cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31526"
FT                   /db_xref="GOA:A8ZK26"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK26"
FT                   /protein_id="ABW31526.1"
FT                   /translation="MLDIFCGAGGMSLGFQKAGCKILGGIDNNPHAVKTHHQNFPKCKL
FT                   KLDATDIRDIENLEDLGIDPKEVDILIGGPPCQVFSRVGIGKMKNHLKRNIEQDPRNFL
FT                   YKEYIRFLRYYKPLFFIIENVDNLANKKDILETIIKELEACGYRVEYNVLDASDFGVPQ
FT                   RRLRIFIIGSRLDLGWKPIFPKSKTKIPLTVGEAISDLLELQPTAMPLKLKSSGPKQKD
FT                   CELPYRSAPESGYQRIMRRYNGDLVRNHICRAHNYEDLKIFDMLKQGQKYGDLPQEVMR
FT                   YRVDIFKDKYKRLIWDDLSWTLTAHMRKDCLAYIHPTQIRSISVREAGRIQSFPDNFIF
FT                   YAPMTRMFELVGNSVPPLLAESVAKPIVKKIREYYNVLSLKE"
FT   gene            14710..16881
FT                   /locus_tag="AM1_A0018"
FT   CDS             14710..16881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0018"
FT                   /product="sensor histidine kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31527"
FT                   /db_xref="GOA:A8ZK27"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK27"
FT                   /protein_id="ABW31527.1"
FT                   /translation="MSHSSISSVSTSLPLRPRARLLRTIGDELISSEIVAVIELVKNAY
FT                   DADATIVLVKFIEPLETGKGSIEIIDNGNGMSLKIIEKSWMEPATFSKKNTKFSKIYRR
FT                   RFLGEKGVGRFATSKLSDFLEIVTRYIESDNEIRAIFDWKQFDDEEKYLDQVEVLWDMT
FT                   SPDEICSEGSIMMLYDSCEIRGSDGITHGTILRMSDLRANWDRDQLLLLRTALSRLISP
FT                   FSDAKDFQVILDLPKQYENLSGKVETPRVFEKPPYRINGKVDSEGNANLILNVMGKDPQ
FT                   HISEVLGKDKNIPQCGPFEVDIRVWDLDRDSLKLLVKDQQSTLKDIRKDIKDIAGINIY
FT                   RDQFRVLPYGERDNDWLRLDIRRVQAPTLRLSNNQIVGYILISSDLNPELRDQSNREGI
FT                   VESQALRDLRFLVRTILAKLEAERYNTRRQQEQETPISSQGSLFGNFNLDPLRTALTEK
FT                   YGKEKDLIGIIDSQEKQLEERVKVVKEVLSRYQRLASLGQLIDTILHDGRAPLYKIDNE
FT                   ATLLIKNIEKSDNNNSLFDKLKKRGESIKKYSSLLGNLFKKIEPFGGRKRGRPKKIILE
FT                   EVISDAFMLLESDLNKANIKIHIPTTKTTVFVESSELQQVIMNLVDNSIYWLNSVDEDK
FT                   RYINVSISNKENPSDGIDIIYSDSGPGIEEKFREHIFDPYFSTKPDGVGLGLAIAGEIL
FT                   TEFYEGSLELIENTSSSGVTFRIHLNKRV"
FT   gene            16883..18049
FT                   /locus_tag="AM1_A0019"
FT   CDS             16883..18049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0019"
FT                   /product="response regulator reciever domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31528"
FT                   /db_xref="GOA:A8ZK28"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK28"
FT                   /protein_id="ABW31528.1"
FT                   /translation="MFEITTWRLLIVDDDEEICKQVKEILEDEEINNVRLSIIITTDFN
FT                   DALEILENQRIDLIILDVREGSHDDNPSEEIGIITLNKIKEKCFLPIIFNTGLPNLVEH
FT                   LRSNLIRIVRKGKSEELWNEINNVFTSNLPIINRALVHHFEEIQRQYMWEFIADNWQSI
FT                   SRDNDNHELAHLLARRISLSLSAEEILSWVSQLGFTSKDSIKKEEVSQSHPITYYLIPP
FT                   ISNYPRPGDLYVKDKEDNPTYWVILNPSCDFIIRKNGKCKVEYILLANASKLSDQEEYK
FT                   SWCLNYSNSQKKKLIKLIQDNREGQSERFYFLPGVCDFPDLIVDFQVVVSIKYDDLSNG
FT                   AYNRLASLDSPHAEALLTRFSRYFGRVGKPDLDAESILSKLQEVISKD"
FT   gene            18510..18638
FT                   /locus_tag="AM1_A0020"
FT   CDS             18510..18638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31529"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK29"
FT                   /protein_id="ABW31529.1"
FT                   /translation="MRKSAAPLQADGVWNTICSQTVDLDYNPISLLQAAGNLPSLD"
FT   gene            complement(19044..19391)
FT                   /locus_tag="AM1_A0021"
FT   CDS             complement(19044..19391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31530"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK30"
FT                   /protein_id="ABW31530.1"
FT                   /translation="MLTLPVAIAVEANTSDRSIEECAQTIEFVPYDRQFIKDLKIVHSQ
FT                   WNYHLIGVEQANSNWWVILKTHPCEVLMMDPGGDADSFSGIVPDDVVEGMELAAKEYNR
FT                   EFYKKMGTKQN"
FT   gene            complement(19430..22678)
FT                   /gene="dacB"
FT                   /locus_tag="AM1_A0022"
FT   CDS             complement(19430..22678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="AM1_A0022"
FT                   /product="D-alanyl-D-alanine carboxypeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31531"
FT                   /db_xref="GOA:A8ZK31"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK31"
FT                   /protein_id="ABW31531.1"
FT                   /translation="MLAVHSFIAPQHFPMKKKLIAMALAGLPTLTQIAPALAQQQQQTA
FT                   ALSPDTPVNLPGLYYDPDPGPSPTFRQLTTAEQAGYVEIPPLPNGVQLPYQVDRAWPQG
FT                   ATPDQILKFGDLQQNPVTASFTKLTLRDISAKQGTDIAGLPIGDVPLVYGLTVDEIDKL
FT                   YTKINNGEKITVDDAAPAIQAALGVLYDPSQAGKQLQQAALTTGEKVLITRLSKIPAFK
FT                   GIPLQDLARGNWQGVISKAEQIQLAGIGKKIGPTLKKLPVNQVVPLVGDAINGNWQQVR
FT                   KRAQAYILAKGTDVAVKEVIKAVPELKNLPLGAVPDLVNQPIEQTLPKIADMAIEEIPG
FT                   AKDKTINSVPGLSEIPIDKLPFDLAFSFFAGDLFARFDIAYSGVEGPEEPSIQHSLSGG
FT                   SENQKFRPIKCTLGQTQNQRADNCPHFEMRKFISSPVAQATGDDDIEGKQWVQGDSGGK
FT                   NGQGVKGGKGLLKWVNGGWEPAGIHPFGVNSHTKFVLKKITEYPDQKSTAKLSVAFQFC
FT                   VMIPLLGQQCTPHFLVIPTPYVVKEDGLFLVASRRNLPASLARLRNQTLAAGVYCDPDQ
FT                   IIATAGQSDAGAANTKYGHLPYEETDEQLYEVTAVDGATVGLTQDAASAFEQMRADAAA
FT                   QGLDIKAVSGFRDRKLQEELFSDQVAEQGSPEAAAKISAPAGHSEHHTGLAVDVGNNAN
FT                   PYLNESWANTPEYAWMQQNAGKYGFELSFPKGNSQGVSYEPWHWRYVGTDQAAATFNNS
FT                   ASNSQSQGSSTHSAPADPDHNLRQYLARIRIGESTDGTNWRPNPKTGAYGIYQFTPESR
FT                   QSLLQRTGLDGWTRDRAVAAQAAVEWIKIIGAEKNVDLIGAIQRGNFALADRVLSPWQW
FT                   TSLPGGPEESEVWSNPANFEKYGSTGDASTNAPATVASAGVPCKPSQVAGVPGSPGAIA
FT                   SNLNGQLGPFVQGDGITTGQFDLPTEYPITSPYGPRSLGFHRGIDYGTPIGSEIRASDG
FT                   GVVTAVKVDCPQQGHLESRCGGGYGNFVFIQHSSGYVTVYGHLSATNVQIGDPVKQGQV
FT                   IALSGNSGRTTGPHLHFEIRDPSGQRLNPANFLY"
FT   gene            complement(22836..22949)
FT                   /locus_tag="AM1_A0023"
FT   CDS             complement(22836..22949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31532"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK32"
FT                   /protein_id="ABW31532.1"
FT                   /translation="MYASCLAKKSLFTQEIQQIAAFNSILAWESQLNFNSQ"
FT   gene            23042..25456
FT                   /locus_tag="AM1_A0024"
FT   CDS             23042..25456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0024"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31533"
FT                   /db_xref="GOA:A8ZK33"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK33"
FT                   /protein_id="ABW31533.1"
FT                   /translation="MIGWGIAGFALVAMATAAIAKWTGNLEKIIVFSQKYLFRKTPEII
FT                   EAKRQKARQKLIKVLLGQVVKRLENSLHHKIPIDLRHEEQPQRVGQRNLPTVQDEEVSE
FT                   NFINRTFNPFTENALHEAESTQKSTQKLLEREDIQGRLLILGEPGSGKTNELLVLARDL
FT                   LIKAQQSPDKPIPVIFELSEWNDNQELDEWLAQQLFEKHKIPLDVSKHWMRQKQLLPLL
FT                   DGLDELSKIEGSEEVSSKELDQGQIKELIQCVREINTFISIFSLPLVVCCRRKEYEALE
FT                   AQGESLKCLNGAIDLQPLSDKQIKEYLQKLKRESLWEVLQSQPELPEFIRSPLFLLILA
FT                   VVYKGEHISSEEELLDEYITKQLNSASKKAYQKRIRSKLRPSKFYIKKLGKEPAPEKTH
FT                   YYLSWLASKLDFEGKTEFLIEQIQPTLLDTAKARKHYRWISGLMYGVIISLCFGLIGGW
FT                   WIGLVFGLIGGLSIVLSENKKPKKYRFSWKGFWEAGLIYGLIIGFLKDLNLGLCFGLSG
FT                   GLSRGLSRGLGDSQKPEKLRLFWKSFWRAGVIFGLIFGLSGSLRRGLAGGIIGGLSEGL
FT                   IEGLSRGLSNIKTSEKFSFSWKSFWRVGFSIGLTIAIIGGLSEGLTEGLSRGVLIALTG
FT                   GSSIGFIAGLIEGIENSDIDVQDKTTPNQGIKTSIRNGIIVAIVFGLCAGLIGGLSEGL
FT                   VFVLASGSSRGIFVRMAVGLNVGLIAGLIAGLIAGIDAVFKHFFLRIVLYQSGVAPWNY
FT                   ARFLEHAENHRFIQRVGGRYRFVHDLLRKRFTATLNEEKNKEKKNGPDRSR"
FT   gene            complement(25600..27051)
FT                   /locus_tag="AM1_A0025"
FT   CDS             complement(25600..27051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31534"
FT                   /db_xref="GOA:A8ZK34"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK34"
FT                   /protein_id="ABW31534.1"
FT                   /translation="MSDIKTKKEALAAINKNKPKAGVKDTKPDPAQAQPQEPVPATLQD
FT                   FHLPELTHEFDAQTPTKTRRRLPIQIGVIGGSIFLILAVVQAVTSGNSDTPKPAVATRP
FT                   QPSIGMAEDDKDAIIKSQAVQISELKQKYETGNVTDAPGQNKLTAVPQKPIVVPKTKPA
FT                   QSHRRPPSAAHRVTRPIQVRRSVPPSRPRIVYRNRPAPKPQPVAARPPAPRPVAQAPKP
FT                   AANFSLAQQSAFTPKPVQPARPIQPKPIRPIKVSTSHPVRKPITTKPVAKAPPPQGILV
FT                   ASLTGDLLEDNQVSDAPTALYPASSSPLGKGLISPGTTAKAKLDNPITWIPQNSDAIIG
FT                   QRYLLTLSEDLGAMAKKGSKVLAEVTSAEGDFLSMQVVEVNQQPIEHVNLTDESPESRK
FT                   TPVAVVQYKQSPYLQAKLKGQGEGFGNKLLRAGLNVGFDQLRSSSVGDRASSLVNSFAP
FT                   NRSSGSRSGLYHFDKEVEIYFVEGV"
FT   gene            complement(27054..27773)
FT                   /locus_tag="AM1_A0026"
FT   CDS             complement(27054..27773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31535"
FT                   /db_xref="GOA:A8ZK35"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK35"
FT                   /protein_id="ABW31535.1"
FT                   /translation="MLKLQYPSETHKKQPPYVLYAILGVFTLNFFSSCGAFLSSSRSAQ
FT                   LASDQSTIYVQTQDDETVQAEKVDPLHREDALLRTYAYELVKVGWTWNGGSPPKKHNDH
FT                   IYPGELFAVAQSIDPLLRDGWLEIEHQKYEKAQQPIQEYLSGQWQSVVEIKRDTDIHLT
FT                   QIKPGQWQIHVISIRTHRSKDGKSFPEKLNKKLVVEAVIPTEGEAQRLFGDSYSQLNHL
FT                   ITKYQRHGLMITSMEDF"
FT   gene            complement(27787..29067)
FT                   /locus_tag="AM1_A0027"
FT   CDS             complement(27787..29067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31536"
FT                   /db_xref="GOA:A8ZK36"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK36"
FT                   /protein_id="ABW31536.1"
FT                   /translation="MSVIGLTLLFIALGEVSAHAINEDLDPSVGVDLLRESKIRMFETS
FT                   QWWDALWEDILGDNPRTTVNNKAMFSILLPFLLVACLVLMARAGMSFLSGETHRIVLQQ
FT                   IVPIVLLLAFTLNYGWGAKVVAWSFREVANRGSDLILDSQWAGLVVRDALKDKIHASSA
FT                   IAEYNRQSASCSRLPAITLRDPAAASSSQGLDQVQAPKVQTAVRCLELLAQKLERDEAA
FT                   IKKDCPSCETALEVIESRKKGIQADLGRISAAIFNTLNPIDDAIHGFNVVKENAVRTVS
FT                   IEGPLQIQYWFVSGQELALILSGILAPIMIIYSTLPIAGHKWAVLQYQKALVIIALVRF
FT                   AYIFVIGFGAIYLTDNPIADQGAAFATFLGYIAPAVATAAVTVGALAASGVYTGAVVTT
FT                   VGAAVTVVSSAALSASSAVTSRALRNR"
FT   gene            complement(29075..30226)
FT                   /locus_tag="AM1_A0028"
FT   CDS             complement(29075..30226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31537"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK37"
FT                   /protein_id="ABW31537.1"
FT                   /translation="MQPKPLLITLVLSVQATITTVPAYAQVSYDDPVISTDITLPTTTT
FT                   PTTFPDVPIPTGDVTIAKDNPLDTSTYTEVPTAQLPSGLLGTVFNVLGPKQKPGQARVI
FT                   NETQRKILKVYEYGQKALDAYKVGRAIYDAIDNFSLKRILSGSISTVLSEYDKLGTNGT
FT                   SESQQGGSGSEDPIYSDPQDPFQVYTQARNNEARKALLPQLMTQLVFSEDGQALIQQQG
FT                   EQVQQSVVNTIESTQALVQLSAASKEQATAGAGIATSVGETGQKAQTLKSSQAVLKSLT
FT                   AQNSLMAQGTATNGAILSNVVSGQEEQKKSSDALVVGSALAHQQRTTGLHLSASELTLQ
FT                   EQIRAELELYKDERHRAQDQAALREQLSFNYLYIPGLYSEAAP"
FT   gene            complement(30216..33362)
FT                   /locus_tag="AM1_A0029"
FT   CDS             complement(30216..33362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31538"
FT                   /db_xref="GOA:A8ZK38"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK38"
FT                   /protein_id="ABW31538.1"
FT                   /translation="MDFETVNEGQTRDILSVNTMLDGIPVFYLGASIAVLGVGFAVLIK
FT                   FGFLLAVLFIALTSVGIILIFGRNPSQQMERVGKPTTYMDGRPSLRFDNVGMPVMAKAK
FT                   KTDPLRRIQDNFCLKTYGQFEFEGVTIGFHLHHWNSREIKIAFMFDVLGLDPTVTPAQS
FT                   KQQLNKSNQKICHLGGTDLKAIMDIRADCSDPLIATATALGKATDALTTAQLQSDAENL
FT                   QSLEAEGRIVKSRLLYQAKCRMRLGGDYDTPDSPADVVFEWVSGFWNDTVAQKVMGEAY
FT                   QSKEQWEKAIFAAYTNSYKRMTRMLTGAEGLGHKIQPLTAQELFDWDYAELHEESIPIP
FT                   QYTRYDDLGLDPNPVVSEHHLHSLGVLFEPEKGKPAVPQFGESLAYLPNKGKYVGALRF
FT                   EGLRTIPEVQDSTELGFIKFLFDTLATPGELFLDARVVTELLPIKSGLTRAILEQTGRN
FT                   SIRKMGDAAQRKELNPIALERLEETKKNLEWMNNGNRPFWVAFAIFLYRDSVDQLNLDL
FT                   DALAQKLEGTKAVKITQKFEHHWCTSLAISAAPMLTLPGGGNHLYKTMSPRVLPTLPQI
FT                   HPAPMDCRGVLLIGYDLPISFYLDLAHTFPNHTLVTGETGAGKTMLMLEMTSYCQREGM
FT                   NVVGFDFPPPTGKSSYEPYMATQEQLGVSSNYKPVDKATINVMEIPDVSWIDDLPKPGD
FT                   PGYDSQQPTREEAWKFIKRNKLRILKAIAMGDAGQSNPMENLLIERALGLCFESFHEAH
FT                   LERYTLASNAPFGSDEAAQMPIYEEFVAFAKVWLKQYIQVNDCGPDLQRTFEHLQLLLE
FT                   GVIPTALGDSINGISSFDANVDALILGLTNVDNDSDSLVYGVAGFDLLIRKAMNGKRTL
FT                   LPVDEGSELLTRTIFAEMVGSLANSGRKWQCNILIGMTEVKTLLDSSCASKVISNLQNK
FT                   FVSHVNEYARKLLVSEFGIQSKILEKFEHESFRASKSLQQSHWCWQRGSRQLIVTHNPS
FT                   NFTLGVGANQGEQTKARNRVMSRYPDDPVAGLVDFGDQLSQANKQGIEVETIGVEDYAA
FT                   "
FT   gene            complement(33375..33926)
FT                   /locus_tag="AM1_A0030"
FT   CDS             complement(33375..33926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31539"
FT                   /db_xref="GOA:A8ZK39"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK39"
FT                   /protein_id="ABW31539.1"
FT                   /translation="MKRLKILYEKTSKQPWWFGYSGFLIIGLIYNLPWLQATSLACLAI
FT                   TASAVAWRRIIRRSPHVLAGLQTVSITTGYQQYAQAQLSVPDSVCNGFDVIPGFGERMI
FT                   GGLGWLNVQGFSLAGAVCGIGWLILAGVVLGAIGFAGKNSLGHSHHGGDIQEMSRPVVG
FT                   LLYFIIVMIMIGALIFATTR"
FT   gene            complement(33959..34765)
FT                   /locus_tag="AM1_A0031"
FT   CDS             complement(33959..34765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31540"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK40"
FT                   /protein_id="ABW31540.1"
FT                   /translation="MYKTIAAFIAAWLGLFISPATAETIKIAPGHGHLIDLTSSWCRVS
FT                   KAYMGTRGIFDLSLDQPQPQTQKIYLTWKPNTQVKSTNLILDLVGCNRSSMELTINRSD
FT                   SAPSTAITRIGTPTPIAHTPEQSRVFTGRLGQPPERTRVHQATTAVQPLTLQRRTKVLP
FT                   KPKTVKRPPVRRISLPQKVKPIPTANLSLVKRNVSDSRTTPATLLRGLNIARASGNQTY
FT                   RYRSEMHWRVNGMIRQMRWGKSPEDAAKLAKISPDQLQTLLNYAQQ"
FT   gene            complement(34848..36050)
FT                   /locus_tag="AM1_A0032"
FT   CDS             complement(34848..36050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0032"
FT                   /product="RNA polymerase sigma factor domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31541"
FT                   /db_xref="GOA:A8ZK41"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK41"
FT                   /protein_id="ABW31541.1"
FT                   /translation="MTAASISSPFSEGIRLPDYLTQLLHRFPVPNPEEELDLIRKAKLG
FT                   HETSLSWLMIGHVRLVSKLAKQYAWTLDDAQDLIQEGMLGIRHAVRKFDSTKGCKFSTY
FT                   ARGWIRGYIRRFCYKNRPKQLRLPEKKQVHLDRVYRLQNQFPDANLEEIAQKANLKLEY
FT                   IEDLLYWGRSFQEIPDWHEFTINDESFYTDDEEYDEYFDFEVVSETKTNLVLIKAPPPF
FT                   IPPKYQIPVHLLKQWFRVGLAQLVSAAQGQVKAVRLGFSQSFSRYSSKPEVGQERVNLS
FT                   TWPASLSFCYENSTNPSAYSHNPRQTPSIATKSLPTKAIALVKGVITHAQESLLVLCGG
FT                   RSDGPTDRPGYQPSPADQRCRGLGEPGTIGRGHLGFGPAVTRFIHRPLAAISDCLRGGW
FT                   P"
FT   gene            complement(36165..36596)
FT                   /locus_tag="AM1_A0033"
FT   CDS             complement(36165..36596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31542"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK42"
FT                   /protein_id="ABW31542.1"
FT                   /translation="MLTINTDSGKSRGGNNDLQSSDQLDPQVIQEFREIYLQIAVKVQN
FT                   LMSMGVAYTYDKLYNLGCEHPPLSYRIDLMVSYELRLCGYSKDDQVNILFHGPYIQSQM
FT                   LHHHLSERGARHYIRQRLAIAPPVPLELGQAQATPTTAA"
FT   gene            complement(36932..37144)
FT                   /locus_tag="AM1_A0034"
FT   CDS             complement(36932..37144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31543"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK43"
FT                   /protein_id="ABW31543.1"
FT                   /translation="MAFPKRFVLHDDGSFVKDFDLNQQKLTMTKDQTEAQSLTLLEALE
FT                   VVERLGSLASKRLVVKGFEGVNRLW"
FT   gene            complement(37131..39170)
FT                   /locus_tag="AM1_A0035"
FT   CDS             complement(37131..39170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31544"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK44"
FT                   /protein_id="ABW31544.1"
FT                   /translation="MLQRQHGSPSHVPDYVFQHPRRPKHDPLPADPLGQRLALLFPNGW
FT                   DWIFASVPEQGNPVDWETVKKFPLSPVELWSLHQDPDCLIGVRPNAQTRWLVLDIDKDS
FT                   RYHPTSAPHWLPKIRHALEEIGICRSLLCQSSHSGGLHLYLPLPESVSSFWLSVCIKLN
FT                   LEAEGVKFCGGQCELYPNPKRYVPKGKGYSLFAAFRLPMQPGSGFHPLDTDLNPLPWFL
FT                   EDWLDCFELCADGQDMGRLHHAIADAQQNFKVRKSGNASSLATWQERIHEEKSQGWTGP
FT                   GQTNEKLKIIACEARVFLGMDSSEQIAEYVCQTAQNTPGFNEHCRHQHEIERRSYEVAT
FT                   WTMRYYWPAGSAPARDAKYNDKQVAPADFGYHQSKREAAQNRIKKAVFELRRVSKLPPG
FT                   ITARASAIAKLAHTSQKTLYRKSNLELWHPHHLPPEPPQKALDPLQEGTITQLCSNNTH
FT                   FLNQRKLELYLLKDLLQLYIYVGFVIMTMRIQAAVALALKGQRAAKAALVNSEDLDRGG
FT                   LGGNSKVIPIQNWDQLHLSLPPGLQQKISKAKRQQQRELEYEQRRRQRVKARKSQRKAL
FT                   SEANAELRPQNQEQLPLQLITNGEQPIEREARLSEREEFDHWYQLAMQCKLVADYSWRD
FT                   GEYWVLAEEQWQPYTELSAVFTLRAMERMFGVCLDLKGDTDGFP"
FT   gene            complement(39944..42067)
FT                   /locus_tag="AM1_A0036"
FT   CDS             complement(39944..42067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31545"
FT                   /db_xref="GOA:A8ZK45"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR027910"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK45"
FT                   /protein_id="ABW31545.1"
FT                   /translation="MSASDRHRSTRKVDIRVNGFNSDELVTRSKLTMNLDCHDDILAAD
FT                   KSGENISPESHHLASVNSEDQIFFVTLPLDVAIDQVISLDFLDQMIDFLLERTDLSRLI
FT                   IQHLYLHLLKVYKFKVEEVIKEKGKSALDTFLPHIQINTDISRESQVLQFNIDEITVKK
FT                   YLNESLSDFFCHESFKGTISNTFCRELLNLALQELESELGSKALREMSASQLQQIVIKF
FT                   LKTNKTGPICDQIKVRASFHSREIALILIEQLSLPSCSLEDMHALLGLRRSPLPKNKAR
FT                   IELPAVTALPTSIPIASSIKAQLRPDLWQQDENSNAKFKYRSKSNPGNFIEHYITSPGD
FT                   IALLPWEAAEQIIDIFGFDTVKLQLIFAAKTMEQEEPWNSSFTLNATDIIKLLGWDKNH
FT                   NTALPEKRLAVASTAYALSCLLVRSVWIAGRGKSKIDASTPTGRMWDVLIEPTGQFDFV
FT                   TKKIEKPEEVYITVSPGLWTMNFLNRAGLKAQEALYQFGYLAKDILQIDPYHNEMALRL
FT                   AIQLTLDSRIRARNENPYDYTVGKLLEEVIPLSEIETARNQKGKARDLRKRWDKSLKML
FT                   NKLGWLLQFDPETYPSWLQPDSESPKPKNWRKVKLIDRLLDAKLTISPPNPIPELLTKI
FT                   GSPKKMALVIDRAQAVDIEPSSLLKARKVKGLSRKQLAGFIDVSSDYIGKMERGDRPIT
FT                   LEIAEKLKRILVF"
FT   gene            42139..42252
FT                   /locus_tag="AM1_A0037"
FT   CDS             42139..42252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31546"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK46"
FT                   /protein_id="ABW31546.1"
FT                   /translation="MFEKERLMILIKSDLKSVFSINKDLLFQMNRNVTLNL"
FT   gene            complement(42274..43341)
FT                   /locus_tag="AM1_A0038"
FT   CDS             complement(42274..43341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0038"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31547"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK47"
FT                   /protein_id="ABW31547.1"
FT                   /translation="MPSKQTTSISTESNVQSVEIAKIRMDGGTQPRSQLYEEVVAEYAD
FT                   DMQQGAKFPPVTVYYDGKEYWLADGFHRVRARESLGTKEIVAEVRLGTQRDAVLFAVGA
FT                   NAVHGLRRTNADKRRSVERLIRDHEWSLWSDNAISKRCGVSNTFVGKIRNELQLNSNDS
FT                   PAKLRRGMDNRLIDTSRIGGKSFQDEKDTTKRQRKRKQVSELDLKQLTVEPKKVVNGDI
FT                   WRLGKSHYLFCGDSSSKKFQKLLPSEIGLFMIFLDTQEYWPQSLPENTKNALSFYSSYG
FT                   EDIDLRNLREIIENCLATTTEADDTVVMLNLPDPSLFILMESLYCLCYCAESDPQRCTD
FT                   ALTAWSAISQPLKKL"
FT   gene            complement(43472..44029)
FT                   /locus_tag="AM1_A0039"
FT   CDS             complement(43472..44029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31548"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK48"
FT                   /protein_id="ABW31548.1"
FT                   /translation="MYLIRSDSSITNLDLSEINLDEEVQPRKQTNQAVVQEYTGAMKLG
FT                   AKFPPVTVFYDGAEYWLADGFHRVRAKESIGQPIICAEVWLGSRRDAILFSAGANTIHG
FT                   FQRTNEDKRRVVERLLKDSEWNQWSDNAIAKKCGVSNTFVGKLRHQLSPTFNGWKSKTR
FT                   RGIDGRVINTHKIGQKRNSSRM"
FT   gene            44400..46973
FT                   /locus_tag="AM1_A0040"
FT   CDS             44400..46973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0040"
FT                   /product="TPR domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31549"
FT                   /db_xref="GOA:A8ZK49"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK49"
FT                   /protein_id="ABW31549.1"
FT                   /translation="MKLSFGEVPKKRTKRILRAILTFANGNKQVNSYRYCLSNIQIDRS
FT                   GPKQVTIKATLKQLAELVSYSDKLHVESSPDPLTQWSLQEALEHLRLTLGVFSDIRQKR
FT                   QGSKYWVFRLDLWFVIEDQVGNLAEFDRKWERKKNLVSSKKTSTSQLENHIPFQVLVDI
FT                   QNFVGREAELKSLENFLVFNKSGIAIVGIYGMGGVGKSTLAKHFAHQYRKSFPDGVLFA
FT                   DLRIQEPSALLESFARAYSCDLNSTMNILDKAERVRTILSQKRSLLILDNANDSEILNY
FT                   LLPTFGQCSVIVTARDKDIAPLQGFQELILEPFSKSESMELLTKLVGRDRIKSENNEAV
FT                   KITEMCGNLPLAINISGSLIKFSCCSLSDYRFSFENEQQKLDIFEWRSRSLRSSFNITW
FT                   DLLGETLKRLLSTTSIFGGSSIDIDALSVMLDKKPIKLQLEMGGLIAVSLVYTNKSKHY
FT                   KLHPLVKEFATEKLFERESNEVNTLHLCLARYYLSSIKSGKLNYDHINDNYGNIIEIVY
FT                   WTFKNCYFKEVVEFGNIIGDFLLFKGYWNDGNNILRNTIFACQQLGYAQTEFEIRLKLS
FT                   ELAREQADYDQAQEQYEACKTFFEETDQKSQLAIVFRELGELTRVRRNYLQARKLHQKS
FT                   LLLNIELDNKKGEAQSLHDLGLIERIFGDYNRAIQLFERSLKIRESLGDLLGISYNYLE
FT                   LGIIARLKKDKKAIEFLRSSCFEFERFGDKRGLAYVFRELGELAVDEMDYVEADKFHKK
FT                   SLQLRQELGDQRGKAISLYRIGRLNQLQKNYELSKQYFLDSIAIAKKLDDKLHKAFNLV
FT                   RLGELANLSGQKSSAIANWRQSLELFNEMHVADPEAIEVKELLMS"
FT   gene            complement(47081..47785)
FT                   /locus_tag="AM1_A0041"
FT   CDS             complement(47081..47785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0041"
FT                   /product="SAM-dependent methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31550"
FT                   /db_xref="GOA:A8ZK50"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK50"
FT                   /protein_id="ABW31550.1"
FT                   /translation="MDILRGINENRPWDLIYEIRKVVKTQHRLLDIGCGTATKLIQLAS
FT                   ITNYQEIIGIEPNERMRFKAEENIKLANLDNISIVSGSAEDLPFEDHVFDVVTAMVAPH
FT                   NTSEVHRVLKPGGHTIIEKIGDRDKWNLKALFGRDSKGLRGQFCDYDEGEREIEFREEF
FT                   SHLFTEVSTKNGFWKTYYSFEGLILLLEQTPTIRGFDRIEDSHVLEKIVETYMTDRGII
FT                   TTQNRILVAAKK"
FT   gene            complement(48258..48443)
FT                   /locus_tag="AM1_A0042"
FT   CDS             complement(48258..48443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31551"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK51"
FT                   /protein_id="ABW31551.1"
FT                   /translation="MGKVKVFSTNRYWAFNLALKSEIMNHFAIQGILLEKSLRYTQEKR
FT                   AIACFVAEMVIFLERH"
FT   gene            48497..49573
FT                   /locus_tag="AM1_A0043"
FT   CDS             48497..49573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31552"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK52"
FT                   /protein_id="ABW31552.1"
FT                   /translation="MPSASIDKLNQLKRQLQDCINPTAAKLLKSTIAKLEAQLNLGQDQ
FT                   IEVSKIDQIKTTNTNSSKVAQRKAAHKKSERKSRQKASQKQRTTLKAPSLNKVETKPSV
FT                   ISQNKKLPIPAQEKPHVKTVDTPNSKNSNSKNQKQAKTTSKSKSGELSEKPPLLPGNGT
FT                   HRAWCRIPGIIRVREKEFEDGRTKSLYFVEVDGQPIKLFLSKKSFKKVKSVLDKPVIVF
FT                   GYPNIMNGQITSLQLTGTSQRASAKTENWVLIGVWRADKQRVLIQRDQERDPEIHIRQH
FT                   SPLVREDCLEKLKDGKLYEFTCHRDGVTIKVVAVGERSTQKSNATESTDHEITDPEIKD
FT                   QEIIDQVFSKLESSTLQV"
FT   gene            49570..50043
FT                   /locus_tag="AM1_A0044"
FT   CDS             49570..50043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31553"
FT                   /db_xref="GOA:A8ZK53"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK53"
FT                   /protein_id="ABW31553.1"
FT                   /translation="MIESRPSLSLNVRLTEEQLGFLDYLYPNIDPEDALIRILERARNR
FT                   AIRKAEQQVHILHPRQEEAEQPETSPDQPISQVDEQVKNPIGQLQELCQKQQISLPRYE
FT                   FSEISEGFRCLVQSMGLQGVGEGASKKKAKMGAAEMLLKRAEEGLCHISPSKG"
FT   gene            complement(50398..50511)
FT                   /locus_tag="AM1_A0045"
FT   CDS             complement(50398..50511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31554"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK54"
FT                   /protein_id="ABW31554.1"
FT                   /translation="MVLGTGLGLRATIGGVIGESSNALKSQYLDCFTIGKV"
FT   gene            50462..51013
FT                   /locus_tag="AM1_A0046"
FT   CDS             50462..51013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31555"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK55"
FT                   /protein_id="ABW31555.1"
FT                   /translation="MTPPIVALNPKPVPKTIPQLPKSVPSAPKLVSRTAFPKKTPEGTR
FT                   PAKLEQGHEELGGLRRSFRRPSQSTKPEFTPKTRSSEAPQVNQPRTPRVSAELERRFRN
FT                   LELKQKNLVEQTRTRGELEYLAVSKNSSGRYWITVAGTGKPFVRNTFASAEFSWGIDVE
FT                   IEGKFENGYMIELCPLKTMN"
FT   gene            complement(51042..52709)
FT                   /locus_tag="AM1_A0047"
FT   CDS             complement(51042..52709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0047"
FT                   /product="mechanosensitive ion channel, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31556"
FT                   /db_xref="GOA:A8ZK56"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK56"
FT                   /protein_id="ABW31556.1"
FT                   /translation="MSYFWPSLAHAQFPSFSHLDTSSNRQPNIHYIQRGNMHIANVRLD
FT                   GVSLFQVAAPTAIDDPDSQSNILPIEWRVNEIETHLEKIVNSGIDPNALRVTASTLNNQ
FT                   EVIIAQGKDWKLPLMTITELDRQIDSTSYSISEIAKVKASKIKSALLEANRERQPEHLK
FT                   QQLFYLLIILVAVIIISLILRYLQILLKHQWTQLNSKNIKNPSTTQNNDFPDGQTSIES
FT                   YQETTIGHPIRKHLPKLSLPQQKNINLTLRSLLWWSQVAIWLSFAIFALLLFPQTRQAG
FT                   LWLVGVPVSFIGILLVLSISKKIIDILIVYGLHRWSENDAFNHTPNQRITLRTPTITNV
FT                   LQEVTRYVVIIIGILMFLDAIQAPLALVLTGIGIVGLSAQNLIKDFINGFLILWEDQYT
FT                   KNDVVKINGIVGLVEYLNLRVTQLRTLEGELVTIANGSFSTAINLTHQWSRINLGIEVA
FT                   YSTDLDQAMAVIEEVAIKLQHDPIWGVLINETPTILGVDAFGESSITIRILIKTQPMKH
FT                   WDVGREYRRRLKQAFDQANITIPFPQRSIWFEGYSVDT"
FT   gene            53012..53401
FT                   /locus_tag="AM1_A0048"
FT   CDS             53012..53401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0048"
FT                   /product="Glyoxalase/bleomycin resistance/dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31557"
FT                   /db_xref="GOA:A8ZK57"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK57"
FT                   /protein_id="ABW31557.1"
FT                   /translation="MLNYVSVGVTDIDQATSFYDVILGIMGYVRLYEDPGQFVGYGETW
FT                   PEFWITQRSDLSQDSEVSKETYISISAPSFEAVDAFYKTGLEVGAESSDSPGYRPTYGQ
FT                   EFYSASIYDLDGNHIEASYYELSSF"
FT   gene            complement(53424..53744)
FT                   /locus_tag="AM1_A0049"
FT   CDS             complement(53424..53744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31558"
FT                   /db_xref="GOA:A8ZK58"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK58"
FT                   /protein_id="ABW31558.1"
FT                   /translation="MNTCAFQGILLEKSLRYTQERRAIAEFVVEINPLREEDPRENLKA
FT                   IYWGENGEKAHNALQAGDQLILQGQLRINKVTHKTATRNMWSSRLALSLIRSTDSTVQI
FT                   NQ"
FT   gene            53870..54691
FT                   /locus_tag="AM1_A0050"
FT   CDS             53870..54691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31559"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK59"
FT                   /protein_id="ABW31559.1"
FT                   /translation="MPSATIDKLNQLKVQLEQCNNDTAALLLKRTIAKLESQLQREQLT
FT                   TQSAKLTPQEPPKTSQTIFKQQSSVQDKKVVPQQQQTTKNLQAKSKQRNHRKKRRPLLP
FT                   GNGTHRAWCRIPGIIRVQEAEAEAEQPVYFIEMDGHQLSLRVKKRFRKLIGASLDTPLM
FT                   VKCYPQIIEGQIVFLQFCGAAESAPETPEDWVMIGVWNSENQRVLVQRDQRCDQSRRIL
FT                   QHSPLVKEACLEKLEGGKLYRYQCQREGFTVTIVGVEVVEGEEGEIVQKAS"
FT   gene            complement(54743..55012)
FT                   /locus_tag="AM1_A0051"
FT   CDS             complement(54743..55012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0051"
FT                   /product="RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31560"
FT                   /db_xref="GOA:A8ZK60"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK60"
FT                   /protein_id="ABW31560.1"
FT                   /translation="MSIYVGNLSFDATEQDLNAVFAEYGTVKQVKMPTDRETGRKRGFA
FT                   FVEMGNDAEEAKAIDELEGAEWMGRTLKVNKARPRENRGGGNRW"
FT   gene            55256..55555
FT                   /locus_tag="AM1_A0052"
FT   CDS             55256..55555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0052"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31561"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK61"
FT                   /protein_id="ABW31561.1"
FT                   /translation="MSSSINQGILVTVICEAVLQHRIVQLLDTVGASGYTIIPAQGAGS
FT                   YGQRMGDIEGFNTNIQVKTIVSLEASDQILEDLQQYRESHALIAFRQQVDGLFD"
FT   gene            55728..56300
FT                   /locus_tag="AM1_A0053"
FT   CDS             55728..56300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31562"
FT                   /db_xref="GOA:A8ZK62"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK62"
FT                   /protein_id="ABW31562.1"
FT                   /translation="MLNASISHEDIDNQQVTAIISHLVRLGREQDYEEWIRGFSAVAQQ
FT                   FRGYGGLNILRTSEQVHPEYVLVLRFDCSSNFKDWLESDTRSEWIERLQPLIARPEDIQ
FT                   AMTGLETWFVLPQKLHKPSIPRYKMVLVTWLGVFIVLAILTRILAPLLSMLPLLLNQLV
FT                   TTGLVALLLTYVVMPQLMKLFRRWLSS"
FT   gene            complement(56392..56958)
FT                   /locus_tag="AM1_A0054"
FT   CDS             complement(56392..56958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0054"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31563"
FT                   /db_xref="GOA:A8ZK63"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK63"
FT                   /protein_id="ABW31563.1"
FT                   /translation="MNQKLNETQRKILNTASDLFYQKGTQHVGINEVIATSGVAKRTLY
FT                   RWFASKDELIEAVMKHRAMQWLEWFEVAVEDRGNTAKDRLLATFDVLEEWYADPSFRGC
FT                   PFINVVLEIADASHPAHHISMSVRESIRQYVMRLATEAGVREPEAFSQQYLLLIGGASL
FT                   MATIEGKSDGAGFARNTLSVLIEAG"
FT   gene            57060..57617
FT                   /locus_tag="AM1_A0055"
FT   CDS             57060..57617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31564"
FT                   /db_xref="GOA:A8ZK64"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK64"
FT                   /protein_id="ABW31564.1"
FT                   /translation="MDFKIYTLETAPDESKGALQQAEQTFKFIPNLEGILAESPATLKS
FT                   GMALWDLFETTSFTPIEQQVIYLTANYEHECSYCVAAHSGLAKMVGMSAEDIEAIRNGK
FT                   PLIDQKLQALRHFTKRMISERGWVGDEEIEEFLAAGYTRQQILEVILGIAVKVIHNYTN
FT                   HIAKTPLDKAFQPYTWSKPSVP"
FT   gene            complement(57638..57820)
FT                   /locus_tag="AM1_A0056"
FT   CDS             complement(57638..57820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31565"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK65"
FT                   /protein_id="ABW31565.1"
FT                   /translation="MVLFHFADPGSRSFCHVLSGTFREMLSDLRAWELECQDWAVGGLG
FT                   LRLKIGVSNSTNCII"
FT   gene            complement(57962..58861)
FT                   /locus_tag="AM1_A0057"
FT   CDS             complement(57962..58861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0057"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31566"
FT                   /db_xref="GOA:A8ZK66"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK66"
FT                   /protein_id="ABW31566.1"
FT                   /translation="MLIALLVESVTAFIPSSQVAFLPTFYLKESMEMLAKDPNSELFST
FT                   DMEPLRIDVIGSLITAAPIDVLVNVILVWAKQHKSKMVCIANTHMLVDAHQKPSFGEVL
FT                   NDSDIVTPNAMPLVWLLKRMGVKTQEIVTSLNLMQCLCQKASQQKVSIFFLGSQCLILQ
FT                   KMRHRLAQDFPELLIAGMEPLPIRPLTLDQRQKLIQRIKHSGAGLVMIAYSSPKQEYWM
FT                   AEHKNQIEAVMIGVGGAFPAYAGLNSSVPTWMKEIGFEWIYRFFQEPTKFWKKHVKTTS
FT                   IFIHLALNQIWNRYFELR"
FT   gene            59755..59967
FT                   /locus_tag="AM1_A0058"
FT   CDS             59755..59967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31567"
FT                   /db_xref="InterPro:IPR021231"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK67"
FT                   /protein_id="ABW31567.1"
FT                   /translation="MSTTISILAGIPEELHETLINYLEDHPDWDQDRVFSAALSLFLMQ
FT                   YGQSDRRTARVYLDSLFKKDLPTAC"
FT   gene            59967..60440
FT                   /locus_tag="AM1_A0060"
FT   CDS             59967..60440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31569"
FT                   /db_xref="GOA:A8ZK68"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK68"
FT                   /protein_id="ABW31569.1"
FT                   /translation="MPTPQPISSLTIHLTSEHLGFLAYLYPKEDPEDALIKLLDSARTR
FT                   AIRRAEQQVRVLHLDQEEPEAPEEDPEEPVNLSGDVVENPIGTLQELCQRQQISMPSYE
FT                   FETIPEGFRCSVQAMGLRGVGEGVSKKKAKMGAARKLLGRGCFGMDRESQQSE"
FT   gene            complement(60432..61205)
FT                   /locus_tag="AM1_A0059"
FT   CDS             complement(60432..61205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31568"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK69"
FT                   /protein_id="ABW31568.1"
FT                   /translation="MQSEKPNLSKFSTLDTDRVLELEAKRKAKGYQPGWLYYQCKPLGL
FT                   VDVMESLRSQGLIEAKNTKEGKAKPRQLLTIELVPRSCWFSNVRSEVSKEDWNELRKMT
FT                   YEKANNRCEVCGGRGPKHPVECHEIWHYDDDQHIQKLEGLIALCPSCHEVKHRGLANVK
FT                   GRGEIADQHLAKVNHWTMPKTQKYVDDQFQVWIKRSKYEWELDISWLNQFGIQVKPKRV
FT                   RSKVVNEGMDKNSVRVLDNSHKDWSLDDFMNPNLF"
FT   gene            61470..62132
FT                   /locus_tag="AM1_A0061"
FT   CDS             61470..62132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31570"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK70"
FT                   /protein_id="ABW31570.1"
FT                   /translation="MPSPTANDHQGPTSEPINHLIDEQMDQITDPNLPFMEKFGRAALQ
FT                   VAIAVHETEGRGMILGLQSPSSKKFVYVQEEKTAIALWMTAVSIKRKVAQLIEQYDPDR
FT                   EAVVVMVVSPTVQLYRASAGKMDLVEIQEVEQTSIKLPAGVKIKSEQQGQVFTYNFTHQ
FT                   KLGKLGRIVVKPHRGNQAQIDYELADTGFDPKAKQRQEIFVPLAQELMQRIDLGLMR"
FT   gene            62279..62560
FT                   /locus_tag="AM1_A0062"
FT   CDS             62279..62560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31571"
FT                   /db_xref="GOA:A8ZK71"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK71"
FT                   /protein_id="ABW31571.1"
FT                   /translation="MNNLLPFQAISPHKIRVFHPKSFEDAEKAINAMKTDDMLLVNLAA
FT                   LETKLAQRLTDYLAGSTFALSGEQMEIGRGIFLFAPPSFLISRIMASG"
FT   gene            complement(62593..63378)
FT                   /locus_tag="AM1_A0063"
FT   CDS             complement(62593..63378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31572"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK72"
FT                   /protein_id="ABW31572.1"
FT                   /translation="MAADNKYSTVLLELKTHYQETLAELEAQTTQLKTKITSLDTLIED
FT                   PLLGSDILSILQGEADSIDSEAPDSTVTNTVEPKAKSKKTTQKAASKKKSATPKKPAST
FT                   AKTKGTVEPKAEATPKKAAPKASPSSGKRKSSTPKKAVSQATAKKKNQKKTSSPSSSVL
FT                   TMNKPYDQMKKIDAITQIMQENPGKVMHYDDLIVRLFGELSKDDQKAERGRIKAAMYQG
FT                   AKNNLWKKANVPMCYIYDPSLQAESKATNSKAQKSRKKT"
FT   gene            complement(63443..63598)
FT                   /locus_tag="AM1_A0064"
FT   CDS             complement(63443..63598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31573"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK73"
FT                   /protein_id="ABW31573.1"
FT                   /translation="MHELGTQESPSLLFRACFNISQPQRLSAKRKMSKPSRNSEFSPLM
FT                   IRYKGR"
FT   gene            complement(63633..63749)
FT                   /locus_tag="AM1_A0065"
FT   CDS             complement(63633..63749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31574"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK74"
FT                   /protein_id="ABW31574.1"
FT                   /translation="MIHATMNRYAFQTILQSKYLRQTQDGQAMIITLRVVLE"
FT   gene            63900..64475
FT                   /locus_tag="AM1_A0066"
FT   CDS             63900..64475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0066"
FT                   /product="riboflavin biosynthesis protein RibD C-terminus
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31575"
FT                   /db_xref="GOA:A8ZK75"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK75"
FT                   /protein_id="ABW31575.1"
FT                   /translation="MRELTYFVACSVDGYIAHIDGSHDGFSQDPEYFADVFATFPETVP
FT                   SHLRDALGVHGENKWFDVVLMGRKTYEIGLKEGVTSPYSHLKQYLFSRSINTSPDENVE
FT                   LVSNNTIDLVTSLKSQSGKGIWLCGGGDLATTLFAHHLVDQLILKINPFLMVSGIPLFS
FT                   GVIQQTALELTDHKIYENGVLLLYYRVK"
FT   gene            64839..66317
FT                   /locus_tag="AM1_A0067"
FT   CDS             64839..66317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0067"
FT                   /product="rieske 2Fe-2S domain protein Pao, putative"
FT                   /note="Phenylpropionate dioxygenase and related
FT                   ring-hydroxylating dioxygenases, large terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31576"
FT                   /db_xref="GOA:A8ZK76"
FT                   /db_xref="InterPro:IPR013626"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK76"
FT                   /protein_id="ABW31576.1"
FT                   /translation="MTTHINPETEALELNSPKPRSAAVEQPFNWLKQWYPISPLSYLDS
FT                   TCPTPITILGKKLVVWHHERQWTVMDDTCPHKLTQLSLGKIQDDGTLVCRQHGWQFDCS
FT                   GQCVKIPMLADSGSSAAVYRNVRSHVSTYPTQVAQELLWVWLDCSSAAQEECQQKQPAT
FT                   LPDPSEQWTEAEWHLSDVPVGYTVSLESSLDPSHAQFLHEGIFGFSPATAMPMRDLELE
FT                   GEMSAEDGFMLRHGGYNAFNQGMRATRRFCPPCANMTQYHLPTGGIQIFQLYFVPTTPG
FT                   HCRYIGKFAIDTPPPAPRFNFFQWANRQLWGLLPQDVQVGLQHLGAYKLSDQDITAMHA
FT                   QEQNEAADPEHRRTSFFPTPADQGILTLRTWFKQFAEGGPATNTLYSEGVETTSDEQLY
FT                   DRWHRHTKLCPSCRHSVDRLANAQKLCQRLAIVSAVLGAVMLLLPILPLRVSLGCLVIS
FT                   IFSLLGYQGLSQLQHRFMSSIPQQGSPKITLYAE"
FT   gene            66414..66533
FT                   /locus_tag="AM1_A0068"
FT   CDS             66414..66533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31577"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK77"
FT                   /protein_id="ABW31577.1"
FT                   /translation="MPRYGFEVIPKGGHCMVLEMRLWGAGKRRSKKQAKVGAA"
FT   gene            complement(66619..67269)
FT                   /locus_tag="AM1_A0069"
FT   CDS             complement(66619..67269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0069"
FT                   /product="phosphoribosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31578"
FT                   /db_xref="GOA:A8ZK78"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK78"
FT                   /protein_id="ABW31578.1"
FT                   /translation="MLRFRNRSEAGKELATHLQHCAQCSSSVVLALPRGGVPVAYEITQ
FT                   ALHLPLEVCPVRKLCVPEHPELAMGAIAPNGVRILNLTMIDEFMISHQQVELITTQERQ
FT                   TLLRYEQLYEHKRFFPRINHQSVILVDDGLATGATMRAAIAFVQRKQPDFLIVAVPVAS
FT                   TSTSKELEADVDQIVCPLKSQYLMSVGYWYDDFSQITDAEVLQILVQARTDRN"
FT   gene            67219..67398
FT                   /locus_tag="AM1_A0070"
FT   CDS             67219..67398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31579"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK79"
FT                   /protein_id="ABW31579.1"
FT                   /translation="MCREFFSSLRSITKAEHYDLEYLILPLLFECITEFLRIRISVVEK
FT                   IQGDSLLVPALARG"
FT   gene            complement(67539..67826)
FT                   /locus_tag="AM1_A0071"
FT   CDS             complement(67539..67826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0071"
FT                   /product="RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31580"
FT                   /db_xref="GOA:A8ZK80"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK80"
FT                   /protein_id="ABW31580.1"
FT                   /translation="MSIFVGNLSYAITEQDLKTAFSQFGAVKQVKLPIDRETGKKQCFA
FT                   FIEMDNEAEEAKAIKKLDGGEWMGKTLTVYKAKPRVNRMGSDNFVAGNLF"
FT   gene            68273..68884
FT                   /locus_tag="AM1_A0072"
FT   CDS             68273..68884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31581"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK81"
FT                   /protein_id="ABW31581.1"
FT                   /translation="MTTPIISLNPKPIPQTTPGQPKPAPSAPKLLSKTAFPKKAPEGTR
FT                   PAKREPGKGELREIRRSVRQPPRSAKPEYIPKTRSSEAAQTSQPRTPRISAELERRFRN
FT                   LELSQKNLVEQTRTRGELEYLAVAKNGFGRYWITVAGTGKPFVRESFATPSFCWECVVE
FT                   IEENFEIGEVIELRPGETMERIEEMIGVWLERERVAGIWG"
FT   gene            68845..68970
FT                   /locus_tag="AM1_A0074"
FT   CDS             68845..68970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31583"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK82"
FT                   /protein_id="ABW31583.1"
FT                   /translation="MVGAGEGGWDLGVIELLTKCRSNNKDCDETVVPKAKINSYS"
FT   gene            complement(68948..69859)
FT                   /locus_tag="AM1_A0073"
FT   CDS             complement(68948..69859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31582"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK83"
FT                   /protein_id="ABW31582.1"
FT                   /translation="MMSGYYQRLWSKLKRKCLQYSYQAIADPKWFVMFCATRIQILRSL
FT                   AILVTKHSSAQIYQDLEQGGNTLFPSLDVNKVVEHLKKDGLFFGINLPSDILHEVLAFS
FT                   TQVEYHANSNPKLKFTLSDKEKSELKYQQIFVTANHIHSSLICPAIKKLENDSKLREIA
FT                   TKYLETIPVLLDSQIRWTFPVTVPLNEAVRGFFNFHYDLEDYRFIKFMFYLTDVPVSEG
FT                   NHVFVKGSHRNKRLKDQFSLTRDSTDMGIINYYGHNNIENIYGKAGCGFVEDFYCFHKL
FT                   TLPMSRSRLILEVKFAMNSYLF"
FT   gene            complement(69936..70550)
FT                   /locus_tag="AM1_A0075"
FT   CDS             complement(69936..70550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31584"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK84"
FT                   /protein_id="ABW31584.1"
FT                   /translation="MNNFLSGIALVFSTLALLMSGAVLYLDLTTRGVLYPQANLSEDPT
FT                   HDKDKNPSPLGGISSEPTAVPDSNTVIEAPQSVSESKADEFIQPAFNSKATVELISVKR
FT                   IKHPEKGTRNIVNVRLRFRRLAENATKNETFDLSDTQARHSETNEVYKQIINSTGLITL
FT                   QTLPLNASAEGYFWLEIPERTTTIDIVIPKTEMFRNVPITG"
FT   gene            70977..72041
FT                   /locus_tag="AM1_A0076"
FT   CDS             70977..72041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0076"
FT                   /product="transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31585"
FT                   /db_xref="GOA:A8ZK85"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK85"
FT                   /protein_id="ABW31585.1"
FT                   /translation="MTQYSELKRALQPHLNWHGARLSFLTLFLLALFKVKTVNLSELAL
FT                   GFDGSAQSDSKYKRLQRFFRGFDIEYETIAKLVIDWMQIPQPWVLSIDRTTWELGTHCF
FT                   NILSIGVVHEGVAFPLLWWMLQKKGNSSSDERMQFIDALLHICPDPQIRCLCGDREFIG
FT                   QLWVRYLRLAPLLPFRLRIRATDKIERQGKALQTKVVFAHLQVGQRQRLKGECRVWGQP
FT                   VAVEGLRLEDGALLVVIGPTQDDQLIEDYALRWGIETLFGIFKTRGFCLESTHFTEVER
FT                   LRKLFALLTLALCWAMKTGLFLHQLKPIALKTHGRRAKSLFRLGFDHLRQMILNPSPDN
FT                   EREFLKALQLLSCT"
FT   gene            complement(72223..72933)
FT                   /locus_tag="AM1_A0077"
FT   CDS             complement(72223..72933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31586"
FT                   /db_xref="GOA:A8ZK86"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK86"
FT                   /protein_id="ABW31586.1"
FT                   /translation="MNKTTKITNLIIFSLIIGIIPGIIDLYILKCFTPQSAVAIPNTAG
FT                   SLRPPKLVASDLPPGFREVPTPISSLIRGAISSTISDHFGSNEIQIRDLVTYMNLNQWT
FT                   LIIGFVTPLNNENAVQMFDLGLEQPSALEKFVTGIKKSNYYLGSVNIVEQRVAPSLSQK
FT                   IGQVSTGMAVIAKARNVSLFSEMVAFRRNNLGAMLIVGRLNDNIPSMTTSKLAQKFDSQ
FT                   LLNFQSYSHPSNQQ"
FT   gene            complement(73175..73306)
FT                   /locus_tag="AM1_A0078"
FT   CDS             complement(73175..73306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31587"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK87"
FT                   /protein_id="ABW31587.1"
FT                   /translation="MFPALKIKQDTIKLMMSRLRTTFLKCLDIGLCIQKQEHTLLLI"
FT   gene            73272..74744
FT                   /locus_tag="AM1_A0079"
FT   CDS             73272..74744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0079"
FT                   /product="trypsin-like serine protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31588"
FT                   /db_xref="GOA:A8ZK88"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK88"
FT                   /protein_id="ABW31588.1"
FT                   /translation="MVSCFIFKAGNTEPYNEQRIRGAIVKVYSVRNKPDYQKPWETVIK
FT                   RSTGSGFIIADNKILTNAHVVADQTFVEVRRHGQAKRYRAQVVSVAHEVDLAILSVKNN
FT                   AFFSGVTPLEFADLPEIRQEVAVYGFPTGGNALSTTRGIVSRIEHQFYTHSSEYFLAAQ
FT                   IDAAINSGNSGGPVLDGNGQIVGVAMQARKSADNIGYMVPVPVIRHFLQDLEDKTFNGF
FT                   PGLGLVYQKMENPGMKRSYGISENLTGILVRHILSESPAEGFIRAGDVIHAIDGHAIAD
FT                   DGTVVFRQGDRTNFNYYIDIHQVGETVSIEFFRNSKLKTVMLTLNKQKKDFRLVPLEQY
FT                   NELPRYFIFGGIVFSPLTKNLIKSWGINWSKTAPKELLIELSNWPSREKIEIVVATRVL
FT                   GSEVNRGYHGIAGWIVKEVNGKKFKDFSEFCQLVTTSNSPFVAFKGARNFQIVIDKKEA
FT                   EESLDEILKNYRIGAAYSEDLKILSAVGEPNS"
FT   gene            complement(74923..76380)
FT                   /locus_tag="AM1_A0080"
FT   CDS             complement(74923..76380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0080"
FT                   /product="polysaccharide biosynthesis/export protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31589"
FT                   /db_xref="GOA:A8ZK89"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK89"
FT                   /protein_id="ABW31589.1"
FT                   /translation="MIRSLQTIAFITILSTMSPSLAMAEISPKEKLNSSIRSNSIAQNP
FT                   NTQAGDTLINQQAYILGPGDEIQLTMFGQPNLFTTNYRVLVDGTVSLPLIGRVLVKGRS
FT                   IGIAEREIAKRYIRFYRRPFITIVLVDARVVTLAISGEVRHPGTYPVESPTQIPTVTQL
FT                   IQLAGGASQSADISQIKVRRPQENGKEQFISVNLLQLLQEGDLSQNLQLRDKDTVIIPT
FT                   TTTVDFSNALLIRNASFSSDRSEPINIAIIGEVYRPGPHTIRPGSADVQEAGTLGNAKA
FT                   ASTELPTVTQAIQTAGGIKPEADIRQVKVIRRPHNGNPQEIIVNLWELLKAGDLSQDIA
FT                   LQAGDTIVVPKAVGLSAAELTELSTISFAPATIDVNVVGEVKRPGIIKIQPNTPLNTAM
FT                   LAAGGFDDRRANKSKVKLIRLNPDGTVTQREIKIDLEQPLNEENNPALRNNDVVVVGRS
FT                   GLTKVGDNLRNILAPITSSFGIFRILF"
FT   gene            76688..77674
FT                   /locus_tag="AM1_A0081"
FT   CDS             76688..77674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31590"
FT                   /db_xref="GOA:A8ZK90"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK90"
FT                   /protein_id="ABW31590.1"
FT                   /translation="MPGLQNILLEFYNYFGELPFIGVTLILVGLVSFRAIPMSTDLATS
FT                   SAAGLVGLIWGNSQRTLVINSTTNLPELGIMLVSLFGLGRLGGIATPLGSNLSNVYLIF
FT                   IVSPIVLICKWILIKNPNHINNLMILAKLEKQLILWHVFMALLMFFFASFAYLILMGDF
FT                   QFIQHSEGNAVLDIMSLVISIIVSLCGVIVFLIFESKLKKRRPELFEDIDDTNFEASWS
FT                   RFFLGVIMLCLSCYILNDLFAVWTELFQNHFVEFSLFPTIHYFIGSLISSLPEMSVAVG
FT                   NYERLSSPDLNTALGSASQSCMTNLLIAGLGSVIALVLSMVGLLQEI"
FT   gene            complement(77791..77925)
FT                   /locus_tag="AM1_A0082"
FT   CDS             complement(77791..77925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0082"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31591"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK91"
FT                   /protein_id="ABW31591.1"
FT                   /translation="MWGFTHFAETLNGRLAMLGFLLGWVTEIISGEGMLSQILSIFSY"
FT   gene            complement(78125..78592)
FT                   /locus_tag="AM1_A0083"
FT   CDS             complement(78125..78592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31592"
FT                   /db_xref="InterPro:IPR025682"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK92"
FT                   /protein_id="ABW31592.1"
FT                   /translation="MMSEIDQEDTQNNSPKKRSLEHSYSKFTDVECPHCHQSVRVNVWW
FT                   IVDQSTQPDLIQKIVEGSFKTHPCPKCTQLIPEVDQPLLIYRPRQQQPLLFAPALKTTL
FT                   AEDQTHTLQHLVQHLLETLDSSDDDWIMEGLKRIRWNQLLMIYSEAELSFE"
FT   gene            complement(78706..79518)
FT                   /gene="aacC3"
FT                   /locus_tag="AM1_A0084"
FT   CDS             complement(78706..79518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aacC3"
FT                   /locus_tag="AM1_A0084"
FT                   /product="aminoglycoside N(3')-acetyltransferase III"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31593"
FT                   /db_xref="GOA:A8ZK93"
FT                   /db_xref="InterPro:IPR003679"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK93"
FT                   /protein_id="ABW31593.1"
FT                   /translation="MSHMKKKQLITKSQLIQDLRKLGVCKKQTIMLHSSVRNIGWVVGG
FT                   PDVVLAAILSLLTDAGTLMMMASWEDNPYDLSRWPKHRQEAYLCECPAYDPSQSRADWR
FT                   EMGILTEYLRTWPGAHRSRHPFSYVAVGELAQWITAEQPWQYRDGPGSPLAKLCEVSGS
FT                   VLLLGSPIGDVTLLHHAEHLADVPNKWIDRYRMPILQNGQRVWMDFEEFDTTNGIVDWP
FT                   DNYFETIVKDYLATHPAQTGKVGGARSYLLDAQSLTQFGVQWMEENFN"
FT   gene            complement(79676..79813)
FT                   /locus_tag="AM1_A0085"
FT   CDS             complement(79676..79813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31594"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK94"
FT                   /protein_id="ABW31594.1"
FT                   /translation="MALGGCGIALGTGLGLRLMFGGVMGGVLYTQPVYRLGSPIGEGLL
FT                   "
FT   gene            complement(79965..80159)
FT                   /locus_tag="AM1_A0086"
FT   CDS             complement(79965..80159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31595"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK95"
FT                   /protein_id="ABW31595.1"
FT                   /translation="MTTFNQTIPDPILQLRHQVLRTELSISEVVFPKTKTPRMAVSITV
FT                   MIGSKQICESLGLSNLELN"
FT   gene            complement(80174..80413)
FT                   /locus_tag="AM1_A0087"
FT   CDS             complement(80174..80413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31596"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK96"
FT                   /protein_id="ABW31596.1"
FT                   /translation="MADTMHGHNELGKHIRSLKNLATQTHAAAKQAEQDSRAIGQASLA
FT                   RKLLDIQRQICVVQLTLKDSEIQKWTGTQMQIPF"
FT   gene            80708..80827
FT                   /locus_tag="AM1_A0088"
FT   CDS             80708..80827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31597"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK97"
FT                   /protein_id="ABW31597.1"
FT                   /translation="MPKSIARSEFISLILQLLGVALRSNSLRIVLITRMMASA"
FT   gene            complement(80912..81667)
FT                   /locus_tag="AM1_A0089"
FT   CDS             complement(80912..81667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31598"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK98"
FT                   /protein_id="ABW31598.1"
FT                   /translation="MAADNKYSTVLLELKTHYQETLAELEAQTIQLKTKITSLDTLIED
FT                   PLLGSDILSILQGEAASIESEAPGSTVANTVEPKAKAKKTTQKAASNKKPKTQKKSAST
FT                   AKTSGTVETKAEATPKTATSKASPSTSMKKPSTAKKAASQRQAKKKKQAKATKASSSSR
FT                   PMQWPYTEMFKTDAIAQIMQEKAGTSVHVDDLVLQLYGELSGDDLKTERDRVYKTMQSG
FT                   VYKNRWRKDPKESMSYFTEEKSQAKPEAS"
FT   gene            complement(81808..83718)
FT                   /locus_tag="AM1_A0090"
FT   CDS             complement(81808..83718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0090"
FT                   /product="penicillin-binding protein, 1A family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31599"
FT                   /db_xref="GOA:A8ZK99"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK99"
FT                   /protein_id="ABW31599.1"
FT                   /translation="MSSSATSPQDFSSRSTSTLFLRGIGDATLTTILTLTLLGSAGLAG
FT                   GLMGVAISYRDLPDVTSLASFSPNETTYIYDINGKLLTGLHEEENRQVVPLAKISPHLK
FT                   LSVLAIEDSNFYQHDGINPVGILRAAITNYQAGQTVQGASTLSMQLAKNLYLTPERAFS
FT                   RKLAEAVLALRIEQLLSKDEILQLYLNQVYWGHNTYGVETAARSYFNKSAEDLTLAESA
FT                   MMAGIIKAPEGYSPFVDLDLAKEQQNIVLGRLEELKWITPAEAEAARAEKITLGEITSY
FT                   QRSQAPDVTNTVIQELTERFGREALVRGGFRVQTTLDWKMQKIAEETVRRNHQHYAYAA
FT                   DQMALVAVDPRTHFIKAIVGGVDNKKSEFNRATQAYRQPGSAFKPLVYYTAFATGKYTP
FT                   DSMVKDSPVSFNDGGLQRYKPQNYDRSFQGSMSIRQALAQSRNVPAIVMGQKVGIKNVI
FT                   DVSRKLGITSPIPNVISLPLGAVDLTPVEMASAYATFANNGWQSKTTAILQVTDPTGKV
FT                   LINNTPQPKLVLNPWAAAAVNSTLQTVVQSGTGVAAQIGRPAAGKTGTTSSERDVWFVG
FT                   YVPQLSVAVWAGNDNYARIGSGATGGGWMAPVWREFMSEALKDTPVQYFEPPSKFPKPK
FT                   G"
FT   gene            complement(83939..86200)
FT                   /locus_tag="AM1_A0091"
FT   CDS             complement(83939..86200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0091"
FT                   /product="helicase, RecD/TraA family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31600"
FT                   /db_xref="GOA:A8ZKA0"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKA0"
FT                   /protein_id="ABW31600.1"
FT                   /translation="MSNGSATMSSPPIEQLQGVVERLTFHSEESGYTVARLKAPRTREL
FT                   ITIVGSFANIQAGQTLQLQGIWRDHPKYGPQFQVKQYKETKPATLTGIEKYLGSGLIKG
FT                   VGPVTAKRIVAHFGLDTLDIIEHHIDRLSEVPGIAKKRVKMIQTAWDSQKAIKEVMVFL
FT                   QGHGVSTTYAVKIFKQYGDEAIETVTHNPYRLATDVYGIGFITADQIARSLGISPHSEY
FT                   RYRSGLLHVLSESSEEGHCYLPQPQLIDRAVKQLTLPEYHPKPDQVEYLIHAMISDAEL
FT                   IVEQIERETSTELLCYAPPFFRAEFHLSRRLLHLLAHPIKVDKNRVRSWLERFMAQTDV
FT                   NLSQQQQQAVELAASERVVILTGGPGTGKTFTTRTIVALWKAMGKEIVLASPTGRAAQR
FT                   LSEVTGHEAKTIHRLLEFDPKTMKFQRDSERTLVADAVVIDEASMLDLFLANSLIKAIG
FT                   PETQLLLVGDTDQLPSVGPGNVLLDLITAKQIPVMELTEIFRQAQASHIIRNAHRINQG
FT                   QFPQLESVSPSPMSDCLWLGAPEPEQGVQAIQELINDLIPQLGYVPARDVQVLCPMTRG
FT                   EVGTRKLNQVLQALINPPHPDKAELTRGGLTLRVGDRVLQQVNDYNREVFNGDMGVIEA
FT                   INLEEIAVTVQYAERSVSYDLADLNEIGLAWAVTIHKSQGSEYPVVILPMYMQHYIMLS
FT                   RNLLYTGLTRAKKLAMLVGPKNAISMAVRQIKDRQRYTLLERRLGGVPKANESLASAIL
FT                   "
FT   gene            complement(86293..87366)
FT                   /gene="recA"
FT                   /locus_tag="AM1_A0092"
FT   CDS             complement(86293..87366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="AM1_A0092"
FT                   /product="protein RecA"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31601"
FT                   /db_xref="GOA:A8ZKA1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKA1"
FT                   /protein_id="ABW31601.1"
FT                   /translation="MSAKTEMTEKQKALDLVMKNVEKTFGKGAIMRLGDAARMQIETIS
FT                   TGALPLDLALGGGLPKGRVIEVYGPESSGKTTVALHAIAEIQKSGGVAAFVDAEHALDP
FT                   VYAAALGVDVSELLVCQPDSGEMALEVVDQLVRSSAVDLVVVDSVAALTPRAEIEGDMG
FT                   DSHMGLQARLMSQALRKITSNICKSGSTVIFLNQLRQKIGVTYGSPEVTTGGNALKFYA
FT                   SVRLDIRRVQTLKKGTEMYGIRAKVKVAKNKVAPPFKLAEFDILFGQGISTIGCLVDMA
FT                   AEAEVIVRKGAWYSYEGDNIGQGRENTIQYFADHPEFAQAVEQQVRQRLALGADCAAHA
FT                   DTNGEEDESPLAEVEAA"
FT   gene            87483..87686
FT                   /locus_tag="AM1_A0093"
FT   CDS             87483..87686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31602"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKA2"
FT                   /protein_id="ABW31602.1"
FT                   /translation="MAIETLTDLVGFPDGWLVGVSCSLEWGYQCWVITPERQVHTDGEF
FT                   YESSFVALSAGRFLVEHSLEVE"
FT   gene            87683..88459
FT                   /locus_tag="AM1_A0094"
FT   CDS             87683..88459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0094"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31603"
FT                   /db_xref="GOA:A8ZKA3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKA3"
FT                   /protein_id="ABW31603.1"
FT                   /translation="MKSEPIVMSWEEYELMPWRLGWKHEYFNGMAYLTPRQQSVLTVIE
FT                   VAPRNDTLQSIKIRPVVPTDATELKHLFFEVFHDSVEYCNYEEQNIQESAQSCIDNYFG
FT                   AVKGEPSKVSCVATSTEGELIGTALVIEQPERHPYLRLLGISPSWQRRGVATNLMATIL
FT                   NQLVNTSFTQLESRYFLANEASRNWHHQFGFQDQLDLFVARLFYRHAQHELWRQEKLGQ
FT                   LSKIDLARLASEVEYWQAEVDRQEVAFESTYPRELS"
FT   gene            88541..90844
FT                   /locus_tag="AM1_A0095"
FT   CDS             88541..90844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0095"
FT                   /product="exoribonuclease II, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31604"
FT                   /db_xref="GOA:A8ZKA4"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKA4"
FT                   /protein_id="ABW31604.1"
FT                   /translation="MPTATSEKLIQLRAQLQDCTNPTAAKILKSTIVKLEAQLSLGQAQ
FT                   TKVSKIDQRKATLKNSNKQTKRKAVQQQPITLKPPSLNTVETKPKAEPQKERPTLPAHE
FT                   KTLLADDVLTQNENIATQKSLESKSETSPKSKSRFSPDVIKVAKRLVLPDELWQRPQVQ
FT                   GITIDGPTSRDLDDAIWIEATESGAVLSVHIADVSELVEMGSILDKVALSRTVTRYFSN
FT                   GNAPMLPRPLSENKLSLLEGEARPTVTVQVTLNPNAQMVDVKIFESWLVSQKRFTYAEA
FT                   SQPKSSTPFHNTLEMAHQWASHLYRNRLTSGSIGATQTAQGQWLTEEGSLIQGKLHPSH
FT                   ILIQEFMILANLAVAQWLADQDIPALYRNHTARAIAPDRETMYQTLLTLGSNAAIRQRL
FT                   HSWMNRAVYSPVLIGHFALNLPAYCHFTSPIRRVADLINHRIVKARLKHQGLPYTQSEL
FT                   VKLGQHIAQVKDEHKEQASEFFKAAHQKVYQEQLQTPEDLANLSGKEFTRLLKYAVESQ
FT                   GVDHLRSELLTRLYAEQLAVQDLYLLLFQSKELELHQQVIQYLSSHIHDAASVITIASN
FT                   REGNWEAFKYLEAENKPPFHVWLEVKISGDTLTTIHPATHSRKQPARHHACLIWIEAYL
FT                   QTSLVSPEQRAQPVLPEPQFKSGNEDIKRVTAPLSKSMHTALVKPLKEGQNFVGMLVDV
FT                   CQTLRWETPVYTMDSSDEWFICECELSVLGQQLEGSGVAKKKKLAKSIAAREILEQLRE
FT                   RGQQQLQEWLERAT"
FT   gene            complement(90919..91206)
FT                   /locus_tag="AM1_A0096"
FT   CDS             complement(90919..91206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0096"
FT                   /product="RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31605"
FT                   /db_xref="GOA:A8ZKA5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKA5"
FT                   /protein_id="ABW31605.1"
FT                   /translation="MSIYVGNLSYDVTQDEIQAVFAEYGAVSNVHVPKDRETGRMRGFA
FT                   FVELGNDAEESKAIEELEGAEWMGRTLKVNKARPRENNRGNNNFSGRNRF"
FT   gene            91793..92005
FT                   /locus_tag="AM1_A0097"
FT   CDS             91793..92005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0097"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31606"
FT                   /db_xref="InterPro:IPR021231"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKA6"
FT                   /protein_id="ABW31606.1"
FT                   /translation="MSTTISILADIPEELHDALRGYLDTHPDWDQSRVLSAALSLFLMQ
FT                   NGTTDRRTTRVYLDSLFRRELPTAC"
FT   gene            92184..92399
FT                   /locus_tag="AM1_A0098"
FT   CDS             92184..92399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="Homologous to biopolymer transport protein
FT                   ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31607"
FT                   /db_xref="GOA:A8ZKA7"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKA7"
FT                   /protein_id="ABW31607.1"
FT                   /translation="MEEQVLYRIVTILSFFIIATLFLNRSDAFPVNLPRAKTVKPQLLP
FT                   KVTVTIDVQGDSALNREPIQLNSLEA"
FT   gene            92400..92555
FT                   /locus_tag="AM1_A0099"
FT   CDS             92400..92555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="Limited homology to membrane transport protein
FT                   ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31608"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKA8"
FT                   /protein_id="ABW31608.1"
FT                   /translation="MKELTDSADKVVVVIHADDQVRHGRVVTVMDRIRVIEGAKLAMQV
FT                   SQVLVR"
FT   gene            92638..92853
FT                   /locus_tag="AM1_A0101"
FT   CDS             92638..92853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31610"
FT                   /db_xref="InterPro:IPR021336"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKA9"
FT                   /protein_id="ABW31610.1"
FT                   /translation="MSSPSQQQLIHYLQTDLGVSEKAIDLALRLQQPLQGSLHILLWQY
FT                   GLINIEQLGKAIEWLMTERGETTSKE"
FT   gene            complement(92837..92992)
FT                   /locus_tag="AM1_A0100"
FT   CDS             complement(92837..92992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31609"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKB0"
FT                   /protein_id="ABW31609.1"
FT                   /translation="MIGKRVENCCEIFTLSLNISESSKENFTRSSIANSLTVPLQGISQ
FT                   SIIPCL"
FT   gene            93491..94957
FT                   /locus_tag="AM1_A0102"
FT   CDS             93491..94957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31611"
FT                   /db_xref="GOA:A8ZKB1"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKB1"
FT                   /protein_id="ABW31611.1"
FT                   /translation="MSNPFAQLLAQQLHTLVKIRNCSSHQEKGFALPLAMGLGFVMILL
FT                   GMSSMIMAQSDRITAWNRKESGASLAVSEGGMARTLAQLTQTDNRILLTRNYDTINPKT
FT                   GTTYLGPDGILNSGDEEPATVDEWTGYTGSSSTPCDATAKTITPNVTFSGAMSSGGQFQ
FT                   LKAYRYNPTDQTGTLLVEGQHGERISHILSTLVIQSEIENFPGVLAMQGAVIRGRTLIG
FT                   QHANLYYDPAWSADTSLTDKSAPSDSDRASYLNAVYSTAQDGPGNDLIAGNIVGCQITQ
FT                   TLSVDLPTTVTSLGEVKSSTTLTAANSPYHIEELELDGTDVVTVDTTDGPVYLYVTDSF
FT                   ELRGNAQLRNIRTDGESPRVGDLRIIVHDADDGTPPIELYDQSCIDTAFVYNKINDLQL
FT                   QGSGDGCPSSGNTNFDGVAWVEDVISSININPHTRIVPAEDDDIITTNGSTSGIRVPND
FT                   VSSLADVVSGIGITPTNKFGYVKSWQRVRF"
FT   gene            94960..95526
FT                   /locus_tag="AM1_A0103"
FT   CDS             94960..95526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31612"
FT                   /db_xref="GOA:A8ZKB2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKB2"
FT                   /protein_id="ABW31612.1"
FT                   /translation="MHLNRWLWLYLKRPKASSGVDSLKSLSAKSGGFTLIEVLVAMIVA
FT                   AVFVSMTMQAMVTSAAFRVVATQYDEAVSWIQEDLETVVNQAAQYEITTQPYSSRCLAT
FT                   LSSDGFASGFLNDSATGLGGASTTIGPRTLGGKYYTLTRTANYASSSDPYRLLNVTYQV
FT                   TEQGDSKPIATVDTEVIPHAVFKCP"
FT   gene            95504..95656
FT                   /locus_tag="AM1_A0104"
FT   CDS             95504..95656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31613"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKB3"
FT                   /protein_id="ABW31613.1"
FT                   /translation="MPYSNVPNSQVMFSELLSLHQSLMSNSRYIDNSLRLFHEFRVSWS
FT                   TTTSV"
FT   gene            95691..95804
FT                   /locus_tag="AM1_A0105"
FT   CDS             95691..95804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31614"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKB4"
FT                   /protein_id="ABW31614.1"
FT                   /translation="MVEIQYYSCRQRLIGKARIRGERSNKLIGLVNIVDLN"
FT   gene            complement(95859..96014)
FT                   /locus_tag="AM1_A0106"
FT   CDS             complement(95859..96014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31615"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKB5"
FT                   /protein_id="ABW31615.1"
FT                   /translation="MATQHYSRNLAKKFSTENFRTKAHEVASVGAKQLPTQFLAVPIGG
FT                   SSLARE"
FT   gene            96085..96951
FT                   /locus_tag="AM1_A0107"
FT   CDS             96085..96951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0107"
FT                   /product="type IV pilin protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31616"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKB6"
FT                   /protein_id="ABW31616.1"
FT                   /translation="MFHFNALIPLRSSPSNAGFTLPEKMVICCIIGIAAAASAPSLMAS
FT                   MNRAKVKQTMTEVQSALNETQREAIKGNKICTLTLNFVEEKITGPCLKSGDRTLDADVA
FT                   IATNLTDPSSSETPDEGQPVLIGSDVQPSLGLSDGETVSQIALAPVSEDEANISKAGVM
FT                   VQVIAKCKGNTEKGLGLGTCKNKNNSNPENGSNEPPSTPGTLTSIPIKYGVLGNPEFAI
FT                   VSAQQTPTDPTGKIVFYNPQDSQVTKRCIAISNTLGLTRIGTYQGDIKPTAITDSGRCT
FT                   AENWEEQ"
FT   gene            96960..98006
FT                   /locus_tag="AM1_A0108"
FT   CDS             96960..98006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0108"
FT                   /product="prepilin-type N-cleavage/methylation domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31617"
FT                   /db_xref="GOA:A8ZKB7"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKB7"
FT                   /protein_id="ABW31617.1"
FT                   /translation="MGGHGLNQQWLDTNSKAIKGYTLVELLVATIITSLVISMAGFGLV
FT                   SATQANKRTEAIAARRHDLSRAFDFISNEIRMANRINQSQTMQATNTSSFSTLLSSAGL
FT                   NTSDWGNPVLYLEIPITAQIPEVCPAGGPNAGSPPPQPATYDRVVYDIRPSTQDWLAPN
FT                   SIYRYGRIPRSDGSIDPCSDPVASDTLVDAIATNVDTTPACPTPGVLMGTGGFQACVNG
FT                   NQVDLFMRSQISEVEIHRLSSTATSRSGNSQPIPVLTAVQQPGTNKVDLNWQWPGSTKG
FT                   VTFEVNQDNTTTGITTKIKTGSDSSQSFEMQNSPGDQHCYSVTAKLGQITSPESNKACF
FT                   TQIANPIN"
FT   gene            98117..98239
FT                   /locus_tag="AM1_A0109"
FT   CDS             98117..98239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31618"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKB8"
FT                   /protein_id="ABW31618.1"
FT                   /translation="MNSIEKQADFSVLTECFSSYSAYPIHIWEQQYSIVTLHFN"
FT   gene            98263..98619
FT                   /locus_tag="AM1_A0110"
FT   CDS             98263..98619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31619"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKB9"
FT                   /protein_id="ABW31619.1"
FT                   /translation="MFADDITDYYFEHSQPTLTASNTVSLNVPIIEFWRCYDISNNVII
FT                   RGQIFNHPKYPAGKSLKSSPIQGCLTKAGRVYVTTKNSMYELGTPHPKSAGDALNWPNH
FT                   TDHQPLEKLTYWGE"
FT   gene            98781..98924
FT                   /locus_tag="AM1_A0111"
FT   CDS             98781..98924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31620"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKC0"
FT                   /protein_id="ABW31620.1"
FT                   /translation="MELNQSIRKIQELGTNGINCDVETEDIVDRRIAWPQRFELMGRNK
FT                   QI"
FT   gene            99082..99399
FT                   /locus_tag="AM1_A0112"
FT   CDS             99082..99399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31621"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKC1"
FT                   /protein_id="ABW31621.1"
FT                   /translation="MLQVTDISVFFQKNTSDIPDDHFETPKKITVIESWTAIRKGKSAV
FT                   IKGRLLGHPDYPDGVKMMTSTVHRYLAGDGHVYIKTQNSLYELGQPLKTTDFQKLERMT
FT                   Q"
FT   gene            complement(99449..99730)
FT                   /locus_tag="AM1_A0113"
FT   CDS             complement(99449..99730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31622"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKC2"
FT                   /protein_id="ABW31622.1"
FT                   /translation="MIAEDLIDYYLNNFNSSLDATGNAAVEIPILQSWDCVDINNQTKI
FT                   HGHLFQHHTLPPGKYLESSAIQRYFVYQGHVCVTTKDSTYRLGIPILF"
FT   gene            complement(99952..100698)
FT                   /locus_tag="AM1_A0114"
FT   CDS             complement(99952..100698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0114"
FT                   /product="FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31623"
FT                   /db_xref="GOA:A8ZKC3"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKC3"
FT                   /protein_id="ABW31623.1"
FT                   /translation="MEKIKSEACEHHLLVIDDGKERRIVKLTEVAYSIGRDATNAIVLN
FT                   NPSISRQHAMLVRVPLPHQAHRYRIIDGNSQGKPSANGIYINGQPSSTRELETKDLINF
FT                   GKDIKATYLTLEMGQVELLNYIESLSYKSLKSDTLDHKATVFNSATGTLAELNTVLACH
FT                   HSPTPEQDHDSLQQTPLQAKETVRLSREEILKELNKPVSRQMWMVIAGAILSFCTLIGW
FT                   LMLDARKSSPALEFTQAPSSLGDARL"
FT   gene            complement(101496..101633)
FT                   /locus_tag="AM1_A0115"
FT   CDS             complement(101496..101633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31624"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKC4"
FT                   /protein_id="ABW31624.1"
FT                   /translation="MSRVRITDSVVLNWARQDLLGVGNIDNKKIRIKRKTADDKPKQRF
FT                   "
FT   gene            complement(102448..102561)
FT                   /locus_tag="AM1_A0116"
FT   CDS             complement(102448..102561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31625"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKC5"
FT                   /protein_id="ABW31625.1"
FT                   /translation="MMHLAQKGFHPLFTLIWEVETKCQSLSPWIAPFSRAF"
FT   gene            102801..102935
FT                   /locus_tag="AM1_A0117"
FT   CDS             102801..102935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31626"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKC6"
FT                   /protein_id="ABW31626.1"
FT                   /translation="MGFLLDIKLRLTKNILIDENIETLPKTYFSRPLSRWGFFLARTS"
FT   gene            complement(103513..104052)
FT                   /locus_tag="AM1_A0118"
FT   CDS             complement(103513..104052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31627"
FT                   /db_xref="GOA:A8ZKC7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKC7"
FT                   /protein_id="ABW31627.1"
FT                   /translation="MKTDDNVLEVLRLFATYGFRKTSISDIAKAADLSRQSIYNQYGSK
FT                   EAVLEWAVTTFLGNITDTVIHQLKTTDGEPAVVLSKSFQLWTGDHVPLLRGTPHGAEIL
FT                   DAAIISVAKASRNYEGEFVDAITTFLWLREVFPTKREAEETTFVLNLASKGLLLKSETS
FT                   EAYALGMKRVIKALLG"
FT   gene            104137..105093
FT                   /locus_tag="AM1_A0119"
FT   CDS             104137..105093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0119"
FT                   /product="short chain dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31628"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKC8"
FT                   /protein_id="ABW31628.1"
FT                   /translation="MEQKISNSGFSDWKPSQLLDLTGKTYVITGANSGIGFEAAKMLSE
FT                   KGGDIVMVCRSRTKAEAAQRKLVAHAQGKVDLVLMDLSDLSSVRKAAQELRGRYQKIDA
FT                   LINNAGIMMTPQEKTVDGFDLQMGANHLGHFLWTGLLLDLVEAAEGRIVVLSSLAHKFD
FT                   SLDLDDFMSDTKYTPIKAYAQSKLSNLMFAFELDRRLKDAGSKAICIACHPGYTSTNLQ
FT                   STGPTGFSKFIMAIMNKLVAQRIDAGATPTVLAAAGVEAQRGAYYGPQKMNEYRGPVSD
FT                   AKVQDHALDRENQRQLWAKSEQLVGFQYSLPVVVNAA"
FT   gene            105324..106145
FT                   /locus_tag="AM1_A0120"
FT   CDS             105324..106145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0120"
FT                   /product="short-chain dehydrogenase/oxioreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31629"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKC9"
FT                   /protein_id="ABW31629.1"
FT                   /translation="MTQQTVLITGASSGIGKATAQFFQQKGWTVIATMRTPDKETELTA
FT                   LDNVLVTRLDVLDVDSIHAAIVQGIEQFGKIDVVVNNAGYGAYGPLEATPTEKIRRQFD
FT                   VNVMGLLDVTRAILPHFRQNKDGILINISSIGGKMTFPFGSLYHGTKFAVEGISEALIY
FT                   EMEAIGCKVKIVEPGVIKTDFAGRSFDFNNDESMTEYQPSIDKFMSGMGSSVESNASEP
FT                   IVVAEVIYQAATDGTDTLRYTAGEDAKVFVANRKAADDATFIQGIKTQFGI"
FT   gene            106685..106819
FT                   /locus_tag="AM1_A0121"
FT   CDS             106685..106819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31630"
FT                   /db_xref="GOA:A8ZKD0"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKD0"
FT                   /protein_id="ABW31630.1"
FT                   /translation="MIVQRLTNSFPADRLSKAFTNLGRILKTQHNLRYLTDANLMQMV"
FT   gene            106915..107082
FT                   /locus_tag="AM1_A0122"
FT   CDS             106915..107082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0122"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31631"
FT                   /db_xref="GOA:A8ZKD1"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKD1"
FT                   /protein_id="ABW31631.1"
FT                   /translation="MNKASCLSLFSNAILYWNTLKINDIVESLRAKGVVITNETLSHIS
FT                   MLGTQWDLLY"
FT   gene            complement(107218..108471)
FT                   /locus_tag="AM1_A0123"
FT   CDS             complement(107218..108471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0123"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31632"
FT                   /db_xref="GOA:A8ZKD2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKD2"
FT                   /protein_id="ABW31632.1"
FT                   /translation="MLSAFRAGQTANANDSEATTILPVETFQVTKVHTYQVKRTYTGTI
FT                   VPRRTSPLSFERAGKLLRLTIDQGDQVERGTPLAYLDTQKLRVKHQELIAGRNQTNALL
FT                   KELRTGSRSETIAAARSSVKNLDSQLKLAQSRHQRRQALYTAGAIPREHLDEATTEVNT
FT                   VQARLNEAQSQLDKVLTGSRPEKIEAQTAALEQLEARLDGLEIDLRQSILRAPFTGRIA
FT                   NRLVDEGTVVSAGQPILTLLEDQALEAHVGVPVEAATQIPIGSNQHLVIGKEQYEAEVI
FT                   ATLPQIDPVTRTLTVVLHIEPSASREVRSGQITRLKLTETIDDFGYWLPTTALVRGVRG
FT                   LWSCYALRETEMSIHPPNTFRVEKRDVEVLHTQGDKVFVRGTLQNNDQVIVNGNHRLIA
FT                   GQLVHPVETNKSVLSNQN"
FT   gene            complement(108675..111797)
FT                   /locus_tag="AM1_A0124"
FT   CDS             complement(108675..111797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0124"
FT                   /product="acriflavin resistance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31633"
FT                   /db_xref="GOA:A8ZKD3"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKD3"
FT                   /protein_id="ABW31633.1"
FT                   /translation="MWTHFYRNTRLLILTICIILVWGLSSFHVLPRMEDPAISQWTGKI
FT                   TTRFPSASATRVDSLVTEKLEQKLQEVEEIKFIESTSQLGTSLIFIVLKDTVKNHDEVW
FT                   SSIRDRIADITPQLPSGVLAPKYEDMNDGRGYTLIVALTWELDTPPNYAILNRLSENLK
FT                   QQLRGIGGIEEIEFWGAPSEEILVEINPVVLGKLGITPQQLAQQIRLSDAKVSSGRLLS
FT                   PNNDLLLEVNSEIDSLERIRQIPIRTDKNSEQLIPLGDIALVKKSRRDPPSELAIINGK
FT                   PGITLAVLVEPNRRVDQWMEEANQTLEAFRGTISSDIGLDIILNQNRYVETRLNSLFMN
FT                   LMIGVVFVVASTTLLMGGKSALVLGLSLPLSILMVFGGMRLLEIPLHQMSLTGLVIALG
FT                   MLIDNAIVVVDEIKHLFEEGLNPQKAIARAVSYLAIPLLASTLTTVLTFFPIAILRGHI
FT                   GEYVRTISISVIVAISSSLLFSLTIIPAIMSRMYQKGEIHQRNMAWWRTGFSNPQITKV
FT                   YRRILGSILTTPLLGVGLAIILPIIGFMAVGHIPEQFFPPAERNQFQIKLELPLSTSME
FT                   QTKSIVEKASNLIAQHSEVTDLHWFIGTYAPTFYYTVARHGIKGEVPHYATAMVQTNTG
FT                   RSIPKLIHNLQRELDQGFPSARILVEQLKQALPIPPIELRVYGPDLDILEELGNQVRSE
FT                   LVQVPQVIHTRTSLGEFLPKLTLSLDEEQAQLTGLDNTQIAQQLNTNLEGTVGGSILED
FT                   TVELPLRVRLSSDNRANLDQITTIGLVPKPPLSPEKSTSIPLSALGQIDLIPETAIITR
FT                   RNGQRVNTVQGFITAGVLPSTVLADFQQRLNNSNFQLPPGYSMEWGGEAAERNEAVGNL
FT                   LSTAGIFIVLMVSVLVLSFNSFRSAGIILLVAVGSVGLALASLWLFGYPLGFMAILGTV
FT                   GLVGVAINDSIVVLAAIRTNPRARKGFRPAMVDVIVRSTRHVLTTTITTVSGFIPLLLD
FT                   GGELWPPLAICIAGGVGGATFLALFFVPCAYLIVFGQTYPKSFKLSGNPTS"
FT   gene            complement(112328..113707)
FT                   /gene="menF"
FT                   /locus_tag="AM1_A0125"
FT   CDS             complement(112328..113707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menF"
FT                   /locus_tag="AM1_A0125"
FT                   /product="menaquinone-specific isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31634"
FT                   /db_xref="GOA:A8ZKD4"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR034681"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKD4"
FT                   /protein_id="ABW31634.1"
FT                   /translation="MCLHRKIIDFIVDELKTLAENSQSKIVRLEVSIDHDIEPLHWLSQ
FT                   QKSIIKTYWSDRHDRFEMAGIGSADLVFSREKASSHVLFKRLRKFLSCKYSCVRYYGGI
FT                   CFSQNQIASYPWQDFGNHFFLVPKFEVFKDQAGTYLALNLLLHHSDNANKKIQQTLQEL
FT                   AAINFNLPHQQCEKPQLSKRVDFPNQLQWYNNVNKGLTYLDQGILEKVVLARQTEFTIV
FT                   DSCQPEHLLSLIQKEQNCSFQFCFQLDRDKAFIGSTPERLYWRQSSQIQTEAIAGTRPR
FT                   GASYQEDNNFAKELLSSPKEIREHKLVLKGLQETLSTLCHQVNIAEDPNLLRLNQVQHL
FT                   YSHCSGILNPEISDADIINQLHPTPAVGGYPRQKALELIASLETFSRGFYASPIGWVAL
FT                   DSAEFLVSIRSGLIQRNKLILFAGAGIISDSQPEAEWEELENKIRNFLQVVSCQASVDI
FT                   I"
FT   gene            113947..114219
FT                   /locus_tag="AM1_A0126"
FT   CDS             113947..114219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31635"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKD5"
FT                   /protein_id="ABW31635.1"
FT                   /translation="MGGDIKSQICIQYSQGIVECSSNEQFPSGRIESNLTQIRKLQNRL
FT                   VNFLCITLRGWKSVIQSMPHDAPFTSNTNVSANLDYHLIRKSRKS"
FT   gene            complement(114230..115342)
FT                   /locus_tag="AM1_A0127"
FT   CDS             complement(114230..115342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0127"
FT                   /product="xenobiotic reductase B, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31636"
FT                   /db_xref="GOA:A8ZKD6"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKD6"
FT                   /protein_id="ABW31636.1"
FT                   /translation="MTATGTSPTLLSSFNLHDLPLANRIVMAPMTRSRAGEEMLANAMM
FT                   AEYYAQRASTGLIVTEGTFISDQAIGWQHVPGIYTQEQTQAWQVVTKAVHEKGGKVFLQ
FT                   LWHCGRASHSSFHQDHQLPVAPSAIKLEGDSIHTPQGKQPYENPRALSTDEIPLVVEDY
FT                   RQAAINAKTAGFDGVEIHSANGYLLDCFLQSKTNQRQDRYGGTLENRYRFLKEVVEAIS
FT                   QVWPTQRIGVRLSPNGIYNDMGSQDYRETFLYVAKQLNTFDLAYLHVLDGLAFGFHELG
FT                   EPMQLSEFRSVYNGTIIGNCGYSQEDADDRISNGHADLIAFGRPFISNPDLVERFTNGW
FT                   PLNPPAEQSIWYSFDREGYTDFPVYSESQA"
FT   gene            complement(115452..116372)
FT                   /locus_tag="AM1_A0128"
FT   CDS             complement(115452..116372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31637"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKD7"
FT                   /protein_id="ABW31637.1"
FT                   /translation="MTQRESIDHDGLFKELIETFFWEFLDLFLPQVLDYVERGPVTFLY
FT                   QEVFSSIGAEEKRIIDLLAQVQFRGQDSYFLFHIEPQSSVQADFEKRMFCYFGRLHEKY
FT                   DLPIYPVVIFSYDSPQKEAESSYKVEFPDFQVLQFNFRAIQLNRLNWRDYLRQHNPVAS
FT                   ALMAKMQIAKEDRPRVKVECLRMLATLQLDPARTEFISQFIDTYLRLEANEEQRFQTEI
FT                   DTLELGEREAIMQTLTSWEERGWQKGEVSIVLRQLNRKFKQLSPEMETQIQSLEVDQLE
FT                   SLSEALLEFESLDDLNAWLQNLENS"
FT   gene            complement(116486..117151)
FT                   /locus_tag="AM1_A0129"
FT   CDS             complement(116486..117151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31638"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKD8"
FT                   /protein_id="ABW31638.1"
FT                   /translation="MALQLELDLWQQLNQAEAVPVESDLQQLQERLDLVVAQLPLEEKL
FT                   STAGTALLQMAEILSRRAEVFLRDWRDAHNDDGPILDLDDEMGMVRQSMVLDDDLIAEP
FT                   DPVTRRTLPKEECESIVVLKDKASLLEELETELRVEQPDEVLQVLEEEDVLAWVHAIST
FT                   YLQGTSGMVPLVELKQELQLSLVPIWLGMLLGGFQFEQRGGFYDQNVWIKSGALNSQS"
FT   gene            complement(117165..117644)
FT                   /locus_tag="AM1_A0130"
FT   CDS             complement(117165..117644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31639"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKD9"
FT                   /protein_id="ABW31639.1"
FT                   /translation="MARAIAEKCRRCSKLPVDQAKLKECWVGQRCHVRRSSYKHRDRYN
FT                   RNKKRKYQLQTGKLIPEVTVEVPVKPAAIRRMYRARRDAPLHAMSAELWIGQKRVAIVE
FT                   PVHTLGWTNSDVTKYSRNILNRFSEHLDGKVLHQFDSQVEVDPSQCPIRPCPLFP"
FT   gene            complement(117649..117870)
FT                   /locus_tag="AM1_A0131"
FT   CDS             complement(117649..117870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0131"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31640"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKE0"
FT                   /protein_id="ABW31640.1"
FT                   /translation="MTQTKYRMVIEWSEEDQCYVVSLPEFDRVMQPITDGQTYEEAAKH
FT                   GQEAIESLMEFYEAEGWTLPAPQMMQMV"
FT   gene            complement(117857..118072)
FT                   /locus_tag="AM1_A0132"
FT   CDS             complement(117857..118072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31641"
FT                   /db_xref="GOA:A8ZKE1"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKE1"
FT                   /protein_id="ABW31641.1"
FT                   /translation="MPKKIREIKAMLKEAGFISRPGKGSHSNWKHPQLPQVITVARKDG
FT                   ADAPLYLERKVQKALQQLEALSNDSD"
FT   gene            118276..118506
FT                   /locus_tag="AM1_A0133"
FT   CDS             118276..118506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0133"
FT                   /product="addiction module antitoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31642"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKE2"
FT                   /protein_id="ABW31642.1"
FT                   /translation="MQQMGAGQFKAQCLKLMDQVQQTHEEIVITKHGQPVAKLVPVEND
FT                   SQTSILGYMKDSVQVTGDIVSPVDEVWEADT"
FT   gene            118506..118928
FT                   /locus_tag="AM1_A0134"
FT   CDS             118506..118928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0134"
FT                   /product="PIN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31643"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKE3"
FT                   /protein_id="ABW31643.1"
FT                   /translation="MSQDLLVLDTHIWIWLLNGNIGRLSSEGLSAIEKASQSAQLGVSA
FT                   ISVWEVGMLESKGRLRLSKGCLDWVREALSAPGLRLLPLTPEIAIESSRLPGQIHGDPA
FT                   DRILAATARILNGTLVTQDLKLLSYGEQAYLSVLQG"
FT   gene            118932..120014
FT                   /gene="xerC"
FT                   /locus_tag="AM1_A0135"
FT   CDS             118932..120014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="AM1_A0135"
FT                   /product="tyrosine recombinase XerC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31644"
FT                   /db_xref="GOA:A8ZKE4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKE4"
FT                   /protein_id="ABW31644.1"
FT                   /translation="MDERYRWDAIAMETSGLVRLEIDESAVDVDLLRAVLVEKTKPSTR
FT                   EGYTKDLVDFFLFVTQGESVYEIEGPKRKSEIKAQVKGELSRLSQSFVGIGRLKALELA
FT                   ARYRECMMQRGLQANTINRRLSAVKSMVRMARRLEMCDWTLAEVDGLTVNPYRDTRGIT
FT                   ASQFRLMMVFVNRFSLAGARDFAMLTLLWEAGLRRSELVGCDVRHFDSEQKRLSILGKG
FT                   RNEREWIDLTESGVLAISEWLEKREVYALTEPLFISLDRANWGSRLSGTSVYRIVRALA
FT                   KKAGVSENFGPHKIRHSGTTTYLEMTGGDLRGAQAYSRHANLNTLKFYDDNRKQLQKKA
FT                   SAKLAETISWKKNTDESANE"
FT   gene            120211..120327
FT                   /locus_tag="AM1_A0136"
FT   CDS             120211..120327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31645"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKE5"
FT                   /protein_id="ABW31645.1"
FT                   /translation="MSPLEKELLPIDETEVFPENDELEIVDLDDLLKELQQD"
FT   gene            complement(120779..121225)
FT                   /locus_tag="AM1_A0137"
FT   CDS             complement(120779..121225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31646"
FT                   /db_xref="GOA:A8ZKE6"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKE6"
FT                   /protein_id="ABW31646.1"
FT                   /translation="MLFKLLVILHTLGATVWTGGHLVLAVTVLPLAMQNRDPDRIHTFE
FT                   EHFEGFGLASLLLQTITGVWLTWIYFPGFQNFLAFQSYLSIYIAIKLSLLLGTLALALH
FT                   ARFFIIPKLTQETLNELAFHIIGVTTLAVLFVVMGVGIRLGGLS"
FT   gene            complement(121348..122028)
FT                   /locus_tag="AM1_A0138"
FT   CDS             complement(121348..122028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0138"
FT                   /product="alternative oxidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31647"
FT                   /db_xref="GOA:A8ZKE7"
FT                   /db_xref="InterPro:IPR002680"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKE7"
FT                   /protein_id="ABW31647.1"
FT                   /translation="MIRILVGILVFVINKIYANRPYPRFYVLETVARVPYFSYLSVLHL
FT                   YETLGLWRKADWLKIHFAESWNELHHLLIMESLGGAEFWGDRFLAKTTALIYYWVIAVL
FT                   YVVSPRSAYHFMELVEEHAYASYDKFLQTEAEHLKTLPAPDVAIQYYRDGDLYMFDEFQ
FT                   TAHQAAERRPQVDTLYDVFVAIRDDEMEHVKTMVACQQPEAQQSLLSPHTPPALTAEDA
FT                   PVVS"
FT   gene            complement(122075..124387)
FT                   /locus_tag="AM1_A0139"
FT   CDS             complement(122075..124387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0139"
FT                   /product="cytochrome b subunit of nitric oxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31648"
FT                   /db_xref="GOA:A8ZKE8"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKE8"
FT                   /protein_id="ABW31648.1"
FT                   /translation="MANPAFDNTVATNLRSRRPSMGLPAWLALICIVTFTVLLTAGAAI
FT                   YKNAPPIPAQIVSPQQETILTQTDIQSGQETYLARGGQHIGSVWGHGSYLAPDWTADVL
FT                   HRWGLATAGVLYDGDPDFSQADFEQLSEVDRATLTVQVQQNFKANRYDTHSDTLALTSA
FT                   QTQGLQRVFEDYQTLLSQGSSIHSIPSGWFADEGQIHSVTAFFSWTAWAASANRPNAPF
FT                   SYTANFPHDDLIGNQAPGQFLIWSIVSVVVLIAAIAFFLFVYITQEDAEDVQPVTTRPA
FT                   IRLATPSQKVTTLFFGVAMILCLVQILMGMVTAHYAVEGEGFYGIPIQQYMPYAASRTW
FT                   HLQLAVFWIATCWLAAGLYFGPRFGKHEPKFQAWGNGGLLAALTVVVVGSLLGTWAGVQ
FT                   GWLGDKSFWFGHQGYEYVELGRLWQLLLIGGMVFWLWLMFRALKPALKAEGNKTGLNHF
FT                   FLYSAITIPLFYASGLMYSNHTPLSIAEYWRWWVVHLWVEGFFEVFATVAIAYLCSELG
FT                   FLKRSTALKATYLTTILYLGSGVIGTLHHLYFAGTPVFITAMGSVASALEVVPLTLIGF
FT                   EVVKSLKLSKEAQGFYRLPLKFFIATCFWNLVGAGVFGFLINPPIVLYYSQGLNTTPIH
FT                   AHSALYGVYGSLAIALMLFALREITPDHAWDEKNFNFSFWWINGGLVIMMVFGLIPNGF
FT                   YQLVQSINHGTWYARSAEVINSAWMHWTVWLRIPGDMVFAVGALVLVMSVGRAVIAIWQ
FT                   QPTQAQPPALTTEITSL"
FT   gene            124362..124511
FT                   /locus_tag="AM1_A0140"
FT   CDS             124362..124511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31649"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKE9"
FT                   /protein_id="ABW31649.1"
FT                   /translation="MLSKAGLAIVAIPKNSFAPNSPFYKWGGVEPEELGSSNAERVWRR
FT                   CLSL"
FT   gene            124682..125374
FT                   /locus_tag="AM1_A0141"
FT   CDS             124682..125374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0141"
FT                   /product="cyclic nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31650"
FT                   /db_xref="GOA:A8ZKF0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKF0"
FT                   /protein_id="ABW31650.1"
FT                   /translation="MIDTADVADWLETTVIFRGLSAEQRQALTQTAQIQPFKKGEQIFH
FT                   PDQEATGFYFVKSGRVKVFQMSAKGKEQILNIFTEGDNFADVPALDGQSFPASAAALEP
FT                   ADLIFFPRYPFLDFLHHNPDVAVQMLVSLFSHLRHLAQLVEQLSFKSVPQRLATYLLSL
FT                   GDTVSDTVYLDLTKGQLAARLGTIPATLSRAFYQLSSDGMIAISGSKVTILDRDRLTVL
FT                   IQSPETPD"
FT   gene            complement(125399..125948)
FT                   /pseudo
FT                   /locus_tag="AM1_A0142"
FT                   /note="cation transporter"
FT   gene            complement(125918..126250)
FT                   /locus_tag="AM1_A0144"
FT   CDS             complement(125918..126250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0144"
FT                   /product="cation transporter"
FT                   /note="2 frame shifts/ deletions"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31651"
FT                   /db_xref="GOA:A8ZKF1"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKF1"
FT                   /protein_id="ABW31651.1"
FT                   /translation="MTLDNRQDVRNVLVTVLFLNVTVMLIKVGLGWWTGSLSLFADALH
FT                   SITDSANNVLGLTMNRLASPEPDREHPYEHQKFDAIGALGIAAFLGIACFEILEGRWAI
FT                   WLTQGL"
FT   gene            complement(126353..126496)
FT                   /locus_tag="AM1_A0145"
FT   CDS             complement(126353..126496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31652"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKF2"
FT                   /protein_id="ABW31652.1"
FT                   /translation="MRLLFLDCFNEVVVRQDRGNSSTTINSTQKMGYRVSITINNNFDL
FT                   NQ"
FT   gene            126735..127274
FT                   /gene="feoA"
FT                   /locus_tag="AM1_A0146"
FT   CDS             126735..127274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoA"
FT                   /locus_tag="AM1_A0146"
FT                   /product="ferrous iron transport protein A, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31653"
FT                   /db_xref="GOA:A8ZKF3"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKF3"
FT                   /protein_id="ABW31653.1"
FT                   /translation="MDLPNSCQSLANMQPPQQLWIVGYQKSAKTNQLIGMGLAPGTAIE
FT                   ILQMVAGNLVVRIGETRIGLNQDIAEQILVSDQPLTAPENVMRDPANMEQIAPLTLKDF
FT                   QLHQTGKVKGFADTDTPDLRAYKKKLLAMGLTPGTEFTVTHIAPLGDPVEIKVRGFRLS
FT                   LRQAEAALLIVQEVQE"
FT   gene            127277..129640
FT                   /gene="feoB"
FT                   /locus_tag="AM1_A0147"
FT   CDS             127277..129640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoB"
FT                   /locus_tag="AM1_A0147"
FT                   /product="ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31654"
FT                   /db_xref="GOA:A8ZKF4"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKF4"
FT                   /protein_id="ABW31654.1"
FT                   /translation="MSTPTIALIGNPNCGKTTLFNDLTGTNQRTGNWPGVTVDQKTGHY
FT                   HYNGTKTTVVDLPGVYSLDGEDDSTGLDEVIARDYLLSTEADLILNIVDASNLERNLYL
FT                   TTQIMEMGLPMVVALNMMDIAQDHDLDIDAQVLSHRIGCPVSSMSAFLGEGIHEIKDII
FT                   NSYVDDPKNHPTFVTYPAVIEDAIHQLEPIVQQQGHNPKIAPRWTALKLLEYENRVAPE
FT                   LQGQQLEQIIAKHRRQVHQLLHEDIDILVADTRYGYIRSLMQAAVQQTHQVSHSKSDQI
FT                   DQVVLNRWIGIPLFLVVMYLMFFIAINIGGAFIDFFDIAVGTLVVDAPQTWLESVGAPG
FT                   WFTGIVTAAGSGIQTVATFIPQIGLLFLILALLEDSGYMARAAFVMDKLMRFVGLPGKS
FT                   FIPMLVGFGCNVPAIMATRTLENRRDRLMTIMMNPFMSCGARLPVYALFAAAFFPRNGQ
FT                   NLVFGLYLIGIAAAVFTGFVMKNTIMQGEASPLVMELPPYHIPKLKGVFLRAGDRLKTF
FT                   LLKAGKMIVLMVMVLAFLNSVGTDGSFGQQDSQNSVLSASSRTITPMFAPMGVQAENWP
FT                   ATVGIFTGVFAKEAMVGSLDSLYGQLAEEAAPQGEADPPFNFGENLQAALVSIPTNMVS
FT                   LGNQLLDPLGLNVGDVQDQSAVAEEQELSTSTFGQMAQRFGTSTAAFAYLLFVLMYFPC
FT                   VAATGAVYRETNLGWTALVAAWTTGLAYWVATMFYQVATFAQHPGFSTVWLGSGAVVMV
FT                   AVIGLLKTLGTKRNAVSISPRQNTSRPKATAGKS"
FT   gene            129733..130119
FT                   /locus_tag="AM1_A0148"
FT   CDS             129733..130119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0148"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31655"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015102"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKF5"
FT                   /protein_id="ABW31655.1"
FT                   /translation="MILKELQDFVLDYHRVSLAEMELHFHMDGDALRHMLTKLVHKGRV
FT                   RKLPIPEHCHGCTFCNPDTIEFYEWVDQAQLGASHLPKKLMTKAQIHSIHSLEEEDPKK
FT                   SEQNAIKYAVILHDCKAGKKPKEE"
FT   gene            130142..130417
FT                   /locus_tag="AM1_A0149"
FT   CDS             130142..130417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0149"
FT                   /product="heavy metal-associated domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31656"
FT                   /db_xref="GOA:A8ZKF6"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKF6"
FT                   /protein_id="ABW31656.1"
FT                   /translation="MSWFSRSAPTNEIQLHIEDLHCEMCAQTVKEALKKVSGVKKVQVK
FT                   LSKKQVNVAIIENREVDFASLASALEPTGYQADCWQEKRSGLKHSE"
FT   gene            complement(130938..131465)
FT                   /locus_tag="AM1_A0150"
FT   CDS             complement(130938..131465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0150"
FT                   /product="DNA protection during starvation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31657"
FT                   /db_xref="GOA:A8ZKF7"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKF7"
FT                   /protein_id="ABW31657.1"
FT                   /translation="MPDTVAQSFNQISENVLHLERSITEPVCEGMNILLASFQALYLQY
FT                   QKHHFVVEGAEFYSLHEFFHESAGEVKGHVHELGERLNGLGGVPAASFTKLAELCCFTP
FT                   EADDAFDCRTMVEHDLAAEQSLIELLRRQTSQAESLGDRGTRFLYEKMLVETEERAYHL
FT                   AHFLAPDTLVQR"
FT   gene            131834..132097
FT                   /locus_tag="AM1_A0151"
FT   CDS             131834..132097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31658"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKF8"
FT                   /protein_id="ABW31658.1"
FT                   /translation="MESKRQVSKNSITVEIHCQNRWVIYRRLQELDIACDCSAYQPLTI
FT                   QVDTPEKAIQLWSISRRVSQPCQQLIWELEKCWQLYSYRFKK"
FT   gene            132118..132576
FT                   /locus_tag="AM1_A0152"
FT   CDS             132118..132576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31659"
FT                   /db_xref="GOA:A8ZKF9"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKF9"
FT                   /protein_id="ABW31659.1"
FT                   /translation="MFPFSLQGVFELELPHIKDEEILHRIIRALEIERAKNIRYSGHWV
FT                   RFRGGQFRAVRRGNRLSSITTGTITIERKNERRLRVHYYLAVWELFLIFTGVVVVLFGP
FT                   IIWQEYSSNPRTVMLILGGMWFWLFGVSLMRVRLCFPWFLKDFISLHQ"
FT   gene            complement(132675..133478)
FT                   /locus_tag="AM1_A0153"
FT   CDS             complement(132675..133478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0153"
FT                   /product="conserved hypothetical protein, possible ABC
FT                   transporter"
FT                   /note="Member of COG0390, ABC-type uncharacterized
FT                   transport system, permease components."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31660"
FT                   /db_xref="GOA:A8ZKG0"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKG0"
FT                   /protein_id="ABW31660.1"
FT                   /translation="MNQSYIPISDFQLALAAGLIFVNIGLSFALQLGLAKSLGIAAIRM
FT                   VVQLLLVGYILAWVFALDNPWLVFFVALMMSVIAGNASVNRTQRRFPAIFWRSLLSILA
FT                   SSALVTGLLVGGIIQIDPWYNPQYVIPLLGMVLGNTLTGTSLALDRLMEDLVRQQSQIE
FT                   ALLALGATRWEAANSMIRDAIRTGMIPTINSMMVVGLVSLPGMMTGQILGGVAPTDAVR
FT                   YQIVIFFTIAAGTALACMGIVMLAFQVLFTPEHQLRLDRLQKRER"
FT   gene            complement(133475..134131)
FT                   /locus_tag="AM1_A0154"
FT   CDS             complement(133475..134131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0154"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31661"
FT                   /db_xref="GOA:A8ZKG1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKG1"
FT                   /protein_id="ABW31661.1"
FT                   /translation="MSSPLLSAAQIGRKIEHHWIWQHLDFELFPGERLAIIGPSGVGKS
FT                   LLLRAIAGLDALQAGQLTFHGQPLSGFSMPEYRAQVIYLHQRPALLEGTVVFNLQQVYQ
FT                   LAIHHPKAYNQEQILEYLWPLGRQLEFLHHSVNNLSGGEAQIVACLRALQLSPQVLLLD
FT                   EPTASMDESTAQQIEVLVNQWQQEDSSRCCIWTSHNVKQLQRVTDRSLTLTRKPQ"
FT   gene            complement(134577..135851)
FT                   /locus_tag="AM1_A0155"
FT   CDS             complement(134577..135851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0155"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31662"
FT                   /db_xref="GOA:A8ZKG2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKG2"
FT                   /protein_id="ABW31662.1"
FT                   /translation="MRTFILIWFGQLISTVGSYMTYFALILWAWQLTGSATALALVGFF
FT                   FQVPQIPITLIAGLIVDRVNRKTLMIFGDAIAALSTLGLGTLYLTDGLAIWHLYLFAAI
FT                   NGGFGQIQQLAYQASVSLLVSEAQLIRANSMNAAVHYGSSILSPALAGVLYPAIGLLGI
FT                   LGIDLVTFAGAIATLIFAIIPQPVHTDPEPKTLTHSLTFGFRYIWKQPHLKALLLITAL
FT                   FWFFHDLGGAIYNPMLLARSNGSAQVLASTGAAAGIGGVIGAIILTIWGGPKRRMQGIL
FT                   IGFMGAGLAKTIFGFGRSLQVWIPGQFCSSLNFPLLNSSETALWMENTAPEIQGRVFAA
FT                   NSLVHKGLKAVASLIAGPLADRIFEPLVQSKVVTGTIGPVFGTQPGAGIALLYVLTSLA
FT                   LIWVGIGGYCLPVLRQVGKTMPVTN"
FT   gene            complement(135861..136802)
FT                   /locus_tag="AM1_A0156"
FT   CDS             complement(135861..136802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0156"
FT                   /product="probable iron(III) dicitrate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31663"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKG3"
FT                   /protein_id="ABW31663.1"
FT                   /translation="MKISLKQFGWRMVLSALIFCLLAACHQAVQNTGVSTETRLIEHAM
FT                   GRSQVPLVPQRVVTLDSAPLDAALALEVKPVGSAGWDGEFAEYLGDRTIGIAAVGTPNG
FT                   PSLEAIIELKPDLILGSKVVAEKIYPQLMQIAPTVLTEETGRDGNWPDNLRLYADALGK
FT                   RDLAEQLLKTYRDRIAALKQQMQNAQETVVSIVASHQGAVYFYSEKSFAGTIFKELGFK
FT                   RPPIQTRPPIHVGLVSNESFEQLDGDYIFLLTGKVRQQLSLNEFIKDPLYSQLSAVKKG
FT                   EIYDVPSEVWAGGRNILAAHRVLDDITKVMVK"
FT   gene            complement(136835..139429)
FT                   /locus_tag="AM1_A0157"
FT   CDS             complement(136835..139429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0157"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31664"
FT                   /db_xref="GOA:A8ZKG4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKG4"
FT                   /protein_id="ABW31664.1"
FT                   /translation="MVRNQPGKLEKVALRHSGVISLMTIVSSGWGLAAVAQQLNVENAQ
FT                   SSPVESISTPIETPSQASPTVAEWMAQIEASQVEITAVRLQSTATGLQVVLETAVDALS
FT                   LPTPTVSGNVLTVEIPNAVLQLPEGNDFEQPNPALGIDRVSVRSLLGDRVQIEIVGTNA
FT                   PPVAEVSATSAGLVLAVTPGAIADGEDEEIEITVTADRDSSYVVPNASTATRTDTPLRD
FT                   IPQSIQVIPKEVIEDQQVLRLNDALRNSSGVVSSSNDQRGQRFIIRGFNSGSVLRDGFR
FT                   LTNGGTGNFGFPELSNYEQIEVLKGPAAILYGFLEPGGVINLVSKKPTEEPFYKLSFRA
FT                   GNRDLYEPSFDISGPLTEDKRLAYRINGVYRTEDSIRDFDTSIQKFSIAPVLSWKISEQ
FT                   TDLLLSFDYSYDRLPTDFGGLPAIGNRIADVPFERITGEPGDDTTIETLRVGYQFEHRF
FT                   SDAWKVRNSFTFYSYSPEFVSNLGFRINEATGDLNRIWVQNAQPIDNFELQTNVVGKFA
FT                   TGPVQHTLLAGVDLYRRDFYALGRIDFSPQPPFNIFNPVYGIPRPASFNDPLPQTDFSR
FT                   TDSLGIFLQDQVTLLDNLHLLVGARYDTVRQTTEDLEVGNRSTQSDDAISPRAGIVYQP
FT                   IEELSLFASYSTSFSPNSGTTIAGDLLDPERGEQFEVGLKTELLGGRFSGNLAFFEITK
FT                   KNVATLDPNSPPGESFSIPTGEQRSRGIELDLIGELLPGWNLVANYAYTDAKITQSNDG
FT                   IQGNRVFGVPRHNFNLWSTYEVQQGPLEGLGFGLGFNFVSDRFGDNANSFVLEDYFLTN
FT                   AALFYERNNWKVALNLRNLFDVDFIDSSEGNRVFENRPGEGFTIIGSVSFEF"
FT   gene            complement(139497..139655)
FT                   /locus_tag="AM1_A0158"
FT   CDS             complement(139497..139655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31665"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKG5"
FT                   /protein_id="ABW31665.1"
FT                   /translation="MTLLSLEPLSDIGCKNLSNSKRVAQTFWKLNRINHIHYSSDPAGD
FT                   EKDPAGN"
FT   gene            complement(139652..140749)
FT                   /locus_tag="AM1_A0159"
FT   CDS             complement(139652..140749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31666"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR010350"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKG6"
FT                   /protein_id="ABW31666.1"
FT                   /translation="MLTQTALSDCRFCSLVSKQNGEDPIGTARTVDHWLLIELAQPWIE
FT                   KMFKEDPRIAPLIKLFRHLFTKYGVVIQPILIAPDKVYSRPGETRIIYFHRAQKLFTQY
FT                   KKQEFIVPEAEFPRLVTALLKHLMKQPNEFSAFHHFRQETTHIREILVCTHGNVDAACA
FT                   RFGYPIYKNLREGYATQPNNHLRVWRCSHFGGHKFAPTLIDLPRGHYWGHLEPEIVDLL
FT                   VNQQGEVAKLRSHYRGWSGLSKFEQIAERDIWMREGWDWLTQDKSGKTTRKGLIGIKRY
FT                   LYPLLKLIPLKRVQFFLEQWTRDAIWAEVQIQFTSPDQTRAGTYFARVEMSESVMTAGK
FT                   SPKLGEAVQLKPVPQYRLSRLVKLK"
FT   gene            complement(140959..141954)
FT                   /locus_tag="AM1_A0160"
FT   CDS             complement(140959..141954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0160"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31667"
FT                   /db_xref="GOA:A8ZKG7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKG7"
FT                   /protein_id="ABW31667.1"
FT                   /translation="MEIMTRTAYNQQWLNTLDSHGSIVFHSDFDVMASCSHRFSKDQVW
FT                   GIQFSPIFCLEASDSYYHRDLCVRNTHDAQPQLVAKFYLSGEHHVHSPNIPNIPTEYCE
FT                   RAGYSYLFSLPEIEEKEIYLANQRLHLLRIYVDPCWLQKLGASVLPLHLQMLLNADPPY
FT                   RFHQCLGKMTPTMHAILQQILNCPYKQGMRRLYLESKAQELLVLQLEQWLALEQGNSAS
FT                   TPLKAADLDYVHLAADILDRELSHPPSIAVLARRVGLNEYKLKVGFRQVFGQTVFGYVK
FT                   VQRLERAKQLLLIGGSTVTQAAASVGYVSQGHFAAAFRQQFGVNPRTLRQ"
FT   gene            complement(141942..142775)
FT                   /locus_tag="AM1_A0161"
FT   CDS             complement(141942..142775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0161"
FT                   /product="probable iron(III) dicitrate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31668"
FT                   /db_xref="GOA:A8ZKG8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKG8"
FT                   /protein_id="ABW31668.1"
FT                   /translation="MITDTTAYALTTRKLKLAYEGKVIIESLDLAIPTGKITILVGPNG
FT                   CGKSTLLKGLGRLLKPKHGVVYLGSESIAKLSSKAIAKRLGLLPQGPTAPEGLTVRDLV
FT                   AQGRYPHQGWLQQWSKDDEKQVNWALSITQMHEFSHYALDNLSGGQRQRAWIAMTLAQD
FT                   TEILLLDEPTTYLDLAHQMEVLDLLYDLNQEQGRTIVMVLHDLNQACRYGDHLVAIRDG
FT                   RVYKQGHPERVMTETMVQEVFGLESQIVSDPVAGTPLCIPIGRKVIQARDVTWKL"
FT   gene            complement(142772..143815)
FT                   /locus_tag="AM1_A0162"
FT   CDS             complement(142772..143815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0162"
FT                   /product="iron(III) dicitrate ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31669"
FT                   /db_xref="GOA:A8ZKG9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="InterPro:IPR035568"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKG9"
FT                   /protein_id="ABW31669.1"
FT                   /translation="MKQWLVVRPPQIPISFHLDRRVPGILLGLILATLVVMVLSVGQGE
FT                   YPVPPLDVIKTVLGLETSNSDFAFIVMTLRLPRTLVAWGVGMGLAIAGTITQGITRNPL
FT                   ASPGIIGVNAGASLAAVTLVVLYPELPVALIPVAAFGGAFTVAVLIYLLAWKGGSSPVR
FT                   LILVGVGFSLIAGALTNLMVTFGNIYNVSQALVWLAGSVYGRSWEQLNVFVPWLIGFGL
FT                   LSLLMSRELNVLQLGDDVARSLGSRLELQRGLLLLSGVALAGSAVATAGGIGFVGLMAP
FT                   HLGRQMVGPSHEGLLPVAALTGGFVVVVADLLGRLLFAPIELPCGIITAIVGAPYFLYL
FT                   LIRDRNS"
FT   gene            complement(143812..144789)
FT                   /locus_tag="AM1_A0163"
FT   CDS             complement(143812..144789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0163"
FT                   /product="Iron(III) dicitrate ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31670"
FT                   /db_xref="GOA:A8ZKH0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="InterPro:IPR035568"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKH0"
FT                   /protein_id="ABW31670.1"
FT                   /translation="MGFGLILGLGLLFVCFMASVGLGVADISPKTVYEALTAFDGSTDQ
FT                   LIIRTVRIPRSITALLVGGAVAVAGAMMQGLTRNPLADPGILGINAGAALAVVGSVFWL
FT                   GTTSLSIYAGFALLGAAIAAITVYALGSLGRGGLTPLNLTIAGAAFTALVSSITTGVLI
FT                   LSQRTLEEIRFWLAGSVAGRDLDLVVQVLPYLVVGMVIAMALGKQLTTLSLGEDIAQGL
FT                   GQNTAWIKVTAAVSIILLAGGSVAIAGPIGFVGLIIPHIVRFWVGVDYRWILPYSAITG
FT                   AILLLVADIGARLIIQPQELPVGLVMPLVGAPFFIYLTRWQVRR"
FT   gene            complement(144883..145287)
FT                   /locus_tag="AM1_A0164"
FT   CDS             complement(144883..145287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0164"
FT                   /product="biopolymer transport protein ExbD/TolR, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31671"
FT                   /db_xref="GOA:A8ZKH1"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKH1"
FT                   /protein_id="ABW31671.1"
FT                   /translation="MRLPDDPNPPAQINIVPMIDVIFAILSFFIIATLFLNRSDALPVN
FT                   LPQAKTAKPQISTKVTVTVDAEGDLALNREPIQLDALEQEVRDLTDTAEKVVVVIHADE
FT                   EVGHGRVITVMDRIREIEGAKLAIAAQKKQ"
FT   gene            complement(145271..145924)
FT                   /locus_tag="AM1_A0165"
FT   CDS             complement(145271..145924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0165"
FT                   /product="MotA/TolQ/ExbB proton channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31672"
FT                   /db_xref="GOA:A8ZKH2"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKH2"
FT                   /protein_id="ABW31672.1"
FT                   /translation="MQLGQIISDGGVVMLPLMVFSLIVIALVIERLIFWSKLNRNQLPI
FT                   VRRVFKLYRQDNVYEALGYLQEQAKFPIARIFLAALALENPTPEEFRLALESEAQAELP
FT                   TLRRFSTMFDTVISIAPLLGLLGTVLGLINSFSSLDMGNIGGSESAGVTGGISTALIST
FT                   AAGLIVAISTLIFANMFRSLYQRQLAFIQEYGGQLELMYRHRYERGGATYASTR"
FT   gene            complement(145925..146041)
FT                   /locus_tag="AM1_A0166"
FT   CDS             complement(145925..146041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31673"
FT                   /db_xref="GOA:A8ZKH3"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKH3"
FT                   /protein_id="ABW31673.1"
FT                   /translation="MSLFKFVDTEFALRVVSRLWFWIEPNLTFFFTVILGAT"
FT   gene            146346..147875
FT                   /locus_tag="AM1_A0167"
FT   CDS             146346..147875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31674"
FT                   /db_xref="GOA:A8ZKH4"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKH4"
FT                   /protein_id="ABW31674.1"
FT                   /translation="MSFNPFSNSQRAQEEHLVRTILAFTLPGSLVLHSLFFGISVGIPS
FT                   AEEVDLSEDAIEIAVVDAPEEEIEEIEEDDPIPLEEIEPEPLEELEEPDITEFVEDIPE
FT                   PVAVNPVPEPEDIPEETEPTEPAEEAEPSASSEEESSEEQSESSETPVKTGDDQPIASS
FT                   NKSKTTKSSTAKKPGKSKAKTTSPKRKPSKKQQKTAVNTQPKPPQKPKKSNQRGRSRLG
FT                   IGYRKDANSKTTAGLAERFIPVYEEGKLVDLKLERSTGDPALDKAIEKDKQKFFKQVKK
FT                   QLKSVPEGRRSKPIKIRFESNDLTAKEREQARKNRALSQQRAQERAAARARRARQKPAP
FT                   APAPAPASQPAPAPLPASTPAPVRQVDAPVASPSTPTPAPAPVPSSTPAPAPAPAPAPA
FT                   PAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPIPSSAPAPAPAPAPAPAPAPAPAPAPVY
FT                   VPPPAPAPAPAPVYVPPPAPAPAPAPAYVPPPAPAPAPAPPPPMAPPPTLE"
FT   gene            148068..149390
FT                   /locus_tag="AM1_A0168"
FT   CDS             148068..149390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0168"
FT                   /product="nickel resistance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31675"
FT                   /db_xref="GOA:A8ZKH5"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKH5"
FT                   /protein_id="ABW31675.1"
FT                   /translation="MTRLPRWLQGLENPIFARLYLAQTINLMGDALTWLGLALLAFELA
FT                   GEQSGTILAGALTLRVTAFVLLSPIAGVIADRMDRKRLMVANHLLRMGIVCLLPWVTQI
FT                   WQIYAIVLALNIFYAIFTPTYTATIPLITTEQQRPQAIALSSATSQLLGVLGPGIAGSI
FT                   AAWVGTRQVFFLDSITFLLAAILIITLPGRMVVNTQPSTQTPSRIWQDMQTGLACLWLD
FT                   PLIRYALALQFIAAIAGAQILVNTVGYVQSTLQLGKTEYGWAMAALGMGATLASIGLGH
FT                   FRNKYHPISLITLGTLLIVLALLPAHEVLLGGLLLLWGIAGIGQTLVNVTTQTVIADRV
FT                   AVEVQGRVYGAHFALSHLWWAFAYPVAGWMGSSLSTYFFYSSLFGLALFGVMFAIFRPH
FT                   QLMQLKRGLWHEHDHDHSDPSHHHHGHLAMQHTHLHFHPAP"
FT   gene            149740..150735
FT                   /locus_tag="AM1_A0169"
FT   CDS             149740..150735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0169"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31676"
FT                   /db_xref="GOA:A8ZKH6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKH6"
FT                   /protein_id="ABW31676.1"
FT                   /translation="MQVHLTAPNFCDLVQNVAQQVKADLQETELLQQFQFPVEFGQGWV
FT                   QRLNIRPGVTLTLERMTLFEPLTILASQGMSTSTLDICFCLSGQVQGSHWDSHQTTTLS
FT                   ANRGCLGFSPEIRGCLEYASAEPVQLVNIGIDIHELASVLHHPVEMLPLALQHSLLGNS
FT                   QCPYIQHFTTTTASQVALQQILNCPYNGLPRRLYLESRVIELLAHLLQSLSPSTASSSK
FT                   LSPDDIERIYAASEILKHQLEHPPSLLQLAHQVGLNDYKLKLGFREVFDTTAFGYLWSV
FT                   RMQEAALLLKRNRMGVTEVALSVGYSSATSFSAAFKRKFGTSPQKYRQHC"
FT   gene            151342..153507
FT                   /locus_tag="AM1_A0170"
FT   CDS             151342..153507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0170"
FT                   /product="TonB-dependent receptor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31677"
FT                   /db_xref="GOA:A8ZKH7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030150"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKH7"
FT                   /protein_id="ABW31677.1"
FT                   /translation="MGTTAPPTATVITTETQLALQVTSGEANSPENADASENADTSEDT
FT                   ELEITVTAQRREENPQDVPISLTVLTEPEIEDADVTSFEKVAGNTPNFNWFSPTDSRSF
FT                   SFYSVRGLSNFNFASRDSVGFFVDDVPLDYGGTLESDFPDLERVEILRGPQNTLYGRSA
FT                   QAGVVNLITRKPTNDFEGNAALSFGSENNLNLRAGISGPLIEDALFFRLAGTFGRRDGF
FT                   YNNLFLDGEEFDEKLGGNIRGKLLWTPSDRWEISFNAFYENNQDGTYPFVPLDDTPFEI
FT                   EQDFNGFNTLKTNSQALKIIYRDDNVQATSISTRRFSEFNVQTDLDQSTIDGGFFENDN
FT                   ASTIFSQELRIQSPDDSESRWQWLIGGYFESRTFDENGRGVRLGNDAGLILPAPLNVPG
FT                   ARTESFGELVDTTFAGFGQVSYRPVDALRLTVGLRYENVSSVLNSLRQVLTFPGAPPIP
FT                   LGNFDGTEQTSTALLPRFAIDYQLSPNATVYGTVARGFRPGGVNIFADDATSLVYEPER
FT                   SWNFEVGVKSNWLDNRLGINLSLFTNSIEDYQVITVDPITFTPVGIFNGDANVKGLELE
FT                   MRATPVEGLDLTASLGLLDAEFTDFTDVATGTDFTGNRLPYSPSFTFNVAAQYRSSFGL
FT                   FVRGEVQGVGETFFEEANAQNIRQGAYVLVNARLGYEFGSSGIFLFANNLFDTRYVTQA
FT                   FNLGVAGVASGSYGTPRTFGVQFRTRF"
FT   gene            153513..154763
FT                   /locus_tag="AM1_A0171"
FT   CDS             153513..154763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0171"
FT                   /product="major facilitator superfamily transporter,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31678"
FT                   /db_xref="GOA:A8ZKH8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKH8"
FT                   /protein_id="ABW31678.1"
FT                   /translation="MANRFSQLGLLGSLYTAQLIPNMFFTVALPVYLRSRGASLETVSL
FT                   LSLLFLPWCFKFLWSPLVDRYGYTRWGHYRAWIFGTQSIAAVLIVICALFDVQAHLGSL
FT                   VGLMLLITFFCATQDIATDAFAVGLLPVGDREVGNGIQSMGGYLGSIIGAGGMLVLLDH
FT                   WAWTPTMLLLAVVMILSMMPMLGVQERSVPSPAAPEPASIWRYYGQQFSAFCQRPGMKS
FT                   WLLLLVLYATGGSMGYTMLQPLMVDLGLSLGHIGWLLGIVGSGAGIGGAIAAIPLIRRL
FT                   SRKWALSAIAILQAIVLLGCLLPALGLQQTVVPVVILFHVGLGFASTIMHTTFMDRTTP
FT                   TTAGFDYSFQSSVSYIGGIGAAAISGLLVTHMGYPLFFGLCSLLSLLSIAVIYGCLGNI
FT                   EPQSPILNPAEVASGQR"
FT   gene            154923..156692
FT                   /locus_tag="AM1_A0172"
FT   CDS             154923..156692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0172"
FT                   /product="iron ABC transporter, ATP-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31679"
FT                   /db_xref="GOA:A8ZKH9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKH9"
FT                   /protein_id="ABW31679.1"
FT                   /translation="MSSLFAQAPAGLWALIAPVRGRIGVAISLAIGSATTTVLALAGIA
FT                   TLIQRLLLADASLADVGVRGLAVAIALAISVFCRAWAFRLSHLAAFDLEALLRTELTQH
FT                   LAQVPLGFAITTGSGAIKKVVQDDVKALHAFVADTTPLIGLALTTPILALVILLVADWQ
FT                   MTVASLAILPVGLICLSLATQDQAQRRQQYDEANEQINATVIEFVQGMQVVRLFDDGTS
FT                   SFARYRSTLDTFTQTLKDWTAATEKPGRAGELMFGPLPVLLVVAVIGSYGVRQGDLTLP
FT                   TLLLFLLLAPQINSAFKPILTLSLFINQSQASALRICKLLAEPILPLPSQPQRPKDASL
FT                   QLQQVSFAYGDRLALDQISLDCSPGSVTALVGPSGAGKSTLARLIPRFWDVTEGAIRIG
FT                   GVDIREMTEAELMSWVAFVFQETFLVHDTIRANICLGATDASEAQVVAAAQAAQAHDFI
FT                   LALPQGYDTVAGERGTSLSGGQRQRITLARALLQNRPIVILDEATAFADPENGVLIHRA
FT                   ISTLTRNKTVIIIAHRLTTIQSADQIVVLDQGQIVEQGQHPQLLAQQGLYAQLWSHHQR
FT                   AQNWQLSAKVPHG"
FT   gene            156649..158400
FT                   /locus_tag="AM1_A0173"
FT   CDS             156649..158400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0173"
FT                   /product="ABC transporter, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31680"
FT                   /db_xref="GOA:A8ZKI0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKI0"
FT                   /protein_id="ABW31680.1"
FT                   /translation="MLKIGSSVPRCPMVNLYRTLIKVAGSYAPQLQRSLGLSLLASIIQ
FT                   GCTLALLFPLLDALASFQEQLPGRLLVLMAGGTVLEALLRWRELDFGWRTSIEVTHELR
FT                   IRLGEQLRQMPQEDLNRYQSGDLNLILSSDVADLVLWMGSIVSLILQAIVVPSTLVLVT
FT                   LWVDWRLAIALLITLPGAIPFYRQLRRHAATEMPQMAQADAIATSRLIEYVQGLPVLRA
FT                   HQQVGQQSDRLQAALQHQRQIQIDSQDRTTRPTLLLAGMVQASLCLILSLGISLVWLQD
FT                   LKISTLMAIIVIVVCCSDPLTYLAGLTTLFDLMESALERVEHLMAICPLPVAPKPKIIT
FT                   DYTITFDHVYFRYRGQENWILNDVSLELPERSFTALVGPSGSGKTTIARLISRYADPQS
FT                   GTLAMGGVNLQTLSPAILMPHLAAVFQDVYLFNDTIYNNIRMAKPVASDADVIAAAKIA
FT                   NCHGLIQRFPQGYHTRVGEVGGALSGGERQRISIARAILKDAPIILLDEPTSALDAESE
FT                   VLVQHAIDRLVADKTVVVIAHRLSTIVGADQILVVQAGKIIERGTHSELLNQKGAYSQM
FT                   WWSQQPQ"
FT   gene            complement(158438..158611)
FT                   /locus_tag="AM1_A0174"
FT   CDS             complement(158438..158611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31681"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKI1"
FT                   /protein_id="ABW31681.1"
FT                   /translation="MSTEIDQNLGFLLQIYACSHFKNSLDLIANFQNLTCEMWILLLLN
FT                   DNRRLLDSPLRK"
FT   gene            158848..159744
FT                   /locus_tag="AM1_A0175"
FT   CDS             158848..159744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31682"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKI2"
FT                   /protein_id="ABW31682.1"
FT                   /translation="MTPQKAASILRDAGFEVDPLSLRLERREELWVMPLSGDRIAWFST
FT                   TSESARLLAFERRVQELVSRHTSLCVPVSTFMNDVVEVRNAVPGLVDHGVLFKTFLADS
FT                   SLAQRFGHELGHALADLHGSIPASQHGDWLPKQLEWPLPHHEVIEKIDVVIDDPGLVAQ
FT                   IDHVLTMHETIVVDPSDLVLLHGDLGFHNVAVEYENLAFRGLFDFKDAARADRHLDFRY
FT                   LIFTPGRFDMLDACCAEYSRLTGRTLDQQRIKLYNAIWAISHLAHRAGTAPDELSCGRT
FT                   LERDLWWTRSAIASLSA"
FT   gene            complement(160075..160704)
FT                   /locus_tag="AM1_A0176"
FT   CDS             complement(160075..160704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0176"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31683"
FT                   /db_xref="GOA:A8ZKI3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKI3"
FT                   /protein_id="ABW31683.1"
FT                   /translation="MDHSNILQLRPSQIEEASELAAHALISDPVFSNLTPDDPELRFQA
FT                   LTWLTSRLMAYCIQYGYTYTTSDIQGVAVWLPPAGEVSSHWLQQIKMALQLKVYQLPVK
FT                   VGWNRLARWLKVLSAIEKAQQQDMGESPYWDLGLMVVHPDSQGQGIGTRLLEPILLQAS
FT                   KEGLPCSVVTATELAVRFYQKNGFEITRKQQIAADAPSFWILKRHP"
FT   gene            161085..161675
FT                   /locus_tag="AM1_A0177"
FT   CDS             161085..161675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31684"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKI4"
FT                   /protein_id="ABW31684.1"
FT                   /translation="MVRPYLTGLSASLLMVMSPLVSQASELPIVESAALGIGKNPPWSE
FT                   PVQVEDPFEGQFIAVFDRHRFSDRFLNTHMRIEVQSLWTQEYVRLLLTAKDRDCYGHHG
FT                   FLSSSYCSEVIDTKKIVKLFVKIDEQIYQVSGQHNTFPVNLELASALSRASEQEIQIRL
FT                   VTESGTSVDSKIGPKTVKAWQTLYTSTLSHNLK"
FT   gene            161687..161815
FT                   /locus_tag="AM1_A0178"
FT   CDS             161687..161815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31685"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKI5"
FT                   /protein_id="ABW31685.1"
FT                   /translation="MLLAIEYGCLLVIRVQLRITLCFATSAVAWVPIREKYHLNSV"
FT   gene            162111..162524
FT                   /locus_tag="AM1_A0179"
FT   CDS             162111..162524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0179"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31686"
FT                   /db_xref="GOA:A8ZKI6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000859"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKI6"
FT                   /protein_id="ABW31686.1"
FT                   /translation="MEIRHEILFAENSDIDPEELNALFQLVGWDNQKRRTVSETRVMLD
FT                   ATHFYVHAHVNRKLVGFARVCGDPYVAQVLDVITHPEYRYHGIATECMHRIASFLSQSN
FT                   YVTVTLLDDSGIPCFYERFGFRGIDETPMKWCS"
FT   gene            162588..163034
FT                   /locus_tag="AM1_A0180"
FT   CDS             162588..163034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31687"
FT                   /db_xref="GOA:A8ZKI7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKI7"
FT                   /protein_id="ABW31687.1"
FT                   /translation="MKAFSIEAAPLAAKPQIGSMLSAYLAELGVGEPYQYFHQYWVEPG
FT                   QRYPFLIRHHSDLAGFAFVRRVERFEMAEFYIVPGFRRVGIGRFAVEELVRQFTGLWIV
FT                   RAFPGNERALLFWRSALRSHYIKHLVEGSEGERIVFTFESLRAR"
FT   gene            complement(163069..164331)
FT                   /locus_tag="AM1_A0181"
FT   CDS             complement(163069..164331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0181"
FT                   /product="major facilitator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31688"
FT                   /db_xref="GOA:A8ZKI8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKI8"
FT                   /protein_id="ABW31688.1"
FT                   /translation="MRTFLIIWLGQFASLLGSELTNFAITLWAWEITGQATPLSLIMVF
FT                   TQIPKLLVSPFAGIWVDRYSRKHLMLLGDLAAGLSTLTLLMLFLTDQLQVWHLYLSGAI
FT                   NGLFGYIQGLAYSASLTLIVAEKHYARATALGSVQMSGSYVLAPALAGALYAATGLTGV
FT                   LSIDIVTFGMAITSLALVKIPQPSEQPTKPKTSWSSLAFGLQYLWVRPSLMALLGFWIV
FT                   NSLIGSTIFAILPAMVLARSNNNPLIWGTLLAFFGMGGLLGGLTISISGGPKRRIHGVL
FT                   IASALWKFGIIVLALAQQTVTKIGTALVCGFCSPFPESANQTIWMSKVEPEVQGRVFAT
FT                   QFLLTQLSSPIGYAIAGPLADHFFEPAMQPSGALAGFFGPIFGTGLGAGMALQVSIFAT
FT                   CGMLIAVGGYSIRQLRWVEIT"
FT   gene            complement(164562..165623)
FT                   /locus_tag="AM1_A0182"
FT   CDS             complement(164562..165623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0182"
FT                   /product="probable iron(III) dicitrate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31689"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKI9"
FT                   /protein_id="ABW31689.1"
FT                   /translation="MARLKLNTMGLLMALAIVGIACTRPTPSTSTGTDCRTITHDLGET
FT                   EVCGQPQKVVTIGPNLLELLLALEVQPIAHAEYFPFPSRQFDQPDQQIPYLGKYLTRQP
FT                   DNVGTAESPSLEAIAKLKPDLILADSIKNKDEYELLSKIAPTLLFDYSGAGSAWQTDLE
FT                   ALGQALQKADKATTMVAESQQQVAKLKQELQPIVAKDPKVLLLLSEQLSQGVRLETANS
FT                   SCGALLEDVGFEVVVPADLSQSQEPSHVISLESLTNLDMDWILIEGFSSQNTAKTPTPE
FT                   EQQVKAIKTEWSENAIAQSLPPSKEGKVYFTPVYLCHALLGPIGTEVFLSDLYQQLSLS
FT                   KIKTSRMPTRFKS"
FT   gene            complement(165652..166695)
FT                   /locus_tag="AM1_A0183"
FT   CDS             complement(165652..166695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0183"
FT                   /product="probable iron(III) dicitrate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31690"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKJ0"
FT                   /protein_id="ABW31690.1"
FT                   /translation="MATVIKSLFIGLLVGALTLACGTTGNQPDQTTPTSGCERIQHDGG
FT                   ETEICGQPQTIVAIGPSILELLLALDMQPVGYADYYALPFDNFDQPQSQIPYLGERLTG
FT                   QVKKVGTWNSPSLEAILKLKPDLIVGSTLANQGQYSLLSQAAPTLLFSYGVNEEWQVQL
FT                   RFLAKVLNRSEKAEQVIAAHNQLVTEVRQTLRPAVQTYPQVLLLASEQLDQELAIENRD
FT                   SRCGGLLENLGFKVLAPKNIGTGTRGVNNISPEVLPELKSDWIFFLAWNTDFSDAGPDL
FT                   EKQQISAVRQQWQENAIAQSLPASQSNQVYFHSAYVCRALPGPIGTELLLKQLQADLLP
FT                   AVNSPTQ"
FT   gene            complement(166695..169262)
FT                   /locus_tag="AM1_A0184"
FT   CDS             complement(166695..169262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0184"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31691"
FT                   /db_xref="GOA:A8ZKJ1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKJ1"
FT                   /protein_id="ABW31691.1"
FT                   /translation="MILELPGRIILGLPSVIATLGLLAPLPVRAEQAAGGRETPDIDLA
FT                   KLSTPPSSQPATSVKEWQAQIEASIVEITAVRVDPSPEGLNIILESKTGQLSIPTTTTE
FT                   GNRLSAVIPNAVLALPEDPSFEQANPTPEITQISVTNLADDQVQVVITGANSAPTATVS
FT                   NADSGLTFSIASESAPDTLAEDEDVEITVTANPEEGYAPPNASIGTRTDSPIRDVPQSI
FT                   QVIPKQIIEDQQAIGLEEIVENVGGVTFLGNNDGRGLNFSIRGFDNVPVLQNGFRLFGD
FT                   DSVEPEIANLERVEVLKGPASVLFGQSEPGGLINLVRKQPLSEPFYKLQIQGGNRGFIS
FT                   PSVDLSGPLDKEGNLLYRLNALYRREDSFRDYTTSFDRFFVGPSLTWNISDQTDVTFSL
FT                   EYIKEDNPADFGTLAFGDGIANIPPSRVTNNPEDTIDKTYLKVGYDLEHRFNDKWKLRN
FT                   EFSYIYDKNDYGILALPFALDEPTGTLTRVFAAQFNENNFFNLNTSLQGEFETGSIRHN
FT                   IVAGIDLSRADNNGATRFSPTPEFFSFLDIFNPVYDPKPAFDTVPIAFGNDNSVNRLGV
FT                   YLQDQIYLLDNLILVGGIRYDIVDRSNISIVTGVEDTQVDEAFSPRVGLVFQPTDYLAL
FT                   YANYSKSFNPTFETDDLGELLDAERGEGFEVGIKAELIKDRLSATLAFFDITKSNVATA
FT                   DPVVPFAVITTGEQNSRGIDFDISGEILPGWNVIASYAYIDAKITQDNTFPIGNDLIGV
FT                   PEHSASLWTTYEIQAGDVQGLGFGVGFNFVGDRAGDLEDSFRVDSYFLTNAAIFYRRDG
FT                   WKFAVNIDNLFDVNFIRSVNGGRARGIYPGEPFTIRGSISVEL"
FT   gene            complement(169534..170268)
FT                   /locus_tag="AM1_A0185"
FT   CDS             complement(169534..170268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0185"
FT                   /product="ferrichrome ABC transporter, periplasmic
FT                   ferrichrome-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31692"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKJ2"
FT                   /protein_id="ABW31692.1"
FT                   /translation="MTSLTADIIHHLDDTKLVGIPGSRLIGTDQRFQDLPQVSQGRTAP
FT                   DLEKIVALKPTLVIGAKGFHDQPLCKVKDLGIATLTTEVKGWQDLIVLTEEIADKIGAD
FT                   PAPLLARYQQCLSKLPAESASTLVLVSRQPILAPNKNSWAGDLLQQFKAKNLAAELQGQ
FT                   SPVEGYVTLSAEKVLEANPDIVLVVDPEQDPVAAFESEPFWSKLKATQNKRVNAFDYYG
FT                   LVNPGSISKIEAACTQLQEVLQ"
FT   gene            170342..170734
FT                   /locus_tag="AM1_A0186"
FT   CDS             170342..170734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0186"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31693"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKJ3"
FT                   /protein_id="ABW31693.1"
FT                   /translation="MFYFLMQCPLCGHPKTHKHGKTSKGSQRYRCPHCQQTFSETFDTL
FT                   CYRRQISPETIQTILQAHVEGSSLRGLSRITGVAYNTCVSVVRSASHKSQMIHNGEVQA
FT                   VATDVINADELWSFVKKSKSTVSRRS"
FT   gene            170686..171186
FT                   /locus_tag="AM1_A0188"
FT   CDS             170686..171186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0188"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31695"
FT                   /db_xref="GOA:A8ZKJ4"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKJ4"
FT                   /protein_id="ABW31695.1"
FT                   /translation="MVLCQKKQKHCEPKELRVGDCWIALSLAKESGLVLSGRIGRHTDE
FT                   LAQELIENTEGKTACHHWQTDGWEGYARQLPDEVVHEVSKALTQRLERTNGIVRQQTGR
FT                   WHRRQNKFGKVWQQSAMTLRLVLSYFNWIWCHSRFKNTAAQRAGLTERPWRWQDLASYP
FT                   TLC"
FT   gene            complement(171168..171323)
FT                   /locus_tag="AM1_A0187"
FT   CDS             complement(171168..171323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31694"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKJ5"
FT                   /protein_id="ABW31694.1"
FT                   /translation="MTNRSRLLLAALLLSSQLFACSSPPPSANSEKPVTADATTNESIV
FT                   HQQSVG"
FT   gene            complement(171316..171450)
FT                   /locus_tag="AM1_A0189"
FT   CDS             complement(171316..171450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ferrichrome ABC transporter, disrupted by frame
FT                   shift and transposon elements."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31696"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKJ6"
FT                   /protein_id="ABW31696.1"
FT                   /translation="MLTPHNLAQVFGITAALMDSPVGLQICAIRAADIPVPSTVPSHD"
FT   gene            complement(171637..172266)
FT                   /pseudo
FT                   /gene="fhuC"
FT                   /locus_tag="AM1_A0190"
FT                   /note="ferrichrome ABC transporter, ATP-binding protein
FT                   FhuC"
FT   gene            complement(172269..172811)
FT                   /pseudo
FT                   /locus_tag="AM1_A0191"
FT                   /note="FecCD transport system permease"
FT   gene            complement(172924..173286)
FT                   /locus_tag="AM1_A0192"
FT   CDS             complement(172924..173286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0192"
FT                   /product="transposase, putative"
FT                   /note="May be a member of OrfB IS3 family."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31697"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKJ7"
FT                   /protein_id="ABW31697.1"
FT                   /translation="MNCPLFRVKVRYQFPEGSELWQDTGFQGFAPSGVSIKQPKKKPRN
FT                   AELTNIQKEENRQISQVRVEVEHQIGGIKRCQIVVQRFRNWVDHYVDDAMETACGLHNF
FT                   RLTHRRGKPTGQFGTA"
FT   gene            complement(173287..174159)
FT                   /locus_tag="AM1_A0193"
FT   CDS             complement(173287..174159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0193"
FT                   /product="integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31698"
FT                   /db_xref="GOA:A8ZKJ8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKJ8"
FT                   /protein_id="ABW31698.1"
FT                   /translation="MESEKVNVTITLMCKVLKLSRSGYYAWMKRQPSPRHQENAILSER
FT                   IQQIHDESRQTYGSPRIHASLIARGFRASRQRVVRLMAQLGICAQAKRPFKVTTDSEHD
FT                   GPIAPNILDRTFTTEEPDQAWVADITYIRTHEGWLYLAVIIDLFSRRVVGWSMAEHMRT
FT                   PLVLNALKAALGQRIPAQTGLIFHSDRGSQYASGDYQQALLKRGITCSMSRRANCWDNA
FT                   VAESFFGTLKTELIYPTTFANRAMAKTVIAEWIEVFYNRQRLHSTIGYCTPVQFEENYW
FT                   RTLNQTLAA"
FT   gene            complement(174207..174398)
FT                   /locus_tag="AM1_A0194"
FT   CDS             complement(174207..174398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31699"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKJ9"
FT                   /protein_id="ABW31699.1"
FT                   /translation="MTATARKLAVLFYNAVRYGMDYVDPGADQYEQKYRQRVLKNLHRK
FT                   AAEFGFKLESIGTGDCVS"
FT   gene            complement(174638..175561)
FT                   /locus_tag="AM1_A0195"
FT                   /note="fragment; similar to N-terminus of transposase"
FT   gene            complement(175788..176156)
FT                   /locus_tag="AM1_A0196"
FT   CDS             complement(175788..176156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0196"
FT                   /product="transposase"
FT                   /note="May be a member of OrfA IS3 family."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31700"
FT                   /db_xref="GOA:A8ZKK0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKK0"
FT                   /protein_id="ABW31700.1"
FT                   /translation="MTQRPRRTFTTEQKAEAVKIVQQSGKSVNQVARELDLTPSALRKW
FT                   IKQAQIDQHPIPGGPLTSAERQELNQLRRDLKRVQMERDFLKNHLHASACPNRLETQKD
FT                   LTGDEDGTPILVELQLLL"
FT   gene            complement(176261..176764)
FT                   /locus_tag="AM1_A0197"
FT   CDS             complement(176261..176764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0197"
FT                   /product="probable iron(III) dicitrate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31701"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKK1"
FT                   /protein_id="ABW31701.1"
FT                   /translation="MIYHRILVFAISVMVVACQKDLDVRTPSTPSQQEDCRMIEHQQGA
FT                   TQICGQPQHIAVLGPFVLEPLLALDIQPFAYADHVAWHQDAYNNPSQDIPYLGEFVTQP
FT                   LTNLGLASQPAIETLLKTKPDLIIGTDFNNADQYQMLSKVAPTLLLVNSGNTRLLQAFG
FT                   DAEF"
FT   gene            complement(176786..179353)
FT                   /locus_tag="AM1_A0198"
FT   CDS             complement(176786..179353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0198"
FT                   /product="TonB-dependent siderophore receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31702"
FT                   /db_xref="GOA:A8ZKK2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKK2"
FT                   /protein_id="ABW31702.1"
FT                   /translation="MVTRLFGKSLLLWVFTLANILTAPSVWAVDKSENSTEVAEASNHE
FT                   REQPTTSVTEWLAQIEEAIIQITKVQVNPTAQGLSIILETGRDELSVPTTTAQENRLTA
FT                   VIPNAVLALPDGPEYRQLNPATGIAEVSVTSLTADQVTVEIVGTDAPPTVSIQNEDTGL
FT                   VLVVDAAAQAISEDEEIDVTVTAEKFLEGYVVPDASTATRTDTPILDTPASIQVIPKQV
FT                   LEEQQVIRLEDALSNLSGVTYGGNFAGLDVNFNIRGFDNVPILRDGFRQFGFGNDGIPE
FT                   TANLERIEVLRGPASILYGEIQPGGVINLVTEKPLADPTYEAQLQIGNRGLISPQIDLT
FT                   GPLTSDNRLLYRLNVLYRNEESFRDYEQNIERIFVAPTLSWKISDQTDLTVQLEYSDYS
FT                   GPFEVGLPVIGNRVADVPASRVAGELEDFSDIEFLRVGYDLEHRFNDRWKVQNTFRFTR
FT                   RDILNTGAIPLFFFDEANGILGRGLSRQVRNPQDFSLQTSVIGKFATGPVDHTLLFGVD
FT                   LNRSEERDTAQFSDFADFQPLNIFAPVYGTFNGVNPGELPVFRDEQLDRDRLGIYLQDQ
FT                   IDLLDNLILVAGLRYETVKETVTSFPNAFDPNTTETIRNDDAWIPRFGLVYQPIPNLSL
FT                   YGSYSQSFTPNFGTTSAGDPLAPERGEGFEVGIKTELWDGNFLATLGYFDVTRQNVATS
FT                   DPNDPFALIATGEQNSQGIELDIVGKILPGWNILASYAYTDAKVTADNDIPVGNRVFNT
FT                   PEHSASLWTTYTLQSGTLEGLGFGLGFNFVGDRAGDLANTFDVESYFLTNAAIFYRRDN
FT                   WRVNLSIRNLFDVDYIAATQNSRESLNEPGAPFTIVGSVAIQF"
FT   gene            complement(179498..180505)
FT                   /locus_tag="AM1_A0199"
FT   CDS             complement(179498..180505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0199"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31703"
FT                   /db_xref="GOA:A8ZKK3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKK3"
FT                   /protein_id="ABW31703.1"
FT                   /translation="MALTLTQADLTDLMEQAENKGETIYQLLEYGVQSNLPIQFGQAGE
FT                   RVMQLRQGLEIAVLHGRLNQPLRVIRQHETTFPLVAKFYLSGTSRVQTLDATDIDCDYQ
FT                   ELAGHHYLYHLPNHTEIEEWFASQALKVVIISIDPDYFNGLDHGHSALPKPIQSLLAGD
FT                   RTHRFHQPLGRITDSIQQQIQKIFHCPYTGLMQQLYLESKVLELLTLQLSTWQYNSRQT
FT                   TNLDIDEIEQLHWAKETLVQQAQQPPSLTEFAQQVGLSEHRLNQGFRHLFGTTVFGYLK
FT                   QYRLQQAQALLHNPNLSIAKVAATVGYRNPEAFSTAFRQQFAISPKAYQLGRRP"
FT   gene            complement(180579..180731)
FT                   /locus_tag="AM1_A0200"
FT   CDS             complement(180579..180731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31704"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKK4"
FT                   /protein_id="ABW31704.1"
FT                   /translation="MTVMATQPTTSKRQDLCLWQSAMLDRLRRLWLLESRIPPASAVGV
FT                   DQHSL"
FT   gene            181060..181173
FT                   /locus_tag="AM1_A0201"
FT   CDS             181060..181173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31705"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKK5"
FT                   /protein_id="ABW31705.1"
FT                   /translation="MLSSLFTTLGTFLLTRKVAIGQFGLIDPLLQDKEIGE"
FT   gene            182666..183289
FT                   /locus_tag="AM1_A0202"
FT   CDS             182666..183289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0202"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31706"
FT                   /db_xref="GOA:A8ZKK6"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKK6"
FT                   /protein_id="ABW31706.1"
FT                   /translation="MSLLPGFTAGLLLITLSELGDKTFFIGAILAMRHPRRWVYGGVTV
FT                   ALATMTALSVWIGQVATVFPQQYVKGISVVLFLGFGLKLLNDAMRMSGNERMIHEQADA
FT                   LEAIQCREQGVTACPGRAVWMEAFTLTFVAEWGDRTQVATITLATAQNPYGVFLGAVLG
FT                   HAICAAIAVVCGKLIAGQISERLLTAIGGVLFLIFGIVVIQQMT"
FT   gene            complement(183544..183798)
FT                   /locus_tag="AM1_A0203"
FT   CDS             complement(183544..183798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31707"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKK7"
FT                   /protein_id="ABW31707.1"
FT                   /translation="MLQRDNAEAAEKQGKSPEAKQIRKEGIDWTKKHKPLISEYCAGVA
FT                   MVPDSAKLIALWGPMVAKVTQNLYGCPGRVFSSLGEANL"
FT   gene            complement(183798..183929)
FT                   /locus_tag="AM1_A0204"
FT   CDS             complement(183798..183929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31708"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKK8"
FT                   /protein_id="ABW31708.1"
FT                   /translation="MLTIDDSRWPLVSTRFRGLGTPEEMAQFYACFEEWLAKEEPFP"
FT   gene            complement(184013..184639)
FT                   /locus_tag="AM1_A0205"
FT   CDS             complement(184013..184639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0205"
FT                   /product="O-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31709"
FT                   /db_xref="GOA:A8ZKK9"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKK9"
FT                   /protein_id="ABW31709.1"
FT                   /translation="MLQWDPELDIFYSGSLAQLTWAVRAHLFDQVTQRYLASHQEAITI
FT                   ELGAGLSTRYYRVGQGYRYWLELDLPEITTLRRQLDTETDHHRFLAQSALDFTWMDELP
FT                   GNPENLLIIAEGLLMYFEENQVQHLIDQLRHRLPGATLVFDALGGTSNSKGAKQLAQLG
FT                   APLNWFIKNEQDIAAMGLSLTSVQSLIQANCRYPHRIGFFVGSLG"
FT   gene            complement(184646..184771)
FT                   /locus_tag="AM1_A0206"
FT   CDS             complement(184646..184771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31710"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKL0"
FT                   /protein_id="ABW31710.1"
FT                   /translation="MISPSESKLTGVPRTMLMTTRARVEEHQRSDAIFHDPKIME"
FT   gene            complement(184982..185359)
FT                   /pseudo
FT                   /locus_tag="AM1_A0207"
FT                   /note="ABC transporter"
FT   gene            185723..186256
FT                   /locus_tag="AM1_A0208"
FT   CDS             185723..186256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0208"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31711"
FT                   /db_xref="InterPro:IPR011518"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKL1"
FT                   /protein_id="ABW31711.1"
FT                   /translation="MRDQLTWNQLEDLKFASSKMTGARRRAFQADIALKYCDGNPNLTE
FT                   IIFGWGRNTVATGLGEKRTGMICVGAQSGFCGRKRWEDLHPEVATALRELAEAHCQQDP
FT                   TFSSSTAYTRLTAAAAITHLRAQGFPPKSVPAKSTMAVVLNRLGYRLRRVLKAKPPKNC
FT                   RKPMPSLPISNTKT"
FT   gene            186283..186921
FT                   /locus_tag="AM1_A0209"
FT   CDS             186283..186921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0209"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31712"
FT                   /db_xref="GOA:A8ZKL2"
FT                   /db_xref="InterPro:IPR011518"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKL2"
FT                   /protein_id="ABW31712.1"
FT                   /translation="MSIDCKATVELGESSRRGKTRTQTKACDHDMGSGPKYIPCGILEE
FT                   DTDTLHIIFGHSHKTSDFMVDNLQDWWNTLAPTEQQTLQLIQIKLDNGPENSGVRTQFL
FT                   NRLVAFSDHIGTAIQLLYYPPYHSKYNPIERCWGILEQHWNGTLLTDVDTLLGWASTMT
FT                   WKGNHPVVTVTQKIYETGISLTKQAMKGIEKRLERHPQLPKWDILIHPI"
FT   gene            186953..187114
FT                   /locus_tag="AM1_A0210"
FT   CDS             186953..187114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31713"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKL3"
FT                   /protein_id="ABW31713.1"
FT                   /translation="MSLHLQAQYVVPAETNKIAHAVFPKGNLCITMANALSDFLSDQDF
FT                   KDFFGVRG"
FT   gene            187145..188386
FT                   /locus_tag="AM1_A0212"
FT   CDS             187145..188386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0212"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31715"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKL4"
FT                   /protein_id="ABW31715.1"
FT                   /translation="MSILQFLEGLTDRQAADAVRSRIDWKYLLCLDLSDVGFNHSVLSE
FT                   FRTRLVTAGVESLIFEKLLQFCQERGWLKPRSRQRTDSTHVLAAIRAVTRLECAGETLR
FT                   AALNALAVAAPDWLIAHSQPEWADRYSERIEDNHLPKSKSQRIKQAELYGKDGLELLNA
FT                   VLAGNSPRWLRQILAVEILRKVWVQQYYCCELSIIWRTQQEAPPASVMISSPYEPDAHY
FT                   AKKHTTSWVGYKAHLSETCEPGELHLITNVETTAAPVDGDMTDSIHTSLANNTLLSSKH
FT                   IVDTGYLDVELLVTAQEQYQVDLLGPTRTNLRWQAKEAKGFAADDFKVNWQNQSLTCPE
FT                   GKSSVSWTPAIDGRNNEVVKIKFAASDCSVFPSLHICTRSQRQRRAVTLRPEAQYKALQ
FT                   QARQREPTSEYQQD"
FT   gene            complement(188374..188505)
FT                   /locus_tag="AM1_A0211"
FT   CDS             complement(188374..188505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31714"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKL5"
FT                   /protein_id="ABW31714.1"
FT                   /translation="MSGEPSLLVEFVPLSPSKRVLDSGHNSIDPLPPALAVGVDQSC"
FT   gene            188533..188649
FT                   /locus_tag="AM1_A0213"
FT   CDS             188533..188649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31716"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKL6"
FT                   /protein_id="ABW31716.1"
FT                   /translation="MTCYIALLLESLYDSVSRFIQLHLIELFKAGLLNKYFL"
FT   gene            188729..190462
FT                   /locus_tag="AM1_A0214"
FT   CDS             188729..190462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31717"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKL7"
FT                   /protein_id="ABW31717.1"
FT                   /translation="MKTIEFPLYLDSSQQVKVTDWMDILKHVYNRGIALLEWRQFYNRL
FT                   QKVREVDPEYNIPVQLNVNRLGGEWSMSCECRIKTRLDKSKSWDEANIEHRPACTLVKP
FT                   HWLTVPLIAGFSPVDLRKSFARKRYKNLGDIPQVYVNDFIGLVVFKAWANYLDQTRPEI
FT                   KRPRYKGKYARVNTIPCESFRSLVKIDFATDHLQLPGLGWISVPALSTRLKSVMDRQRL
FT                   HMEQHPDHYPELAKKLIERNALLRVAHWLEQGVPMPEEVFGDIKKAIKHAEHAIEKTGN
FT                   VSFAITKLRELAIKRELNQAINDLCTPGVFRICRKADKFYLQITVRSVVNQGNPRPEPI
FT                   GLDMGLNLLCHTTNGVKVKHPDLSQLTNKINRLKQKQSKMKLGSQNWHRIQKKISLAEQ
FT                   RKTRAKRSRQHYIAGWLVDANQNMAIKKFSHKDVVARPLPRPSKKTEQYLKNGREEQRI
FT                   INNQVREAALGQFTSFIQLKAADRENHVIEFIECDSSATPNEILETSSFHSGGPQSEKA
FT                   QNLQRTREGGRVTTTTREESESNSSTTRRLKQAPLLVNPAQSPKPFKRLRRMPQAERKV
FT                   L"
FT   gene            complement(190574..191056)
FT                   /locus_tag="AM1_A0215"
FT   CDS             complement(190574..191056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0215"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31718"
FT                   /db_xref="GOA:A8ZKL8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKL8"
FT                   /protein_id="ABW31718.1"
FT                   /translation="MFTNAALDDVDFQVKRGLQKAHFLQWAQGQWLTKHLKMIIGPTGV
FT                   GKTFLSCVLSEHLCRQGVRVRYFKTAELIGQLKMAKVDCSFLKLRKQLAAFELVVLDEW
FT                   LRDPLSTHDAREILDFLDERYRRASCLFATQSQWHQKIDEPTLDDAILDRIVPDSI"
FT   gene            complement(191358..191486)
FT                   /locus_tag="AM1_A0216"
FT   CDS             complement(191358..191486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31719"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKL9"
FT                   /protein_id="ABW31719.1"
FT                   /translation="MRIFGGRVAAIAGVEIIREDQLREVTSSFQITLLVPDTVTRF"
FT   gene            complement(191778..191927)
FT                   /locus_tag="AM1_A0217"
FT   CDS             complement(191778..191927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0217"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31720"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKM0"
FT                   /protein_id="ABW31720.1"
FT                   /translation="MSSTQEIGFQNINHLGIIAGIVDEIGIVKIIDQLLGTHVQKHATA
FT                   CGRL"
FT   gene            complement(191890..192021)
FT                   /locus_tag="AM1_A0218"
FT   CDS             complement(191890..192021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31721"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKM1"
FT                   /protein_id="ABW31721.1"
FT                   /translation="MQYAISIQNLAYIPQVIDMRGYFCGCPSEVGHVFNSRDRLSEY"
FT   gene            192084..192224
FT                   /locus_tag="AM1_A0219"
FT   CDS             192084..192224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31722"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKM2"
FT                   /protein_id="ABW31722.1"
FT                   /translation="MHIQNGSKSQFRLFGANLCLSLTGPIGTELYFEELEQQMLTDNLY
FT                   K"
FT   gene            192229..192993
FT                   /locus_tag="AM1_A0220"
FT   CDS             192229..192993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0220"
FT                   /product="thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31723"
FT                   /db_xref="GOA:A8ZKM3"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKM3"
FT                   /protein_id="ABW31723.1"
FT                   /translation="MFSPSPKLNHWIKAITVRSNAGLRLFCFHYAGGNAFVFRNWANQV
FT                   LDGVDVYAVELPGHGTRLAEPPCNRMECLIQDLKAALMPYLKPPFAFFGHSMGALISYE
FT                   LAQALRKEDLSPLHLFVSGYRAPHVPDDEPPIHTLPTADFLNALRCYNGTPEAILQNSE
FT                   LMELLLPTLRADFALLEAYQYRSRPLLDCPITAFGGAEDWKASAEEIKAWRSHTQSKFL
FT                   FYRFPGDHFFVHSAQSSLLQVLNAALQDLVGV"
FT   gene            complement(193381..193503)
FT                   /locus_tag="AM1_A0221"
FT   CDS             complement(193381..193503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31724"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKM4"
FT                   /protein_id="ABW31724.1"
FT                   /translation="MWSIGYGAWSKGNISEQMVEEYLEHHRPVSNNDVDTLMLE"
FT   gene            193586..193783
FT                   /locus_tag="AM1_A0222"
FT   CDS             193586..193783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31725"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKM5"
FT                   /protein_id="ABW31725.1"
FT                   /translation="MSPIDLMRIFNQHVDMIFTDHAFLYADILCIAYLDEQLTASVLHF
FT                   TFGHLITILGNPSEMLHQGS"
FT   gene            193821..194939
FT                   /locus_tag="AM1_A0223"
FT   CDS             193821..194939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0223"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31726"
FT                   /db_xref="GOA:A8ZKM6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKM6"
FT                   /protein_id="ABW31726.1"
FT                   /translation="MPKHILAHAQGLVYTLLHLMPSPYQQETLQALLELFLEATGQSLP
FT                   AHSKVKSASAISRFLNQYQWPTRQVIRAVRQAAIERLLKVRMPGRQPYLQVILDLTTLE
FT                   KTGKFKAMPGLIRVYHGKRGLHLVVMYLVVGKWRIPWNFRVYRGKDTPSPAQLGLQLLR
FT                   RLPHSLKERFQILVLADTAFGSIEFLEGTKHLEYSTIVGVRKDRKQQAGGPISQLSHRG
FT                   QQARLVGLSFPVWVSWFWLKRENGKRELRYVLSTKPLKGSTITRWGRRRWQIEGWFKTA
FT                   KHRFSLDRFAQGTLTGVYRWLVLSMIAYLLAHWAYLTTARSRLPEWGQAARLAMELWFP
FT                   HLLVMTLIADVEQLRPRMQQLGLDLHLSWCKI"
FT   gene            195323..196396
FT                   /locus_tag="AM1_A0224"
FT   CDS             195323..196396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0224"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31727"
FT                   /db_xref="GOA:A8ZKM7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKM7"
FT                   /protein_id="ABW31727.1"
FT                   /translation="MSISSPCDTYTLTSAELIELLQQAQKEGESIFWETELHEQFNLPK
FT                   VLGDGGDRVIKLRGGLTLHIRNATLHQNLRMVQQHTSQFPLTAKFYLSGSSRVQTRGFS
FT                   GIQAEYEERANSHYLYYLPDMIEVEEWQAKEPTQIVMVYAETDYFHAFQWADSTLPEPL
FT                   QFLKQASLKPVADLRFHQNLGNVTPAMYQVLQQILHCPYHGVIEQLYLESKALELLTLQ
FT                   FAHWQANGVISEQKLTKKVLLRSEDLGRLHHAKEILIERLVEPPSLVKLAREVGLNDRK
FT                   LKQGFRQLFGTTVFGYLQDYRMQQAKQLLHDSDLSIAWVAKTVGYKNPEAFSTAFRRKF
FT                   DISPKGYQLSQRNYMHG"
FT   gene            196453..196575
FT                   /locus_tag="AM1_A0225"
FT   CDS             196453..196575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31346"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKM8"
FT                   /protein_id="ABW31346.1"
FT                   /translation="MQRKAKRLSPMICKEVFENYSYLLCCHRKDVRKLLYSLQG"
FT   gene            196595..198205
FT                   /locus_tag="AM1_A0226"
FT   CDS             196595..198205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31347"
FT                   /db_xref="GOA:A8ZKM9"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKM9"
FT                   /protein_id="ABW31347.1"
FT                   /translation="MLAPFEPHDVHPAALRWSRRMTNQAVGIRSLAVKFPSVIHTPEAW
FT                   GEAFPELAAQAQARVRLPRKPQPGIDQDAESDLATWSQEVAPYLSDPFRGNVERRRLAV
FT                   QESPRAIECQAAQDAIAAAGLQPDDIELMIASTLFSESMGIGNAPALAQQLGLRCPAWT
FT                   LESTCSSALVALQTVRSLVQAGEYRTVLVIVSHFGSRVVDPADTLSWAMGDGAGSFIVT
FT                   AQPDQQGVLATHVMSTTDTCGAYAYEFVTNDQGMPQLRMRTGESAGAIAETAVASVRTC
FT                   CESAAAKAGISLDQISLFAFNTPTAWYASVCTRALAIPPERVMNLYPRYANIGPVLAVA
FT                   NLYHAAESGRLYQDDLVLVYTHGAGATAAATVMRWGEVALGPKPTAPSRVTPEQETVRL
FT                   ASSLTSLPVTASDMETVAPILTLSRAMVQAAVSKDRLQLVETYLLDWIRRSLPALAPSL
FT                   SPDQPLATVLDSLMGLTFKSQIEVDLQVRVPMEQFFGEHTIAHLAEYILNQLELSVLRA
FT                   LPSDPHAETCADSRETLRL"
FT   gene            198213..201824
FT                   /locus_tag="AM1_A0227"
FT   CDS             198213..201824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0227"
FT                   /product="barbamide biosynthesis protein BarG"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31348"
FT                   /db_xref="GOA:A8ZKN0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKN0"
FT                   /protein_id="ABW31348.1"
FT                   /translation="MELHSLLTTLSKQGIKLSTCEGLLEVDAPQGVMTSDLRHALSQHK
FT                   AEIVRLLNQLPAAGEVNGSATELPTLVSDPSQRYAPFPLTDMQYAFWVGRSGVLELGTV
FT                   ANHGYYEIDGQNIELERLNQALQILIDRHDMLRAIILPDGRQQVLETLPPYQMPLVDLR
FT                   GQSDDAVHSALAEIRDRLSHQVVPADQWPLFEFSATQLDGGRVRLHISYDLQVFDAWSL
FT                   FRLFDEWVQLYKTPDVPLPPLELTFRDYVLAEQALQKTELYLRSQTYWLNRLDSLPPAP
FT                   DLPLARHPKELKQHRAHRHEDHLQRSDWQQLKQRAMQAGITPSGLLLAAFADVISLWSQ
FT                   SPRFTINLALFNRLPLHPQVNDLLGDFTSVTLLAVDQSVPASFTERAARLQQQLWQDLE
FT                   HRYFSGVRVVRELARRRGTAPSVMPIIFTSTLGFRSLGQETLTFSHFGERVYGISQASQ
FT                   AWMDMQVWEENEELTFNWDVVDGLFPDGLIDDMFSAYGRWLRHLARSASSWTESGQPLK
FT                   RSSYGGVSRTLLPPDQQTQRALMNATDAPISDALLHELFATQVRLRPQAPAVITLQQTL
FT                   TYQDLFARANQLEYHLRQMGVTPNQLVAIAMDKGWEQVVAVMGVLMAGAAYVPLDPHLP
FT                   QSRLEALLDNSEAAIVLTQTRWLEQQVWPDRVHCLCVDDWSRDGSDFGFSILDFRSKSD
FT                   GVDVNFDLAQVDQSKQSEHLEPLSSVQTADDLAYVIYTSGSTGTPKGVMISHRNVVNVI
FT                   THTNQRFQVGEQDRMLALTALNHDLSVYDIFGLLSAGGAIVMPDVEAVKDPSHWLTLMA
FT                   RERVTLWNSVPAFMEMLIDEAEAQAINPLDSLRLTILGGDWLPLSLPDRLRAIAPNTQI
FT                   FSIGGPTETTIWNIGYLIDTVDPNWASIPYGQPLANSKYYILNEILEDCPIWVPGQMYC
FT                   AGVQLAKGYWRDKEKTNHQFITHPYTGERLYATGDLGRYRPNGTIEILGRIDFQIKLRG
FT                   LRIEAGEVEAALLQHPAVQAAVVGGIGDHHPERLVAYVVPQSTAPSLEELRDFLAQKLP
FT                   SHMVPSAFVFLETLPLSANGKVDRKALQAQAISVQSVNTAYVAPQNQLETAISTIFQTI
FT                   LDIPNVGIHDNFFDLGGNSLLLAKVYRALVEELPEETRSISLIDLFRYSSVQAIAQRLS
FT                   QTTPDLELESQMVSRNQQLAQGKNRLKTRLEKSRNLR"
FT   gene            201842..206839
FT                   /locus_tag="AM1_A0228"
FT   CDS             201842..206839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0228"
FT                   /product="beta-ketoacyl synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31349"
FT                   /db_xref="GOA:A8ZKN1"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKN1"
FT                   /protein_id="ABW31349.1"
FT                   /translation="MNVHRNGLEIAIIGLSGQFPGSPTLDQFWQNLKAGVESISVFSDA
FT                   DSQLASAPSSATQTAVKAGGILTDIEYFDAPFFGINPREAETMDPQHRLFLECAWQALE
FT                   QAGYAPGRGNDAVGVFAGVGMGTYLLYNLSPHPEVMASRGFLQTLVGVDKDYLSTRVSY
FT                   KLNLRGPSISVGTACSSSLVAVHLACQSLLSGECDMAIAAGVAVKVPQMNLTLSPDEIA
FT                   STDGQCHAFDARANGTVGGNGLGAVVLKRLEDAITDRDTIYAVIKGSAINNDGGMKAGY
FT                   TAPSQAGQTQVIRAAQAMAEVEPDSITYMEAHGTGTPLGDPIEIAAMTEAFRASTNKVG
FT                   YCAVGSVKTNVGHLDAAAGIAGLIKTTLALHHRLLPASLNFDTPNPDIDFANSPFYINT
FT                   GLKEWVANGTPRRAGLSSFGFGGTNVHLVLEEAPAPAPSSLSRPQQLLLLSAKTRSALD
FT                   TATANLVQHLHLPDINLADVAYTLQVGRSTFAHRRIVVCATGAEAIAALVDKADCQAPQ
FT                   SEYGLTDSDTSQRPVVFMFTGQGAQYVNMARELYDTEPLFRQTCDRCFTILEPHLGFDL
FT                   RSVLYPDAASPEFDIDQATQQLRQTAIAQPALFVIEYALAQLWMSWGIRPTAMIGHSIG
FT                   EYVAACLAGVFSLEEALPLVVRRGQLMQQLPGGAMLSVNLSVDEVASLLDEIDKTISIA
FT                   ASNSPSLTVVSGSNAAIAALEQWLTQQQIGCQPLHTSHAFHSSAMDEIATPFAQAIGQI
FT                   QLHPPQMPLISNVTGTWMTAAEATDPQYWVHHLRQTVRFAEGIAELLQDSHHLFLEVGP
FT                   GRTLNTLTRQQATDRAVLSSLHHPKDHASDVAFLLQTLGRLWLAGVTVNWPGFYAHEQR
FT                   DRLPLPTYPFERQRYWIDPPKTLPSKASLSQAVPLRQNSSQANDLADWFHVPSWQRSSR
FT                   LSTPIRSSSSANILIFLDQAGVGEVLVERLQQQGHRVATVDIGSEFAQLSDTKFCLNPD
FT                   QADDYQALFKTLRTQQFSTNAIAHLWSITTAAEMPSGLDPLDATLSRSFYSLLFLAQAL
FT                   GDQPGTDPVHLTVVSNQLQSVIGNERMCPEKATLLGPVGAIAQEYPHLNCCSIDLELDE
FT                   PLSEATDPDLLESLLAEITAPSDDALIAYRGRHRWVQTMQPIRLEETLADPANLRSGGV
FT                   YLITGGLGGIGLTMAEYLAQAVQAKLVLIGRSGLPDDTAAADGQDAPVRRKIADLEALG
FT                   AEVLVTQADVTDLAQMQRAIAEAEAIFGSINGVIHAAGIPGGGIMQRKTRAAAEAVLAP
FT                   KVKGTRVLEAVLPADLDFLVLCSSLASVIPLPGQVDYAAANAFLDAVAQARTARDQFTT
FT                   CINWDAWTEVGMAVKAANPSVQDTDQNPDPIAVEHPLFEVCYPHDADQVRYVSRLSLDQ
FT                   HWVLNDHRWGEQGLLPGTAYLEMARAAWANHHQTNPTDGIELRNVYFLTPLLVDAEQEV
FT                   HTVLTQKDTYVEFQIQSPSGVQISGAQPLEWQTHTVGEIAIPQPAQPRTFDLPALKATC
FT                   SQPQAGSAAPSLDHLLDGPIQFGDRWRSLKWINRSDTEALALLELPDAFHAELSVHRLH
FT                   PALLDVATGFLMMQLRQSDTAYLPFSYRRLTMWGTLSAQICSYIQWLNPSDSDSLKFNI
FT                   VLMDDQGIELIDIEDYTLRRKANDATT"
FT   gene            206823..208628
FT                   /pseudo
FT                   /locus_tag="AM1_A0229"
FT                   /note="polyketide synthase pseudogene, putative"
FT   gene            208625..212977
FT                   /locus_tag="AM1_A0230"
FT   CDS             208625..212977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0230"
FT                   /product="nonribosomal polyketide synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31350"
FT                   /db_xref="GOA:A8ZKN2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKN2"
FT                   /protein_id="ABW31350.1"
FT                   /translation="MTPSIHEFLFQLSEQGIKLWVEGDRLRCNAPKQVLTEELRSQLAD
FT                   CKADIVQFLSRADARSSGASNGTVTPDLPQIRPCPDDRFQPFPLTDIQQAYWIGRTQAF
FT                   ELSQVSTHFYSELDCDPDLDLNLLTQGWQRLIERHDMLRAIVRPDGQQQILAQVPPYEI
FT                   AVLDLRGESAEKTAVQLTELRDRISHQVLPSDQWPLFEMQATYYDPAHLRLHISFDLLT
FT                   SDARSIEIVFRELGQLMQQPNTEFTPIELSFRDYILAEIAFQNSDAYRRSRDYWQRRLA
FT                   TLPPSPELPLAVNLAGISAPRFVRHHQLLERDTWQRLKTQAAQIGITPSTLILTAFAEI
FT                   LTVWSKKSRFTLNLTLFNRLPLHPQVNDLVGDFTSLTLLSIDHTQASSLIIRARQIQAQ
FT                   LWTDLEHHHYSGVQVLRDLARSQGEGTAPLMPVVFTSILNPEAMGERPFPLDWLGQLTY
FT                   AVSQTPQVYLDHQVSEVSGALKLTWDVVEAIFPAGLIKEMFAAYCALLNRLAQEDDLWH
FT                   TPQRQLLLPHQLKQIEAINATDTNFVTSDSAPLLHTLFFDQAIRQPEQIAIATPDRTLT
FT                   YQELCDRVHQLSYFLHQQGIQPQDRVAIVMAKGWEQIVAALGILSLGAVYIPIDAALPQ
FT                   ARQWQLFAEADVTYALTQSVIDATLEWPPSLPRISVDTLSFSSISIPSSPTSPTDLAYI
FT                   IYTSGSTGQPKGVMIDHRGAVNTILDINQRFGVTSADRVLALSSLSFDLSVYDIFGTLA
FT                   AGGTLVIPAADGNRDPAHWLNLIERHHVTIWNSVPALMQMLVEFAASQPDRTAATLRLV
FT                   LLSGDWLPLSLPDQIRSIAPRSQVISLGGATEASIWSILYPIKEVDPTWRSIPYGRPMA
FT                   NQRFYVLNAALSPCPVWVTGQLYIGGIGLAQGYWRNHEKTQASFMVHPHTQERLYKSGD
FT                   LGRYQPDGTIEFLGREDFQVKVNGHRIELGEIEATLLQHPAVRHAIVTTIGAPRDQQQL
FT                   VAYIVPDSPAALTPASSPSFNAQVEAHEPRPLDGTLTDPAERLDFKLQQRGVRSPAPSQ
FT                   SGVQLPKPEFDDALVQAYWQRQSHRQFLEQPISLEAFSQFLSSVLQMQVTGLPLPKYRY
FT                   ASAGSLYPVQVYLYLQPNRVEDLAAGFYYYHPVDHQLLLLSDFAEVAAHRYGINQAVFA
FT                   DSSFSLFLIGQLQAIAPMYGELARDFCLLEAGYMSQLLMEAASQQEIGLCPIGTLDFAA
FT                   LRSHFCLEDSHILLHSFVGGKIDPTWTKQAASVNLTIQAQNRNIQGVQKTDLQLELSSF
FT                   LQQKLPRYMVPSAYVVLETLPLTANGKVDRKALPLSDNFSPPQQSVIKPQTQTERMVAR
FT                   VWQEILQLETAGIHDNFFELGGNSLLMIRTQVKLQELLHQEIPIVELFKSPTIHALASY
FT                   LSQHYSSSQQTESSTKKGGQRAQLRGDRQALRDQRKQSRQSHRSTHQS"
FT   gene            213257..217915
FT                   /locus_tag="AM1_A0231"
FT   CDS             213257..217915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0231"
FT                   /product="polyketide synthase type I, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31351"
FT                   /db_xref="GOA:A8ZKN3"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKN3"
FT                   /protein_id="ABW31351.1"
FT                   /translation="MNGLEIAIIGLSGRFPGAQTIDEFWQNLKQGVESVSFLSDEELLA
FT                   SGIDADTLSDPNYVKANAILSDADAFDAQFFGISPKEAELLDPQQRLFLEQSWTAISHA
FT                   GYDPATYDGVIGVYAGVDTSTYLVNNLCPTYGGIADLQMFLGNAVDYLATRVAYKLNLN
FT                   GPAITVQTACSTSLVAVHLACQSILNGECDMALAGGVSITVPQITGYTYQESGIASPDG
FT                   HCRAFDAQAQGTLFGSGVGIVLLKRLSDVIADGDTIHAVIKGSAVNNDGALKAGYTAPS
FT                   PEGQTTVISEAQAIAGIHPETITYIEAHGTGTALGDPIELAALTQVFRRQTNKTGFCAI
FT                   GSVKTNVGHLSVAAGITGLIKTVLSLKHRQIPPSLHFQQPNPQIDFASSPFYVNTALAD
FT                   WPTGNTPRRAGVSSFGMGGTNVHVVLEETPPAIAAAPSRPWQLLKLSAKTPSALEQATA
FT                   ELINQLNQTPELNLADVAYTLQVGRPGFSERRMLVCQTLDQAVQDLENGTFASASSVDD
FT                   RAAQRPIVFMFSGQGTQYVNMARELYDCEPTFRQWIDRGSDLLKPHLGLDLRHILYPNS
FT                   AQTEDAAQQLQQTAVTQPALFLLEYALAQLWQDWGVAPTAMMGHSIGEYVAATLAGVFS
FT                   FEAALTLVAARGALMQSLPAGQMLSLPLSEAEVQPLLGSGLSLAVINGAAACVVSGETD
FT                   AVTDLQEKLAAQGVEGRLLHTSHAFHSAMMAPILDRFRQRVQQVSPNPPQIPFVSNVTG
FT                   TWITPQEATDPAYWANHLRQTVRFADGLQTLMHDAAPILLEVGPGRTLTTLAKRHPSRP
FT                   ADTVILSSVRHPQDASSDAAFLLNTLGHLWLSGVLVNGAEFYRHESRRRIPLPTYPFEP
FT                   QRYWIDPPRHSAHRALTALSDAGSNNGTSKTFVTQKSEIADWFYLPAWKPSVAPQAQFD
FT                   PLATTCDLVLIHDQDREVGGFVNDLIQHLEQQNPNLIFVQPSTAFAQLNDRFYTVNPQS
FT                   SDDYQTLIQTLVSQHKRLQKIVHLWTLSTSEKPNGNFASDYLASDPELVQRCQFSGFYS
FT                   LLFLAQALAKQTEPDANSDGIQITVISNYLQSVTGNDPLAPEKSLLLGPIRVIPQEYPT
FT                   IHCRSIDINLPSPNRWQAERLTGQLLHDICCPITEPIIAYRGHQRYVQAVEKIRLDEPS
FT                   KEDFEVRSHLRQNGVYLITGGLGHIGLTLARYLAESMQAKLILMGRSTLPEKGEWHTWL
FT                   STHAASDRISRKIRQIQALEALGAEVLVVSADVSNEAELRSAISQAESQFGAINGVIHG
FT                   AGLVGAETFRAISQLDLVTCEQQFQPKVYGLLVLEKVLNDKPLDFCLLLSSLSSVLGGL
FT                   GHASYAAANLFMDALTHYHNQTHSSPWISINWDAWNQDSDTEKMAFFGSSLAQFSIEPD
FT                   EGIRALQQILLHPEQSQVIVSTADLSARIDQWIRPKAIGKKLALESSHSHERPTLSTDY
FT                   IPPEHKAEKILADIFQQVLGVKPIGIYDSFFDLGGDSMIGIQLISKIRSHFQIELSIQH
FT                   LFEAPCIADLAFNIEALLIEDILVEPLGTESR"
FT   gene            217912..226071
FT                   /locus_tag="AM1_A0232"
FT   CDS             217912..226071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0232"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31352"
FT                   /db_xref="GOA:A8ZKN4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKN4"
FT                   /protein_id="ABW31352.1"
FT                   /translation="MTSELNRDEKRKALRSRLSPAQRAQLDQRLRGDRSSAVNVNAIPR
FT                   RSTTSPSPLSFAQQRLWFLQQLEPGQAFYNEHAALRLAGELNLAALEHSLNALVERHEV
FT                   FRTRFDIVHGQPVQVIIPHLALSLAQADLQTVPAADQAEVVQRLSREQSHEPFNLEQAP
FT                   LLRWLLIWLDEQDYVLLFTIHHIIFDGWSIDILMRELSSFYTTFSAADDSDSSNVLPEL
FT                   PIQYTEYALWQRQWLQGDVLQAQLDYWRRQLAQAPPLLNLPSDRPRPAIQTYRGKAQTF
FT                   QLSQPMAQALKDLSRQTGLTLFMTLLTSFKILLHRYTEQTDLIVGSPVANRNRAEVEGL
FT                   IGVFVNSLVLRTDLSGNPTVAELMQRVRRVLLGAYANSELPFEKLVEELQPERDTHSNP
FT                   LFQVSFTLHNTPRQAVELSGLTLTPVEVSRDRALLDLRLDMTETEQGLTGCWEYSTDLF
FT                   DDDRIERMSGHYQKLLEMMVANQAQHIADLSLLTESEFHQLMQWNQTQADYPQDRCLSE
FT                   LFATQVEQTPDAIALIFEDQHLTYAELNARANQLAHYLQTLGVKPDDLVGICCDRSLDM
FT                   MIGLLGILKSGGAYVPIDPDYPSDRLAWMMSDAHLAILLTQRSLTDQLPPHQAQVVELD
FT                   GDWQTIAQQPRHNLANLATADHLAYVIYTSGSTGKPKGVQITHRSLVNFLCSMHKQPGL
FT                   TADDTLLAITSISFDIAALELYLPLITGAKVVVASRTVAADGEQLSELLSRTGATIMQA
FT                   TPATWRMLLTAGWSGQAGLKMLCGGEALSGDLAQQLMNMGTSVWNLYGPTETTIWSTIY
FT                   PVKNQPHNHTDSEVPFTKGDLGGSIPIGHPIANTQIYLLDRHGQPVPVGVPGELHIGGD
FT                   GLARGYLNRPELTAERFIDFGLPIADFGLEPDSQIPPKSEIVRLSAHDEVQNPKSVRLY
FT                   KTGDLARYRPDGSIEYLGRLDHQVKIRGFRIELGEIEAVLRQHSDVHEVVAISRPDLFG
FT                   ESQLVAYLVCQPERQVDSGELRKFLRAKLPDYMVPATYMTLEALPLTPNGKVDRKALPA
FT                   PTPELRMIDADASPASPIEDMLAGVWAATLGLEGVGRYDNFFELGGHSLLATQVMSQIQ
FT                   RLLQVEVPLRSLFESPTVAQLAERVEAAIQTGASLSIPAIQSRSNRDVAPLSFAQERMW
FT                   FLAQLEPENPFYNLPIAVALDGLLDLDALEQTLTEILRRHQGLRTRIETRVGVAIARIA
FT                   DPVPFPLRRVDLSQSASLDREPEIQRWIDTAARQPFDLQQDLLLRATVLRLSEQEHILL
FT                   LTLHHIAADAWSFGLLASEISALYPAFCDGNPSPLPELPIQYGDVAVWQRQWLQGNALQ
FT                   TQMDYWRQQLQDAPALLNLPTDYPRPAVQTYRGARYGFELSASLTRSLHHLSQQAGCTL
FT                   FMTLLAAFKLLLGRYSNSTDILVGTPIANRNRAEVEDLIGCFVNTLVLRTDLSHQPTVL
FT                   KLLERVREVALGAYAHQDLPFEQLVDGLQLGRSLSHTPLFQVMFVLQNTPLPQVTLPNL
FT                   QIHPLDTGSGTTQFDLTLSLEETPAGLTGVIEYNCDLFEEATITRMAGHYQMLLDGFVA
FT                   HPQRPVAELPCLTTAEQQQLVAWNQTQAVYSQDACIHHLFEAQVERIPDAIAVVFQDQQ
FT                   LTYGELNQRANQLAQKLRSQGVQPDVPVGICVERSIDMLVALLGVLKAGGAYLPLDPTY
FT                   PSERLAFMLDDAQVKHLVTQSALCDRIPPHQAQVVYLDRLATENSRPDSGNPIHSPQTE
FT                   NLAYVIYTSGSTGKPKGVMVNHRSLVNYTEAIASAYVLKPSDRVLQFASINFDVAAEEI
FT                   FPTLAQGGTLVLRTDEMLDSIPTFLHQVQALELTVLNLPTAFWHQFTAELDRMSTTVPD
FT                   SLRLVVIGGERALADRVQTWHRVVGEQIRLVNCYGPTEATIGATLCDLTAYAPTEWAGN
FT                   ESGATILSSNDVPIGKPIQNVQTYVLNADLQPVPIGIPGELYIGGDGLARGYLNRPELT
FT                   AERFVDLRLPISNSKFKTQNSKLSPSICLYKTGDLVRYRPDGNLEYLGRIDHQVKMRGF
FT                   RIELGEIEAALGQHPAVQNAVVVDDETELGTRRLVAYGVAMPYADLSMPELRQFLTEKL
FT                   PAYMVPAVFVLLETLPLMPNGKVNRQALPAPDATQAESDATVASPRTPTEITLAEIWAQ
FT                   VLSVTQVGIHDNFFELGGDSILSLQVVARSHQAGLQFTPKQLFEHQTIAELAIVAQTKH
FT                   ETEIEQGLATGSVGLTPIQQWFFEQQLPDPHHFNQAVLLEVPQPLDPGLLEQAVQQVLI
FT                   HHDALRLRFEPIESSWRQEYAPPDSALLLIRWDFSTLSKAEQQAAFATAAAELHTSLDL
FT                   SKGPLLRVGYFDWGDHLSDSLLIVIHHLVVDGVSWRILLEDLQTAYQHLSRGETVQLPA
FT                   KTLSFQQWSQQLQQMAQTVLDSSEPDYWLAQQSSTPLPVDIVGAEKAGAENTVASAATV
FT                   HCILSMAETQALLKEVPSVYNTEINDVLLTALVQTLTAWVEPDAAIHSPTFLIDLEGHG
FT                   REGITANLNVSRTVGWFTTVFPVALSLDPNVHPGEALKQVKEQLRRIPHQGLGYRLLRY
FT                   LSEEPSLTAALKNLPQANILFNYLGQFDSALTDTALFRPLSESAGPTQSPRGQRSHWLE
FT                   INCWVSGGQLHLDWIYSQALHQSSTMETLAQQFMETLRSLIAHCQSPDAGGYTPSDFSE
FT                   ADLSQDDLDRFLAHLNRRS"
FT   gene            226077..227525
FT                   /locus_tag="AM1_A0233"
FT   CDS             226077..227525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0233"
FT                   /product="nonribosomal protein synthetase condensation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31353"
FT                   /db_xref="GOA:A8ZKN5"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKN5"
FT                   /protein_id="ABW31353.1"
FT                   /translation="MNTAVHNTIQDIYELTPIQKGILFHSLYAPEVGLYLMQTGYTVRG
FT                   HLNRLAFERALQHLAQRHTILRTSFHWEEADKPLQVVHRQATIPLEYQDWRDLSETEQA
FT                   ARLQMVLKCDRERGFDFSQPPLLRMTIIRLADQDYEIIQTEHHLILDGWSGALVMGEVI
FT                   QLYQAFCQGQDSPLLPSIPFKTYLSWLRKQDLSKAERYWRQALQPIKASTPIVALESGS
FT                   IPNPTERYDEQQIKLSATLTADLQALARQHQLTLNTLFQGTWALLLSRYSGQDSVIFGC
FT                   CVSGRPVDLPGVESMVGVFINTLPVYVDVRSDQPLLPWLKRLQAQQVEMRQYEYSPLVD
FT                   VQGWSPVSHGNSLFESIVVFENYPILQMSKQGKDGLELQKSTVFYKTNYPLTLVGYPGS
FT                   ELVLGISYDCRRFDAATIGEILNHFERVFQLMIANPDMQLQDISLFTPVEQNLAHWLYQ
FT                   NAAFDDCWLQEDTLHAGGYAHEHF"
FT   gene            227512..228762
FT                   /gene="ectB"
FT                   /locus_tag="AM1_A0234"
FT   CDS             227512..228762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ectB"
FT                   /locus_tag="AM1_A0234"
FT                   /product="diaminobutyrate--2-oxoglutarate aminotransferase,
FT                   putative"
FT                   /note="Also carries the gene symbol of dat."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31354"
FT                   /db_xref="GOA:A8ZKN6"
FT                   /db_xref="InterPro:IPR004637"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR012773"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKN6"
FT                   /protein_id="ABW31354.1"
FT                   /translation="MNIFEQRESNVRSYCRSFPTVFHRAKGALVYSESGKENIDFLAGA
FT                   GALNYGHNNDYIKQKVLSYLDADAMTHGLDLHTAAKEKFLATFSEQVLIPKQLDYRIQC
FT                   CGPTGTNAVEAALKLARKVKNRTGIFSFMGAYHGMTQGSLSVTGNTAIRSGIESFAQVT
FT                   FMPYPYRLMDGFDTIHYIESVLNDIHSGIEKPAAIIFETVQAEGGIVVAPIDWIQQLRA
FT                   LCDRNDILLICDDIQVGCGRTGPFFSFERANIIPDMVILSKSISGYGFPMSLLLMKQEL
FT                   DQWQPGEHTGTFRGYQLAFVGGTAALEYRSSTDLEKVVRLKETFLRTFLTEEIAPLHPK
FT                   IEIRGLGLIWGIDLAALDDGNFAKKIATRCFEQGLIIERVGRRDTVLKLLPPLTIEMPI
FT                   LRRGCTILKQAIEECLA"
FT   gene            228848..238093
FT                   /locus_tag="AM1_A0235"
FT   CDS             228848..238093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0235"
FT                   /product="peptide synthetase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31355"
FT                   /db_xref="GOA:A8ZKN7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKN7"
FT                   /protein_id="ABW31355.1"
FT                   /translation="MIQTLTPPDSISEQRLHHKIYWLNQLSGERPETAILTDYRRPEHY
FT                   SPNNESVTFELDDRLSQAILQISQASDFSSYLLLLSAFSCVLRVYNRSDDLMLGIPAYS
FT                   FPENHSENGERLSNPIARSVLPLRLQINNQLSFKEVLQLVKEATIQAYVHQHYPLDDLL
FT                   GTLDLPRLDHRCPLYDIVVALDNLHPHPADRKQDLTVSWHIDAASISGRIEYRNSLYQN
FT                   GTIEALIRHLINGLEYAIAHPNRPISQLNLLRDEDVDQLLKAFNHNSQSYPADQTIQGL
FT                   FESQVEQSPDQVAAVCWNESITYQELNSQANRLARCLQSAGVQTGDFVGIFQERSLNFL
FT                   RSILAILKAGAAYVPMDSAYPPERIQYMLQNSEVSVLLTDAKTRESIVDNSQYYPHLKH
FT                   IIYLKTDGKFEAYLTSSNEPASCENLSDKNLEITCHSRDWAYMLYTSGSTGLPKGAIIR
FT                   HDGAINHIYAQFDALKLDENLRFLQTAPASSDISVWQFLAPLLIGGCTVITDTETVCDP
FT                   QALLQMLQTHSITLVELVPVVLKGLLNYAAQLPDQVRSLHQLNWMMVTGEDVSVNLVNQ
FT                   WLHLYPSIPAVNAYGPTEAADDITQQIIATPLPEHQRSVSIGKPLANLNLYIVDAQMQL
FT                   VPVGVPGEICVSGIGVGEGYWQNSEKTTLSFVANPFLNSGHITTQHHSCLYKTGDLGRW
FT                   LLNGSIEYLGRLDHQVKIRGFRIELGEIEVALSQHPALKEAVVMVREDRPGDKRLVAYG
FT                   VPNAESAVETLETLELRRFLNEKLPDYMVPSAFVLIERLPLTPSGKVDRKALPAPEGNA
FT                   LASAEASRAATPVEDILIGIWATVLGCNRPGIHDNFFELGGHSLLATLIISQVRQVFQL
FT                   ELPLRRLFEYPTISQFAIAIERESQSGLAAPPIEPQSDTNNLVLSFAQQRMWFLAQLEP
FT                   DSPFYNLPVAVRLQGELHQLALEQTFSTILYRHRVLRTQIETVAGQPVANLSVDSDVAI
FT                   AQIDLSGLSQPEQEAEVQWWMTAEAQRPFNLSREPLMRVSLLHLEQHDHILLITLHHIA
FT                   ADGWSIGVLVNEVATLYPVFCAGQPSPLPQLPIQYSDFADWQRQWLQGEVLEQQLTYWR
FT                   KQLADAPALLELPTDNPRPAVQRFQGDSYSFTLDTKLSTDLQQLSQSTGCTLFMTLLAG
FT                   FNLLLSYYSNRDDIVVGTPIANRNRAETERLIGLFVNTLVLRTDLSDNPNVTELLSRVR
FT                   EVALGAYAHQDLPFEQLVEELQPERSLSYSPLFQVMFILQNAPLDEIELPGLMLTSLES
FT                   DSGTSQFDLTLILEELPKGLVGTVEYSTDLFEETTIARLVGHYQTLLSAIVANPKQRLS
FT                   ELTLLTEVEQRQLVQWNQTQVDFPIDLCLHQLVEAQVERTPEATALIFEDQQLTYAELN
FT                   ARANQLAYYLRSQGVKPNDLVGVCGDRSPELVIGLLGILKTGAAYVPLDPSYPQERLNW
FT                   MVTDTQMPILLTQEHWRDQLPQHKSQVVCWDLDSEAISQQPDPNPERRVGADHLAYVIY
FT                   TSGSTGKPKGVQIEHQSLVNFLFSMQRQPGLEATDILLAVTSVSFDIAALELFLPLITG
FT                   ATVALVSRTVAMDGILLSRQLEAVGATVMQATPATWRMLLAAGWRGQVGLKILCGGEAL
FT                   SRDLAQQLVTTGTSVWNLYGPTETTIWSTVYPIKDPSSEIPLSKGDLGGSLPATLPIGH
FT                   PIANTQIYLLDRHGQPVPIGVPGELHIGGDGLARGYLNRPDLTEEKFVVHSQWGQLYRT
FT                   GDLARYRPDGSIEYLGRLDHQVKIRGFRIELGEIETVLRQHSDVHEVVAISRPDLFGEP
FT                   QLVAYLVCQPERQVDSGELREFLRAKLPDYMVPATYMTLEALPLTPNGKVDRKALPAPE
FT                   LSLDTVSEGELPSTPMEMRLEQIWIEVLGVEASQHLGLHSNFFELGGHSLLATQVISQI
FT                   RQVFQVELPLRRLFECPSIAQLTQAIAAAIQGGEVPDLPPIQPCSPAEPIQLSFAQQRM
FT                   WFLAQLEPDNPFYNLPVAVRLQGTLNINALEQTITEIIRRHQVLRTAIVTQLGEPSAVL
FT                   QPSSSVSLTQVTLSQGEQDADVQEWMDAEAQRPFNLSRDPLMRVSLLCLSHNEQILLIT
FT                   LHHIATDGWSFGVLVNEVATLYPAFCAGQSSPLSPLPIQYSDFAAWQRQWLQGEVLAKQ
FT                   LDYWRKQLRGAPALLELPTDHPRPAVQRFQGASYTFNLETELSSHLQQLSQDTGCTLFM
FT                   TLLAGFNLLLSRYSNRDDIVVGTPIANRNRAETERLIGLFVNTLVLRTDLSDNPNVTEL
FT                   LSRVREVALGAYAHQDLPFEQLVEELQPERSLSYSPLFQVMFVLQNAPFSQVDLPELTL
FT                   TPLESDSGTTQFDLILSLTETDAGLMGTVEYDTDLFGVGTIARLVGHYQKLLEMMVANQ
FT                   AQHIADLSLLTESEFHQLMQWNQTQADYPQDRCLSELFATQVEQTPDAIALIFEDQHLT
FT                   YAELNARANQLAHYLQTLGVKPDDLVGICCDRSLDMMIGLLGILKSGGAYVPIDPDYPS
FT                   DRLAWMMSDAHLAILLTQRSLTDQLPPHQAQVVELDGDWQTIAQQPRHNLANLATADHL
FT                   AYVIYTSGSTGKPKGVQITHRSLVNFLCSMHKQPGLTADDTLLAITSISFDIAALELYL
FT                   PLITGAKVVVASRTVAADGEQLSELLSRTGATIMQATPATWRMLLTAGWSGQAGLKMLC
FT                   GGEALSGDLAQQLMNMGTSVWNLYGPTETTIWSTIYPVKNQPHNHTDSEVPFTKGDLGG
FT                   SIPIGHPIANTQIYLLDRHGQPVPVGVPGELHIGGDGLARGYLNRPELTAERFIDFGLP
FT                   IADFGLEPDSQIPPKSEIVRLSAHDEVQNPKSVRLYKTGDLARYRPDGSIEYLGRLDHQ
FT                   VKIRGFRIELGEIEAVLRQHSDVHEVVAISRPDLFGESQLVAYLVCQPERQVDSGELRK
FT                   FLRAKLPDYMVPATYMTLEALPLTPNGKVDRKALPAPDLSRTQDEIVPPRSHTEATLAT
FT                   LYTEILGVEIISVHDNFFELGGHSLLATRLTSRLRETFELELSLRSLFEKPTIAELAEH
FT                   IDVLRLAIAQAPIPATTTEPGRKEIEL"
FT   gene            238090..242811
FT                   /locus_tag="AM1_A0236"
FT   CDS             238090..242811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0236"
FT                   /product="nonribosomal protein synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31356"
FT                   /db_xref="GOA:A8ZKN8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKN8"
FT                   /protein_id="ABW31356.1"
FT                   /translation="MKPIESFLSDLYRLDVKLWVEGTDDKRQDGSEQTRLRCNAPEDIL
FT                   TADLSAQISARKAEIIAFLNQAHAASHLSLPEIQAIARPEHVSLSFAQQRLWFLDQMEP
FT                   NSPLYNIPAAARLTGTLDAIALDQSFNAIVQRHESLRTAFQAVDGQPVQMIVPELTVPL
FT                   QRVDLSTLDKAEQEVRVLQLAQQEAQQPFDLTQAPLLRVTLIRLTDTEHVVLLTMHHII
FT                   SDAWSMDILLQELTALYGAFSAGQPSPLSELSIQYADLAVWQRQWLQGEVLERHLSYWH
FT                   QQLGGNLPILQLPSDRPRPRVQSFRGAKHTFTLSAELTAALKALSQQAGVTLFMTLLAS
FT                   FKVLLHRYTGQADLLVGSPIANRNRSEIEGLIGFFVNTLVLRSNLADNPTFRELLQQVQ
FT                   QTTLAAYEHQDLPFEKLVEELQPERDLSYSPLFQVKFALENAPTSDLNLADLTMSFLQF
FT                   ESSTAKLDLSLDMSEEVSDTGAARLGGTFEYSTDLFDKATIQAMAEHFQCLLTGIVAHP
FT                   DQCISDLPLLTEAERYQQFVTWNDTQVEYAQDECFHQRFEAQVEQTPNAIALVFQDEQL
FT                   TYAELNRQSNQLAYYLQNQGVKPEVVVGLCVERSPAMILGLLGILKAGGAYLPLDPTYP
FT                   PERLAFMLADAQVPLLVTTSTSATHLPNPTAQVIKLDADWPTISQEPEHNPSSAVTVEN
FT                   LAYLIYTSGSTGTPKGVLVPHAGLVNLTDDKIRTCQVRPDSRVLQFFSLSFDASVPEIV
FT                   MSLGCGAALHLAPPEDLLPGPGLLKLLREQAITHITAPPSALTALPPADLPALQMVLVG
FT                   GEAPSPELIAQWSKGRLFINAYGPTETTVNASMVPCEAGAEPTLRPAANKQLYILDRHL
FT                   QLLPIGVPGELYIGGIGLARGYLNRPEKTAAAFVDFGLPLFDAGLDTGQLLSPNSKIPS
FT                   AAQQSHAFEAINPESTRLYKTGDLACYRRDGHIKLLGRLDHQVKIRGFRIELGEIEARL
FT                   AQHPAVQESVVIVREDQPGERRLVAYVATSSDPAPTTSELHRFVAKTLPKYMVPAVFVR
FT                   LEALPLNPNGKVDRQALPAPDTLRPALAETFVAPRNSTETCLVQVFADVLEVKQVGVHD
FT                   DFFELGGHSLLATKLIARLLKDFQIELAIADLFESPTVAGLAERIESLRQASGSQSASQ
FT                   EATHQTIAAFLKAEAVLDPTIRPAPGSSRAIAPACGIFLTGATGFLGAFLLAELLQQTT
FT                   AKIYCLVRSHSQASAQHKLQASLTSYQLWHDAWQSRIIPIVGDLAQPRLGLTESQFQAL
FT                   ARDADMIYHSGAWVHHASPYSLLKASNVLGTEEVLRLACHTKVKPVHFMSATSVFAPAD
FT                   VANPQVIREQEDITNHAPLGGYNQSKWVAEHLVVMAGDRGLPVAIYRLGRISGHSQTGV
FT                   FNPNDFLYRLIIGCVELGYVPKDAEMLLDMIPVDYASRAIAYLSQQPSSQTQPFHLVHP
FT                   QPVSSSILFEALRSQGYTVQQISEQHWRSKLLHIAETSPNHPLYPLIPLLTAPSQPSSE
FT                   PSLEAVLRFDCQNTLNGLAKSEIACPPLDQSLLHTYFTYLSQNGWLKQSEPQT"
FT   gene            242847..243734
FT                   /locus_tag="AM1_A0237"
FT   CDS             242847..243734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0237"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31357"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKN9"
FT                   /protein_id="ABW31357.1"
FT                   /translation="MTSSTSRYSDYDPWAWLYNRSEAHLALQGLMPLLDKLLFPHLPEN
FT                   GQILDVCCGTGQVSKQLIQQGYQVTGLDGSEKMLHYARENAPQGKFLLDDARSFTLPST
FT                   FDAAISTDSSLNHIMSLDELQQVFQNVYAALKQGGRFLFDLGLENRYRNIEVNDGELQA
FT                   DYAWTVGETYDADNKTGTFTITLFQPADSDASPSLTNSDKRSHSIPQRLKRFVYNRVLR
FT                   VLRPGLLPQLIDKYWQSLPMTFTAKPYSQAEVRAALEVVGFTQVEVYDFRARRATPQRK
FT                   DYAYFLAQKPSGQA"
FT   gene            complement(243805..244443)
FT                   /locus_tag="AM1_A0238"
FT   CDS             complement(243805..244443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31358"
FT                   /db_xref="GOA:A8ZKP0"
FT                   /db_xref="InterPro:IPR011518"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKP0"
FT                   /protein_id="ABW31358.1"
FT                   /translation="MSIDCKATVELGESSRRGKTRTQTKACDHDMGSGPKYIPCGILEE
FT                   DTDTLHIIFGHSHKTSDFMVDNLQDWWNTLAPTEQQTLQLIQIKLDNGPENSGVRTQFL
FT                   NRLVAFSDHIGTAIQLLYYPPYHSKYNPIERCWGILEQHWNGTLLTDVDTLLGWASTMT
FT                   WKGNHPVVTVTQKTYETGISLTKQAMKGIEKRLERHPQLPKWDILIHPI"
FT   gene            complement(244470..245003)
FT                   /locus_tag="AM1_A0239"
FT   CDS             complement(244470..245003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31359"
FT                   /db_xref="InterPro:IPR011518"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKP1"
FT                   /protein_id="ABW31359.1"
FT                   /translation="MRDQLTWNQLEDLKFASSKMTGARRRAFQADIALKYCDGNPNLTE
FT                   IIFGWGRNTVATGLGEKRTGMICVGAQSGFCGRKRWEDLHPEVATALRELAEAHCQQDP
FT                   TFSSSTAYTRLTAAAAITHLRAQGFPPKSVPAKSTMAVVLNRLGYRLRRVLKAKPQKNC
FT                   RKPMPSLPTSNTKT"
FT   gene            245021..245155
FT                   /locus_tag="AM1_A0240"
FT   CDS             245021..245155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31360"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKP2"
FT                   /protein_id="ABW31360.1"
FT                   /translation="MHHYYILCSEVCEVFPRNRPRYPESTFRKEKSTFYEEKLGYILL"
FT   gene            245207..246682
FT                   /locus_tag="AM1_A0241"
FT   CDS             245207..246682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0241"
FT                   /product="aminotransferase, class III"
FT                   /note="aminotransferase, class III superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31361"
FT                   /db_xref="GOA:A8ZKP3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKP3"
FT                   /protein_id="ABW31361.1"
FT                   /translation="MTQSLLDSQSNPQQSPQLDPQRAYLDRFIVRYTQRTQTSKAIAQF
FT                   SRSVLADPRQSEWFSPTTKELCYLVVGERSQGSRVWDVNGNEYIDLIMGFGANLLGHNP
FT                   PLIKEALQAQLEKGIQLGPQAEYAGEVAALISELTGLERVAFSNTGTEAVMTAVRLARA
FT                   ATQRTKIAVFTNSYHGHADGVLVEPGFPLPSILQRLLGGLVSRLNARAVPMAPGIPKVI
FT                   AKNVLVLDYGNPESLQVIKAHRHQLAAVLVEPVQSQQPDLQPKAFLHDLRSITQDSGIA
FT                   LIFDEMVTGFRLHLGGAQAWFGVEADIATYGKVVGGGLPIGVIGGKAAYLDKIDGGQWA
FT                   YGDDSYPSVEKTFFAGTHCKHPLSMAAARALLHHLKQQGPTLQEQLNQRTACFVEQFNA
FT                   FLAVNSLPIQMAHFGSFFSPVFRQDASPCTISALMPGFELLRYHLLDRGILLRGEGGGF
FT                   LSTAHTDDDINAITQAMKDSIAELQSAGFFPTS"
FT   gene            246679..247143
FT                   /locus_tag="AM1_A0242"
FT   CDS             246679..247143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31362"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKP4"
FT                   /protein_id="ABW31362.1"
FT                   /translation="MTFPALPPRLYLVVPWDLPIQHPLDDVYKDKLERSLKQFLIALDQ
FT                   DSDQVAQAIINRELSRLDLSSVSPIALTSTQTALKPCEVEDFDAYFEVNHVQTNEPATC
FT                   MIWSLLVSYQAFLTLCQQKHDFYLEHITQQKQGFRSYTNLLSRVFDLNLE"
FT   gene            247140..247742
FT                   /locus_tag="AM1_A0243"
FT   CDS             247140..247742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0243"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31363"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKP5"
FT                   /protein_id="ABW31363.1"
FT                   /translation="MNNNSIPMITNATITNADPQQIWKKCHWLFFINIQGLILSLRRFE
FT                   RSLAANNLSQARVELETATDLMLASGSAMELAGCLSHQEYEHQVRPTMAPPHVTTPDFS
FT                   GLMSWEHAALIEIWKKLRPTFANLPDSFSAQHQQFVSAYFSLSNAHRAVCQKFGGDQMG
FT                   SLRCDHITAVQVLDKFTKNRWKLIDPKRKTAPGCPFR"
FT   gene            247761..248024
FT                   /locus_tag="AM1_A0244"
FT   CDS             247761..248024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31364"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKP6"
FT                   /protein_id="ABW31364.1"
FT                   /translation="MKDVGLMNTLIAILTDLGVPKDCLHSEARLHKDLQLDSTEIVEIS
FT                   LALKRRLDVRVKLEGRQDMTLAQVCDRIEVAQLTNSNSAHGS"
FT   gene            248014..248478
FT                   /locus_tag="AM1_A0245"
FT   CDS             248014..248478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0245"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31365"
FT                   /db_xref="GOA:A8ZKP7"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKP7"
FT                   /protein_id="ABW31365.1"
FT                   /translation="MVLDVQGKLECLARNVDVQYGDIKGVGIDIVSVAQIANLVEQFDC
FT                   QSLALLFTPNELDWCQSAGIEKEERNRAFALCFATKEAVSKALTTGLVGIEWTDIEAYF
FT                   EADKIHNPITVMLSGAARVHARNHHIQCWQVNWWEWDGHVMVHVLSFLRE"
FT   gene            248489..250030
FT                   /gene="badA"
FT                   /locus_tag="AM1_A0246"
FT   CDS             248489..250030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="badA"
FT                   /locus_tag="AM1_A0246"
FT                   /product="benzoate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31366"
FT                   /db_xref="GOA:A8ZKP8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011957"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKP8"
FT                   /protein_id="ABW31366.1"
FT                   /translation="MGCISAQLPDIFNVAAYFLDGEVAQENSERIALFYQEETYTYGQL
FT                   QQWVQRAARSLLMAGIERENRIALLLPDSPELVFAFWGAIWMGAVPVPINTACSVDEVR
FT                   YILQDSRAKLLVTTEDWQAKLSPITSPFLQHTWLNTGETPLLSQLEQLPATAITAATSR
FT                   DEPAFWLYTSGSTGKPKGVIHLHQSMVVCVEHYAKTTLGLRRDDITYSVANIPFAYGLG
FT                   NTLYMPLAVGAATVLSDAINAFDIVADIQRYQPTVFFGIPSVYANLLAIHEIEPLNPAG
FT                   LRLCVSAAEQLPESLWYQWRATHNQEIYEGIGTTEFLHIFLSNQPGACKPGTSGRPVAG
FT                   YDVRVVDDEGHSCAVAEIGNLVVGGESLMGGYWNHLQATRQAIHGSTMHTGDKYQCDAE
FT                   GYFKFMGRKDDLFKVNGQWVSPMEIEDVLHQHPQVLEVAVLPESQAEERLTQVIAYITL
FT                   KAGNPPSPELETQICRFAKQHLPHFKAPKTVQFVDALPRTPTGKIHRKSLGVVHS"
FT   gene            250075..251394
FT                   /locus_tag="AM1_A0247"
FT   CDS             250075..251394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0247"
FT                   /product="chorismate binding domain protein"
FT                   /note="Putative Anthranilate synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31367"
FT                   /db_xref="GOA:A8ZKP9"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKP9"
FT                   /protein_id="ABW31367.1"
FT                   /translation="MVTELHPTITYQETFVPGKRSEIATLKSCLDAGLFSNYMLYKKDG
FT                   DVRIAGNELATISVSPDVIQLQSQGQSHTEPATDPFQQVGALLKTLAIKNWTAYGYVAF
FT                   DMARFYSSYSKSIQQPLLHFLVPETELQFTHAGVHVKRVGLLDPLLKILESDRSLADYQ
FT                   PIPLEQDAADCEPYSHKIKTLIAAIQQNELHKAIISRSKKLTGDLDLIGTYAVGVKNNN
FT                   SARSYCFKLADVGAVGFSPEILMEVNQAGMLVTNPLAATRPRGKDHEADQQLENELFTD
FT                   AKEVKEHALSIWLAQSELDSVCIPQTVKVFNFMEVKKYRCVQHLSSRVGGQLQTGKTLW
FT                   DALKVIFPGVTVTGINKSQALDWIDQLESEPRGIYAGGIGWVDSKGMADLAIAIRSVYQ
FT                   YCNTICLNAGAGIVAESNTQNEYVESVNKMNTMLTSLVLK"
FT   gene            251404..251844
FT                   /gene="acpS"
FT                   /locus_tag="AM1_A0248"
FT   CDS             251404..251844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="AM1_A0248"
FT                   /product="probable holo-(acyl-carrier-protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31368"
FT                   /db_xref="GOA:A8ZKQ0"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKQ0"
FT                   /protein_id="ABW31368.1"
FT                   /translation="MNQPTHQHEAPYRQGLHIVKTAWIEACLAQSGEQFEQQYFSIAER
FT                   HRTQIRAPYAQYLAGRFAAKATILQILHIQLETFDRWHDIEIKNWPHGEPFVTLDGYCQ
FT                   KLAADLHLNNWLLSISHISTYAAASVIARLKSPFHKEKSPFR"
FT   gene            251872..252999
FT                   /locus_tag="AM1_A0249"
FT   CDS             251872..252999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31369"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR010350"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKQ1"
FT                   /protein_id="ABW31369.1"
FT                   /translation="MIDRFDKSFAYSLPVNFIRPQLFNDCQICSVISKSNGEDPIGSAH
FT                   PCDIWIMVEISLPWTEERLMTEPILRQLYQLFHDYYDADEQPFQMMPMVIAPDHNYSVP
FT                   EYTRVLLFQRPAPFFAQFNKQEFLLPFEQLPHLMQTALTQPSNLKTFDCYKQPTSLTRD
FT                   LFVCTHGNVDVACARFGTPVYFELRKYCGKTEGDGKFSLKSKIQNPKSFYSPPSSNSST
FT                   LRVWRCSHFGGHQFAPTLVDLPTGQVWGHLEMEMLDTLIQRHRPVTELRRFYRGWSGLP
FT                   QYAQILEREVWMQQGWDWLAYNKLGHIMAQDTDHEKWDADWADVRLEFASPDGLVKGAY
FT                   EARVEVTGSVLTVWNSGEKPEAVKQYSINQLICVA"
FT   gene            253018..254367
FT                   /locus_tag="AM1_A0250"
FT   CDS             253018..254367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0250"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31370"
FT                   /db_xref="GOA:A8ZKQ2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKQ2"
FT                   /protein_id="ABW31370.1"
FT                   /translation="MRTFIFLWLGQLSSSVGSSMTYFALNLWIWQQTQSATSIALILVF
FT                   YQLPQIVIAPLSGLLADRVSRKRLLIFSDTASAYCTLAVGILAAFQILKLWHVYLIAAA
FT                   IGCFGNIQALTYSTLIPLIVHKQHHTRASSMGAMVGYGADIFSPALAGLLYPLIGLLGI
FT                   TLIDMSTFAIAIFTLVLVPIPAIEKVNKHNDEQRLAFPSVEGAKRKIWREVTFGFRYIA
FT                   SQPSLLTMVITISIFAFLHQLGETLYQPMILARTGGNTQVLGLIVAASGLGGVFGAIIL
FT                   SIWGGFRRRISGILVGFIGTGVSNLILGLGHFPGLWAVARFGSSLHNPLVMSSYMAVWY
FT                   AKIAPEHQGRIFAADYLVGIVIESTAGLSAGLLADRLLEPALQSGEWMALHLGGWIGTG
FT                   PGSGMALLITMSGMGTVLIGIIGFKIPQLRDVETLLADHDSIGDKHTATN"
FT   gene            255155..255982
FT                   /locus_tag="AM1_A0251"
FT   CDS             255155..255982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0251"
FT                   /product="chromosome partitioning protein, ParA family,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31371"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKQ3"
FT                   /protein_id="ABW31371.1"
FT                   /translation="MAKILAFFNHAGGVGKTTLVQQVGYHLSQCKRRVKGKRSRKKGDY
FT                   YRILLVDMDPQASLTTFMGIEPYDQEKTIYNAILKDEELPILNALYAGQGMEDSNGLDL
FT                   VASNLGLAIAEQELMTAVMKDFRLRDSLEPIKEEYDFILIDCPPSLGNLTYISLVAATH
FT                   LLVPIQSQYKAFKGVQPLFDTVRLVSARPNKSLKIAGFIPTMYDQRNSHDERTLAAIQQ
FT                   QLTPVAKVFSPIPRTTTFADASEENLPLALFDNKHPALEPIKVLAEQLESLAL"
FT   gene            256030..256938
FT                   /locus_tag="AM1_A0252"
FT   CDS             256030..256938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0252"
FT                   /product="chromosome partitioning protein, ParB family,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31372"
FT                   /db_xref="GOA:A8ZKQ4"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKQ4"
FT                   /protein_id="ABW31372.1"
FT                   /translation="MYGSSLESLDNDVDQESDKIAVIPIDKIKRTPDQVRRYFDPMKMN
FT                   QLVSSVRIDGILENLIVSSLNDGKFQLISGERRLRAAKEVGLTEVPVKILNLDEFDAFR
FT                   ISLIENLQREDLNPVEETDGIIKLLAGELHLREDEVVSLLYQMQNSLTRQVVNHNVVVQ
FT                   ENQETVEKIFNYLGRLSWQSFVKHRLPLRKLPVDILEFLRQGKLAYTKAQLIARIKDQE
FT                   FRKEMLNVAVTEELSLSEIRTRISEFAQKEISNNPDIDTELRKKTAGCLKALKKSKAIN
FT                   SPTKQKKLRKILEQLEKLLES"
FT   gene            257037..257261
FT                   /locus_tag="AM1_A0253"
FT   CDS             257037..257261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31373"
FT                   /db_xref="GOA:A8ZKQ5"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKQ5"
FT                   /protein_id="ABW31373.1"
FT                   /translation="MNFNDPPVQAAIIGGGCTIISSLIAAIAASIIGKKIADGGKLSKL
FT                   LSMAIKDIEFLLEVEKLHCGCPPKGWRGK"
FT   gene            complement(257477..257731)
FT                   /locus_tag="AM1_A0254"
FT   CDS             complement(257477..257731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0254"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31374"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKQ6"
FT                   /protein_id="ABW31374.1"
FT                   /translation="MPLVSATLQLGHERTVAEIYSGGTSVGLQLVREGYAVVYHRYLDG
FT                   CSESEDQYIAAEEEARTQRLNFWSQSNPVMPWEYRRGKQ"
FT   gene            complement(257883..258632)
FT                   /locus_tag="AM1_A0255"
FT                   /note="fragment; similar to C-terminus of transposase"
FT   gene            complement(258796..260526)
FT                   /locus_tag="AM1_A0256"
FT   CDS             complement(258796..260526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0256"
FT                   /product="RNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31375"
FT                   /db_xref="GOA:A8ZKQ7"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKQ7"
FT                   /protein_id="ABW31375.1"
FT                   /translation="MSKARVKPMMEWSAIPWPKLERKVFKLQKRIFRARQRGDVKVVHR
FT                   LQKTLMRSWSAKCLSVRRVTQDNQGKKTAGVDGVKSLSPEARLPLVGQLKLGSKAPPTR
FT                   RVWIPKPGKDEQRPLGIPTLYERARMTLVKLALEPEWEAVFEPNSYGSRPGRSCHDAIE
FT                   QIFAAIKQKAKYVLDADIAQCFDRINHEALLKKLKTFPTLRRQIKTWLKAGVIDGHQFL
FT                   QTSEGAPQGGTISPLLANVALHGLEYRIKQAFPIRKIADGNKRKRIATPDVIRYCDDFV
FT                   ILHEDLSVVQRCQSLVHEWLKDMGLELKPSKTHISHTLKRYEAENPGFDFLGFSVRQFP
FT                   VGQHQSGRLCGTLLGFKTIITPSRKKQKVHYNRLVSIINAHKAAPQAALIRHLNPVIRG
FT                   WTRYYSTMASKETFSRLDHLLYQKLQTWANHRHPGKSRKWVVNKYWQTVGGDKWVFATR
FT                   VTKSRTEKLLKHRQTPIIRHVKVKGDASPYNGNLVYWSSRTGKHPEAPKRVSMLLKKQK
FT                   GKCAQCGMFFREEDLLEVDHILPTSMGGLDVYKNLQLLHRHCHYVKTAKEKSSQAKWYV
FT                   "
FT   gene            complement(261138..263285)
FT                   /locus_tag="AM1_A0257"
FT                   /note="fragment; similar to N-terminus of transposase"
FT   gene            263438..264007
FT                   /locus_tag="AM1_A0258"
FT   CDS             263438..264007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0258"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31376"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKQ8"
FT                   /protein_id="ABW31376.1"
FT                   /translation="MPQVSATLQLGLDVDLLRAILVEKTKPSTREGYTKDLVDFFLFVT
FT                   QGEMVYGVEGPKRKSEIKAQVKRELSRLSQSFVGIGRLKALELAARYRECMMQRGLQAN
FT                   TINRRLSAVKSMVRMARRLEMCDWTLAEVDGLTVKPYRDTRGITASKFRLMMVIGCQPH
FT                   RRCRDNHKADQPPNLNRIIWRTLPLR"
FT   gene            complement(264086..264817)
FT                   /locus_tag="AM1_A0259"
FT   CDS             complement(264086..264817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0259"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31377"
FT                   /db_xref="GOA:A8ZK23"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK23"
FT                   /protein_id="ABW31377.1"
FT                   /translation="MLTHWESIESQAMQENWSYAEFLLALCETEAQRREQARLKRALTE
FT                   ARLPNAKSFTNFDFSHCPQLNPAPLMQLAADPGWLERAENCLILGPSGVGKTHLATGVS
FT                   KKMLEFGKRVKFFAANALVQQLQQAKLQLQLHPMLKKLDRYDLLILDDLGYCKKSEAET
FT                   SVLFELIAHRYERKSLLITANQPFSQWDDIFTDSMMAVAAIDRLIHHGLIIEIQADSYR
FT                   RKSATQRTAQTQSPPQKSQSK"
FT   gene            complement(264645..266381)
FT                   /locus_tag="AM1_A0260"
FT   CDS             complement(264645..266381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0260"
FT                   /product="transposase, putative"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31378"
FT                   /db_xref="GOA:A8ZK24"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZK24"
FT                   /protein_id="ABW31378.1"
FT                   /translation="MPNKRIDSYHTRVYMNGRDLGLKQAEAAYIAEISTRTGQRIEAGT
FT                   HQPNRGRLQDQRTVPDPLADVWEDELEPMLRRDPRLKPMTLYEYLQDKYPGQYPQVLRT
FT                   LQRRVRTWKALHGPSPEVMFELRHEPGVQGFSDFTELKGITITIAGKPFEHLIYHYRLG
FT                   YSGWRYAQIIEGGESFVALSEGLQNAFAACGGVPTQHRTDSLSAAYRNMGGRRSKNLTR
FT                   LYDELCDHYRLEPTRNNKGVAHENGSIESPHGHLKNRIKQAIYLRGSADFTSVAEYQAL
FT                   IDAQVAKLNQQCQTKYEQEKDHLQPLPKYRTPDYEVLTAKVSKRSTIDVRCILYTVPSR
FT                   LIGRQLELHLYHDRIVGYLERHPVVELPRKRVSGKGKRRDRCINYRHVIGSMRLKPRAF
FT                   IYCTWQSDLLPNPEYRQIWEQLKAQFDLEQAAKIIVEALYIAAVQDKEQAVAVYLQQQL
FT                   RSSSLTLNRLKKQFEPPQMKQVPDLSIEQHSLELYDKLLPSCSVPAEPLPAPEPLFKKA
FT                   QALPHVDPLGIYRIPSHAGKLVLCGILTSLVRNGGPTKRTSSSKTCPHRSQAPKRKKFY
FT                   QL"
FT   gene            266578..267135
FT                   /locus_tag="AM1_A0261"
FT   CDS             266578..267135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0261"
FT                   /product="tyrosine recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31379"
FT                   /db_xref="GOA:A8ZKR1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKR1"
FT                   /protein_id="ABW31379.1"
FT                   /translation="MVFINRFSLAGARDFAMMTLLWEAGLRRSELVGCDVRHFDSEQKR
FT                   LSILGKGRNEREWIDLTESGVRAISEWLELREVYGLTEPLFISLDRANWGSRLSGTSVY
FT                   RIVRALAKKAGVSENFGPHKIRHSGTTTYLEMTGGDLRGAQAYSRHANLNTLKFYDDNR
FT                   KQLQKKASAKLAEKITWNQTSD"
FT   gene            complement(267397..267762)
FT                   /locus_tag="AM1_A0262"
FT   CDS             complement(267397..267762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31380"
FT                   /db_xref="GOA:A8ZKR2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKR2"
FT                   /protein_id="ABW31380.1"
FT                   /translation="MSKAHGSWQRINQALDKMGYNTPNTSTVERFNGTARRMNAHQVRR
FT                   SLAFAHRSDTRQAVAWWSATVYNWVREHRSLRSPLEVPEGNKRFQQRTPAMAVGLTEHI
FT                   WTEAQILRTPVYIASKN"
FT   gene            complement(267774..268499)
FT                   /locus_tag="AM1_A0263"
FT   CDS             complement(267774..268499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31381"
FT                   /db_xref="GOA:A8ZKR3"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKR3"
FT                   /protein_id="ABW31381.1"
FT                   /translation="MKERKRPLLSVLACVNSKCESYGQAGLENLIVRKVYGQDQIRYLR
FT                   CRCCGAAFSERKNTAFWNTKIPESRAIEVGRQIAEGTSIKGTSRLTYTHRATVKRLSLK
FT                   FGQHAQDFHEQEAQQLDIDVLEMDERHGYVAIKQQQCWDAVAIDAASKFIIQVEVGPRN
FT                   TNLIDRLMRATHKRLAHPRDLVLMTDGDASYRTLFPIIFGVSYLPPVRATWGARPTQNT
FT                   GFLDPLPTSKSSNIVRGKS"
FT   gene            complement(268576..268716)
FT                   /locus_tag="AM1_A0264"
FT   CDS             complement(268576..268716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0264"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31382"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKR4"
FT                   /protein_id="ABW31382.1"
FT                   /translation="MIRYADDVAAVFEHEEDAIRFMRVLPRRLEKYGLRLNAKKTHLVV
FT                   R"
FT   gene            complement(268789..269334)
FT                   /locus_tag="AM1_A0265"
FT   CDS             complement(268789..269334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0265"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31383"
FT                   /db_xref="GOA:A8ZKR5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKR5"
FT                   /protein_id="ABW31383.1"
FT                   /translation="MTVSSATIYHIRNATLEDTPNLQKLLMAFMQETFQRPWGGTPQKL
FT                   EQDGLGAEFQMVIAEAENYQLVAFAAWISSYDLHYCMKGGQVIDLFVEPAHRGRGIAVR
FT                   LITEITLQIQQQGGVYITGQSVENPSVRRLYQRCARCFPGAECHVSGRAFRRLTELSDY
FT                   SLRDIVKNLPKPEWNYEP"
FT   gene            269405..270031
FT                   /locus_tag="AM1_A0266"
FT   CDS             269405..270031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31384"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKR6"
FT                   /protein_id="ABW31384.1"
FT                   /translation="MKASVYFAGGIEMVRPYLTGLSASLLMVMSPLVSQASELPIVESA
FT                   ALGIGKNPPWSEPVQVEDPFEGQFIAVFDRHRFSDRFLNTHMRIEVQSLWTQDYVRLLF
FT                   TAKDRDCYGHHGFLSSSYCSEVIDTKKISKLFLKIDEQIYQVSGQQNTFPVSTELANAL
FT                   RSAPEQEIQIRLVTESGASVDSKIGQKTVKAWQSIYTPTVSRGLD"
FT   gene            complement(270265..270387)
FT                   /locus_tag="AM1_A0267"
FT   CDS             complement(270265..270387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31385"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKR7"
FT                   /protein_id="ABW31385.1"
FT                   /translation="MDNYNQNTFSIINCLAVVFDDFTPVFCYDDIDVYSININP"
FT   gene            270437..270886
FT                   /locus_tag="AM1_A0268"
FT   CDS             270437..270886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0268"
FT                   /product="ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31386"
FT                   /db_xref="GOA:A8ZKR8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKR8"
FT                   /protein_id="ABW31386.1"
FT                   /translation="MYSANTLKAELNALGGRISSQREMILNAFQALPEGQHISAAKLHQ
FT                   LLVKQDYSIGLPTIYRNLKLMSQMGVLRELELPPDRKLYELNPPYHHRHHHLICVKCNQ
FT                   TIEFKNSSILRIGKRQAKEAGFHLLDCQLTIHALCPSCQRSVTQS"
FT   gene            271500..272117
FT                   /locus_tag="AM1_A0269"
FT   CDS             271500..272117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0269"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31387"
FT                   /db_xref="GOA:A8ZKR9"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKR9"
FT                   /protein_id="ABW31387.1"
FT                   /translation="MNLLPGFTAGLLLITLSELGDKTFFIGAILAMRHPRRWVYGGVTV
FT                   ALATMTALSVWIGQVATVFPQQYVKGVTVVLFIGFGLKLLNDAMRMSGNEGMVHEQADA
FT                   LEAVECREKGVTAWSGRAIWMEAFTLTFMAEWGDRTQVATITLATAQNPYGVFLGAILG
FT                   HAICAAIAVVCGKLIAGRISERLLTAIGGVLFLIFGIVVISR"
FT   gene            complement(272223..272762)
FT                   /locus_tag="AM1_A0270"
FT   CDS             complement(272223..272762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31388"
FT                   /db_xref="GOA:A8ZKS0"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKS0"
FT                   /protein_id="ABW31388.1"
FT                   /translation="MLTIDDSRWPLVSTRFQGLGTPEEMAQFYACFEEWLAKEEPFALV
FT                   LQRDNAEAAEKQGKSPEAKQLRKEGIAWTKKHKPLISEYCAGVAMVPDSAKLIALWGPM
FT                   VAKVTQNLYGCPGRVFSSLGEANLWATKQLGVPVQIETAAPPSLAISRLIFQQRWILVL
FT                   LGILAAIGVALRLILH"
FT   gene            complement(272793..273605)
FT                   /locus_tag="AM1_A0271"
FT   CDS             complement(272793..273605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0271"
FT                   /product="O-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31389"
FT                   /db_xref="GOA:A8ZKS1"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR016874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKS1"
FT                   /protein_id="ABW31389.1"
FT                   /translation="MISPSESKLAGVPRTMLMTTRARVEEHQRPDAILYDPKVMEWWSS
FT                   LQWDPELDIFYSGSLAQLTWAVRAHLFDQITQRYLASHQEAIAIELGAGMSTRYYRVGQ
FT                   GYRYWLELDLPEITTLRRQLDTETDHHRFLAQSALDFTWMDELPGNPENLLIIAEGLLM
FT                   YFKETQVQQLIDQLHHRLPGATLVFDALGGSSNSKGAKQLAQLGAPLNWFIKNEQDIAA
FT                   MGLSLTSVQSLIQANCRYPHRIGFFRWVPWLSQLPPLRNACLILETTV"
FT   gene            complement(273985..274326)
FT                   /locus_tag="AM1_A0272"
FT   CDS             complement(273985..274326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKS2"
FT                   /protein_id="ABW31390.1"
FT                   /translation="MSATKSYLTQFEDWLMRLQPFGIILSQTQSEEVDPKQMQSIHLLT
FT                   AQWAKQYQSLITAHCQGIAIGVETVQERIARQTKTPQLIKTVFGCPGQIFLHSEEARQW
FT                   IQQQLSLKT"
FT   gene            complement(274376..275653)
FT                   /locus_tag="AM1_A0273"
FT   CDS             complement(274376..275653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0273"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31391"
FT                   /db_xref="GOA:A8ZKS3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKS3"
FT                   /protein_id="ABW31391.1"
FT                   /translation="MNMISAQRIQKLSLLASLYVSQFLPFWFLFEALPVILRQRGLSLA
FT                   AIGLLPMLLLPIAFKFLWSPVIDFYGFTRWGHYRFWIICFQSGVIGVTVFCSFLSVEHN
FT                   LPVLLVGLALMALLCSSQDIATDALALGLLSPRERGVGNAVQGIGGSLGKMIGGGGMLI
FT                   LLNKWGWSKSLLTLAALMLLALMPLLWHRETIRPMGRVTGKSINPALDPLIAYCKIFIE
FT                   SCQRPGIRIWLLTLAVITAGYNFSAAMFRPLLVDLGFSIADIGRMIGIFGIAMTMLGSA
FT                   AAGLLMAKLGRQRALLIAANTLAVGTFSNVLLTYGFTQLPVLNTIIGVTFFAFGILGTT
FT                   AFTIMMDKSRIELAGTDYTLQTSVIALCSILSAALGGVIASIVGYRGIFILSTGILLNC
FT                   NWLIVQHLDLNITSSKNSETYDYAHH"
FT   gene            complement(275668..278232)
FT                   /locus_tag="AM1_A0274"
FT   CDS             complement(275668..278232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0274"
FT                   /product="ferrichrome-iron receptor"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31392"
FT                   /db_xref="GOA:A8ZKS4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKS4"
FT                   /protein_id="ABW31392.1"
FT                   /translation="MSKAYSAIEVSGHEITLILLCSVSIVQPQHVLAAPEQHPTLDQPQ
FT                   AHPATTVTDWLTQIEGDLVKVTNVQIETTETGLSVQLNTSAGQLATPQIQSIGNRLIAV
FT                   IDNAILEDPQGFQSIDPASDITELTVIQATPTQIRVLVTGVELAPIAQVTVGTEGLALV
FT                   VTPITDDAETEITVTAERSQTGYFIPKATTGTRTDTAIRNVPQSIQVLPKEVLKDQQVT
FT                   RLDEALRNVSGITGDTTEGAGFQFSLRGFSAAKVLRNGFSLSGSDALSNTGLLTLPETA
FT                   NLEQIEVLKGPSSILYGEINPGGVINLVTKTPTSQPLYEAEVQVGSRTFFRPRIDFSDT
FT                   LTQDGQLRYRLNALIQRDEGFRDYDQNIQREFVAPVLSWDIGEETNLTLDFEYLHDQRP
FT                   NDSGLLAFGRGVVDVPRERIVGEPDDVIDRDFITTGYTFKHQFNENWSVRSAFRYSKQD
FT                   YLSNFFLPLNFNEATGLVARINGSTDWFQDYLGLQTEVTGKFKTGPIQHTLLFGVDLSQ
FT                   DRSGIDARVNFAPSLLDIFNPVYGTPTRLSFNDFATVARAQDVTTRRLGILLQDQIKVL
FT                   DNLQFVVGGRYDTVDQQVTNSPSLFDPAGRQGEQTVDAFTPRVGVVYQLIPELSLYSSF
FT                   AQSFTPSASTTAAGDFLIPETGEGFEVGFKAEVVPDKLFATLAYFNITKQNVATPDPNA
FT                   LGVFNAFVATGEQQSQGIELDLSGEILPGWNVIASYAYTDAEITQDNVIPIGNQLTGIP
FT                   KHSANLWTTYTLQQGDLQGLGFGIGFTYASDRQGDLSNTFVLNDYFITNAAIFYQRQRL
FT                   RLAVNFKNIFNVNYIQGTPISRIRGIEPGEPFTVIGSITYQF"
FT   gene            complement(278369..279370)
FT                   /locus_tag="AM1_A0275"
FT   CDS             complement(278369..279370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0275"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31393"
FT                   /db_xref="GOA:A8ZKS5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKS5"
FT                   /protein_id="ABW31393.1"
FT                   /translation="MATLQLTLSSSNLYEMLAESQQQIDADYQIQADPVTWSLQQSFGD
FT                   WLNHSFQLREGLDLVFTRANLRENLHFTESFEKLSIWGLRFHLAGHSRLQLHSNQAEIL
FT                   TRPHTNMLGFMSGEMQVNTTYPAHQCVEMLTLVIHPQLFATFIPEDCPLGSIGHNIARP
FT                   FSSDFNLVGHTSASMLTPLQQILHCPYQGAIKRTYLESKALELIALKLNQVSESRFYPE
FT                   DINLKTDDIERIYLAKEILLDNMDNPLSLVALAKQAGINDFKLKRGFRQIFGTTVFGCL
FT                   RQHRMEQAQRLLESYDLSISQISQAVGYASPSQFSAAFKKTFGYSPSSYRAL"
FT   gene            complement(279571..279783)
FT                   /locus_tag="AM1_A0276"
FT   CDS             complement(279571..279783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31394"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKS6"
FT                   /protein_id="ABW31394.1"
FT                   /translation="MFINGCFRTLGYTYCKSNLDQVVAKRLEKKQQMRWSKKAYLLLQV
FT                   RTKVLDGDWRETFERWYPELAAPAA"
FT   gene            complement(279837..280805)
FT                   /locus_tag="AM1_A0277"
FT   CDS             complement(279837..280805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0277"
FT                   /product="carbonic anhydrase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31395"
FT                   /db_xref="GOA:A8ZKS7"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKS7"
FT                   /protein_id="ABW31395.1"
FT                   /translation="MKKLVRGLQEFKQKYVAQHQELLKELSHGQKPRVLFITCSDSRVD
FT                   PNLITQTDVGELFVIRNAGNIVPPYGAANGGEGGTIEYAIAALEIEQVVICGHSHCGAM
FT                   TGLMKLNKLQADMPLVYDWLQHAETTRRVVSENYPESQGEERVEILVAENVLVQIDNLK
FT                   TYPIVRSRMLQGKLQIYGWIYHIETGEVLAYDEKTHTYIPPQSQLIEKPPSLPSRLEQY
FT                   LISTHAPPVACELPVPRLQSASSIPSTSPVNGSTATDRIRSQLNALLKASPDSWTDVDD
FT                   SMRSMSKLLEDAQHEGMSANEANNYHHQFSEQIPKWLRQLE"
FT   gene            complement(281036..281158)
FT                   /locus_tag="AM1_A0278"
FT   CDS             complement(281036..281158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31396"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKS8"
FT                   /protein_id="ABW31396.1"
FT                   /translation="MILIPDLWPKIGIKMLFEYQILAVYCFARISRSEDFDDLV"
FT   gene            complement(281239..282105)
FT                   /locus_tag="AM1_A0279"
FT   CDS             complement(281239..282105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0279"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31397"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="InterPro:IPR022573"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKS9"
FT                   /protein_id="ABW31397.1"
FT                   /translation="MKTDSIFYRIFQADPGILFELLGQSSHRAQGYEFKSVEIKQVAFR
FT                   IDGVFLPTPEAADQTVWFVEVQFQRDPAFYQRFFSEIYLYLNLHPDTVDWQAVVIYPKR
FT                   SIEPDYHHVFRANLNSDQVHRIYLEDLNEAVDSVGVGLMQLIVADSAKTVTQAQALISR
FT                   VQPQEQTNPRFATIIELIETIVVYKFPQLSREEIESMLGVSELKQTKVYQEALDEGRQE
FT                   GRQEGKLEGEQSLILRLLNRRIGDVALELRSQIQALSLDQLETLGEALLDFTESADLVN
FT                   WLQKNRA"
FT   gene            282229..282471
FT                   /locus_tag="AM1_A0280"
FT   CDS             282229..282471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0280"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31398"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKT0"
FT                   /protein_id="ABW31398.1"
FT                   /translation="MQPDNDKIDDVVLALLALNIHDETEQGARSWKGYDWEALNRLHQK
FT                   GWISNPVTKAKSVILTPEGLARSRELFKQLFTKET"
FT   gene            complement(282590..284176)
FT                   /locus_tag="AM1_A0281"
FT   CDS             complement(282590..284176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0281"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31399"
FT                   /db_xref="GOA:A8ZKT1"
FT                   /db_xref="InterPro:IPR003997"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKT1"
FT                   /protein_id="ABW31399.1"
FT                   /translation="MTSIQTFAGGDPKQLNSTLTPESDQNVLPLTKAHPKKEKPFDRPV
FT                   ILQQSPVWSRAIIWGIVGAASAALAWACLFQIEEAIPATGQLEPKGAVKEIQSPVAGVV
FT                   KEIKVEEGQLVKKGEVLLVLNRQGTRSEIQSLEHQRRNLVQVNDYYRQQLQGQSNAPLP
FT                   DVIDSALINSTRDRQSLVAENKLYRAQLNGAQEWRHFSAEERQRLQSGLTQGSSSVAAA
FT                   QARINQADKQLRQIEVQLEQTKIQLASAQQTLALNQEIVQDIEEAYRKGAIARVQFKQQ
FT                   QNEVQTGTAEVSRLQQEQIRLLRQLEQVGQEKQQAQAQALNTVATNQRELLDRIAANKK
FT                   RISEIDSQLTKAIVDNQRTIADLENRLQQAKLTLDYQELKAPVDGMVFDLKPSTPGFVA
FT                   NASEPVLKIVPADNLKAKVYITNKDIGFIQTGMAADVRIDSFNFSEFGDIKGTVESIGS
FT                   DALPPTEVRQFYSFPAVVKLDSQTLKTKERQLALQSGMSVNVNIKVRKRPVISLITDRF
FT                   SREADGIKHLR"
FT   gene            complement(284173..287130)
FT                   /locus_tag="AM1_A0282"
FT   CDS             complement(284173..287130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0282"
FT                   /product="toxin secretion ABC transporter ATP-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31400"
FT                   /db_xref="GOA:A8ZKT2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR010132"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKT2"
FT                   /protein_id="ABW31400.1"
FT                   /translation="MTLTHLSLESFLKDLPGFDQLSEAVLSSVATEFQPLRYPMGRPLV
FT                   SNRAMPQDLILIYQGQVRLLGYDPRTDTPVTLKLLGPGAAVGWISLVRQIPCETAIASV
FT                   ETVGLKLPAANFLELLSHEPSMAQVYEQQPSILEVFDVLGQQLLRRADGSTDLKNLAER
FT                   ALPESLVQTRPLRDISIDQLQPHLEWFVSGGSIPDLEIGQPLEACLEQVNGTVSRSETL
FT                   RLIGLTPIKAFQSSIEPVAASPQSEVWDEIPEAPTLLPAVDDAPVKHGKYPFKSGRGPV
FT                   DAPLACFQMLALHLNLPFRKDVLRRILKNHSERNGPGVSLPVYGAISESMGLRAQLVET
FT                   PASAFSRLPTPALVNWQDRIALVYETSTKEIVFAVPEQTLLRKHPDDFLDAFEDKVQVL
FT                   LLERTHETPQSRFNLSWFWPSIKKHRKVLTEVLIASFFVQLFGLANPLITQVIIDKVLS
FT                   QGALGTLNVLGLLLVGVAIFEALLTSFRTYLFVDTTNRIDMSLGAEVIDHLVRLPLRYF
FT                   DKRPVGELATRVNELENIRKFLTGTALTVVLDAVFSVVYIVVMVFYSWLLTIIALGTVP
FT                   LFALLTFIFAPIIRRLTRTKAEENAKTQSYLVEVVSGIQTVKAQNIELKSRWQWQDRYA
FT                   RYVSSGFKAVVASTTAGSISGFLNKLSSLLLLWVGAYLFIQGQLTVGELIAFRIIAGYT
FT                   TGPLLRLVQLWQNFQETALSLERLSDILDYPQEVTEADRDLIPMPLMQGAVKFEDLSFR
FT                   FKDSGPMQLQQVSLEVPAKTFVGIVGQSGSGKSTLMKLLMRLYNANSGRILVDQYDISK
FT                   VELYSLRRQIGMVLQDSLLFDGTVQENIALSAPDATAEEIVAAAKVAYAHDFIMELPQG
FT                   YNTRVGERGSALSGGQRQRIAIARMVLQNPQLIILDEATSALDYNAERQVCQNLAEAFG
FT                   DRTVFFVTHRLKTLESADMILMMDQGHLVEQGTHAELMQQKGRYYWLYQQQETQS"
FT   gene            complement(287127..287879)
FT                   /locus_tag="AM1_A0283"
FT   CDS             complement(287127..287879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0283"
FT                   /product="conserved hypothetical protein, possible
FT                   PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31401"
FT                   /db_xref="GOA:A8ZKT3"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKT3"
FT                   /protein_id="ABW31401.1"
FT                   /translation="MKPAQPIMDNTVQSAELIPLLGQYQLLPQLLKELITDQAIQEVPL
FT                   SSEERVQAVEQFYHQYQIGDDTQREAWLKHYCMTLQQMAAQAQRQFKLQKFKLQTWNNQ
FT                   VESDFLQHKGQFDQYVYSLIRVASAEVAQELYFRLQGDEQAFSDLATQYSQGPEAQTGG
FT                   LIGPVTATHMHPTLVQLLTNAQPGQVRPPIRLGEWFVIVRLQTFISAQLDAPLRQQLLE
FT                   QRFNEWLQTQMESVAVSDTSIAVSVQTP"
FT   gene            complement(287881..287994)
FT                   /locus_tag="AM1_A0284"
FT   CDS             complement(287881..287994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31402"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKT4"
FT                   /protein_id="ABW31402.1"
FT                   /translation="MMQLGAEKRATPQAKQDGNPISLRARSFKSPSLLKVF"
FT   gene            complement(288012..288149)
FT                   /locus_tag="AM1_A0285"
FT   CDS             complement(288012..288149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31403"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKT5"
FT                   /protein_id="ABW31403.1"
FT                   /translation="MTTTLREIALKQILEASEIELLVPVSHTAAPEPPDYETVQSTSLK
FT                   "
FT   gene            complement(288190..288378)
FT                   /locus_tag="AM1_A0286"
FT   CDS             complement(288190..288378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31404"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKT6"
FT                   /protein_id="ABW31404.1"
FT                   /translation="MQGKDIRNKFTDGLFLYLHLLNISNKKFDKDLNKPEYNEILSADG
FT                   FADSRDINEATTDIRSF"
FT   gene            complement(288500..292597)
FT                   /locus_tag="AM1_A0287"
FT   CDS             complement(288500..292597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0287"
FT                   /product="hemolysin-type calcium-binding region protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31405"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKT7"
FT                   /protein_id="ABW31405.1"
FT                   /translation="MGKPKNPIKAIVKVVKKIAPSPTKHGGWGNDTLIGYMPVNYLYGH
FT                   GGNDTLRAVGWKNTLDGGSGNDYLHAIGGQNTMRGGTGNDEIHAIGGRNNVRGDSGHDY
FT                   IRAWGGSNWVHGGDHNDNIEVGGISNTVYGGGHDDYIVAWGGRNSLHGEWGNDTIRAGG
FT                   GSNWVHGGDGFDNIKVWGAHNTVYGGGHNDYIESWGGRNTIRGEWGDDTIRAWGGSNWV
FT                   HGGDGHDNIVVGGISNTVYGGGHNDHIEAWGGRNTIRGEWGNDTIRAGGGSNYVHGGDG
FT                   YDNIKVWGAHNTVYGGGHNDYIEAVAAGNRLYGEWGHDHIKAFGGSNFVDGGSGNDRIE
FT                   IFGIGNTVYGGSGDDHITTAAASNTIHAGSGNDKVVAVGGKNTIHGNEGHNTLIAAGGY
FT                   NRLTAGWGNDTLIAVGGYNNMDAGHGHNTLVGVGGYNNMNAGYGNDFIFGFGGANKINA
FT                   GHGRNTVIGLGGANVINSGTGNDTIIGVGGANVVNAGDGNNVVIGFGGLNKLHSGNGRD
FT                   IMVGVAAGNWLTSAGGNDIMIGLGAANYLNGGAGNDILVSAAALNVQVGGEGQDVMVAL
FT                   GKANAMAGDTVGKDTLKKMAEDLDLGSLKLSDASLPKLNFSDFSLPNFKEFAADFSELG
FT                   DVIPNFKAPNFNIGQLPNLSNLKISLNAPDIKLPGLPDLSIDAPEGGLNFPGFDFKVTG
FT                   FKNVQLPSIQMPSINLPGHLIPSLRLPTSNIGLPQLTIPSLSLPTINIPTVSLPSIPVP
FT                   QVTLPTLNIPALSLPSLPSLPSIPSVTLPDPLRTLKDKANSVAQSVKLPNLTLPNFNLY
FT                   SHGANSDTMVALGEANFLLGGKGNDIQFSHGLANALFGGNGADVQVTLGAVNFLSGGQG
FT                   DDIQVAGGKVNVVDGGLGNDIQASIGKFNFLKGGQGDDLMLAGGKFNMMMGQDGNDIMI
FT                   GGGMLNTMMGGAGNDIMVGGGKLNKMLAGIGDDLVIGGGKVNSLSGGKGNDIMVGAGKF
FT                   NTMLGGEGNDILLGGGKTNTMKGGAGADIIVGGGKMNLLFGGDGNDLILGAGKTNIFKG
FT                   GQGDDIILGAGKKNVLKGGEGNDIILGGGKTNSFKGDAGKDILIGGGTKNVLKGGAGDD
FT                   ILIGGGKENKLIGGKGNDFILAIGKKNTFDGGKGDDIILGLGQENKIKSGSGNDIVLVK
FT                   GAKNSFVSLGGLNRIYGAGKNNTIQGGQDKDTIHAGGESNTYDAGAGDDTLISYGNNIT
FT                   LTGGAGNDTYQIGGKDAFGASLGANPGGTRTTTIDNRGDASTTDKLLLGANVDYHNIDF
FT                   SRSGNDVKLNVSDTNEVVILKDWYTTPLSQQVDTIQISNGASLQSSQVNDMVKAWDIFE
FT                   AAGSTLAAKTQLDSTLKQSWAV"
FT   gene            292624..292743
FT                   /locus_tag="AM1_A0288"
FT   CDS             292624..292743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31406"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKT8"
FT                   /protein_id="ABW31406.1"
FT                   /translation="MCGGFCPRCVEPTIAEPISRKNPEEFRVIQVKIQVFVGR"
FT   gene            complement(292832..293362)
FT                   /gene="hlyC"
FT                   /locus_tag="AM1_A0289"
FT   CDS             complement(292832..293362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlyC"
FT                   /locus_tag="AM1_A0289"
FT                   /product="RTX toxin activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31407"
FT                   /db_xref="GOA:A8ZKT9"
FT                   /db_xref="InterPro:IPR003996"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKT9"
FT                   /protein_id="ABW31407.1"
FT                   /translation="MMTQDIPKAVKTTLNQIEVSAANDSPIAQAPTILSQVTTEEVQQR
FT                   LQLLGSITWLMMQSPLHRSYTLEDLETRILPSLMHDQFRYYQSGGQPVGFLNWAWLSEE
FT                   IEAQYQTGEYQLLFPEWKCGDRLWYPEFIAPFGHARYIVKDIRQNIFRKGTPAKALRVD
FT                   AEGNLRSIAKYTL"
FT   gene            complement(293674..294090)
FT                   /locus_tag="AM1_A0290"
FT   CDS             complement(293674..294090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0290"
FT                   /product="RTX toxin acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31408"
FT                   /db_xref="GOA:A8ZKU0"
FT                   /db_xref="InterPro:IPR003996"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKU0"
FT                   /protein_id="ABW31408.1"
FT                   /translation="MRQRLQLLGGITWLMLQSPQHWHCTIEEVEARILPSLTLNQFRYY
FT                   EANGQPIGFVSWAYLSEEAEEKYQTGSYKLLPQEWQSGEQLWCTDFISPFGHDQSMFDD
FT                   LRQNIFPQGTTAKMIRTQEDGSRSIVEYQLGAEE"
FT   gene            complement(294151..294321)
FT                   /locus_tag="AM1_A0291"
FT   CDS             complement(294151..294321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31409"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKU1"
FT                   /protein_id="ABW31409.1"
FT                   /translation="MTTITPEKTELALEQIQEAPEATLVIPVEDAVVSAPTETIPEPPD
FT                   NIASSAESTED"
FT   gene            complement(294448..294609)
FT                   /locus_tag="AM1_A0292"
FT   CDS             complement(294448..294609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31410"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKU2"
FT                   /protein_id="ABW31410.1"
FT                   /translation="MKLSAAPQHQPLVGLLGLGVFLFAIALSHQLKLDLFSLNLNFTPK
FT                   RISLHNLM"
FT   gene            complement(294691..299961)
FT                   /locus_tag="AM1_A0293"
FT   CDS             complement(294691..299961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0293"
FT                   /product="haemagglutination activity domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31411"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKU3"
FT                   /protein_id="ABW31411.1"
FT                   /translation="MTSGFWLGATLTPFLFSDIALAQVIVPDDTLGMEQSAVSTGATAN
FT                   DFVIDGGAQRNTALFHSFKQFSINSNQTVFFENPASVDNIITRVTGGLPSNIDGLLGVD
FT                   GPANLFLANPSGIIFGPNAQLDVAGAFMATTADQFLFANGTSFNAVNPNAPPLLTISVP
FT                   LGVKFGANPQPISVNGATLRAGVGEPLVLLGGDVALNDANILAPGGHVGLSGLSQPGTI
FT                   SFNLDATSPQSFLTVPPLGQTNLSLNNSNINTVSEGSGDIVLQAQNISFIETTLLAGLN
FT                   EDVDSFDTQGGSILVKGTGDIQLSGSIIQTFVEENGQGGDIHMNATNRLFLSGESEISS
FT                   LAEGFESDAGAIFINTPDIRLNSGSRIASVTQASGGDINLTTHSLLVRQNSDIATTKFG
FT                   PNTSDGNIRIRANNILIDDRGGDRNRPPIGITADVSFIPQDLGLPPEMIGGTGGNIEID
FT                   TQNLTLIGGLIGSTVFGNAQGGNLTIRARDTVRLVGDPAAARDNFAGIADVSTAIRDAT
FT                   LEGVSGDLRIDARHLILANGSTIDAGAFGFGNSGDILINTTESVTLQGTLNGQPSRIIT
FT                   QLQNSGPFDGGNIDLVTGRLTLQDGGQISASTIAESEGNGRDVSIIANQGIFITGSSPR
FT                   IELPPGNADSPFVLDPTGTRFPSGIFASSPGEGNAGNVDIFSPNITVSNGAQISVSSTN
FT                   AGAAGSLFIRGNNVVLDNAALLAEAVEGNLANIELSVRDSLQLLNGSRISTVARGDADG
FT                   SNIIISGTDTQLLRFLIFKGGSTISTENSGRFGNGGDIDIAAQFILAFPGELNQIIANA
FT                   VEGDGGEINIFTNAIFGRQFLNISASSKLGVNGDTIIETIETDPTNSLTQLPENVLDNS
FT                   TQVADACAVPRSGQSQFIVTGRGGLPLMPSSRPVGRYLLSDLRTQAPQDGKQVLQEAKQ
FT                   LVVTARGDYYLQGESSRSLPQLLEAARQEYQQAKYPEAITYWTQAVNQLSKSKHPGAYA
FT                   SVQSHLALAYHHLGDWDKAREAMAASQAVLTPELIAQQPALHAQVLNTRASLFLTRGNI
FT                   QAALEDWQQAAAVYQRAGDDLGNLQAQLNQIQVLQDLGYLRQTQQRLVQLMQPLEQQPP
FT                   SPVKAIGQLNLGKVSRAEGNLLRSQRQLEAALTTAQSLNQLALTSTILLNLGHTFRGQG
FT                   NTQKALGYYQQAREIAPTSLIQFQVQVSRYDLLVVQKDPAASTIFQELQVQAQQLPSSR
FT                   EGIYAQLHLIETVLDSKLDESQALLNLLSRIQAQAQELDDPNAQSYILGYQGRIYGQAQ
FT                   QWSQALSLTEQALQRVQRQQAPEVLYQLAWQLGRYRRQLGNRQGAISAYLDAVAALRSL
FT                   RGDLSTASDDVRFTFRDGVEPVYRELVALLLEGDMNQTEASSNLTQARKLIEDLQLNEI
FT                   QDYFQDACVQAQPLAADQVDPKAAVIYPIVLKDRVDVIVSIGNQPLRHYSTPIEPGQVD
FT                   TTVNQLLRSLTTPLGSVQKNNLTKLKLIYDWVIDPASADLAQQDIETLVFVADGALRTL
FT                   PLTTLYDGEQYLIEKYNVALSPGLELLAPRSQDRERVKLLVGGVSEARSGFPALPFVAK
FT                   EVEQITAQIQDNDVLLNQDLTRDNLNDYLTEVSSEVVHLATHAEFGASPEDTFILTWEG
FT                   KLSIQAMASLLRSRSLMSEVPIDLLVLSACETATGNSRAVLGIAGMAIRSGVRSTLAGL
FT                   WSLDDQAAAAFMGHFYQALAQPNTTKASAFRQAQLALMKNPKFRAPYFWSPFVLVGNWL
FT                   "
FT   gene            complement(300066..301037)
FT                   /locus_tag="AM1_A0294"
FT   CDS             complement(300066..301037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31412"
FT                   /db_xref="GOA:A8ZKU4"
FT                   /db_xref="InterPro:IPR010328"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKU4"
FT                   /protein_id="ABW31412.1"
FT                   /translation="MQSVEKPQPKSQNIIHLTYSFVMEQQLSHPFNGLGMRSKLIHSHP
FT                   IAGIIFAFFLVFPSTAWARRYQPPTGDPPKGVFGSNGSRSCDLTFEHSQPVQASSHMGP
FT                   KPLLRPPASDQPKTLPITLLAPLQHVGRTSSVTPTFAWFISASHPYRIQISLFTDPSDQ
FT                   SSELLYQLEYVETASGLIQYTLPEDKSVLQTGQRYFVQLSMACNPSSDRFNQFFIAEID
FT                   VKAPSPALKQALSQARTPQQKAAVFAKAGYWFDTVRELLVDASPSDSYHQLPDLLKELA
FT                   RLEVEAEHRQALVKIANLLKDSTQRAPVKSLNSNPPFPKPLN"
FT   gene            complement(301561..301875)
FT                   /locus_tag="AM1_A0295"
FT   CDS             complement(301561..301875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0295"
FT                   /product="Mo-dependent nitrogenase C-terminus family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31413"
FT                   /db_xref="InterPro:IPR009717"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKU5"
FT                   /protein_id="ABW31413.1"
FT                   /translation="MFHINGLRLHSSTKQSLKQFFLKRVHSVFVSINVEHRSTANLICQ
FT                   LVPTQCPFERDIRFLGHTLFHIPPLCKLNPAYEEVVALRFRALSYLADQCGEDISRYCR
FT                   "
FT   gene            complement(302220..303953)
FT                   /locus_tag="AM1_A0296"
FT   CDS             complement(302220..303953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0296"
FT                   /product="formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31414"
FT                   /db_xref="GOA:A8ZKU6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR009188"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKU6"
FT                   /protein_id="ABW31414.1"
FT                   /translation="MKILLFASAYNSMTQRFHVELVDLGHEVSIELALDHERMRQAVDL
FT                   FQPDVIVAPFLKTAIPEDIWKQHLCIIIHPGIKGDRGPSSIDWAILEDESEWGVTALQA
FT                   DAEMDAGDIWASINFPLEGETKSDLYRGKGAQAAITCIKQTLANFIDPKYQPEPLDYGN
FT                   PDVKGTWRNPLKQSHRAISWESDTTAEIVRKIRSADSQPGLLDVLFGEQFYLYGAHPEN
FT                   TLTGKPGELIAQRYGAICRATIDGAVWITHLKRKKKEEQVFFKLPAAQVLREYIHALPE
FT                   VPVSLELSPHELTFRDIWYEEKNQVGYLHFPFYNGAMSTEQCQRLRNAYLYARTKDTKV
FT                   ILLMGGEGFWSNGIHLNVVEASADPAAESWQNINAINDFVYEVLRTDTHLVISAMQGNA
FT                   AAGGVMMALAVDRVYAREGIVLNPHYKRMGLYGSEYWTYSLPRRVGPEMAQKLTSVCMP
FT                   MGTRAAKSIGLIDDYFGNTVSDFKTQVIKEAESLAQGEDFQDILWLKNKQRFLDEQYKP
FT                   IAIYRQEELEQMKLDFTSNAYNTARHNFIYKISPSETPLHLAVHRQQVKDNVSCKLLSP
FT                   A"
FT   gene            304047..304169
FT                   /locus_tag="AM1_A0297"
FT   CDS             304047..304169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31415"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKU7"
FT                   /protein_id="ABW31415.1"
FT                   /translation="MAIIQPLLMQNDLSGQQLHNNPAQYLPPLKLRWLEQYPCS"
FT   gene            complement(304897..308544)
FT                   /locus_tag="AM1_A0298"
FT   CDS             complement(304897..308544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0298"
FT                   /product="WD-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31416"
FT                   /db_xref="GOA:A8ZKU8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKU8"
FT                   /protein_id="ABW31416.1"
FT                   /translation="MTESERIVAAANAAVFKQANRYLSDVETTILLGAIADQTYEQIAA
FT                   TSHYSINYLKRDIGPKLWRLLSKALGEKITKTSFQVALSRYLVEAQTQPPPLPQTVHCD
FT                   WGAAPDVSFFLGRSTELSTLQQWIVGDACRLVALLGIGGIGKTTLAVKLAQQLQSKFDQ
FT                   IVWRSLRNAPPLETLLTELVPLLSGQTDSRPELSALLPTLRARKCLLVLDNLEAILQPE
FT                   SLGLFRSGYEEYGQLLQLVGDIAHTSCLVITSREKPEAIAAQEGLALAVRSLVLGGLHA
FT                   DADPILTAKGLSGSAISRSQLIETCGGNPLALKIVATSVQDLFEGDIATFLAQGTVLFN
FT                   GIRQLLDQQFERLSRLEQTLMYWLAINRDWTTVDALQEDIVPPVPRYRLLEALEALCRR
FT                   NLIERQIGSYTQQPVVMEYVTEHFIEQITTELIHQTFDLFTHHALIKTNIKDFIRISQC
FT                   RLILDPVIHALNQEFGSLTGMAKHLQATLDTLRSDEVYRVSYGGGNVLNLCRQLQLDAQ
FT                   GYNFSNLAIWQAYLQDMTLHQVDFTQAKFHKTVFMQTFSGILATEFSSDGELLATGDTN
FT                   CDVGVWSVANGQPLHTLQGHSDWVRTVAFNSESTLLASGSDEYTIMLWDLKQGQHLRTL
FT                   SAHQGQVCTVMFSPDGHTLISSSQDLTLRLWDVYTGECLRIFEGHTQPIWSVQFSMDGQ
FT                   HLISGGEDNVLKLWDVATGKCLKTLIGHHNWIWSVAYSPDGQRVASGSHDNTVKVWNVS
FT                   SGSCIHTLRGHTNWIWSVAFNPQGNIIASGSEDQTVRLWDVYSGHCLKILDGHDHRIWS
FT                   VTFSPQPLMSMLSSEKLSRQQALLASGSEDQTVRLWDVSWLESGTSEATSKPQSVHVLT
FT                   SQCLQTLQGHTQQVWTVAFSPDGKTIVSSGDEQFLRFWDVATGTCYKTLKGHPRRVTSV
FT                   VFSPDGKLLASCGEDQTIRLWDAQKGQCLKILKGHTKQLWTTVFNADGSLLASGGGDQT
FT                   IRLWDVQTGQCLKVLEGHDSCVWSLDFSPTDATLLASASYDQTLKLWDIEEGKCFNTLE
FT                   DHEGAVQSIAFSGDGTQLVSGSMFDQTVRLWSTATGECLQVLPQQIAMAVAFSPTSSNS
FT                   SARDELMIAIGGGDQRLTIWHPNKGTHQPQLFAHQRMIMDLAFSPDGTTFVTGSWDETA
FT                   KLWNATTGELIKTFRSDRPYEGMNITGVAGLSDSQKCSLQALGAFDIAL"
FT   gene            308931..309440
FT                   /locus_tag="AM1_A0299"
FT   CDS             308931..309440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0299"
FT                   /product="acetyltransferase, GNAT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31417"
FT                   /db_xref="GOA:A8ZKU9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKU9"
FT                   /protein_id="ABW31417.1"
FT                   /translation="MNQPIVSEKLRIRRFERDDVEDFVSFMTDSDSTKFLTFGEEQKSQ
FT                   EGATGLLKATMESYDSDAPLMAFAVENQQTTEFVGFCGLTPREEGTVEIMYAVMPNERG
FT                   QGYATEIAATLAQYAISQLGYRRVIAPISPEHKISKAVAVRAGFKDHGISQNPDSLVKV
FT                   HLFVFE"
FT   gene            309817..310452
FT                   /locus_tag="AM1_A0300"
FT   CDS             309817..310452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0300"
FT                   /product="peroxidase/ antioxidant protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31418"
FT                   /db_xref="GOA:A8ZKV0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKV0"
FT                   /protein_id="ABW31418.1"
FT                   /translation="MTLQLGDTVPNFTQKTTEGDLNFYDWAGDSWVVLFSHPADYTPVC
FT                   TTELGSVAKLKSEFASRNAKVIALSVDDVNSHKGWINDINETQNTVVNYPIIADADQTV
FT                   ANLYGMIHPNANAKVTVRTVFVIDPDKKLRLTLTYPPSTGRNFNEILRVLDSLQLTDNY
FT                   SVATPVDWTDGDDVVVAPSISTADAKQKFPKGVNEIKPYLRMTPQPNR"
FT   gene            310505..311737
FT                   /locus_tag="AM1_A0301"
FT   CDS             310505..311737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0301"
FT                   /product="Acyl-CoA dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31419"
FT                   /db_xref="GOA:A8ZKV1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKV1"
FT                   /protein_id="ABW31419.1"
FT                   /translation="MRTQSCSSPNTDTESIPSAPMLSATVKDYRAIANQVSAQLAAHGV
FT                   EQDTKAGSPVEEVNALKQSGLILLPVPQEFGGAGATWPQIYNVVQILSKAQGSVGQLYA
FT                   NHATLVSMGRLVGGPGQAERYYRLTSQQNLFWANALNSRDQRLKLMSVNGAFRLNGVKS
FT                   FCTGMVAADISIVLSMEEKSNHPVLCVVPMDREGITYNDDWDTMGQRRTASGSYTFHDV
FT                   LVKPDEVLGPPLSSGASTTLKSLIALLGQTFVYLGIAEGALEAAKGYTTTSALAWMASD
FT                   AETATQNPFILQRYGQMWAELQAAIALAHQASEALQAGWEKGTALTTEERGEIAIVMAS
FT                   ARAIAIQAGIKITTHIFDGMGPRATAANYGFDRYWRDLRTFSLHDPIDYKFKDIGNWML
FT                   NQQYPTPSQYS"
FT   gene            311833..312537
FT                   /locus_tag="AM1_A0302"
FT   CDS             311833..312537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0302"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31420"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKV2"
FT                   /protein_id="ABW31420.1"
FT                   /translation="MLFRQLYDPESSTYTYLIADSKSRMALLVDPVLEQVERDLKLLQE
FT                   LKLTLSSCVETHIHADHITGTYQLQSQTGCLSTVPAHGPAVCADRQLQDGEILTLGDIS
FT                   LKAIATPGHTDSHNAYLVNGHRVLTGDALLIRGCGRTDFQSGDAGTLYDSVTQKLFTLP
FT                   DATLVYPGHDYHGLTVSTIAEERQWNPRFMGRDRNTFIEFMNALDLPDPQKMMEAVPAN
FT                   EHCGLVVSTTAR"
FT   gene            312547..313557
FT                   /gene="cysK"
FT                   /locus_tag="AM1_A0303"
FT   CDS             312547..313557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="AM1_A0303"
FT                   /product="cysteine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31421"
FT                   /db_xref="GOA:A8ZKV3"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKV3"
FT                   /protein_id="ABW31421.1"
FT                   /translation="MRIAHDITQLVGHTPLVQLNRIPAAEGCVGRILFKLESMNPSGSV
FT                   KARIGVSMIQAAEEAGQIHPDKTVLVEPTAGNTGIALAMVAAVKGYRLILTMPETMSQE
FT                   RRKLLRAYGAELVLTPSSEGMKGAIQQAMDLVETVPHAFLLQQFENPANPEIHFQTTAE
FT                   EIWADTEGQVDILVAGAGTGGTITGVAKAIKRRKPSFQAIAVEPQSSPVLSGGNPGLHQ
FT                   IQGIGPGFVPSVLQVNLLDEVIRVADEDAIATSRRLACEEGLLSGISSGAALWAALQVA
FT                   RRIENAEKLIVVIQPSGGERYLSTGLFNNLMPGLRTDVLNQDKLPHKILIGRCAN"
FT   gene            complement(313869..315491)
FT                   /locus_tag="AM1_A0304"
FT   CDS             complement(313869..315491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0304"
FT                   /product="hexose oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31422"
FT                   /db_xref="GOA:A8ZKV4"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKV4"
FT                   /protein_id="ABW31422.1"
FT                   /translation="MSNSGDAPIIPASVSDRQGFNKRWYASNDQLQIYRPTAGIDVVDA
FT                   FNTVLRDKTIEPGQCQITCGRHCYEGFVYNPSTKAVIDLTGLKSYGEATVGSIPSIYLD
FT                   VGLGNWDMYRLLNNVYQKTVPAGACYSVGLGGHITGGGYGVLSRLYGLSIDYLIAIDIV
FT                   IGDRKNGARMISQCSATNQPELFWAIRGGGGGQFGIITRYYFDLQNLPDSPDYIYIQSL
FT                   NWNWMLSNSNNPISFETFSSILNYFQDVYTNQSESSWNTFGIFHGNHMDAGSLGFSSVD
FT                   IYNESLHGIHTNFETELLSRHENRLKEAELLSPLSMDDLVINGHPYIPSTKALGLNPES
FT                   SSRGYTFLEGMQQLNASGPNRYGKYKSAYHTQKFTDSMMKAAYSGLTQKVIDPNGKSVN
FT                   MKNSLIQFDAYGGKINTVPSNATAITQRSSIMKLQYQSYWVTSLPPGYDDETLKTAHVS
FT                   WLNQIYQNIYSDSGGIPNGIGTEGCYYNYPDIYIGSTKAGTPPIQQALSLYFGKNLDRL
FT                   VNVSATYNPESWFQNSQSISNIA"
FT   gene            315677..315817
FT                   /locus_tag="AM1_A0305"
FT   CDS             315677..315817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31423"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKV5"
FT                   /protein_id="ABW31423.1"
FT                   /translation="MDWGIELNAKHQLYEVNREAPESEDGVTVDQSKGIELKTVMWGHG
FT                   Q"
FT   gene            complement(315845..316300)
FT                   /locus_tag="AM1_A0306"
FT   CDS             complement(315845..316300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31424"
FT                   /db_xref="GOA:A8ZKV6"
FT                   /db_xref="InterPro:IPR007715"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKV6"
FT                   /protein_id="ABW31424.1"
FT                   /translation="MYRYQQQNSTQTLIEGLEEYHSCNSGLVERRNVSTAEKRFFRCHD
FT                   VVHVVFGCDTTLSDEAVVKISTIFGTSIGLQVLRGYGSKESKEIYRKLGLFDIVLTTIK
FT                   SIVLVPITIWHCVQMRKRWPWSNYDRYLEMPLNEIRRKFGIRVVHSR"
FT   gene            316448..317032
FT                   /locus_tag="AM1_A0307"
FT   CDS             316448..317032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31425"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKV7"
FT                   /protein_id="ABW31425.1"
FT                   /translation="MSQALPSLIVNRSFMAEFIEAEKPCCALGMVEVEDQPCGFVTLRP
FT                   EPMIPPGATDLGFNFGHTIFGTSTYEVIHFAFEFYGFQTFNVLINPNNPIAQVVLKQMI
FT                   KSGDYFFFAIDEESGSATAFRSEIGDDTLLSLQENWERIQHSNTTEDQYHHVMLKFAAN
FT                   PHPPGILLKWVCGDNIEYLDLTKDRMNLTPA"
FT   gene            317162..317470
FT                   /locus_tag="AM1_A0308"
FT   CDS             317162..317470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31426"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKV8"
FT                   /protein_id="ABW31426.1"
FT                   /translation="MSASQISQALLRRYEPTCGVSIEAVELLLLLVKQKDKVDFEFIWQ
FT                   QRGRRNPKELAAMLDELITAGLIREVPGKSAEIADGWNRTESLQQPTGLSDDDFGAS"
FT   gene            317583..317798
FT                   /locus_tag="AM1_A0309"
FT   CDS             317583..317798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31427"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKV9"
FT                   /protein_id="ABW31427.1"
FT                   /translation="MQHQFILLCVLGPVFIALSACSNPANELYQKPVDQGQKAIDKAGN
FT                   VQLEIDKAQSTLEQQEKSLAGEQNSQ"
FT   gene            complement(317913..318065)
FT                   /locus_tag="AM1_A0310"
FT   CDS             complement(317913..318065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31428"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKW0"
FT                   /protein_id="ABW31428.1"
FT                   /translation="MQLYYPLLAASSFFPDLRYYRKHLMSIIDEVDGRFGRGKIEIEES
FT                   VRQQT"
FT   gene            318100..318612
FT                   /locus_tag="AM1_A0311"
FT   CDS             318100..318612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31429"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKW1"
FT                   /protein_id="ABW31429.1"
FT                   /translation="MAISMYKASVPPLIRCLNNLSGILEKGAAHAENKGIDPSVLIHSR
FT                   LFPDMLPLAKQVQIASDVARKGAARLAGIEAPSIEDNEASFPELITRSSTTVDYLNTFT
FT                   PDQIDGTEDKIISLPIRGEIYKFPGLPYLLTFVKPNVYFHVTTAYNILRHSGVELGKFD
FT                   YLGKPEH"
FT   gene            318891..320135
FT                   /locus_tag="AM1_A0312"
FT   CDS             318891..320135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0312"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31430"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKW2"
FT                   /protein_id="ABW31430.1"
FT                   /translation="MDNSIRIPLNLPDIRVLELSKTERGDWLIKIESTLQGTTCHQCGR
FT                   EITDLHCHDQPFRIRHLPLFEVPVYLEIRPKRYRCKYCDDHPTTTQHLEWHEPRSPNTK
FT                   AYERWLLRILINSTVSDVARKLGVSEDIVSGIIDRWIAAQVDWSEYADLKVMGMDEISL
FT                   KRGHRDFVVLITIPTTDGVDILAVLADRKQQTVANFLQSIPIDLRQTIERVCTDMYQGF
FT                   VSAVREQLPQAKIVIDRFHVTKAYRNCADTVRKREVKRLRRELSKQEYDSIKGAMWPFR
FT                   KRPENLKESEQQLLERLFAYSPQLKQAYNLREKLTQIFEGRYTKHGAKCAIRAWCKQVL
FT                   KSDIKEFDCFLTTINNWMDEMTNYFLEGWTSGFVEGFNNRVKVLKRRCYGIFDIERLFQ
FT                   RISLDLNGYQTFAVT"
FT   gene            complement(320160..321038)
FT                   /locus_tag="AM1_A0313"
FT   CDS             complement(320160..321038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0313"
FT                   /product="chromosome partitioning protein, ParB family,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31431"
FT                   /db_xref="GOA:A8ZKW3"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKW3"
FT                   /protein_id="ABW31431.1"
FT                   /translation="MTNVAAILNRDSVGQSSSSLSIPIKNIHLPTNQPRKYFNAEKLAQ
FT                   LVTSVKEHGVLEPLLVRPLKNGEYELVAGERRLRAAKEAGLTEVPIIAKQLNNREAVHV
FT                   ALIENLQREDLNPIEETDAILDLLGLVLELNKEQVIALFYQAHHAKHRGQELGQNVLSQ
FT                   LDTVQQTMQEVGRFSIDSFRSSRLPLLKLPEDVLEVLRQGLLEYTKCQAIARVSDKKVR
FT                   ANLLNTAITEQLSLKDIKLEIQSLKAEDKQTPQNLLSQRCKDIGSRLQKSKVLDNSRNR
FT                   SKIKKLWLSGN"
FT   gene            complement(321071..321823)
FT                   /locus_tag="AM1_A0314"
FT   CDS             complement(321071..321823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0314"
FT                   /product="chromosome partitioning protein, ParA family,
FT                   putative"
FT                   /note="containing CobQ/CobB/MinD/ParA nucleotide binding
FT                   domain (PF01656)"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31432"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKW4"
FT                   /protein_id="ABW31432.1"
FT                   /translation="MTKIFSFFNQAGGTGKTTLAMNLGYALSQLGHSVLLVDMDPQSSL
FT                   TIFMGISSYEVATTVSQSILDKKTLPILCGIHEMDLVPSNLSLSAADVQLATAIAKETR
FT                   LKRAISSIESNYDYILIDCPPTLGVLSILSLVASTHILIPMQTQYKSFVGLDLLLGTIN
FT                   ELKVEGVASNLQIAGVIPNLHDRTSQSKEILEAVIEQFSGIAPVFPPVPKAVAFADASM
FT                   NHTPLEIYDRKHPANSILHSIAENLESL"
FT   gene            complement(321906..322103)
FT                   /locus_tag="AM1_A0315"
FT   CDS             complement(321906..322103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31433"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKW5"
FT                   /protein_id="ABW31433.1"
FT                   /translation="MQHPKAKAERGAKVLFWEGDLADLDCAILLLVSGAATLAIPLANS
FT                   RPNTSPWNVPRGERFHDQYL"
FT   gene            complement(322103..322588)
FT                   /locus_tag="AM1_A0316"
FT   CDS             complement(322103..322588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0316"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31434"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKW6"
FT                   /protein_id="ABW31434.1"
FT                   /translation="MLHKPIRVYFTVAIAAMLLSLGQGISILHPSPLATAAPNPQSNPH
FT                   YTAAISRLEQEDLQGAMAELNQAIQIDPSLSEAYALRGVLFMGEKNFQEAAEDFAQVTR
FT                   LQPKSAEAHLNLAKSQLMLKDYQAALQSATKATQLDPQNQSAALLVKMIPHLAKPAQ"
FT   gene            complement(322632..323036)
FT                   /locus_tag="AM1_A0317"
FT   CDS             complement(322632..323036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31435"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKW7"
FT                   /protein_id="ABW31435.1"
FT                   /translation="MTFIPSLSQIQLEILRVAKLSSGEMLNLSLEAPIEQDEGPPSAHP
FT                   QFVQELVDWGLIEVYFKHVHIGTSRFQQDSWAEYCADLSLPSIRAWELWRQEFISEQEG
FT                   ATHVLTPGERFGEFSEVWVEEMRFRAVQPS"
FT   gene            complement(323112..323768)
FT                   /locus_tag="AM1_A0318"
FT   CDS             complement(323112..323768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31436"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKW8"
FT                   /protein_id="ABW31436.1"
FT                   /translation="MKLITSITVKQADHNEVIDTAATQVGLAANKAFLFVIRKEIQGWK
FT                   NFTALCSWGFSKVSQKHGPIFEEVKERTVAVYRKGCQQETVFVQALIKTQLTDRIDAHW
FT                   KLHEKAIDWFKVQTQAFLADNPVEDTSEVEAEDLAPDVSDDLGQAEPVAEESMTILDEA
FT                   PVPVLDPPVDPDPLDDELAVPQDPTPVVASGSGKRRTGTKRVTLADVMKQEAAKS"
FT   gene            complement(323891..324007)
FT                   /locus_tag="AM1_A0319"
FT   CDS             complement(323891..324007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31437"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKW9"
FT                   /protein_id="ABW31437.1"
FT                   /translation="MYPQGFHAILIHRQWDSPTQSIFSKSTSPQLPIEPDFY"
FT   gene            complement(324104..324742)
FT                   /locus_tag="AM1_A0320"
FT   CDS             complement(324104..324742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0320"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31438"
FT                   /db_xref="GOA:A8ZKX0"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKX0"
FT                   /protein_id="ABW31438.1"
FT                   /translation="MFKTQELPASSNQNWRQMLEDEYQGRQTYAFSKGFNVPLHIHDIW
FT                   IVCRGVVQICTLDSEGQESILGLACPDMPFGPPLTQIKAYEAIALTDVVLMRIEQSELE
FT                   RSPLLAQRILIQLNRRFQQTEALLSIVHHRLIRKRIEQLLLLLAREVGEMTPEGVRICV
FT                   RFTHQQIANLTGTSRVTASRILSSLRKEGWMSVDQTSHFVIHDSAVSES"
FT   gene            complement(324889..325371)
FT                   /locus_tag="AM1_A0321"
FT   CDS             complement(324889..325371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31439"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKX1"
FT                   /protein_id="ABW31439.1"
FT                   /translation="MPAYDFEQQFVIGTHHEQTLDAYFQQYFWIEPASRQEQRQGIDRW
FT                   FQAPDGSWMSVEYKADMTAGRTGNAFIETISVDVRAVQGWAYASEADVLAYYVPPRNSV
FT                   WLICFMEFRQYLAEWHQRYPLRQIPNQGYCTEGLLVPLVLFGNIAFEVCRIGEWSH"
FT   gene            complement(325525..326010)
FT                   /locus_tag="AM1_A0322"
FT   CDS             complement(325525..326010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31440"
FT                   /db_xref="GOA:A8ZKX2"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKX2"
FT                   /protein_id="ABW31440.1"
FT                   /translation="MNERNGYAKLIPTPQLDPLLMGEVMGSDAFIEGDWVLLRYWDNRP
FT                   TKVTRVQQNFLYVGLEVGETFEDALVHFYPEELGYPLDHRFWSQRQKQCYLRCHLDPAL
FT                   LRRWDRNSHVFVGKDTDLNVFLLCALASVIILAVSGFWLHYQVFWGLSDVGGNALNP"
FT   gene            complement(326067..326192)
FT                   /locus_tag="AM1_A0323"
FT   CDS             complement(326067..326192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31441"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKX3"
FT                   /protein_id="ABW31441.1"
FT                   /translation="MCSKVSSLALSESLVWFVAFYNNHPDSAAWPHQQNLEIRSQ"
FT   gene            complement(326185..326397)
FT                   /locus_tag="AM1_A0324"
FT   CDS             complement(326185..326397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31442"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKX4"
FT                   /protein_id="ABW31442.1"
FT                   /translation="MNLEVEPPDYYKLGCSYYEVANKCNVYIDYYFTSEPEAYLIVGCA
FT                   YWVIPRQFAEQFIHVFLLGDASRSV"
FT   gene            complement(326550..327320)
FT                   /locus_tag="AM1_A0325"
FT   CDS             complement(326550..327320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0325"
FT                   /product="phage protein Gp37/Gp68"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31443"
FT                   /db_xref="InterPro:IPR011101"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKX5"
FT                   /protein_id="ABW31443.1"
FT                   /translation="MENSKIEWTHHTFNSWIGCAHNSPGCLNCYAEAMMDKRYHRVKWG
FT                   KDGTRSRTSESYWKQPHKWNRKAAERGVTETVFCASLADVFEDRDDLINWRLDLFDEVI
FT                   EKTPNLIWLLLTKRVDVAAKFLQFRQVPSQVWLGQSICTQRESDVVIPKLAKLQKKVGG
FT                   IFLSCEPLLEPLDLSALPANWCITGGESGPSARPCDVTWIRSIRDQCKSAEIPVFIKQL
FT                   GSKPVGVPKLRSAKGGDAEEWPQDLRVREFPVFG"
FT   gene            complement(327310..327759)
FT                   /locus_tag="AM1_A0326"
FT   CDS             complement(327310..327759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0326"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31444"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKX6"
FT                   /protein_id="ABW31444.1"
FT                   /translation="MKIITLWQPWATFIALNFKEFETRSWGTRYRGKLAIHAAKRPINL
FT                   DGQAIVGQVNNLTDGKVPRNPCDYPLGCIVAISDLVDCPRMDSSLISRQTELELAVGCW
FT                   QLGRFAWQLGSIVPLPEPIPYRGSQGLRDVRPETLKILMELTNGE"
FT   gene            complement(327756..328016)
FT                   /locus_tag="AM1_A0327"
FT   CDS             complement(327756..328016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31445"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKX7"
FT                   /protein_id="ABW31445.1"
FT                   /translation="MKKQVWNLLQQGRGIMQLQPLGCLSSRSKSLCLGCEAGQYYECQS
FT                   CGYLQPYCKGADDDYFEICDDCWGIAEKMHEAIGMPMEAER"
FT   gene            complement(328161..328691)
FT                   /locus_tag="AM1_A0328"
FT   CDS             complement(328161..328691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31446"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKX8"
FT                   /protein_id="ABW31446.1"
FT                   /translation="MIAVQTALPLQLPKSGPVKTTKQRQAFERMLAQLRKEAAEILAIA
FT                   NQMFQQTWQRLQEVPTPQMGAAVKAYHKANGIVIPQAIRSGPISSKPSRPYRPWPMARK
FT                   YRERIRRMQVRAQKKYSIFSLQFDFIQSELVRLPHYFGVCPLPSEEGCTLNLQDLLLNP
FT                   AIEREKQLRAQEG"
FT   gene            complement(328700..329533)
FT                   /gene="dcm"
FT                   /locus_tag="AM1_A0329"
FT   CDS             complement(328700..329533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcm"
FT                   /locus_tag="AM1_A0329"
FT                   /product="C-5 cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31447"
FT                   /db_xref="GOA:A8ZKX9"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKX9"
FT                   /protein_id="ABW31447.1"
FT                   /translation="MNDLFVQSGDGLYLPQQSTYHQRQSGLLLPKREYDVPIAIDLFCG
FT                   CGGFSLGMIEGGFQVVAAVEKDANAALTYLANLGAYPLDMNFVVDEDEARFTKLLEKIM
FT                   QMDKDGGIAQCFLSGQHRPPERPGVEHFWLGDVRQLTGQQILDSIGVGVGEVDCVFGGP
FT                   PCQGFSIAGKRQVLDPRNSLIFEFARMILEIRPKTFVMENVPGIVSMVTPESVPVIDAF
FT                   CRVIADGGFSTYDALRKTLHQQAEAFGGIHQTSPAKKPKRKSKDSDPQPQLSLFE"
FT   gene            329532..329753
FT                   /locus_tag="AM1_A0330"
FT   CDS             329532..329753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31448"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKY0"
FT                   /protein_id="ABW31448.1"
FT                   /translation="MSVNLLTTQLETDSRAQIRDFDRGEVLAPLPGFVLGNHQNVLSGD
FT                   CGEHLETGAVLSPERSEEVHQMMLRRVH"
FT   gene            330441..330566
FT                   /locus_tag="AM1_A0331"
FT   CDS             330441..330566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31449"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKY1"
FT                   /protein_id="ABW31449.1"
FT                   /translation="MLRKNRLFIRLIAWKHKIYKHQSNYFVVVVNSEATVNTNHS"
FT   gene            complement(330627..330932)
FT                   /locus_tag="AM1_A0332"
FT   CDS             complement(330627..330932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31450"
FT                   /db_xref="InterPro:IPR025475"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKY2"
FT                   /protein_id="ABW31450.1"
FT                   /translation="MFQESERMAVIAAFREYLHEVANLGANPIDVVPDLADKYNVQVSG
FT                   MWKRPSRPQVMVELAKLEAMLEVKLLCWCAPLACHGDVIKSYLVWKHPEPQQLELS"
FT   gene            330933..331178
FT                   /locus_tag="AM1_A0333"
FT   CDS             330933..331178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31451"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKY3"
FT                   /protein_id="ABW31451.1"
FT                   /translation="MKGIAKDAGTVATVALNIAIMAKINDGDVHDIFAIERDKLYGFRQ
FT                   GVFEHENCPLLIQLGRSSTASNANFKTVLDFMKILF"
FT   gene            complement(331265..331444)
FT                   /locus_tag="AM1_A0334"
FT   CDS             complement(331265..331444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31452"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKY4"
FT                   /protein_id="ABW31452.1"
FT                   /translation="MVVRCQRVELLGSKQGEQASSNTVAPAPTHTPPQPQRQVKPPVAS
FT                   KAGGGSFVDDNIPF"
FT   gene            complement(331478..331702)
FT                   /locus_tag="AM1_A0335"
FT   CDS             complement(331478..331702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0335"
FT                   /product="single-stranded DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31453"
FT                   /db_xref="GOA:A8ZKY5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKY5"
FT                   /protein_id="ABW31453.1"
FT                   /translation="MNTVNLIGRLTADPQMRYFEFGKVIAKFHLAINRTKDETDFFEIE
FT                   AWEKTAEVIGQYCQKGSQIGVSGSLLQER"
FT   gene            complement(331901..332128)
FT                   /locus_tag="AM1_A0336"
FT   CDS             complement(331901..332128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31454"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKY6"
FT                   /protein_id="ABW31454.1"
FT                   /translation="MQLVGARGVFAYYWQAQQAFELFWAELPDDVSDCQLTKSWMAWFE
FT                   GSLRQKKTASRYRSCRGLFTWWSWRSSLFS"
FT   gene            complement(332277..332795)
FT                   /locus_tag="AM1_A0337"
FT   CDS             complement(332277..332795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31455"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKY7"
FT                   /protein_id="ABW31455.1"
FT                   /translation="MIKTQDRSQAPLQQQAHVRPLGFGESPSGLAIFCNRANTNTWYTL
FT                   NQDSQPVELPYPALTGYLQSIEFIKGEYKGKPKSKLRFKMMAHRPCTLEAGSESTFTKG
FT                   FLSAIASLTPDHLHYPITIEAIPADEEKVLFCSVWLMGQKVFQAWDEQTNWREVARKAM
FT                   TNVAQLQSG"
FT   gene            complement(332776..333222)
FT                   /locus_tag="AM1_A0338"
FT   CDS             complement(332776..333222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31456"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKY8"
FT                   /protein_id="ABW31456.1"
FT                   /translation="MEQSIAILVLADAITCCFVSTIASTIQATSNSPPRITPINLFHTY
FT                   KFPWPIRWGFHISRENPMTVSIPPLTLKVSAPQTNVTSYSTNPEDLPILEQISSLLPNL
FT                   SQAGKVALIRGVSELLAVSMSLPTQPKEITLSLHHEATYDKNSR"
FT   gene            333204..333494
FT                   /locus_tag="AM1_A0339"
FT   CDS             333204..333494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31457"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKY9"
FT                   /protein_id="ABW31457.1"
FT                   /translation="MLYFAPIDQPHPYRSSILPDDCPKAFLGLSLLEINQLEGAAIPDF
FT                   DFSDVDFHGITSSDSEGSPPVVNQGLIGVGRSRKEKRRKRKVLGGEGRGCC"
FT   gene            complement(333648..333893)
FT                   /locus_tag="AM1_A0340"
FT   CDS             complement(333648..333893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31458"
FT                   /db_xref="GOA:A8ZKZ0"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKZ0"
FT                   /protein_id="ABW31458.1"
FT                   /translation="MTASEPDRLDRIENLLTGFGEDLSTVKNDLNSLKEQTIKTNEQVK
FT                   KWDGRLWGLTLALISTAWAGIIGATAVVITRSLTGS"
FT   gene            complement(333979..334131)
FT                   /locus_tag="AM1_A0341"
FT   CDS             complement(333979..334131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31459"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKZ1"
FT                   /protein_id="ABW31459.1"
FT                   /translation="MDSLMDRALQMLNGMIDEGWEYPEAEFRVLSRLDLSPSQVDQLQQ
FT                   LYDEQ"
FT   gene            complement(334134..334478)
FT                   /locus_tag="AM1_A0342"
FT   CDS             complement(334134..334478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0342"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31460"
FT                   /db_xref="InterPro:IPR022243"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKZ2"
FT                   /protein_id="ABW31460.1"
FT                   /translation="MTTTEATQAPTIAQLNDRFRQGDHTLGQVFTTQLVQGLSSQEQQE
FT                   LFRLVRTFDDFNEDNDPWKEHDYGRIEFQDEQYLWKIDYYDKNLKYGSEDSSDPKVTTR
FT                   VLTIMHSSEY"
FT   gene            complement(334545..334811)
FT                   /locus_tag="AM1_A0343"
FT   CDS             complement(334545..334811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31461"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKZ3"
FT                   /protein_id="ABW31461.1"
FT                   /translation="MTVALLTPEQRYAALYPKTRKFDITIDFYPGVRGGGEEIDLTIEL
FT                   PSQAHVTSRQQCERWVVENYPSGRLIFVQPIFTTQQLLAEDEF"
FT   gene            335124..335342
FT                   /locus_tag="AM1_A0344"
FT   CDS             335124..335342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31462"
FT                   /db_xref="GOA:A8ZKZ4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKZ4"
FT                   /protein_id="ABW31462.1"
FT                   /translation="MSNIKALREDRGLSQSQLARKMQMTETTIRNWEHGRTGVEWFERV
FT                   ARLCEILNCTPNDLFGYEEVSKDDPET"
FT   gene            335394..335684
FT                   /locus_tag="AM1_A0345"
FT   CDS             335394..335684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31463"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKZ5"
FT                   /protein_id="ABW31463.1"
FT                   /translation="MTSEELQQLIESNAKAIEALATQQTERQRHTDRQIAELTRTVSTF
FT                   VRETSDVVSNLMNDRATMYELISQNSEAQASINESLSQIAEAISRIADKDN"
FT   gene            complement(335839..336894)
FT                   /locus_tag="AM1_A0346"
FT   CDS             complement(335839..336894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0346"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31464"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKZ6"
FT                   /protein_id="ABW31464.1"
FT                   /translation="MKQGLTLVEMAQAVQDQAEAKRDFVADTRTLEMNPDGSITVESEA
FT                   VEETFTTTEHTHGQISQRLSIPLKYYRRMQSSAPQLLAENVNHWFNTNPERRMIRTLDG
FT                   SARAFLSDRYRRVDNFEIAETVLPVLAEFGQGLKIMSVGLTDSRLYIKAVNERVQLDVR
FT                   KGDAVQAGVVISNSEIGLGSIRIEPLVYRLVCLNGLISQDHSFKKYHVGRQVGESDAAV
FT                   ELFSDETREADDRALLLKVRDMVCGAADIAKFTQIVEQMRDATERKIEGNPVTAVEVLG
FT                   DKLNVNQEERSGILTHLIQGGDLTAYGMMNAVTRTSQDVESYDRATELEAMGSQVLSLP
FT                   QSTWREIAIAR"
FT   gene            complement(336918..337115)
FT                   /locus_tag="AM1_A0347"
FT   CDS             complement(336918..337115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31465"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKZ7"
FT                   /protein_id="ABW31465.1"
FT                   /translation="MKGFHLNQISEFYEVLGHPAEYRRHETGVTLDYGLMPSVDELKVQ
FT                   KQLQVKAEEKRVAIDSLPLA"
FT   gene            337238..337489
FT                   /locus_tag="AM1_A0348"
FT   CDS             337238..337489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31466"
FT                   /db_xref="GOA:A8ZKZ8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKZ8"
FT                   /protein_id="ABW31466.1"
FT                   /translation="MKTLRQDAGLSQSELARALDIAESTVRNWDQGRSIPTLSALEYPH
FT                   LLKLLNCSPEELANAAAQSKILFEQKQAAKGKKGSGSS"
FT   gene            complement(337686..338147)
FT                   /locus_tag="AM1_A0349"
FT   CDS             complement(337686..338147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0349"
FT                   /product="acetyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31467"
FT                   /db_xref="GOA:A8ZKZ9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZKZ9"
FT                   /protein_id="ABW31467.1"
FT                   /translation="MSSHQMPVLRITKREELECICELEQGEMRMFVIPYSLQKHQVEFA
FT                   KPDVIYKSIWWNEELIGFFILVLDPDGQSVEFRRIIVSKPEQGLGTIVVRSVDNICSSE
FT                   LGRSRVWLDVFESNERARHVYEKCGYQLFGETQHEGRNLFLYEKTVQQS"
FT   gene            complement(338454..338573)
FT                   /locus_tag="AM1_A0350"
FT   CDS             complement(338454..338573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31468"
FT                   /db_xref="GOA:A8ZL00"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL00"
FT                   /protein_id="ABW31468.1"
FT                   /translation="MDIPHRDIPAGLSFRGIALISFRVLVILDIPQFARPNLS"
FT   gene            complement(338747..339013)
FT                   /locus_tag="AM1_A0351"
FT   CDS             complement(338747..339013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31469"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL01"
FT                   /protein_id="ABW31469.1"
FT                   /translation="MEKPTNLSDTGELDEIYRRRKQLAISLKFHHYQDLQKLPQEVAVR
FT                   AMAEAWGACHPEGFPKYCPGTSTAIIPQEQISKSIRESKYFSG"
FT   gene            339153..339542
FT                   /locus_tag="AM1_A0352"
FT   CDS             339153..339542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31470"
FT                   /db_xref="GOA:A8ZL02"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL02"
FT                   /protein_id="ABW31470.1"
FT                   /translation="MMPKRTKKNKPLTGQALLAKVSTLSDLTREEKAKACGYFTFAKDS
FT                   TERINVMAFLNAVLDAEGMDLGAKGKSNGKLGGRKLTFRTSVQSNGNLLVGSAYTKKME
FT                   LQPGDEFEIALGRKHIHLKLMAEED"
FT   gene            339743..340018
FT                   /gene="hup"
FT                   /locus_tag="AM1_A0353"
FT   CDS             339743..340018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hup"
FT                   /locus_tag="AM1_A0353"
FT                   /product="DNA-binding protein HU"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31471"
FT                   /db_xref="GOA:A8ZL03"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL03"
FT                   /protein_id="ABW31471.1"
FT                   /translation="MNKGELVDVIAENTGATKKQADTILTALTETIMETVSSGEKVILV
FT                   GFGSFEARDRKARDGRNPRTGKKLTIPATKSPIFSAGKTFKEQVKD"
FT   gene            340194..341000
FT                   /gene="rpoD"
FT                   /locus_tag="AM1_A0354"
FT   CDS             340194..341000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="AM1_A0354"
FT                   /product="RNA polymerase sigma-70 factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31472"
FT                   /db_xref="GOA:A8ZL04"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL04"
FT                   /protein_id="ABW31472.1"
FT                   /translation="MATSYDSLHFFFKEIARYPLLSHEEEIQLARQAQAGSLRAKQRMI
FT                   ECNLRFVVSIAKKYQNRGLPLLDLIQEGSIGLSTAVDKFDLAQGCRFSTYAYWWIRQGI
FT                   TAAVRAKSRPIYLPHYHWDTVGKIKKHFRVLTQQLGREPSLSELSEATNIKPKTISRTL
FT                   QLFQQISSLDQLVGPQQKDTLLDMLAGEDQPTHYLESLQLDDELSQVMASLDERERFVL
FT                   SQRYGLEDDHPKSMKEIGQQIGLSHEGIRLILKKIMQKLERYAQSA"
FT   gene            complement(341023..341538)
FT                   /locus_tag="AM1_A0355"
FT   CDS             complement(341023..341538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31473"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL05"
FT                   /protein_id="ABW31473.1"
FT                   /translation="MPGPSFHKSWRQTAIEFCEDACSKGVKYILVEFPSYLMTWRCNQT
FT                   AASVRAQSLHSSQPEEISSTSLGPLKVASATQKSSQKNVQTPPPEIATQQALGIDNDDD
FT                   EFISQCKKELAIHIGPMADLMTKQTLNQSPEMSHQELIEALAAHIADPNAALSFRKACY
FT                   SINGIHLL"
FT   gene            complement(341678..342022)
FT                   /locus_tag="AM1_A0356"
FT   CDS             complement(341678..342022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31474"
FT                   /db_xref="InterPro:IPR021336"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL06"
FT                   /protein_id="ABW31474.1"
FT                   /translation="MIQDELAISGAAIDLALRYPDPSQGRIHIILWQHGLLDLDELGQT
FT                   FEWRTSKKLIWLPVRENRKNWQHIVNVCQLRCSNSAKIVFISTLMSEIRLWGNLRVVDH
FT                   QGEFIYSQFR"
FT   gene            342114..342230
FT                   /locus_tag="AM1_A0357"
FT   CDS             342114..342230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31475"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL07"
FT                   /protein_id="ABW31475.1"
FT                   /translation="MSQLETDNLPINETDILPEIDELDDVDLDDLLKDLQQD"
FT   gene            342266..342757
FT                   /locus_tag="AM1_A0358"
FT   CDS             342266..342757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31476"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL08"
FT                   /protein_id="ABW31476.1"
FT                   /translation="MDPNNLAVWKNLETRLGTPFRKNMVDLVLEMARDRTTDPHKIATW
FT                   MVTTSTYICSAIFGTNDPMPLLFLYVRALDIQYPDTMQEIYEIFSDEGLVKYAPSSLKR
FT                   GDFTSILWAAGSTFANGELKLIDDEIHINPKGLQRLRSIWQAPTRKFNNPSGNAEYPSQ
FT                   "
FT   gene            complement(342953..343300)
FT                   /locus_tag="AM1_A0359"
FT   CDS             complement(342953..343300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31477"
FT                   /db_xref="GOA:A8ZL09"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL09"
FT                   /protein_id="ABW31477.1"
FT                   /translation="MKKLSDYAIGAFLIVIAPLVIVIAGFLYIDVVHVRLPTVEQLLVK
FT                   YPTCEQRGEFVATHIKESQTTPTVLIDRPARDLDGLWQRYRAKVENILEERDERIFAHT
FT                   LYKLGSGCWHD"
FT   gene            complement(343313..343468)
FT                   /locus_tag="AM1_A0360"
FT   CDS             complement(343313..343468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31478"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL10"
FT                   /protein_id="ABW31478.1"
FT                   /translation="MDTVRVGQEVLSARVSDVISNLDEAEWVDVQKLRETQNQAMSSIR
FT                   LPISSN"
FT   gene            343540..343938
FT                   /locus_tag="AM1_A0361"
FT   CDS             343540..343938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31479"
FT                   /db_xref="InterPro:IPR025355"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL11"
FT                   /protein_id="ABW31479.1"
FT                   /translation="MGASGVGSFDNDNAMDWVAELEGYADDSPIVDALNTVIDQADDSP
FT                   GTLDCSIAIAAAEVVAAQLGHPHEDCPEEIEVWVEGHPAPSATRVAQARQAIEVILAES
FT                   ELKGLWENSGGLEEWQGAMEDLLSRLPY"
FT   gene            344011..344493
FT                   /locus_tag="AM1_A0362"
FT   CDS             344011..344493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31480"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL12"
FT                   /protein_id="ABW31480.1"
FT                   /translation="MDPNTLIAWKNLETRLDVPFRNNMMALLLEMARERTADPQKIATW
FT                   MLTTSACICNAVFGIDDPMPLLSLYIRVLCDHYPRTIEQIAQIYSYGSLKRYVPVIADR
FT                   DDFIGILSAAGSTFANGELILMDGEIDVSQKGLERFQLIWKAPAVKLANPGPSVLW"
FT   gene            complement(344854..345291)
FT                   /locus_tag="AM1_A0363"
FT   CDS             complement(344854..345291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="Putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31481"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL13"
FT                   /protein_id="ABW31481.1"
FT                   /translation="MTFSLSTEQVPQANTSQSIPYLVVVDATIDNYQSLWASSLLGKEV
FT                   HILDIETDGIIQIKTLLSQYQGLSCLHLICKGEPGQLELGTTHLSDKNLWEYADEIRQW
FT                   REYLSDSAEILISGCELAASRVGQAFVSWLGLLSGAAVRVV"
FT   gene            346124..346447
FT                   /locus_tag="AM1_A0364"
FT   CDS             346124..346447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0364"
FT                   /product="anti-sigma-factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31482"
FT                   /db_xref="GOA:A8ZL14"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL14"
FT                   /protein_id="ABW31482.1"
FT                   /translation="MSYEVFQPADLMDGISANQLRSEINDALANGVKTILIDLRDVTFM
FT                   NSSAIGSLVATLKSVRGEDGTLSLCSLNDQVRIIFELTKMDHIFDIYADRQEFMHKNGI
FT                   SSS"
FT   gene            346428..346565
FT                   /locus_tag="AM1_A0365"
FT   CDS             346428..346565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31483"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL15"
FT                   /protein_id="ABW31483.1"
FT                   /translation="MVFPPANLIQALMNQSFVLGKDFSRIAEGELIISPQVEVFIHSII
FT                   "
FT   gene            complement(346838..346960)
FT                   /locus_tag="AM1_A0366"
FT   CDS             complement(346838..346960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31484"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL16"
FT                   /protein_id="ABW31484.1"
FT                   /translation="MSRTFPKISSNLIDRFWEAFLKTLLMSMNTGSPLESPEEL"
FT   gene            347142..347348
FT                   /locus_tag="AM1_A0367"
FT   CDS             347142..347348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0367"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31485"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL17"
FT                   /protein_id="ABW31485.1"
FT                   /translation="MKPTQAFYNGTPIAPPSIHLTTEQKMDLLDWHPIFTGRCPNCERP
FT                   IRETTPPRSHWDCAECGWREDLA"
FT   gene            347700..348977
FT                   /locus_tag="AM1_A0368"
FT   CDS             347700..348977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0368"
FT                   /product="response regulator receiver, CheY-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31486"
FT                   /db_xref="GOA:A8ZL18"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL18"
FT                   /protein_id="ABW31486.1"
FT                   /translation="MSDCQTLLDFADQLIESNTGAALSQIQRLVLMEALTLRAKAKTYD
FT                   QVASETGYSSGYIKAIAAELWKLLSKVSGKKVTKGNVQTMLQQQLKHEPSLLQDGRLVV
FT                   ETGMIPNRQPIIPKATDVTAVVTAAKATEIKETNGNKTDVNQAEVKEKATVIPSVILVV
FT                   DDQPNIMNLLTSIMEQDEYEVWQASSGAEGLQMAAKVLPDLILLDVNMPDMDGYTVCQQ
FT                   LKADPQTTAIPIIFVSALDESWDKVKGFSVGGSDYITKPFNTLEVIVRIEDQLKIRQIQ
FT                   DQMLKADQAPTDSPQSKPSSAKAVILMVDDEPKNLALLTDVLEQEGYEIWQADSGAEAL
FT                   RVAGMVLPDLILLDINMPDMQGYDVCQQLKANAKTKLIPVIFVSALDETWDKVKAFSVG
FT                   GSDYINKPIQIVELMARMKHQLQIWH"
FT   gene            349068..351812
FT                   /locus_tag="AM1_A0369"
FT   CDS             349068..351812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0369"
FT                   /product="two-component hybrid sensor and regulator
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31487"
FT                   /db_xref="GOA:A8ZL19"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL19"
FT                   /protein_id="ABW31487.1"
FT                   /translation="MNPKTPSLSLRWVLIIPFVVQIFAAVGVVGYFSYRSGQRAVEDVV
FT                   NQLQNEISDRITERLDTYLRTPSLVADNLSLAIQTRELDINQINRDWELYLWRHINLYD
FT                   NVKGVYVATEDLQYRHIISQEEGLVMELFSLEDQFLRYYLVDPKGSVTDELIEVLEKEF
FT                   KPRSRPWYTAPKQAGKATWTPIFIWVQGDTMSVDFATPVYGPSQQFEGVVGTSFSLSNI
FT                   SDYLATLKIAESGEAFILERSGAVVATSTGEKPHGIDLDSQTVARLNAIDSQNTLMRQT
FT                   TQYLFDRFGSLEIINSLTQDRYKIEGRQYFLKVESYRDNLGLDWLIAIVIPESDFMAQI
FT                   YANIRTTLALCLGALGIATFLGILTSRWILQPILRLQTASNSLAAGQLDQAIEVKGIHE
FT                   LSSLGSAFNSMARQLQESFQALEDNNAKLDQRVQQRTAELKVAKEKAEVANQAKSLFIA
FT                   NMSHELRTPLNGILGYAQVLERSPTISDKAQQQVHIIHKCGTHLLGMINDILDLSKIEA
FT                   GKLDLMPKPVHLTSCLQGVAEACRVRAAQKGLEFVYAVDPGLPEGVELDEQRLRQVLFN
FT                   LLSNAIKFTQQGTVTLQVSVAEVTRSDYRRLRFGVTDTGVGIAPAHLDQLFNAFVQVGD
FT                   RQKQAEGTGLGLAISRRLVQLMGSQIEVQSAVGQGSQFSFELEVPLATEWELSPSTLQN
FT                   HAIIGYAGERRRVLVVDDRWDNRSVLVSLLQPIGFEIVEAEEGQKALAVLQQQPFHLMI
FT                   TDLAMPVMDGFELLRQVQQLPIRPPKMIVSSAYVSKQEQELAMAAGADALLPKPVDAAK
FT                   LFELLARELGLEWQYVGNEAPQDITSAPAAAITLPSRERLRSMYDAADAGDFRMVRRQL
FT                   EQLMATNPEYEGFVRPLLALAKKLKTDEIKGMLAQYVDDEASG"
FT   gene            352247..355078
FT                   /locus_tag="AM1_A0370"
FT   CDS             352247..355078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0370"
FT                   /product="hemolysin-type calcium-binding region protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31488"
FT                   /db_xref="GOA:A8ZL20"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR003995"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL20"
FT                   /protein_id="ABW31488.1"
FT                   /translation="MTIEARYDIDPDLTGISRITDDSPIQFLSNRLDHWKGLKHYRFDL
FT                   TVRNSYQFATAPNHDGKHGGSLELTRFNKKWTNQKQDYYQYKTLFGTDSRDVIYETQDY
FT                   RYLGGWGEYLDETLKPVSQNIYGGGGNDTIIAHDLQGYSDSVKSYLNGDPSSINQFHGE
FT                   AGNDILKGNAFQNLLYGGTGNDTLDGGGGDDFLSGNEDNDKLWGGDGEDQLFGGIGNDI
FT                   LVGGDGYDEIDAGDGDDTIFLDVPIEGNNKGDYVIGGTGADTFVIGGTTMTTTTTTTTT
FT                   PYDWKGTGLGATTDVMGAVIDGTGLGVASKVTKGVVGAVIDIFKGAESKNVETTTVESV
FT                   PGNIATGNYIQITDFNPREDVIVIPISAELSNVGRTITDDNLRTLELYYKDSGRVFAEI
FT                   KLEELYKLYNNDEVALNINNRDELESVWESVLDSSLYLGTYDANDSSPTIKLGTTTENF
FT                   KNADGSLTEIKTTVSELDANYMVIGAYAGANILTSGKDDDLWGTDYNDVLVAYPTASNK
FT                   EPQHNEINKLYGFNGDDILAGGAGADYYFGGDGTDIVSYADDRFDDNDSNGITVNLADS
FT                   LEGNKEDYAYLDPESEKAIFSWAWDVYADPLDPDQADKLFSIEGIIGSKWDDSIKGDKW
FT                   NNIFNGGDGNDTLEGGAGNDTLIGGEGEDTLEGGGGNDTLIGGAGSDTLIGDVVAGNDT
FT                   LIVDAGADTFVLDTTEGGIDTIRGFSLAENDVLLIDNKSLGTSHAKARNLNGMLSATGL
FT                   KLQLGNVGIATIENVDSSNVHRVLGRVEFTTSSHINTPLGLGDDLLATGDGNDRLTGGS
FT                   GDDLLSGGAGNDTLLGGTHKDLLLGGRGDDLLNGGKGIDRLYGGSGADTFVINNTVSGL
FT                   NKRAGIDVIQDFSVDEFDHIQIDASVFGIGINDHHLVQLGNDSFLRVNNRKIAQLTGVD
FT                   VNTFVTDEHVDLV"
FT   gene            complement(355227..356087)
FT                   /locus_tag="AM1_A0371"
FT   CDS             complement(355227..356087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31489"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL21"
FT                   /protein_id="ABW31489.1"
FT                   /translation="MKTAVTPVGNPVYWITFGPRINKPTETNITFPGTKLDLVESILHI
FT                   LSIHWDAWEYGRNAIQDFPNLEEAIFSEHVCYLLQKYYGATHQPNVDPETELDEIDLYD
FT                   VWNWKHLFFSDEETYTDLADCLLNPELMAGINHRRYKPGLALEVHAMTLHGLDNYERYV
FT                   NTPKGSLVANPSNGGCQMPVIEEVASGKVTKVPPNPNIFWINHKYCYLKSKLACVTTTK
FT                   TYAQARLDAYYILSEALIHKPDANDALHHGSLVLACCGAGVIGLRRATFFWNVSRGNNG
FT                   KEDAG"
FT   gene            complement(356196..356405)
FT                   /locus_tag="AM1_A0372"
FT   CDS             complement(356196..356405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31490"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL22"
FT                   /protein_id="ABW31490.1"
FT                   /translation="MTTNPFIGYIEQAWIYHQTDYGQHPDPCTGLPSDQILDRVASWLS
FT                   EFNPLIPPESETALSIRVGIVQRY"
FT   gene            356428..356574
FT                   /locus_tag="AM1_A0374"
FT   CDS             356428..356574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31492"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL23"
FT                   /protein_id="ABW31492.1"
FT                   /translation="MKGFIYDLLGWEDQGGRFIVVGWEVWEVVLGMRSRLHTDPLKYLS
FT                   AHL"
FT   gene            complement(356549..356704)
FT                   /locus_tag="AM1_A0373"
FT   CDS             complement(356549..356704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31491"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL24"
FT                   /protein_id="ABW31491.1"
FT                   /translation="MSSKTALDAFLAAEETKALKQFSSEKPGRIGVQLTSISFLPHVIT
FT                   DEQKDI"
FT   gene            complement(356755..358005)
FT                   /locus_tag="AM1_A0375"
FT   CDS             complement(356755..358005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0375"
FT                   /product="transposase, mutator family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31493"
FT                   /db_xref="GOA:A8ZL25"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL25"
FT                   /protein_id="ABW31493.1"
FT                   /translation="MSRKKKAPNRVDELLDELIGENPQPEDILGESGLLKRLSKRLVER
FT                   ALAGELTHHLQQSSNDQSGDENSNGPRNSRNGYSKKTVQSEQGEMDLSIPRDRCGEFEP
FT                   VLVPKGQRRIAGLDEKIIALYARGMTTRDIRAQLVELYGANISEALISDVTNSVMEEVK
FT                   DWRSRPLDEVYPIVYLDALYVNIKVNGQVSKRAVYVALAVTVEGNKELLGLWIGAAERE
FT                   GAKFWLSVLTDLKNRGTQDILIACCDGLKGFPQAIESVYPQTQVQVCIVHLIRNSLRHV
FT                   PWKESRAVAADLKPIYQAATLEESEAALDAFAHKWDETYPGISQIWIRHWDNVAPLFQY
FT                   PMAIRKVIYTTNAIESLNRSLRKVIKTKAVFPNEESVYKLMFLAMRNISKRWTRPILNW
FT                   KAALSHFAILFPTRFNY"
FT   gene            complement(358228..358536)
FT                   /locus_tag="AM1_A0376"
FT   CDS             complement(358228..358536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31494"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL26"
FT                   /protein_id="ABW31494.1"
FT                   /translation="MIHTFQSSANHILPTGGGLGTRSYYWLPFQKSSPQVVFAFEVTRC
FT                   NAFISEERARDCMNRLQTAFKDIPGLYLKTSWDIPEVTQAATQDQARVKESSSSAPE"
FT   gene            358528..358647
FT                   /locus_tag="AM1_A0377"
FT   CDS             358528..358647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31495"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL27"
FT                   /protein_id="ABW31495.1"
FT                   /translation="MNHENHLNCSSVDQRNPSGVLSSAHPSEPSEGRSVRNWN"
FT   gene            complement(358659..358796)
FT                   /locus_tag="AM1_A0378"
FT   CDS             complement(358659..358796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31496"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL28"
FT                   /protein_id="ABW31496.1"
FT                   /translation="MPLPNSLIEGDAILRSQNNTNDNYQASPLPWCNPLDQEAITRAIL
FT                   "
FT   gene            complement(358835..359350)
FT                   /locus_tag="AM1_A0379"
FT   CDS             complement(358835..359350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0379"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31497"
FT                   /db_xref="InterPro:IPR021297"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL29"
FT                   /protein_id="ABW31497.1"
FT                   /translation="MLIQDRPTQPKPELWVESPSSNQLLLNRPITIKAIVTPIWKDEAQ
FT                   QLLQSQVDQLDEQLAQLDTQVQQMVSELSQHTIQSTGGEGRTIAETQNQIQGIQVQAEK
FT                   RKNELLQQKAQVLQQLEKVGTLELGEEVEQGQVDSYFYVKQGDHFIRKMQVEMVLRDGV
FT                   IEEIRGDL"
FT   gene            complement(359411..359524)
FT                   /locus_tag="AM1_A0380"
FT   CDS             complement(359411..359524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31498"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL30"
FT                   /protein_id="ABW31498.1"
FT                   /translation="MADYRSLPTKQIRAVAHYLAPPTGANKAGGTLSVTAN"
FT   gene            complement(359496..359828)
FT                   /locus_tag="AM1_A0381"
FT   CDS             complement(359496..359828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31499"
FT                   /db_xref="GOA:A8ZL31"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL31"
FT                   /protein_id="ABW31499.1"
FT                   /translation="MLELMNTQFQVWAMQSKEAIAIRERAMILADQEAIRKAAKQQREH
FT                   DYRMAVLGDFSYWGWLVVLVALIAGAGGWWLRGTIAPSSANNKSGILPVTAQPNSEGGR
FT                   LSVTSN"
FT   gene            complement(359840..360475)
FT                   /locus_tag="AM1_A0382"
FT   CDS             complement(359840..360475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31500"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL32"
FT                   /protein_id="ABW31500.1"
FT                   /translation="MTIMNDLMQTLGMDDKQVGHLLRACGMSEDGYDLETLQGVVKLRE
FT                   EKSADNYTHAWCIYTADTHQVDLKPIHKAITAEGIETGNDLYHPLFTLVCERVSEESMD
FT                   PVDAVKAELQGTEEPEEEVTIDDVEEVDEDMKLALKADSLRTCRRVVKNARKTSERVVQ
FT                   AAHKYHMQQLSRDLKKMFAEEWAKEEAQEALEGETVPGKCLEAEVREV"
FT   gene            complement(360681..361118)
FT                   /locus_tag="AM1_A0383"
FT   CDS             complement(360681..361118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31501"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL33"
FT                   /protein_id="ABW31501.1"
FT                   /translation="MPERLKVDAVYPNAEYKEILQASKQHFYGTFATKCVTILYAVFKP
FT                   VVVALRTNSVAEVRKAILISRDQVETFYELALIMVTADGDSPELTPPSPAPSTAAPMVV
FT                   EPETVQPPPEPYEPPREEEEPPAVDSDSPAISIYAGLKEDD"
FT   gene            complement(361118..362299)
FT                   /locus_tag="AM1_A0384"
FT   CDS             complement(361118..362299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31502"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL34"
FT                   /protein_id="ABW31502.1"
FT                   /translation="MGELQGDLWGFRGICVNRDLGWRYIISLIMEKRKSMNAIAKFGID
FT                   TGASGNKVLVQTTHPGKVGVEDLILQSSAIRKVTASYYESLNLVNNRQGSHLSFDGAHW
FT                   IVGEYAEGAVRRTKVNRIKKHHAVAKVLSIVGQYISEIDSPLDVEIDLMLPSNEAPYFR
FT                   ETEELIFKHIRSFQYGIDTVSCNPVRVQVHPEGAGFASYANVYPCSILMFGHRDVTIIN
FT                   LKDEQANVVPNAYTWTGYGTIEILRNFPFAFSNELTGAKLLYEEAMAWGEGGLSAMLTE
FT                   EEKPIKLAALKEAKDLVWTDLSDDLAADTDFMNSKRVYVGGGGSFFWGDYLADLCQVKA
FT                   DILAPVRREIKTTFAQLRLSLSQQQRFIDLYLIWRQHAAPVMQLQPAPVKEVV"
FT   gene            362285..362494
FT                   /locus_tag="AM1_A0385"
FT   CDS             362285..362494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31503"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL35"
FT                   /protein_id="ABW31503.1"
FT                   /translation="MQLPQIPLEIGETWGNPENDLRTCRKAWSGATLRADSRGFGGVAE
FT                   APTPITTPRHRNGNLPNRTDPKFS"
FT   gene            362825..368410
FT                   /locus_tag="AM1_A0387"
FT   CDS             362825..368410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="Shows homology to DNA helicase but no HMM support"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31505"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR024385"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL36"
FT                   /protein_id="ABW31505.1"
FT                   /translation="MSTAVWVGSNAIVQKLGTYVKREDFKALSRGFLPEALKSVAGGAV
FT                   QRIRGKKPNEEDKERHAHDVVLSAPKSVSMALHLEGDNRIFDAHMEAVLETFELLEREY
FT                   AQTRIQVNGVRSVVDTGNMIAALMPHHTSRDGDMQLHTHMLIMNGTQGPDGRWRSLSHE
FT                   KLAQAKWIGSFYRQKLAEKVQRLGYRIYQTKDAFELVGYDRSDVEVFSKRHRAIVKAVR
FT                   DEGLEVTPENKKLKVLPTRKAKRGVGKKLEIIQDHWREEARSQGVGHPVLAEPLAVLPD
FT                   PGRARYEVESAIRHYAEWSSIFEKDDIYAYVFKTLKRQGMAMEQVDEAIKQSKELIPVD
FT                   RGFTTVTAVEEEAQIHQRWMAGQGQAQPMVAHPSLAGISVKLNEDQAKTILNTLTSTDH
FT                   YQIWQGFPGVGKSRTLGVLKTLLNGSGFTIRGFSPTIPAAKKLQDELGITTNTVEHLVL
FT                   HQVDDSPNQVWLIDEAGMMSRRQMKVILEKAEAVKAQVIFVGDAGQNSSIEAGNPFKFM
FT                   QANGATTHRIEEIIRQKVDVQKQAVELIARGRGIAALELLDANGYVIESGCKAEMAQAA
FT                   ADQYLALPLKEQEETLIIAGTNEERLDTEQAIRRGEKQAGRLGESSKIVQLKSRNLSIE
FT                   QKRRVDWYRKGDYVRLLQTSHTASIKRGELYKVEKREGDELVVSSFGGRLYRFKPAKYK
FT                   LKEVYSAHKFDVAVGDKLRWTTTIKENNWINGQQLTVTALDGLNMKVRDHEGRSHDVPL
FT                   TQPLALEYDRVWTSYRSQSGSKKRTIVITTNDRTSSREPFLVDISRQEHELTVYTESLN
FT                   KLRNRVAKSNAQKSALDLIEGTYGNQRTTTADHQRASSPVSPTHGRDHHLDQSSRRGPS
FT                   PEPTHPRREQRTQVPSQGADQHHSNGSQSRSQPVHPGIQGGDGIQETLGYERVDQGTRQ
FT                   GNGQLKVENRGYQRLAVDDERQGIGGRRGDHADQGQAPPTRTTQDGRSTEWGATSSDIA
FT                   NWVMHWSEENELAASGLEDHLLALDKDIESLTQSLEPYSFEGLEELAEIVENADKQQDL
FT                   SQNLTYIAQTIDNFNQIITQSLDSRPFIGLEELAEIVENADKQQELSQNLSYISRSIDN
FT                   FDYTIEQFLSQQRIKTIADAVAEWRTGQELANAVTEMVDVLTQGTEGLDRAIIRLQAGI
FT                   ETTQSLDVQFPAMVELVDAVQDWQTEVEVSAVIGEVQELVESITVPQFPGMNDLAQDVH
FT                   DLNEEQALAESGLVEQLAELTTQINTLVEPQQAQFEGMAQLAEVVTELQQGQSLAQVQP
FT                   QLQAITQQIEAFNAKQPTYSFAKIKELADTVSEWRAHESITQHIGALNDLTVRAQRSLK
FT                   TFPAMLQLAKSVKAMRSVDALMNGPVADQIKEVAQQLTDKGMSITPKPKTIDDQVFWKP
FT                   DYTGVERPDHIDEKHWNEWVASCAHPDVIAARLQSIADDQVIDRLLGAKIEDIATRRRD
FT                   GSFKTVRSQYHIEPIRALINDRSHPEVLSYQELAEGGGWWADAGVDPLSFEELGPNEEP
FT                   TLSLYGTFKPDTPRIDVDKTRRARAKDSNAPTKYRKYENPLGTKRELFERDMAFQPVPN
FT                   HIAERIFDKYGVVQTDEERTKGFWYTVYKHPEIPIYRTEGDKKDAALVSQGRVVIGGQG
FT                   VNIGYRAKNQHDEKLERRVLHPHLDVFAVPGREFRYAHDWDSEQSTVWNVRREMVREAE
FT                   LIEERDCKTWRIPWDSEQGKGVDDLIANHGPIAFERADKNAYPMEREITMHYRGQYTQI
FT                   KKRLNRHFGCAVHDIPIYLEAMKDGDEMDGIRVLWESSTARSFQHYHDKQHYIEGIIKL
FT                   SDAYRRLVRKDGDPKAMQILVNRLKRPRPIIKVEARSRNIKRGYGR"
FT   gene            complement(368407..368628)
FT                   /locus_tag="AM1_A0386"
FT   CDS             complement(368407..368628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31504"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL37"
FT                   /protein_id="ABW31504.1"
FT                   /translation="MSDMYNDPIGNSFNDPWSQRLPGDPKPQQRSRVEIEDRSGMRLTE
FT                   IIPGPPPMPGSDWISSSGGTVINSRRVD"
FT   gene            complement(368690..370885)
FT                   /locus_tag="AM1_A0388"
FT   CDS             complement(368690..370885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31506"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL38"
FT                   /protein_id="ABW31506.1"
FT                   /translation="MEKLESQNFISAKYRELREEEQLFFQAAPTMRVAKKLIQFAALPP
FT                   AAAVAATHAPIVGPAVAGVVGQATHLMHSGIHGVAADQIAKNFAEIAGQIQPGWGRQSA
FT                   FNAWANVRTADMLAKTDAWARPLSGFAAPTMIGKGIVDTSKLAISYARQGIPTVVARPV
FT                   VHMWRMTNHYINRAKDWFEETLSKLPEQVQQNVRSAMETVQRRQATMAEAQNQASIPTE
FT                   RDMERRDEYVKILSEQQNDPNLTYERIQETLQNQPDLGADYDKQVFYQALKAGKGPDEA
FT                   TAIISQGPNVSQMADAKLQDTSVYLAETAKSVEAQYKLDNPTPEVNQELTQEPEAQTVL
FT                   EVNASVVNPSVELSTDAQQQYSQLLGEFEKNPDLTWEDIQSRLGENPTLLSELDQKVVA
FT                   QAAVNGVDLEDVQKLVTTEANFDAFEQGAEVQTESTSQDQYAELLSKALDEELTYADTQ
FT                   EYISEDPQLQEYYDELVVMQGQDEGMSEEEAKAVVRNSSDPERAEPSQAPEAEAPKAKA
FT                   SESEDLDPLRMLNEDIVEKLSRNIEIGNMRVFLNQKEIFRLNDDGIIDHNRSSVNLEQS
FT                   RMIREALRNPEKFKGTLTIKVGTRTILRIQNGIAIPDRYGLSGKDIKAEADIPKDAQQQ
FT                   SETKGQKTEAEAPKPNDKEQPTEPENQQVASSQSKHPTAEVQDEFAGFTQEQKDTIHRR
FT                   REKGLDSSKLIAKIKKNLARPPVEKKEQPKREVSMSR"
FT   gene            complement(370938..371294)
FT                   /locus_tag="AM1_A0389"
FT   CDS             complement(370938..371294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31507"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL39"
FT                   /protein_id="ABW31507.1"
FT                   /translation="MSSEEQQFREALQIGQQAVNATNSVIINAVALRKPRVAVKIETAE
FT                   QAMELAKKEIRNNTPTDVIKTKLRMSDYAEKVQDPTKMAERYVKSAQLKVAVETHGHKL
FT                   TQNRNRGQNRGFGR"
FT   gene            complement(371291..373018)
FT                   /locus_tag="AM1_A0390"
FT   CDS             complement(371291..373018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31508"
FT                   /db_xref="GOA:A8ZL40"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL40"
FT                   /protein_id="ABW31508.1"
FT                   /translation="MSQHTEQPPQPQSEGVDLSPLFSGPLPWLTGLLALIVIALWWFED
FT                   ETRREPDDARWATRREQHRAKMLGLKQIRDRKRDEIALRLGSDDPLILPDLQPLVTIVG
FT                   GSGKGKTATVIELALADAIRQEHTLIVFDVKGTLKKKFIPFALKQPDPYECYCFAPGKR
FT                   YSHGFDYLKFMQDADDSLRARSIASTLSDNVIVNLSGKHPFFDNHAEYFLQALLMMAKR
FT                   ADYSDLPMVWALMGLPGIAERIQMADQEGAFKVDSDLGMWVRQQLVGLMSVTGTQDTAG
FT                   GILASGINYLLPMVNRQTIPCLSIDGREPTQSTIPLDLPGKQIIFFELDGQAKKATAPL
FT                   VAVAIHLLIQRNLNEDTERDRPFGVFLDEFARLMLPSFEEVVSLDRSYGFYSFVSMQSY
FT                   SQPKIKYQSETSESIFDNTSTQFIFKSGSYKVREDLSADLGEYTKHYHSKSRSYGKMGN
FT                   SRSRNEQEKKKRLITASDIKRLKKGEFICTNPGMDDRPIRMRFNLKKRNGTDMQRFTEC
FT                   ERMYNSHVHKQMVRIAQERVLDSPEQIMSDRMVSADALLPSTQEVESHKLKQQEEKAA"
FT   gene            complement(373192..373521)
FT                   /locus_tag="AM1_A0391"
FT   CDS             complement(373192..373521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_A0391"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_A0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABW31509"
FT                   /db_xref="GOA:A8ZL41"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZL41"
FT                   /protein_id="ABW31509.1"
FT                   /translation="MKQVEALKAISALSQETRLDIIRYLVQCGEAGAAAGEIGKAVEVT
FT                   SSRMSFHLSKLENAGLVSSERQSRHIVYKADFACLGGLISFLLNDCCDNHPDIASCCLP
FT                   GKNCC"
XX
SQ   Sequence 374161 BP; 98428 A; 88496 C; 88663 G; 98574 T; 0 other;
     ttattgtcca caggcatcgc ggaaaaatct gtcccagaag attttgaaga acggtttacg        60
     gccttttacc ttgctgaatc aacctgtctt ggtcaacttg ctaaatctaa aaacggtgag       120
     gcttgctgcg gaactgctga gtgtaccgtt gatgacctgg gttgctgtgc ataggatttt       180
     agaaccagag atgcaagctt tagtcaaagg tagttccgat catctcggtg aagtaagcaa       240
     gtgctcatca acccagaaga caagcaggtg gagatttata gaccagggca agatgttgaa       300
     ttgctgcaat ctcctagtac gatttctgga gcggatgtgc tgccagagtt tagcctcaat       360
     ctggaatgga tttggaggta gcttgtattg aaggaggcag gattttcgga aaattcgcga       420
     tcgcgtgaag gccaacccaa actggcgaaa gatgctgcga tcgcgaagcc gtaccttgtc       480
     gcaatgacag cagaactcca aataatggct acggagactt tgtagcctgt gctcagatca       540
     agtcttccca acggtctacg gcttcttcct ccatggcagc aataaaatca gccacgttcg       600
     atccataaat cccccagctg ttgaccccgc caatttccac aagcttaggt tcgccagcat       660
     gtatcccaat gtcaacagtc agcatgttca taccagttac gtccaaggct tgtgcaacac       720
     tctctgcaac ggatcttatc tcctgaggca cttcagagta tggctcgtct ggatacgagc       780
     tgccgcagaa aaatattccg ttccggcaaa agcaacggta ttcagcctca aatgaaacca       840
     cttcagagac cacagctagc tcattttgat gatgtgagaa agtctttacc caatgtgaaa       900
     gctcttgggt ttttaagacc tccgctggga aaagcttgta attggtatcg gaacggacaa       960
     aaatattatc tccgaacatc ctttgaaggg gtaaattggg tagtgctcca aatggtgcaa      1020
     ataggaaagc acgtcctaaa aaaggataga tgtaagaata gtatttagag caccttagac      1080
     tcgaataatc gtcaaaaata gctgtactga gtggtggatg cctgagcaag cgggtcatag      1140
     caaacatcgt cccgtagccc acaatccaat cttcagtatc tggccatcta cctaacatta      1200
     catcgtcccg atcgatgacg atgggctcta ttttcttatg ttgtcttaaa tatcctgcaa      1260
     ctatctccga tgctgggaac tctgggtgca agtctatcag ccagcgcaaa gtcttcatga      1320
     cgcaaaattc caagagaagc caagttgatt tctatgcaaa gatgactttt gatcatcgag      1380
     cagcaaaaat ttgattaatc cacatgaggc tgtcacatcc atacggcata gcttaactac      1440
     gggattttag agaggcaaag cctaacgcct cgcgtcaaca gtgcggcttt aacacgtcca      1500
     gctgcgtgcg catgttaggt ggcgtcaact ctttgcttaa tggtctggta tgtgtccaca      1560
     ttggtgttaa tcttcgaccc ttgaaaaaca ataacctctc tggcgccagc acccaatgct      1620
     agctctctta acactctctc ctcaatttcc gtaagcccac cttcattctt ctccagttga      1680
     tgaattatta ctctaggaga agttatgagc cgatttctca gaagtttccg gatcaaatat      1740
     tgcagtattt tttcagcata tgtgaagttt gcgacgaaag agcgggaatg atcaaaggga      1800
     tttatgagtt gcagcccagg cttactcatg ttttgacatt cagcgccaac accctcaacc      1860
     gtcaatttat ttttttctcc gcttacggcg attaatggtt tgtcttttac agtggcccca      1920
     cttgaaaacg aggtgatgct tacttcagat ttggtaagtt caatgaggag atcttctgaa      1980
     aaaatgccca ttagtctttg aaccaagttc actgagtcac ctaaatatgg ttatacgact      2040
     acgaggataa aagtgcattg tttctgacaa ccctaccggt tatacgagtg gctccatgcc      2100
     ttgagcttga ttagccgatt gttagacaca atactcttca agctttaatg cctttgggaa      2160
     agtgaccaaa taggagccta gcgataatgt ctcatcgcag tcatttaatt ctggaatgta      2220
     cacctgcact cccgtcctcg caacgtattc atagttggca acttcttcag taactcctga      2280
     gtcggttgga ttcctagatc cagagcacat ttcgggcata gccatttgaa atttgtctga      2340
     atggaattgc ccgtgggaaa ggctgcgatc gcaaccctga attcacgaca tttacaacag      2400
     tgattcaagt gaggcgtttt cagcagatag acccctgcct tcttctgcac atccaaatct      2460
     ccaagcttga tccgggtcgg tcttctaact tcggttggca tggtaaattc tccattgaga      2520
     aatggaagca atagctactt caattgaggg cgattccctt aaccaggagt cgcccgttta      2580
     ctgaatcttt ttgctcagca gcaaaagatt gataaacttc aaacggatta tttcgtggtc      2640
     gtggtaaatt ctgaggcgat tgtgattggc aatctcacta ggggcggcac actacactcc      2700
     acgtcgccct ttccccatcc ccaacttccc accagtcatt catctcaaat tccaaacttc      2760
     ttctgagcag caatgaacaa ggtgctggca gcacacttga tggtctcctc acttgcatcg      2820
     tgcttcccta gctccctgga cgcctcttga taacaaaatg aatagagggc cgctcggtta      2880
     gaaatatagc tagcaatcac actcttggta tccccatcca acgccccatc atccaggggc      2940
     gcatccccaa ccactggggc ctgacctggt gccgaggctt gctcgaccag gctgtacttg      3000
     cctttgccat ctttggcaat ctggatggtt tggcctctac ggagagcgag caaagctaca      3060
     tcgccaggtg gtccccataa cttagcctct tcaccattcg ctaccttgat tttggcgttg      3120
     aggcgtgggc catactgagt atcaaattct ttagccggga ataggaattg ggcagtgagt      3180
     acctgggtca tggttctgct ccttcagtgc atccattatg ggtaggtttg gagaagtaga      3240
     aacgggcata cgatttttct cctgtagata cgcgaaaccc ccgacacatg cgccaggggt      3300
     gcttttgaga tgagttttag gcgagagatg gagaaaatat caatcatagg tgttcgctat      3360
     tttcttccac atcacttgat agcgagcagt tccactctcg tcttcagtag ctagatatcc      3420
     tttctcagta tcaacaatct ccaagctacg aacggtcaga tatcgttggt cttttttgga      3480
     gtgtatgtct accgtgttca agtccaactc caattcatga gggtggaagt gaagaagaat      3540
     tgcatccgat ttgaccagct tgcaagcaat cgggatttca atcatttgct ctggggcaaa      3600
     ttcctcatca accaaagtta gttctaggac atcaccaacc ttgagctgga tggagagtac      3660
     ttctaagatt tgaacatcca tgcaaaacgc tcctgaaatg cttgatgtat cgctgactct      3720
     gcatcacaac ttacaccaat acaccaacct aagccctata gcagcaacat actctctgat      3780
     gaccgttcca agactctcgc cattatcagc catctggaaa tcaatcactt ggaacgtgcg      3840
     accattccaa acttcgattt gggcaacata aatattcatc ggggaacctc cgggaatctt      3900
     gaagaaagcc ccttggtggg ggataccaag gggctgtgcg gtttgagagg agaaagcgga      3960
     acgagaagaa ttaaaagaga acgtttggtg gagggggact gctaggggag aggatccatt      4020
     tgaacaagct gaaacagccc gacaacaaaa gccaaagcag tgaatgtaat cggtttgtta      4080
     tgcaacttca tggctttgca aatattgccc cgtgaccgct ggtgggacta ctttcatttt      4140
     gtgaggaata gaataatacc gatgggtttg ctgagtagta tctcgctcct gcaagctctc      4200
     attggcaatt ttcttccgta gtttagtaat ggcatccaac actgcctctg cacggggtgg      4260
     acatcccgga atgtagacat caaccggaat cagcttatca acccctctca cagcactggg      4320
     agaatccgcg ctgaacatgc ccccagtaat cgtgcaggct cccattgcca tgacatattt      4380
     gggttcaggc atttgttcat agagcctcac caatgcagga gcatatttca tggtgatagt      4440
     gcctgcagta atgagtaaat cagcttgacg aggagtagca cgaggaatca taccaaaacg      4500
     ctccatatcg aagcgagaag cgtaggcccc cataaactcc atgaaacaac acgcagttcc      4560
     aaacataaag gggtagaggc tagacatttt cacccagtca tacagatcat ctaaagccgt      4620
     caatataacg ttgtccgata gttcctgagt gacctctagc ggtgttatgg ggttgatgat      4680
     attggcttct agactttgtg gtttcatagt taataccacc tgttcaaaaa gattctaaat      4740
     ttgcaaggta gttctgttga aatgagctat ttatacgcaa tatttttgtt gcagcatcta      4800
     tcattcaaga ctagaaatag taaatttcag ccttgactta acagaaccaa atcctccaag      4860
     aaaaagcttg attgaataga ggattttttg agagacaata ctatttttga gaacacttat      4920
     ccttgagcca aaccctattc aagcctcaca aatagatttc agaggtttgt taggctttta      4980
     cgcaagtggg caactagttt tgttctttat tggaattaaa aaatacatag caaagcaccc      5040
     cagcccggaa gccagagtga agcgggaggg gcgttagtac tcgctggagt gcattagggt      5100
     tagaaccctg gttgtcttgg ttaagtcgct tggatctacc gagccgtgaa taaggttcgg      5160
     agcaaagtaa tcaattttcc agttgaagac ttcgccttta aatttgatgc acccaaaatt      5220
     gtgctcacca tacgggtcat tgctgggatt gaaatcatcg aacgtgcgga ccagtcggaa      5280
     gagttcctgc tgatcttcgg aggaaagggc gtcaacccca tgggtcgtaa agattcgacc      5340
     tagagaatga ttaccttggc gaaattcatc attgagttca gcaatggttg atgcgtgggt      5400
     tgcttcgata gttgccatga tgttgagtcc tctgaaatca cttgaaacga aacaggggca      5460
     gggtgcccct gtggtggacg gtctaaaact cgtcttcgta ctgagattca gcccgaagtt      5520
     gccggggtga ggggatagtt tcccagtctg caagtcgggc agacacgccg aattgcttca      5580
     agacccaatc tcggagccga tcaccaactg aaccaacacg gttcttgatg atgatgtaat      5640
     actcttccaa ggctccccct tcccggacac caggccaaaa ctcgacctgg gcgtacagca      5700
     aggaatattc agggtgaagt ggatcggtaa ctcgttcgtc gatccactgc tccatttgcg      5760
     ttagagtagt gttcatctgt attacctctg gtaattggtt tacagaaaga gccgctggtg      5820
     ttcctgctaa gaaaagcagc ggctctgttt aatggactgt ctttgaaatc gtttcagttt      5880
     taagccttga tgggcatcgg gctatccccg gtggctgcgg tattagcagt ttgaccagca      5940
     ctcagcagaa ctcacttatt tagttagctt gcaaccctgg atttttgttt actggagagg      6000
     ccgtttgctt tcctcatcca tgtatttata ttcgcataat acagtaatac tgtcaatata      6060
     gaatgttgtg atttgcgtat tcgcaattta aagccataat ggcggtatgc gaatattagg      6120
     aaatgactat gttgaatcgc ataaaagagt tactagataa caggccagac cccgttagcg      6180
     gcactgacaa aaccacacct tatcggtttt ggcaagatac aggagtcggt agggatactg      6240
     cctaccgaat gtataacgac cccacttaca tccctactag tagtgcccta aacaaaattt      6300
     gtgaggcgta taaaattcaa ccaggcgatt tcctagcatg ggagccggac agtctttcac      6360
     aagacagtgc tgctcaaaca gaatcacctg aaattccaag tagtcaggca aaaaagtcag      6420
     ataaacagaa tcaacagaaa aatagtggcc gaaattcttt gctgaaaatt ttacccacaa      6480
     tacctaaaac agcttaagca atgcaaactc attcgatctg ttaacttcca gaatcattgc      6540
     tttatcttcc aaacagttga cctgatcagc aatcacagcc tttactagaa caaaccattt      6600
     tgggtgattg tgcccaaaat ctatacataa ttggcagagt caaaccactg ccaggctata      6660
     aggaggtgag aagaatgtaa acacattaaa cgcaaaaaac cccgactggt cgaagagtca      6720
     gggctttaag cgtccaagca cttccaatat ttcaggggac ttgaaccaaa tgctatttgt      6780
     ctcagcatga gtttgggcct ccaatggagc cttgcgtcta tcctaagcga tacatatgca      6840
     gtggtcaaga ttgttatggg cattttttgg ccaaatggct ccctactcac tacatttagg      6900
     ggccacggcc atgacctact ccaaaacctt aactcccacc tgcagaggca acccctgcga      6960
     cctctgcggg gatatcacag gcaaatgcag aaaggccgac aacctcaatc tctgcatgac      7020
     cctctcaggc cagattgagg gatatcgcta cctgggccaa tccaaagatg gcctctgggg      7080
     taagtacgtc ctcgatgacg ggcaagacct cagccaggaa gaaagggagc gtcgatggca      7140
     agagcagcgc attcttcggg aacaacgtgc ccaagcagaa gctcaacacc atgcccaatc      7200
     cctccccgca acagaacgag accagcatta tcgccaactt cttgaccagc tcacccttca      7260
     cccagcggat cgagctgact tgcatcgtcg gggattgacc gatgaacaga tcaaagcctg      7320
     gggggtgaag tcagttgagc aatggcaatc gctctctggt gaactacctc ataccttgtc      7380
     tggaattggc ttagatggtc aatccttaat tacccctaga ccaggctatc tctgccccat      7440
     tgttgatgca gatgacctta tcgtcggttt ccaagtcaga gcacgaaccg ctgagggcgg      7500
     tcgctattac tggctcacag gtaaaaccaa gaaacgaccc cacggaccca cccctcacct      7560
     tcccaatggt gaattacccc tatccgtcca tcgtcccgaa caaaccacga gagacgctat      7620
     cgcactcgtt gagggaacgg gggcaaagcc tcacctcctt gctcaccgat tgggccaaat      7680
     caccattggg gctgcgggtg gactattcgc tgcatcccct gaaacgctga aagcatcact      7740
     cgctcagctt gggacaaact cgattgagtt ctatcccgat acgggggcca ttcagaacaa      7800
     atctgttctg cggcaatatc gggcaacctg gaaactattg aaagactggg gatacactat      7860
     caccgttgcc tggtggaagc agacggataa gcgcatccac gctgacattg atgaactgga      7920
     agacctgagc cagattcagt atttgtccgt ggctgagttt gaacggattg cagctcaatg      7980
     caatggacta ttgcataagc ttcagcaggt actctctaaa atcactcgtc cctcctcacc      8040
     cgctcaaggg tttgcacctc ccaatgaaca acaaacccag atccctaacc ctcgcggaac      8100
     gaagcgaact tcgtcagatg acgagtgtct tgcaacgcag cctacaacaa gccgccgagc      8160
     aaaaagagcc cgtcgccgca ctgcacgact ccttgcagct catcgaagac atggatatat      8220
     ttcaaaactt cgactggaaa attatcgaag acgcattaga agacatactt caagagcgac      8280
     acacgccaga ggtagcagcc tacaaagccg ctctggagat aacaggactc tcgacccaac      8340
     aacgccatta gtccaagaat accaaccagg acaacgactc caaacttggg aaacccttat      8400
     ctcatcagga ttcccctata tcctcgacca gtcccaaccg ggaacaggta aaagctacga      8460
     ctctgggaac gttaccccga ttggctttgg gatggagcag gttatttacc tctccgacca      8520
     acaccgcaat cccaccgtat ctactctaga ccgtggcaat tattggatgt caaccccata      8580
     ggcgatgtcg cgacaaccac aaggcggatc aacccccaaa tttgaaccgt attatttggc      8640
     gtacactccc tttgcgttag ctctttttca gacctcatac gataccttca gaacaaaacg      8700
     acaacccgtg atcgaaatga caaccagtga tcgctcgatt atttggactg ggatttttga      8760
     ggtggagact gagtttgagc cgttctctga gtcgctgatt tgcgccgata actatcggct      8820
     tgaatttcga taatcaagcc atgatgaatt aagcgatcaa tggcagccac cgccatcatc      8880
     gaatcagtga aaatgtcatc ccattggctg aagggttgat tcgctgtaat caacaaactt      8940
     tttcgttcat agcgatgcgc aattaattca aacagaacgg acgtttccgc ttccgacttt      9000
     ttgcaatagc ccaagtcatc caagatcaac agatcatagc ggtccagttt tttgagcatt      9060
     ggatgcagct gcagttggag cttcgcctgt tgcagttgct ggaccaatgc gttggctgca      9120
     aagaacttca cccgcttacc gaattccagc atctttttgg acaccccagt ggccagatgt      9180
     gtttttccaa cacccgaggg ccccagaata aggcaattct cggcgcgctc caaccaaccc      9240
     ggatctgcgg ctaattgcat caagggagct ggattgagct ggggacaatg gctaaagtca      9300
     aagttggtaa aactttttgc gtttgggagc ctggcttcgg tgagggcacg ttttagacga      9360
     gcttgttctc ttcgttgggc ctccgtttcg cacaaggcta gtaagaattc cgcataagac      9420
     cagttttcct gcatggcttg ggattcgata gattcccaat gggtcaacat gtgggagagc      9480
     ctgagctttt ttaaatagag gctcaggtgc tggtaggggc tcagcgggga ctgagcagga      9540
     ggggaggagt ttgtcataaa gttcaagtga atgttgttca atgctgaggt caggaacctg      9600
     cttcatctga ggcggctcaa actgtttttt caggcgattg agggtaaggc tggatgagcg      9660
     aagctgctgc tgtaagtaca ctgctacggc ctgttcttta tcttgaaccg cagcaatata      9720
     cagggcttcc acgatgatct tggcagcctg ctccaggtca aattgggctt tgagctgttc      9780
     ccagatttgg cggtattcag gattgggaag taggtctgat tgccaggtgc aatagataaa      9840
     agcacgaggc ttcaatcgca ttgaaccaat aacatggcga tagttgatgc aacggtcgcg      9900
     acgtttgcct ttgccactga cgcgcttcct cggcaattcc accaccgggt gtcgctccag      9960
     atagccgaca atccggtcat ggtatagatg cagttccaat tgacgaccaa tcagtcgaga     10020
     agggacggtg tatagaatgc agcgaacatc gatggtgctg cgtttgctga ctttagccgt     10080
     gagcacttca tagtcagggg ttcgatattt gggcagtggt tgtagatggt ctttctcttg     10140
     ctcatacttg gtttggcact gctgattcaa cttggcaacc tgtgcatcaa ttaaggcttg     10200
     atactcagca acgctcgtaa aatctgcact gccgcgcaga tagatcgcct gcttaattcg     10260
     gttcttcaga tgaccatggg gagattcaat ggagccattc tcatgggcta cacctttgtt     10320
     gttacgagtg ggttctagcc gatagtggtc acacagttcg tcgtacagac gagtgaggtt     10380
     tttggaccgg cggccgccca tgttgcgata ggctgcactc aaactatcag tacgatgctg     10440
     tgtaggaaca cctccacagg ctgcaaaggc attttgcaat ccttctgaga gggcgacaaa     10500
     gctttcgcct ccttcgatga tctgggcata tcgccagccg ctgtatccca gacggtaatg     10560
     gtatatcagg tgctcaaagg gtttgccggc aatggtaatc gtgatgccct tgagttctgt     10620
     aaagtcggaa aacccttgta ccccgggttc atgacgcaat tcaaacatca cttcagggct     10680
     tggtccatgt aaggctttcc acgttctcac ccgacgttgt agggtccgca ggacttgggg     10740
     atactggcct ggatacttat cctgcaggta ctcatacagg gtcatgggtt tgaggcgtgg     10800
     gtctcgacgc agcattggtt ctagctcgtc ttcccacaca tcagctaagg ggtcgggaac     10860
     ggtgcgttgg tcctgaaggc ggccgcgatt aggttgatgg gtgccggcct caattcgttg     10920
     tccggttctt gtagatattt cggcaatgta agctgcttca gcttgtttca agccgaggtc     10980
     tcttccgttc atataaacac gagtatgata ggaatcaatt cttttgttag gcacttgtac     11040
     agccctctat tgattaggga tgtaaaaagt gtcttttttc ttgagattga attctagaaa     11100
     cgcgatctca cacatcattt ctagggaatt gagatctagt tttatccttc tcaggggatg     11160
     cctggtttct tcatagctat agccgacgtg acatcgtcat taatccgtca gctcgattgt     11220
     cgtctaatag gcaatggttg gtccgacttg gaagcaagac acggtggact taatcgggtc     11280
     aagaatcggc ttcaacgatc tgccaaaagg gatgcctacg ttgttcccgc gaactgtagc     11340
     cgcattggag tcttgaatgc cttacgggac aagaatatcc ctggtgctga taccgccaat     11400
     cttatctgtg gcacctgcat tgccagagaa gcctgtatca atgcagatgg gccagggtat     11460
     gggttcttga atcagcggcg caatgtccta ggtgccccac tgttgagggc acatcctgac     11520
     tcactgcccg acccagagga ttacccactg gaaaacacga tgctgatctg ggatgaaccc     11580
     ggtcagaact tccaggtcaa gcagtccgtg actgttacct ttagcgactt gcagcaaacc     11640
     atcacaaccc tgattatcta tccagaaatc tttgccctag tgcaaccgtt gctctcagcc     11700
     ctcctcccct tgatggatgg gtctataaag ctagggaaat atggcttaaa tcatctagcc     11760
     ctcaaaagcc gtttgcccga tatggcagga gtgaaactcg gagaaatcgc cctaatcctg     11820
     atgcccaacc tgggattcct caatacctct tccgactatg ggattgacct tgcagactta     11880
     cccaagcaac tcagaaagaa gttctctgaa cgggactcgg agatggcaga gcaggccagg     11940
     aatggggtgg ttaaacagtg gctcattccc ctgatccgaa tcctgcaagg aggagcagga     12000
     tgtatccaag tcagtcgcta tggcctcctg acccttaata cccccaatcc tcgacatcga     12060
     gacttagccc aagctgctca agccaatgta tttctcgatg ccaccctctc ccgtgaagac     12120
     ttagcactca agctgggttg ctctcctgat gaaatcttag tagttcgtca agccgtccca     12180
     gacaccggaa atctggaggt gattcaggtg gccgacatgg ggcgcgtggg catgagtcga     12240
     ggtggggatc agaccaagcg cattgatgca ctagtccagc attaccaaga tttggatgca     12300
     gtgaatacta ggactatcga ttttaagcag tttgaaaagg atggggcctg gtggcgtgat     12360
     agccgagggg tgaatgattt cctcaccgtt cagaccctag tactggtagg cactccctgt     12420
     cgtaacctca atgacttagc tgctgagttt gccatcacga gcggatacta cccagaggaa     12480
     gaagatccag cgttcaaagc tttcgtggac cgatcgatac tagctgagat tcaccaagcg     12540
     attggacgac tcagagcaca tcgacgccct ggagaatccc tgcaagtggt gttgatttcc     12600
     aatatcgata tggacattcc ggtgcagcag atccaagcca aggatctgac gattgaagcc     12660
     gcccacaaaa cggagcgggt aagacttgcg attgaatcag ccatcctcca gctccaagcc     12720
     aaaggcgaga aggtcactca gcagatcgtc tcagcgatga ccaaaatccc cagagggacg     12780
     attgcgcgat actggcgtct gttcatttcg cttttagata gttttaatag caaagtgaac     12840
     aattccaaga atgtgtcaga ggcagaccaa gactgccatc aagcgattgc gggtgttcta     12900
     gatgagctgg cggatctgcc tatagatgac ctactaccca gcctcaatga agtgttcttt     12960
     gactggctca aacccagaga atgggccaac gtctgggaca aggtgagcat atcgtgccag     13020
     atggcgattc tagagggggt ggcgatgatg ttaccagtga agctgctgga ggaaacgttg     13080
     ccagaaaaac ccaatcaaac agttcagttg agccaacatg tctaaaaaaa gcttgttaaa     13140
     gatcaaaaga gatcttgcat acgttgtaga actctttgct tataattctc tagtgttgcg     13200
     aaagggtcag attaagagaa tgtagagaac atatactaac ttacaaaaac ttgcgatgat     13260
     aacctgtcca taatcataag cagtattacc actagtttac ttaattagtg atagaaacac     13320
     tcaagctttg tttttcaact cagtgtataa actgtattaa cctaaatatg ttcagaaata     13380
     aaccagtgaa accatctgtg cttgatatct tctgtggagc aggtggtatg agccttggtt     13440
     ttcagaaagc tggctgcaag atactgggtg gaatagataa caacccacat gctgtaaaaa     13500
     ctcaccatca gaatttccct aaatgcaagt tgaaacttga tgctactgac attcgtgaca     13560
     tagaaaatct tgaagatctt ggtatagatc ctaaagaagt agacattcta attggtggac     13620
     caccatgtca agtcttttcc agagttggca ttggaaaaat gaaaaatcat ttaaagcgaa     13680
     atattgaaca agatccaaga aattttttat acaaggaata tatccgattt cttcgttatt     13740
     ataagcctct attttttata atagaaaacg ttgataatct tgcaaataaa aaagatatat     13800
     tagaaacaat tataaaagaa ttagaagctt gtggatatcg agttgaatac aacgttttag     13860
     atgcatcaga ttttggagtt cctcagcgaa gacttaggat ttttatcatc gggtcacgcc     13920
     tagatctagg atggaaacca atttttccaa aatcaaaaac taaaatacca cttactgtcg     13980
     gggaagccat cagtgactta cttgaacttc aacctactgc tatgccttta aaactcaaat     14040
     ctagtgggcc taaacagaaa gattgtgaac taccatatcg tagtgcgcct gaatcagggt     14100
     atcaacgtat catgcgacga tataacggtg atcttgtaag aaaccatata tgccgtgctc     14160
     ataactatga agatctaaaa atatttgaca tgctgaaaca aggacaaaaa tatggtgatt     14220
     tacctcagga ggtaatgcgt tatcgggtcg atatttttaa ggataagtac aaacgtctta     14280
     tctgggatga tctatcttgg acactaactg ctcatatgcg taaagattgc ttagcctaca     14340
     ttcaccctac tcaaatacga agtatttcag tcagagaggc tggtaggatt cagagttttc     14400
     ctgataactt tatattctat gcgccaatga caagaatgtt tgagcttgtg ggcaactcag     14460
     tcccccctct tctggctgag tctgtagcga aacctatagt aaaaaagatt cgtgaatatt     14520
     ataatgtact aagcttaaaa gaataattag ctaagaatta taagaataga ttttttagca     14580
     tatatttatc taacgggata tttaaaatat tcatatattt actccaattt taaatcctaa     14640
     taataacatt cttaactgag aatacttcaa aagttatttt tccttagtag aaatatttca     14700
     gcaacgctta tgtctcatag ttctatatca tcagtttcaa cctctttgcc actacgtcct     14760
     agggctcgat tactgagaac aatcggagat gagttaatta gtagcgaaat agttgctgta     14820
     attgaattag taaaaaatgc ttatgatgcc gacgctacta ttgttttagt taaatttatt     14880
     gaacctcttg agactggtaa aggatcaatt gaaattatcg acaatggtaa tggtatgtca     14940
     ctcaagatca ttgaaaaatc ttggatggaa ccagcaactt tttcaaagaa aaatactaaa     15000
     tttagtaaga tttatcgtcg tcgattttta ggagaaaaag gtgttgggag atttgcaaca     15060
     tcaaaattat ctgacttttt agaaatcgtt acgaggtata tagagtcaga taatgaaata     15120
     cgagcaattt ttgattggaa gcaatttgat gatgaagaaa aatatttaga tcaagtagaa     15180
     gttttatggg atatgactag ccctgatgaa atttgttctg agggttcaat tatgatgttg     15240
     tatgactcat gtgagattag aggttcggat ggaatcacgc atggaactat tctacgaatg     15300
     tcagatctta gagctaattg ggacagggac cagcttctac ttcttcgaac tgccttatcc     15360
     cgattaattt ctccattcag tgatgcgaaa gactttcaag tcattttaga tctgccaaaa     15420
     caatatgaaa atctttctgg taaagtagag actcctagag tatttgaaaa gcctccatac     15480
     cgtattaatg gaaaggtaga ttctgaagga aatgccaatc ttattctgaa tgttatgggt     15540
     aaagatcccc aacatatttc agaagtttta gggaaggata aaaatatacc tcaatgtgga     15600
     ccatttgagg tggatattcg agtgtgggac ttagacagag attcattaaa actattagta     15660
     aaagatcaac aatctacatt aaaagatatt cgtaaagata tcaaggacat agcaggaatt     15720
     aacatttaca gagatcaatt tcgtgtgctt ccatatggag agagagacaa tgactggttg     15780
     agattggaca taaggagagt acaggctcca acacttcgct tatcgaataa tcagatcgtc     15840
     gggtacatac tcatttcttc tgacctaaat cccgaattaa gagatcaaag taaccgggag     15900
     gggatcgtag aaagccaagc attaagagat ttacgattct tagtaagaac tatcctagct     15960
     aaacttgagg ctgaaagata taatactcgt cgacaacaag agcaagaaac tcccatttct     16020
     agccaaggaa gcctctttgg aaattttaat cttgatccgc ttcggacagc tctaaccgaa     16080
     aaatatggta aagagaaaga tctcataggc ataattgata gccaggaaaa acagcttgaa     16140
     gagagagtaa aagtcgtaaa agaggtgtta tctagatatc aacgccttgc ttcacttgga     16200
     caattaatag atactattct tcacgatggt cgagctccat tatataagat tgataatgaa     16260
     gctacattac taattaaaaa tattgagaaa tctgataata ataattcatt atttgataaa     16320
     ttaaaaaaac gaggcgaatc gataaaaaaa tattcttcac tattaggaaa tcttttcaaa     16380
     aaaattgaac cttttggagg acgcaagcga ggtcgtccta aaaaaataat tcttgaagaa     16440
     gttatttcag atgcattcat gctgttagaa agcgatctaa acaaagcaaa cattaaaatt     16500
     catattccaa caactaaaac tacagttttt gtcgagtctt ctgagttaca gcaggtgatt     16560
     atgaatcttg ttgataacag tatatattgg cttaatagtg ttgacgaaga taagagatat     16620
     attaatgtat ctatttcaaa taaggaaaat ccttctgatg gaattgatat tatatactct     16680
     gattctggtc caggtataga agaaaaattt agagaacata tttttgatcc atatttttct     16740
     actaaacctg atggtgtcgg ccttggatta gcaattgctg gggagatttt aacagagttt     16800
     tacgaaggaa gtttagagct gatagagaat acttcttctt ctggagttac attccgtatt     16860
     catctaaata agagagttta gtatgtttga aattactact tggagactac ttattgttga     16920
     tgatgatgag gaaatatgta aacaagttaa agaaatatta gaggacgaag aaattaacaa     16980
     tgttagactt tctattataa ttacaaccga ttttaatgat gcacttgaaa tcttagagaa     17040
     tcaacggatt gatctcatca tccttgatgt tcgcgaaggt tcacatgatg ataatccttc     17100
     agaagaaatt ggaataatta cattaaacaa gataaaagag aagtgttttt tacctataat     17160
     ctttaatacc ggattaccaa atctagttga acacttaaga tctaacctta ttcgtattgt     17220
     tcgaaaagga aaatctgaag agttatggaa tgaaatcaac aatgtattta caagtaacct     17280
     accaattatt aatcgagcat tagtacatca tttcgaagag atacagcgtc aatatatgtg     17340
     ggaattcata gctgataatt ggcaaagtat ttctagagat aatgataatc atgaattagc     17400
     acatttatta gctcgaagaa tttctttatc tttatcagcc gaagaaattt taagttgggt     17460
     ttcacaacta ggatttacaa gtaaggattc aattaaaaaa gaagaggtat ctcaaagcca     17520
     ccctattact tattacttaa tacctcctat ttcgaattat ccacgacctg gtgatttata     17580
     cgttaaagat aaagaggata atcctacata ttgggttatt cttaatccat cttgtgactt     17640
     tattattcgc aagaatggca agtgtaaagt ggagtatatc ttacttgcta acgcaagtaa     17700
     attgtctgat caagaagagt ataaaagctg gtgtttaaat tattcaaaca gtcaaaagaa     17760
     aaaattgatt aaactaattc aggataatag agaaggtcag tcagagcgtt tttatttttt     17820
     acctggtgta tgtgattttc ccgatttaat tgtcgatttc caagttgttg ttagtattaa     17880
     gtatgatgat ttatccaatg gagcttataa tcggcttgct tcactcgata gtcctcatgc     17940
     tgaagcctta cttactagat tctctcggta ctttggcaga gtaggaaaac ctgacttaga     18000
     tgccgaaagt attctatcta aactgcagga ggttatcagc aaggattaag tatttttatt     18060
     atcctaaaca cgctaatcca aaaccttgca cattagtgca aggctttagc tgctacacac     18120
     ctctaaaaat agagatttat aatactaaca gctagaggtt ttcatatcaa atcagatcga     18180
     taagttgacg acgcagctct agattgggac tttcagtccc ttctttaacc tctggacttt     18240
     cagtccagag tggttaagtt taaaattttt ttcatccatc atattctaag cagtcaactt     18300
     acacaactta gaagagctgt ttcaagtttg ccaggggtaa ttcgaaatca ctggaagtcc     18360
     gtaaagagca agggcactat ggagaatcta gttacgcaat attcttggtt ctaaactttc     18420
     tcccagaaaa ttaaacagct ctggactgct tagggttttc tcttttttta ctttgacaat     18480
     ttatatagtc caacagttat ctaatagaaa tgagaaaatc agctgccccg cttcaagcag     18540
     acggggtatg gaatacgatt tgctcccaaa ccgtagattt ggattacaat cccatttctt     18600
     tgctgcaagc agcgggaaat ctaccctcac tagattaaat atttctcatt tttaaatcag     18660
     cttttcagca ccctcactga ctccaaccca gcctgcacaa tctcctcaat ctgcaccatc     18720
     gtcttcagta ggcgcagccc aattacccga tcagcacgaa aaatacctcc aaagatgcaa     18780
     ctacttccag aaactgatca aaaactcaat ccgaccaaac acaggtgcag tatgatttat     18840
     cctgcgggat taggttggga tagctcatca acccagagga taatcaggta aaaatctatc     18900
     ggcctaatca ggttgttgag atgctagaat ctcccagctc ggtttctgga gaagaggtat     18960
     tgccagggtt tagtctcaat ctagagtgga tctggggatg aggttgattc aaacttgctt     19020
     agaacaccag cttaaagttg atgtcaattc tgcttagtac ccattttttt ataaaactca     19080
     cggttgtatt cttttgctgc taattccatc ccctctacaa catcatctgg cacgattcca     19140
     ctaaatgagt cagcatctcc acctggatcc atcatcagaa cttcacaagg atgagtcttt     19200
     aaaatcaccc accagttgga gttggcctgt tctacaccaa tgagatgata gttccactgg     19260
     gaatgaacaa ttttcaaatc cttaataaac tgccgatcat atggaacaaa ctctattgtt     19320
     tgggcacatt cttcaatact ccgatctgaa gtgtttgctt caactgctat agcaactggt     19380
     aaggttaaca aacttactga tagtgatatt aaaagagtcc gcatggcttt tagtacaaga     19440
     aatttgcagg atttagtctt tgaccagaag ggtctcggat ctcaaaatgt aaatgtggtc     19500
     ctgttgttct accgctgtta ccagagaggg caatcacttg gccttgctta acaggatcac     19560
     ctatttgcac atttgtagct gataaatgcc cataaaccgt aacataaccg ctactgtgct     19620
     gaataaacac aaaattgccg taccctccgc cacatctaga ctccaagtga ccctgctgag     19680
     gacaatctac tttaacagca gtgacgacac ctccatctga tgccctaatt tcagatccta     19740
     tcggtgtacc gtaatcaata cctctgtgga atcctaatga tcgcggacca tagggcgaag     19800
     ttataggata ctcagttggt aagtcaaact gtccagtggt tatcccatct ccctgaacaa     19860
     acggccctaa ttgaccatta aggttactcg cgatcgcacc aggcgaaccc ggcaccccag     19920
     ccacctgtga aggcttacag ggcaccccag ccgaagccac cgtagcaggc gcattggtcg     19980
     aagcatctcc agttgaccca tacttctcaa aattggctgg attactccac acctcacttt     20040
     cttcaggtcc accgggcagc gaggtccatt gccaaggact cagcaccctg tctgccaggg     20100
     caaagttccc tcgctgaatc gcaccgatta gatcaacatt cttctcagcc ccaatgattt     20160
     tgatccactc caccgctgct tgagccgcaa ccgcccgatc ccgtgtccag ccatccagcc     20220
     ccgttcgttg cagaagggac tgcctagact ctggtgtaaa ttgataaatt ccataagcac     20280
     ctgtcttagg attgggcctc caattcgtcc catccgtgct ttctccaatt ctgattcggg     20340
     ctagatattg cctcagatta tggtcaggat cggcgggggc tgaatgggtt gatgagccct     20400
     gactttggct attgctagcg ctattattaa aggttgccgc tgcttgatcc gtacccacat     20460
     accgccaatg ccacggctca tagctcaccc cttggctatt ccccttagga aacgacagct     20520
     caaacccata cttccccgca ttctgctgca tccaggcata ttcaggagtg ttagcccaag     20580
     attcattcag gtagggattc gcattatttc ctacatccac ggctaacccc gtatggtgct     20640
     cactgtggcc tgcgggtgct gatatcttcg ctgctgcttc tggagaacct tgctcagcga     20700
     cctggtccga gaacaactct tcttgcagct ttctatcccg aaagcctgat accgccttga     20760
     tatccaatcc ttgagccgct gcatcagccc gcatttgctc aaaggctgac gctgcatctt     20820
     gagtcaggcc aactgtagcc ccatccaccg cagtcacttc ataaagctgt tcatcggttt     20880
     cctcataggg aagatgccca tacttagtat ttgcggctcc cgcatcactc tggcccgctg     20940
     tcgcaataat ctggtcgggg tcgcagtaca ccccagcagc caaagtttga tttctcaaac     21000
     gtgcaagact agcaggcaag ttccgccgac tcgcgacgag gaacagccca tcttctttga     21060
     caacatacgg tgttggaatc accagaaagt gaggtgtaca ttgctggccg agcaagggaa     21120
     tcatgacgca gaactgaaag gcgacactga gcttagccgt actcttttgg tcgggatact     21180
     ccgtgatttt cttgaggaca aacttggtat ggctattcac cccaaacgga tgaatccccg     21240
     caggttccca gcctccattc acccacttca gcagtccttt tcctccttta accccttggc     21300
     cattcttgcc ccctgagtct ccttgcaccc attgtttccc ttcgatatcg tcatcccccg     21360
     tcgcttgggc tactggagag ctgataaact tccgcatctc aaaatggggg cagttatccg     21420
     ctctttggtt ttgggtctgg ccgagggtgc atttgatggg tctaaacttt tggttttcac     21480
     tgccaccgga tagcgaatgt tggatggaag gctcctctgg cccctcaact ccgctatagg     21540
     caatatcaaa cctcgcgaat aagtcccccg caaaaaagct aaaggctagg tcaaaaggga     21600
     gcttatcaat cggaatctct gagaggccag gaacagagtt gatggtcttg tccttcgctc     21660
     caggtatctc ttcaatcgcc atgtccgcaa tcttaggtag ggtctgctca atgggctgat     21720
     tgaccagatc ggggacggca cccaagggca aattctttag ttcaggcacg gccttgatca     21780
     cttccttgac agcaacatct gttccttttg ccaagatata agcttgtgcc cgtttcctca     21840
     cctgttgcca gttaccattt atcgcatcac cgacgagagg gacaacctga ttaacgggca     21900
     gtttcttgag ggtggggcca atcttcttac caatccccgc tagctgaatc tgctcagcct     21960
     tggagatgac cccctgccaa ttaccccgtg ctaggtcttg aagcggaatc cctttaaaag     22020
     cgggtatctt gctgagtcta gtaatcagca ctttctctcc tgtagtcagg gcggcttgct     22080
     ggagctgttt acctgcttga gaagggtcat acaatacccc taaagctgct tggatggccg     22140
     gggcggcatc atcaacggtg attttctcgc cattgttgat cttggtgtag agtttatcga     22200
     tttcatcaac cgtcaggcca taaacgaggg gcacatcgcc aatgggtaat cctgcaatat     22260
     ccgtcccctg tttagctgaa atatctcgta aggtcagttt ggtgaaggat gccgtgacgg     22320
     gattttgctg taagtctcca aacttgagga tttgatcagg agtcgcccct tgaggccatg     22380
     cccgatctac ttggtaagga agctgcactc cattgggtaa gggtgggatt tcgacatagc     22440
     cagcttgctc agccgtcgtt agttgtcgaa acgtagggga cggtccagga tcgggatcat     22500
     agtaaagtcc cggtaagttg acgggggtat ctgggctaag tgctgccgtc tgttgctgct     22560
     gttgagctag agcaggggct atctgcgtca aagtcggtag accagccagg gccatagcta     22620
     tgagtttctt tttcatgggg aaatgctgtg gtgcgataaa ggaatgtacc gccagcaaaa     22680
     acggccccga tctgagctat taactgaagt gttctgtagg ctatctggag gcgatttact     22740
     tgacagagaa gcgttaccca gaagacttgg gaggacttgt taaagggctg tgcggttagc     22800
     aagaaggaaa taggtgatgg tgcagccaga tccgttcatt ggctgttgaa gtttaactga     22860
     gactcccaag ctaagatgct attgaaagct gcaatttgtt gtatttcttg ggtgaagagt     22920
     gatttcttgg ctaaacaact ggcatacaac gccttggctc tggttgcttg caaacaccac     22980
     agcaaaagga aaagatgact caagaatcaa gcagatccta gattttctca acaacattcc     23040
     gatgatcggc tggggaattg ctgggttcgc gttggtggca atggcaacag cagcgatcgc     23100
     taagtggaca ggcaaccttg aaaaaatcat cgtattttct caaaaatatc tctttcgcaa     23160
     aacaccagag attatcgaag caaaaagaca aaaagcccga caaaagctga ttaaagtttt     23220
     acttgggcaa gttgttaaac gcttggaaaa ctctttacat cacaaaatcc ctattgattt     23280
     gaggcatgag gagcaaccac aacgggttgg acaacggaat ttaccaactg ttcaagacga     23340
     agaagtctct gagaatttca tcaatcgaac attcaatccc ttcacggaaa acgctctaca     23400
     cgaggctgaa agcacccaga aatctactca aaaactctta gaacgggagg acattcaggg     23460
     acgtttattg attttgggag aaccggggtc tggaaagaca aatgaactgt tagttctagc     23520
     tagggactta ctgataaaag cacagcaatc tccagataaa ccaatcccag taatctttga     23580
     gctatctgaa tggaatgaca accaggagct tgatgaatgg cttgctcagc aattatttga     23640
     aaagcacaaa atcccattag atgtttctaa acactggatg agacaaaaac agctgcttcc     23700
     tctattggat ggcctggacg agcttagcaa aatagaaggg agtgaagaag tttcatcaaa     23760
     agaacttgac caaggtcaaa tcaaagaact gattcaatgt gtaagggaaa tcaatacctt     23820
     tattagtatt ttctctttac ctcttgttgt gtgttgtcgg cgcaaagaat atgaagcact     23880
     cgaagcacaa ggtgaatctc tcaagtgttt gaacggagct atagatttac aacctctcag     23940
     tgataagcag attaaagaat atcttcagaa attaaagcgg gaatctttat gggaagtact     24000
     tcaaagccag cctgaacttc cggaatttat ccgttcacca ttgtttctac ttattttggc     24060
     ggttgtatat aaaggggaac acattagcag tgaagaagaa ttgcttgacg aatacataac     24120
     taaacaacta aattcggcca gcaaaaaggc ttaccaaaaa agaattcgtt ccaagttgcg     24180
     gccgagtaaa ttctatataa aaaaacttgg taaagaacct gctccagaga aaactcatta     24240
     ttacctgagc tggttagcaa gcaaactgga ttttgaagga aaaactgagt tcctaatcga     24300
     acaaattcaa cctacattgt tagatactgc aaaggctcga aaacattatc gttggatttc     24360
     tgggctgatg tatggagtga ttataagttt gtgttttggg ttgataggag ggtggtggat     24420
     cggtctagta ttcggtttaa ttgggggact aagtattgta ctgagtgaaa ataaaaagcc     24480
     aaagaagtat agattctcat ggaaaggatt ctgggaagca ggactgattt atgggttaat     24540
     tattgggttt cttaaagatc ttaatcttgg tttgtgtttt ggactgagtg gaggactgag     24600
     tagaggactg agtagaggac taggtgacag ccaaaaacct gaaaagctga gattattctg     24660
     gaaaagcttt tggagggcag gagtaatttt tggactaatt tttggactca gtggaagtct     24720
     gcgtagagga cttgctggag ggattattgg agggcttagt gaagggctta tagaaggact     24780
     gagtagagga ctgagtaaca tcaaaacatc agaaaagttc agcttttcat ggaaaagttt     24840
     ttggagagta gggtttagta ttggactgac tattgcgatt attggagggc ttagtgaggg     24900
     gcttacagaa ggactgagta gaggcgtctt gattgcatta actggagggt caagtattgg     24960
     gtttatcgct gggctgattg aaggaataga aaattctgat attgatgttc aggataaaac     25020
     aactcctaat caaggaatta aaacttctat cagaaatggg ataattgttg caatagtatt     25080
     tggactgtgt gctgggctaa ttggtggact gagtgaagga ctagttttcg tgttggctag     25140
     tgggtcgagt agggggatat ttgttaggat ggctgttggg ttgaatgtcg gactgattgc     25200
     tggactgatt gctggactga ttgctgggat agacgcagtc tttaaacact ttttcttgcg     25260
     tatagtcctc taccaatctg gagttgcccc ctggaactac gcaagattcc tcgaacatgc     25320
     cgaaaaccat cgattcatcc agcgagtagg tggccgctac cgctttgtcc atgacctgct     25380
     aagaaaaagg ttcacggcaa ctttgaatga ggagaaaaat aaagaaaaaa aaaacggccc     25440
     agatcggagc cgttaactga agagttcaaa ttgaaaaact gaagtcagct tatttcaaga     25500
     gcaagatcca agcgattatc cccaagatcc agccaatggg acctgcgagg agcaggaacg     25560
     gtgtgaggac gatcaggagg atgacaagac aacctttcat caaacaccct ccacaaagta     25620
     aatttctact tccttatcaa agtgatagag gccactgcga gaaccactag aacgattggg     25680
     agcaaagcta ttcacgagag acgaggctct atctcccaca ctgcttgaac ggagctggtc     25740
     aaagcccaca ttgaggcccg ccctgagcag cttgttgcca aaaccttctc cttgaccttt     25800
     gagcttggct tgcagatagg gagactgctt gtattggaca accgcaacag gcgtctttct     25860
     gctttctggt gactcatccg tcagattgac atgctcaatg ggctgttggt tgacttccac     25920
     cacttgcata ctcaaaaagt caccctccgc actggtcact tctgccaaga ctttggagcc     25980
     tttcttcgcc attgccccta agtcttcact cagggtcaac agataccgct gaccgatgat     26040
     cgcgtcactg ttctggggta tccaggtaat cggattgtcg agcttcgcct tggctgtcgt     26100
     accaggggaa atcagtccct ttccgagtgg actactgcta gcggggtaga gggcagtggg     26160
     tgcatcggat acctgattat cctccagcaa atcacccgtc aaagaagcca ccagtattcc     26220
     ttggggtgga ggggctttgg caacaggttt tgtggtaatc ggtttacgga cggggtgaga     26280
     ggtggatacc ttgatgggac gaatgggctt gggttgaatg ggtcgagcag gctgcacggg     26340
     cttcggagta aaggccgact gctgggcaag gctgaagtta gcagcaggct tgggggcttg     26400
     agcgacgggt cggggggctg ggggtctagc cgcaacaggc tgaggcttgg gagcaggtct     26460
     attgcgataa acgatccgag gtcgagacgg gggtacagac cgacgtacct ggatgggtcg     26520
     ggtcacccga tgggctgcac tgggcggtct gcggtgggac tgggctggct tcgtcttcgg     26580
     caccactatc ggcttctggg ggactgctgt gagcttgttc tggcccggag catccgtcac     26640
     atttcccgtt tcatacttct gctttagctc agaaatttgg acggcttgac tcttgataat     26700
     ggcatcctta tcatcctcag ccatcccaat cgagggctgg ggcctggtgg caaccgctgg     26760
     cttgggagta tcactgttcc ccgatgtcac ggcttgaacc accgccagaa ttagaaagat     26820
     actccctcca attaccccaa tctggatggg taaccgtcgt cttgtcttgg tcggtgtctg     26880
     ggcatcaaac tcatgggtca gttccggtaa atggaagtct tgcagggtgg cgggtacagg     26940
     ttcttggggt tgtgcctgtg ctgggtcagg cttggtatcc ttgacacccg ccttgggctt     27000
     attcttgtta atcgcagcta gggcttcttt tttggtcttg atatcagaca tgactaaaaa     27060
     tcctccattg atgtaatcat caggccgtga cgctggtact tggtgatcag gtggttgagt     27120
     tggctatagg agtccccaaa cagtcgctga gcttcccctt ccgtgggaat cacagcctca     27180
     accacgagct ttttattcaa tttctccggg aaggatttac cgtccttaga ccgatgggta     27240
     cggatggaaa tcacatggat ctgccactga cccggtttga tctgggtgag atggatatcc     27300
     gtatcccgct taatctcaac gacgctctgc cattgacccg acaggtattc ttggatcggt     27360
     tgctgagctt tctcatattt ctgatgctca atctctagcc agccatcccg gagcaggggg     27420
     tcgatggact gggctacggc aaacagctcc cctggataaa tgtggtcgtt atgcttcttg     27480
     ggaggactgc ccccattcca ggtccaaccc actttgacga gttcataggc ataggttctc     27540
     aggagcgcgt cctcccggtg caaggggtcc actttttcag cctggacggt ctcatcgtcc     27600
     tgggtctgga cgtagatggt ggattggtct gatgcgagtt gggcactgcg ggagctggag     27660
     aggaatgctc cacagcttga aaagaagttg agggtgaaca cccccaaaat ggcatacagc     27720
     acataggggg gctgtttctt gtgggtttcg cttgggtatt ggagttttag catgggtctg     27780
     atatctctat cgatttctca aggctctgga ggtgacggct gaactcgcgg ataaggcagc     27840
     ggaagacaca acggtcactg ctgctcccac ggtggtcacc acagctcccg tatagacccc     27900
     tgatgcagct aatgccccca ccgtcaccgc agccgtggcg accgcagggg cgatatagcc     27960
     taagaaggtg gcaaaggcgg ctccttgatc cgcgatgggg ttatccgtta gatagatcgc     28020
     cccaaatcca atcacgaaga tataggcgaa tcgcacaagg gcaataatga ccagggcttt     28080
     ctggtactgc aaaaccgccc acttatgacc cgcaatcggt agggtggaat agatgatcat     28140
     gatcggggct aagatccctg acagaatcaa ggccagttct tggccggaga caaaccagta     28200
     ttggatctgg agaggacctt cgatagagac ggtccgaacc gcattctctt taaccacgtt     28260
     gaagccatgt atggcatcat caatggggtt caaggtgtta aatatcgcgg cactaatgcg     28320
     gcctagatcg gcttgaatcc cttttttacg actttcaatc acttccagag ccgtctcaca     28380
     gctcgggcag tctttcttga tggcagcctc atcccgttcc agcttttggg ccaacaactc     28440
     caagcagcgc acggcggttt gcactttcgg ggcttgaacc tggtccagtc cttgactgga     28500
     ggacgcggct gcggggtctc tgagggtgat tgccggcaga cgagaacagc tcgcagactg     28560
     acggttatat tcggctatcg ctgaggacgc atgaatcttg tccttgaggg catcccggac     28620
     cactagcccc gcccactggg aatcgaggat caggtcgctc cctcgattgg ccacctcccg     28680
     aaaactccag gcaacgactt tcgcccccca gccatagttg agggtaaagg cgaggagtaa     28740
     gacgatggga acgatctgct gcaagacaat ccgatgggtt tccccactca aaaagctcat     28800
     ccccgctctc gccatcagca cgaggcaggc cacgagcaaa aagggcagca ggatgctaaa     28860
     catcgccttg ttattgacgg tcgtccgggg gttatctccg aggatgtcct cccacaaggc     28920
     atcccaccat tgggaggtct caaacatgcg gatcttggac tcccgcagca ggtctacacc     28980
     cacggaaggg tcgaggtcct cattaatggc atgggctgac acttcaccca aggcgataaa     29040
     cagtagggtg agaccgatga cggacactat cgttctaggg agcggcctct gaatataagc     29100
     caggaatgta gaggtagttg aagctaagct gctcccgcag agcggcctgg tcttgggcgc     29160
     ggtgtcgttc atctttgtat agctccagtt cagctcggat ttgttcttgg agagtgagtt     29220
     ctgaggcgct taggtgcagc cccgtcgtgc gctgctgatg ggcaagggca gagccaacca     29280
     cgagggcatc tgaagacttc ttctgctcct cttgacccga tacgacgttg ctcagtatgg     29340
     ctccattggt tgcggttcct tgagccatca ggctgttttg agcggtgagg gacttgagga     29400
     ctgcttggga ggacttcagg gtttgggctt tctggcccgt ctccccaaca gaggtcgcaa     29460
     tcccagcccc cgctgtggct tgctctttgc tagcggcact gagctgcacg agggcttgag     29520
     tggactcaat ggtgttaacc acggactgct gcacttgctc tccctgctgc tgaatcaagg     29580
     cttgaccatc ctcagagaag acgagctgag tcatcagttg ggggagtaag gctttacggg     29640
     cctcgttgtt gcgggcttgg gtatacacct gaaaggggtc ttggggatct gaataaatgg     29700
     ggtcctcaga tccactgcct ccttgctggc tttcgctggt gccattggtg cccaatttgt     29760
     cgtactcaga gaggacggta gagatggacc cgcttaggat ccgcttcagg gagaagttat     29820
     cgattgcgtc atatatggct cggcctacct tgtaggcatc aagcgctttc tgtccatatt     29880
     catagacctt gagaatcttg cgttgggtct cattgatcac cctcgcttgt ccaggtttct     29940
     gcttgggtcc aaggacatta aagaccgtgc cgaggagacc actagggagc tgagccgtgg     30000
     gcacttccgt ataggtagac gtatctagag gattatcctt ggctatcgtc acatcccccg     30060
     tggggatggg aacatcaggg aaggtggtgg gtgtagtggt ggtcggtaag gtgatatcgg     30120
     tgctaatcac ggggtcgtcg taggacacct gagcataggc ggggacggtg gtgatggtag     30180
     cttgaactga cagaaccaga gttatcagta aaggtttagg ctgcatagtc ttccactcca     30240
     atggtttcaa cctcaatccc ttgtttgttg gcctgggaga gctgatcgcc aaagtccact     30300
     aatccggcta cggggtcatc aggatagcga gacatcaccc ggttgcgggc tttggtttgc     30360
     tccccttggt tggcaccgac tcccaaggtg aagttgctgg ggttatgggt gacgatcagt     30420
     tgccgagacc ctcgctgcca gcaccaatgg gactgctgga gggacttgga ggcgcgaaag     30480
     gattcatgct caaatttctc aaggatcttg gactggatcc caaattctga gaccaatagc     30540
     ttacgggcat attcattgac gtgactgaca aatttgttct ggaggttgga gatgaccttg     30600
     gatgcacagc ttgaatccag tagggttttt acctctgtca ttccaatcag gatgttgcac     30660
     tgccatttac ggcctgagtt ggcgagagac cccaccatct ctgcaaagat ggtacgggtt     30720
     aatagctctg acccttcatc aaccggtaac agggtccgct tgccgttcat ggctttgcgg     30780
     atcagcaagt caaaccccgc caccccatag acgagggagt cactgtcgtt gtccacgttg     30840
     gtcagtccca agatcagggc atccacgttg gcgtcaaagg agctgatgcc attgatagaa     30900
     tctcctaatg ccgtggggat gacgccctct aataggagct gtaggtgctc aaaggttcgc     30960
     tgtaagtcgg gaccacagtc gttcacttgg atatactgct tcagccagac tttggcaaag     31020
     gcgacaaact cctcataaat gggcatctgt gccgcttcat cggaaccgaa aggcgcattt     31080
     gacgcgaggg tgtagcgctc aaggtgggcc tcgtgaaagg attcaaagca taagcccaaa     31140
     gcccgctcaa tcaggaggtt ctccatcggg ttagactggc ccgcatcccc catcgcaatc     31200
     gctttaagga tcctcaactt gttgcgcttg ataaatttcc acgcttcctc acgggtgggc     31260
     tgttgggagt catagcccgg atcacccggt ttgggcagat catcaatcca ggagacatcg     31320
     ggaatctcca tgacgttgat ggtggctttg tctacgggtt tgtaattgga ggacacccct     31380
     aattgctctt gggttgccat ataaggttca tagctggatt tacccgtggg gggcgggaag     31440
     tcaaacccca cgacgttcat cccttcccgc tggcaatagc tcgtcatctc cagcatcagc     31500
     atggttttac ctgcccccgt ttcccccgtg acgagggtgt gattcgggaa ggtatgggct     31560
     agatcgaggt aaaaggaaat cggaaggtca taacctatga gcaacacccc ccgacaatcc     31620
     atcggggcgg gatggatttg gggcagggtg ggcagcactc tcggggacat ggttttatac     31680
     aggtgattcc ccccgcccgg taaggtgagc atgggggcgg cactgatggc gaggctcgta     31740
     caccagtgat gctcaaattt ctgggtaatc ttgacggctt tggtcccctc tagcttttgg     31800
     gctaaggcgt ccaggtcaag gttgagttgg tctacggaat cccgatagag gaagatggcg     31860
     aaggcgaccc aaaagggacg attgccgttg ttcatccact ctaggttttt cttcgtttct     31920
     tcaaggcgtt ctaaggcaat ggggttcagt tctttacgct gggcggcatc ccccattttg     31980
     cggatagagt tccgccccgt ctgctccagg atggctcggg tcagcccgga tttgatgggc     32040
     agcagttcgg tgaccacacg agcatccaag aacagttctc caggggtggc gagggtgtca     32100
     aacaggaatt tgataaatcc cagttccgtg gagtcttgga cctcggggat ggtcctgagt     32160
     ccttcaaacc gcagtgcgcc cacatatttt cctttattcg gcaggtaggc gaggctttca     32220
     ccgaattggg gaacagcagg tttccctttc tcgggttcaa acaggacccc caggctatgg     32280
     aggtgatgct cactgactac tggattggga tctaagccca ggtcgtcata gcgagtgtat     32340
     tgggggatgg ggatgctctc ttcatgcagt tcggcgtaat cccaatcaaa tagctcttgg     32400
     gccgtgaggg gctgaatttt atgacctaag ccttctgcgc ccgtgagcat cctcgtcatt     32460
     cgcttatagg agttggtata ggcggcaaag atggctttct cccactgctc tttagattgg     32520
     taggcttccc ccatgacctt ttgggcgacg gtgtcattcc aaaagcccga tacccactcg     32580
     aacactacat cagcgggaga gtccggggtg tcatagtctc caccgagacg catccggcat     32640
     ttagcttggt agagcaggcg ggatttgacg atacgaccct cagcttctag agattgcagg     32700
     ttctcagcat cggattgcag ttgagcggtg gtcagggcat ccgtggcctt ccctagggca     32760
     gtggccgtgg caatcaaagg gtctgagcag tctgctcgga tatccataat tgctttgagg     32820
     tcggtgccac cgagatgaca gatcttctgg ttgcttttat tgagctgctg tttggattgg     32880
     gcgggggtga cggtcgggtc caaacccagc acgtcaaaca taaacgcaat tttgatctct     32940
     cgactattcc agtgatggag atggaaccca atcgtcaccc cctcaaattc aaactgtcca     33000
     taggtcttga ggcagaagtt atcttgaatc cgtctcaggg ggtctgtttt cttggccttt     33060
     gccatgacgg gcatccccac gttgtcgaac cttagggacg ggcgaccgtc catgtacgtc     33120
     gtgggcttac ccacccgctc catctgctgg gagggattgc ggccaaatat aagaatgatg     33180
     ccgacgctcg tcaaagcgat aaagaggacg gccagtaaaa acccaaattt gattaagacg     33240
     gcaaaaccca cccccaaaac ggcgatggat gctccaaggt aaaagacggg tataccgtct     33300
     agcatcgtgt ttacagagag gatatctcgt gtttgacctt cgtttacggt ttcaaaatcc     33360
     ataattgacc tcctttatcg ggttgtcgcg aagatcaggg caccaatcat gatcatgacg     33420
     atgatgaagt agaggagtcc caccacgggg cgggacatct cttgaatatc tcccccatga     33480
     tgggagtgac ccaagctgtt cttacctgca aagccaatgg caccgagaac aacacccgcg     33540
     aggatcagcc agccaatccc acagacggct cccgctaagg agaacccttg aacattcagc     33600
     caacccaagc ccccaatcat gcgctcccca aagccgggga taacatcaaa gccattacag     33660
     acggaatcgg ggacgctcag ttgagcttgg gcatattgct gatagccggt ggtgatgctc     33720
     acggtttgca ggcccgcgag gacatggggt gatctgcgga taattctgcg ccaagcgacg     33780
     gctgatgctg tgatggcgag acaggcgaga gaagtcgctt gtagccaggg gagattgtag     33840
     atcaggccga tgatgagaaa gccactatag ccaaaccacc agggctgttt tgaggttttt     33900
     tcgtaaagga tcttgagtcg tttcatggga ggttgcctct tatggatcag tagtgctgtt     33960
     attgctgggc gtagttgagt aaggtctgga gttggtcagg agagattttg gctagctttg     34020
     ctgcgtcttc aggagacttc ccccaacgca tctggcgaat catgccgttg actcgccaat     34080
     gcatctctga gcgatagcga taggtctggt tacctgacgc tctagcgata ttcagacccc     34140
     ttaaaagagt cgctggagtg gtacggctat cggacacgtt acgcttaacc agagacaggt     34200
     tagccgttgg gataggcttt accttctgag gcagggagat tcgtcgcaca ggaggacgtt     34260
     tgacggtctt aggcttgggc aggactttgg ttctacgttg aagggtcagg ggttgaaccg     34320
     ctgtcgtagc ttgatgaacg cgagtcctct caggtggttg acccaggcga cctgtgaaga     34380
     ctcgcgattg ctcaggggta tgagcaatgg gggtgggcgt tccaatccga gtgatggcag     34440
     tactgggggc actgtcagac cgattgatcg ttaactccat tgaggagcgg ttgcagccca     34500
     ctaaatctag gattaagttg gtcgatttca cctgggtatt gggtttccaa gtcaggtaaa     34560
     ttttctgggt ctggggttgg ggctgatcta agctcaagtc aaagattccc ctcgtgccca     34620
     tataggcttt ggagacccgg caccaactgg aggtaaggtc aatcaggtga ccatgacccg     34680
     gtgctatctt gatggtttcc gctgtggctg gggaaatgaa cagccccaac caggccgcta     34740
     taaatgcggc aatggttttg tacatggcgt ttttccttgg caagtgcgtc tgttcgggag     34800
     gagggttgct atcaaagaca gcccctccct gtggttgttg gctggtgtca gggccagccc     34860
     cctctaaggc aatcagatat tgctgctaat ggtctgtgga taaatcgggt tactgctggg     34920
     ccgaatccca gatgtcctcg cccaatcgtt ccaggctctc ccagtccacg gcatcgctga     34980
     tccgctgggg aaggttgata ccccggtcga tcagtaggcc cgtcactgcg acctccacaa     35040
     agaaccaaaa gagattcctg agcatgggta atcactcctt tgactaatgc aatagctttg     35100
     gtaggaaggg actttgtagc gatggaggga gtctggcggg gattgtgaga ataagcagaa     35160
     ggattagtac tgttttcgta gcagaaggaa agagaagcag gccaagtgct gaggtttact     35220
     cgctcctgac ctacttctgg ctttgaggaa tatctactga aactttggga aaatcccagt     35280
     cgaacggctt tgacttgacc ttgggctgca ctgacaagct gggccaagcc aacccggaac     35340
     cactgcttga ggagatgaac ggggatttga tacttcggtg gaatgaaagg tggaggtgct     35400
     ttgattagga cgagatttgt ctttgtctca gatacaacct cgaaatcaaa gtactcatcg     35460
     tattcttcat catccgtgta gaatgactcg tcattaatcg taaattcatg ccagtctggg     35520
     atttcttgga acgaacggcc ccaatagagt aaatcttcga tatattccag ctttagattt     35580
     gctttttgag caatctcttc gaggttggca tcaggaaact ggttttggag tctataaacc     35640
     ctatcaagat ggacttgttt tttctcgggc aatctcagtt gcttgggtct gttcttatag     35700
     caaaatctgc ggatataccc tctaatccaa cctcttgcat aggtggagaa cttgcagcct     35760
     ttcgtagagt cgaatttcct aacggcatga cggatgccta acattccctc ttggatcagg     35820
     tcttgagcat catccaaagt ccaggcatat tgcttggcga gtttggatac tagacggaca     35880
     tgcccaatca tcaaccagga taaagaggtt tcatgtccta gcttggcttt gcgaatcaag     35940
     tccaactctt cctctgggtt gggaaccggg aagcggtgta agagctgggt taaatagtcg     36000
     ggtaaacgga tgccctcaga aaaagggcta gaaatcgaag cggcagtcat aagcttgccc     36060
     tccacaaatg gaagagagag aacttaatat agataatttg ttgattacga ttattcgatt     36120
     tgcactaaac tctctgaagc cagatgtccc agttgcctag cgaactaggc agcagttgtg     36180
     ggagtagctt gagcttggcc cagctccaag ggtacgggtg gggcgatagc aagccgctga     36240
     cggatatagt gtcttgcacc acgctcagat agatggtggt ggagcatctg ggactggata     36300
     taggggccgt gaaatagaat attgacctga tcgtctttgg aatagccaca aagacgaagc     36360
     tcatagctca ccatgaggtc aattcgataa ctcaagggtg ggtgttcgca acctaagtta     36420
     taaagtttgt cgtaggtgta ggcgacaccc atagacatca aattttgaac ttttacagca     36480
     atctggagat aaatttctcg aaattcttga atcacctgtg gatcaagctg atcagagctt     36540
     tggaggtcat tgttgcctcc acgggatttc ccggaatcag tatttatagt tagcatgaaa     36600
     acatctcctg tcgcggaggt atagatcacg gcttgtgcgt tgtggtagat gggcaggccg     36660
     tggtttgcaa atttaactag agaatattcc tgtgcaagac agaaacaggc aggactcctg     36720
     tcagggattc ccgatagaaa tggcatttaa aacagtctga gcaaaggcta gacctttgct     36780
     gtttcttgtg ggtggtagta gaaatacaaa aaagaaaaag ttgggtgcga aaacattcgc     36840
     ttaaatcact tggctgtact ttagcgccaa cccaggagtg gagtcaaagc gaaagaaaca     36900
     cttagttaca attgcaaaaa tttatcaaca actaccacaa cctattgacc ccctcaaatc     36960
     ctttcaccac aagccttttt gatgccagag accccaagcg ctcaacaact tcaagagcct     37020
     ccaacaatgt aagagactgc gcctcagtct ggtctttggt catagtgagt ttctgttggt     37080
     taaggtcaaa atctttcaca aatgagccat cgtcatgcag gacaaatctt ttagggaaag     37140
     ccatcagtat ctcctttaag atccaaacaa acgccaaaca ttcgttccat tgcccgcagg     37200
     gtaaacacgg ctgataattc tgtgtaaggt tgccactgtt cctcggccaa cacccaatac     37260
     tctccgtccc tccaagagta atctgcaact aacttgcact gcatcgctaa ctgataccaa     37320
     tggtcaaact cctctcgttc actaagtcga gcttctcgtt caatcggctg ttcaccatta     37380
     gtgatgagtt gaaggggaag ctgttcctga ttttgcggcc gcaattctgc gtttgcttca     37440
     ctaagcgctt ttcgctgtga cttcctcgct ttcactcgtt gccgccgacg ctgctcatac     37500
     tcaagttcac gctgttgttg tcgcttggct ttagagattt tctgctgcag gcccggaggt     37560
     agggagaggt gcagctgatc ccaattttgg attggaataa ccttggagtt cccccccaaa     37620
     cccccccgat ctaggtcttc agaattcaca agcgccgctt tcgccgccct ttggcctttg     37680
     agggccaggg cgacggcggc ttgtattctc atcgtcatga ttacaaaccc tacataaata     37740
     tagagttgta aaagatcctt taatagataa agttccagct ttcgctggtt taaaaagtga     37800
     gtattatttg aacagagttg tgtaatagtt ccttcctgca aggggtctag ggctttctga     37860
     gggggttctg ggggtaaatg atgggggtgc cagagttcta ggtttgactt gcggtataag     37920
     gttttctggc tagtgtgagc tagttttgca atcgcactgg cacgagctgt gataccaggg     37980
     ggaagcttgc tgactcttct taattcaaag acggcttttt tgatccggtt ctgggcggct     38040
     tcacgcttgg attggtgata gccaaagtcg gcaggagcga cttgtttgtc gttgtatttg     38100
     gcgtctcggg caggggctga accagcgggc cagtagtagc gcatagtcca ggttgccact     38160
     tcataactac ggcgctcgat ttcatgctgg tggcggcaat gttcgttaaa gcctggggtg     38220
     ttctgagcag tttgacaaac gtattctgcg atctgctctg aactatccat tcccaaaaat     38280
     acgcgggctt cgcaggcgat gatcttcagc ttctcgttgg tttggccggg gccggtccag     38340
     ccttgggatt tctcttcatg aatgcgctcc tgccaggtgg cgagggagga agcgttaccg     38400
     gatttacgga ctttgaagtt ttgctgcgcg tctgcgatcg catggtgaag acgacccatg     38460
     tcctggccat cggcacatag ctcaaaacaa tctagccagt cttccaggaa ccaggggaga     38520
     gggtttagat cggtgtcgag tggatggaag ccgctacccg gctgcatagg gagacggaat     38580
     gcagcaaaga gactgtagcc cttacctttg ggcacatacc gcttggggtt ggggtagagt     38640
     tcgcattgac ctccacaaaa tttgacgcct tcagcttcca ggttgagttt gatgcacaca     38700
     ctcaaccaaa aactactgac ggattcgggc agggggaggt agaggtgtaa gccgccgcta     38760
     tggctacttt gacaaaggag tgagcggcag ataccgattt cttccagggc atgtcggatc     38820
     tttggaagcc aatgtggagc gctggttgga tgatagcgag agtccttgtc tatatcgagg     38880
     accagccaac gggtctgggc attgggcctc actccgatca gacagtctgg gtcttgatga     38940
     agtgaccaca actccacggg ggagagaggg aatttcttca ccgtttccca gtcaacggga     39000
     ttaccttgtt ccgggactga cgcaaagatc caatcccagc cattggggaa aagtaaggcc     39060
     aatctttgac ccaatggatc tgctggtaat gggtcatgct tagggcgtct gggatgctga     39120
     aatacataat ctgggacatg ggaaggcgag ccatgttgac gctgaagcat gtcttggaaa     39180
     tactcccaaa ttttagattg gggtattttc acagaataat ttttgtcttg tttacatttg     39240
     catttaaatt actttaaata attgggttgt cttataaggc tacaaaccag tcacagaaag     39300
     ggattttaca aaacttagtg catacatacg gagattttag tgtaggcata cggataactt     39360
     agtgcataga aacggagaat attgtctctt ccttaaaggg acacccagct taggttaagt     39420
     gccgataaat gaagttgatt ttattaagac aaaaaaaata ttaagtgtag ggatacggat     39480
     attgagacaa tctattttta gtgctaggat acggagaaaa ttgtctcatc ctgtcttaca     39540
     ccttgctcgg tacccaataa tttaggtctt gatactaagt gctaggatac ggagaaattt     39600
     gtctcatcct gtcttacatc ttgctcggta cccaataatt taggtcttga tactaagtgc     39660
     taggatacgg agaaatttgt ctcatcctgt cttacatctt gctcggtacc caataattta     39720
     ggtcttgata ctaagtgcta ggatacggag aaatttgtct catcctgtct tacaccttgc     39780
     tcggtaccca ataatttagg tcttgatact aagtgctagg atacggagaa atttgtctca     39840
     tcctgtctta catcttgttc ggtatccaat aatttaggtc ttgatactaa gtgctaggat     39900
     acggagaaat ttgtctcatc ctgtcttcct caaataatgc acttcaaaat accaagatac     39960
     gcttaagctt ctcagcaatc tccagagtaa ttggacgatc tcctctctcc atcttgccaa     40020
     tataatcaga actcacatca ataaaccctg caagctgctt ccgacttaat cccttaacct     40080
     ttctggcttt aagtaagcta cttggttcga tatcaactgc ctgggcacgg tcaatcacaa     40140
     gagccatttt cttgggtgag ccaattttgg ttaaaagctc agggatagga tttggtgggc     40200
     ttattgtcaa ctttgcatca agcaatcgat ctattaattt aacctttcgc caattcttgg     40260
     gtttcgggga ctcactatca ggttgcagcc agcttgggta cgtttcggga tcaaactgta     40320
     aaagccatcc taatttattg agcattttca aggatttatc ccaccgtttt ctcaaatctc     40380
     tggccttgcc cttttgattt cgtgctgttt ctatttccga aagtggaatt acttcctcaa     40440
     ggagtttccc cacagtatag tcataaggat tctcatttct agctctaatt cgagaatcaa     40500
     gcgtgagttg gatggctaat cgtaaagcca tttcattatg gtaaggatcg atttgtaaaa     40560
     tatctttagc aaggtagcca aattggtaca gagcttcttg tgccttaaga ccagctcggt     40620
     ttagaaaatt cattgtccat aagcctggag aaacggttat gtaaacttct tctggctttt     40680
     caattttttt cgtcacaaaa tcaaactgtc cagtaggctc tatcaataca tcccacatcc     40740
     gaccagtggg agtactagca tcgattttac ttttgcccct acctgctatc catactgacc     40800
     ttaccaataa gcaagaaaga gcataggctg tgctagcaac agcaagtctc ttttctggta     40860
     aagcagtatt atggttttta tcccatccga gaagcttaat tatatcggtc gcattaaggg     40920
     taaatgagct attccagggc tcctcttgtt ccattgtttt cgcagcgaag atgagctgaa     40980
     gtttgacagt atcaaaccca aagatatcaa tgatctgttc agcagcttcc cagggtaaaa     41040
     gggcaatgtc tcctggggag gtaatgtagt gttcgataaa gttacctgga ttagatttgc     41100
     tacgatactt aaatttcgca ttcgaatttt catcttgctg ccatagatcg gggcgaagct     41160
     gtgcctttat gctgctagca atagggatag atgtaggtaa agcagttaca gcaggtagtt     41220
     ctattctggc tttgttttta ggtagtggcg aacgtcgaag ccctaataaa gcatgcatat     41280
     cttcaagaga gcagctaggt agactcaact gctcaattaa aattagagca atttcccgac     41340
     tatggaaaga agcccttact tttatctgat cacaaatagg gccagtttta ttagttttga     41400
     gaaatttgat aactatttgt tgtagttgtg atgcagacat ttctcgtaaa gccttacttc     41460
     caagttcaga ctctagttcc tgcaaagcta aattcaataa ttctctgcaa aaggtatttg     41520
     agatggtccc cttaaatgac tcatggcaga aaaagtcaga aagtgattca ttcaagtact     41580
     ttttaacggt tatttcatca atattaaatt gtagtacttg agattcacga gatatatcag     41640
     tatttatctg aatgtgtgga agaaaggtat ctaaggcact cttacctttt tctttaataa     41700
     cttcttcaac cttgaactta tataccttga gcaaatgcaa gtaaagatgt tgaattatta     41760
     atctagatag atcagtcctt tcaagcagaa agtcgatcat ctgatccaga aaatctaaag     41820
     agataacttg gtcaatagca acatcaagcg gtaaggtaac gaagaatatt tgatcttctg     41880
     agttaacact tgctaaatga tgagattccg gcgagatgtt ttctcctgac ttatcagcag     41940
     ctaatatatc atcatgacaa tctagattca tagtcaactt agaacgtgta accagctcat     42000
     cagagttaaa gccattcact ctaatgtcca cttttcgtgt tgatcgatgt ctatcagaag     42060
     cagacactaa aattaaccct cctcaagcga aatataaata gccagataca ataatcatta     42120
     ttttgaagca cacctaaggt gtttgaaaag gaaagactaa tgattttaat taaaagtgat     42180
     ttaaaatcag tattttccat aaacaaagac ctattatttc aaatgaatag gaatgtgacc     42240
     ttgaatttgt aagatttata gatttcaatc gattcatagt ttttttaatg gctgagagat     42300
     tgctgaccag gcagtcagag catcagtgca acgctgaggg tcagactcag cacaatagca     42360
     gaggcaatat agactctcca tcaaaataaa caaggaagga tctggaaggt taagcataac     42420
     gacagtatca tcagcctctg ttgttgtagc gaggcaattt tcaattattt ctcgtagatt     42480
     tctaagatca atatcctcgc cataagaaga ataaaaagac aatgcattct ttgtattttc     42540
     tggtagagat tgcggccaat actcttgtgt gtccagaaag atcataaaca agccaatctc     42600
     agaaggtaag agcttctgga attttttaga agatgaatca ccacaaaata aataatgaga     42660
     ttttcccagc ctccatatat cgccattcac aaccttcttg ggttcaacgg taagctgctt     42720
     taagtcaagt tcactaactt gctttctttt tcgttgcctt tttgtagtat ctttttcatc     42780
     ttgaaaagat ttaccaccta ttctagaggt atcaattaat cggttgtcca tgccccttcg     42840
     aagcttagcg gggctgtcat tgctatttag ctgcagttcg tttcgaattt ttcctacaaa     42900
     tgtgttacta acgccacatc tcttagagat tgcattatca ctccataaac tccactcatg     42960
     atcacgtatt agtctttcta cggatcgacg tttatccgca ttggtacgcc ttaaaccatg     43020
     tacagcgtta gctccaacag caaataatac agcatccctc tgtgttccta gtcgaacctc     43080
     agcaactatt tccttcgtgc caagactttc tcttgcacgc actctatgaa aaccgtcagc     43140
     tagccaatat tctttaccat cataataaac agtaacaggt ggaaattttg caccttgttg     43200
     catatcatcg gcatattcag ctacaacttc ttcgtataac tgggagcgag gttgagtacc     43260
     tccatccata cgtattttag ctatctcaac agactggaca ttcgattcag tagatatgct     43320
     agtggtttgt ttggaaggca ttcagaacta gcagtagaca acaacataaa gacatgaaag     43380
     catctaaact cataagcaac taataattca aggaattaaa agcctactgt taagttgtgt     43440
     taagtatgac ttttgtgcct cagtaacttg attacatcct tgaggagttc ctcttttgcc     43500
     caattttgtg tgtattgatg actcttccat ctatccctct tcgagttttt gacttccaac     43560
     cgttgaaagt gggcgacagt tgatgcctga gctttccaac gaaagtattg ctaactccac     43620
     atttcttggc aattgcattg tcactccatt gattccactc agaatctttt aatagtcgct     43680
     cgacgactct tcgcttgtct tcgttagtac gttgaaatcc atgaattgta ttagctcctg     43740
     ctgaaaaaag tattgcatca cgacgagaac caagccaaac ctctgcacaa attattggtt     43800
     gaccaatgct ctctttagct cgaacacggt gaaaaccatc agctaaccaa tattcagcac     43860
     catcatagaa aacagtaaca gggggaaact tagctcccag tttcatggca cctgtatact     43920
     cctgtacaac tgcctggttg gtctgctttc gaggttgaac ctcttcgtca aggttgattt     43980
     ccgataaatc tagattagtt atagagctat cagaccttat taagtacatt ttcttagact     44040
     ccagtctaat atttcagttt acatattttt tcctactaaa aggaaaacaa agccaataat     44100
     gattgctcat acttaagtta atttatctag agccatacac cagaagaact agttttaagt     44160
     gtcatacaaa gaattaatat ttaactctag taaatgtata agcaaaagac taatttataa     44220
     aacaatgaat aactgaattg attacagaat acatctagaa aactaccctt atgtcaaaaa     44280
     aattaaaaca ccttaaatct tccaggataa tgtgtatgac ctcttgtatt ctttaaactt     44340
     cggggacccc aaagttcact atagagtttt ttctgatata ttcctccgat ttatattaaa     44400
     tgaaattatc gtttggagaa gtaccaaaga aacgtactaa gcggattctg agagctatac     44460
     ttacatttgc caatgggaac aaacaggtta attcttaccg ctactgtttg agcaatattc     44520
     agatagacag gagtggtccc aagcaagtga cgataaaggc tactcttaag caattggcag     44580
     agttagtaag ctactcagat aagttgcatg tggagagtag ccctgatcca cttactcaat     44640
     ggagtttgca ggaagcttta gagcatctaa gacttacact cggggtattt tctgatatcc     44700
     gccagaaacg tcaaggctca aagtactggg tattccgact tgacttatgg tttgtcattg     44760
     aagaccaagt aggtaattta gcagaattcg atcgtaaatg ggaacgtaaa aaaaacttag     44820
     tatcatccaa aaagacttct acttctcaac tagaaaatca tattcccttt caagttcttg     44880
     ttgatataca aaactttgtc ggtcgtgaag cagagctaaa aagtcttgaa aatttcttag     44940
     ttttcaacaa atcaggaata gcaattgttg gtatctacgg tatgggagga gttggtaaaa     45000
     gtactcttgc taagcacttt gcccatcaat atcgaaaatc atttcctgat ggggttctgt     45060
     ttgccgatct ccgtattcaa gagccttccg cactcttaga gagttttgct agagcctata     45120
     gttgtgatct caactcaaca atgaatattt tggataaggc agagcgtgtt cgtacaatct     45180
     tgtctcagaa gcgttctctg ttgatacttg ataatgccaa tgattcagaa attcttaatt     45240
     atctattgcc aacatttgga caatgttcag taatagttac tgcgcgtgac aaagatattg     45300
     ctcccctcca agggtttcaa gagttaattc tggaaccatt cagtaagtcc gagtcaatgg     45360
     agttgctaac taagttagta ggtagggata gaattaaatc agaaaacaat gaagcagtaa     45420
     aaatcaccga gatgtgtgga aatctgccat tagcgattaa tatatctgga agtttaataa     45480
     aattttcttg ctgtagttta agtgattata gatttagttt tgaaaatgag caacaaaagc     45540
     tagatatttt tgagtggcgt tctcgctcat taagatcttc gtttaatatc acatgggatt     45600
     tattgggtga gacattaaag agactattat caacaacttc aatttttgga ggttctagta     45660
     ttgacattga tgcactatca gtaatgttag ataagaaacc gattaaattg caattggaga     45720
     tgggaggctt aatcgcggta tccttagttt atactaataa atcaaaacac tataagttgc     45780
     acccactagt taaagaattt gcaactgaga agctatttga aagagaatca aatgaagtaa     45840
     atactttaca tctatgcctg gctagatatt atctaagttc tattaaatcc ggtaaactaa     45900
     actatgatca tatcaacgat aattatggaa atattattga aatagtttat tggacattta     45960
     agaattgcta cttcaaggaa gttgtagagt ttggtaatat cattggagac ttccttctgt     46020
     ttaaagggta ttggaatgat ggtaataaca tactaaggaa cacaatcttt gcttgccagc     46080
     agttagggta cgctcaaact gagttcgaaa ttcgcttaaa gctgagtgaa cttgctaggg     46140
     aacaggctga ttatgatcaa gctcaggaac aatacgaagc ttgtaagact ttttttgaag     46200
     agacggatca aaaatcgcaa ttggcaattg tatttcgtga attaggcgag cttacacgag     46260
     tccggcgcaa ttatttacaa gctcgcaaat tacatcagaa aagcctctta ttaaatatcg     46320
     aactggacaa taagaaaggg gaagcacaaa gcctccatga cttaggacta attgaacgta     46380
     tatttggtga ttataatcga gctatacagc tttttgaacg tagtttaaaa atccgtgaat     46440
     ctcttggtga tttattaggc atatcatata attatttgga acttgggatt attgctcgtc     46500
     taaaaaagga taaaaaggct atagagtttc taagaagtag ttgtttcgag tttgaaagat     46560
     ttggagataa gcgtggtcta gcatatgtat ttcgtgaact tggagaatta gctgttgatg     46620
     aaatggatta tgttgaagca gataagtttc ataagaaaag ccttcaattg agacaagaac     46680
     ttggagatca acggggtaaa gctataagcc tttatagaat aggacggctc aatcagcttc     46740
     agaaaaatta tgaattatca aagcaatact ttttagatag tattgctatt gctaaaaaac     46800
     tagacgataa gctacataaa gcctttaacc ttgttcgatt gggtgagctt gccaaccttt     46860
     cagggcaaaa gtcttcagca atagctaatt ggagacaaag tctagaactg tttaatgaga     46920
     tgcatgttgc agatcctgaa gcaattgaag ttaaagagct attaatgagt taatctagat     46980
     ttcaaaacaa tcttattttt cgaagaatta gaaaatcatt aaataaagga tacaataata     47040
     ttttatccag aagtaggtat attatttcta atatagatta ttatttttta gctgctacaa     47100
     gtattcgatt ctgagtggtt atgattcctc tatcagtcat atatgtttct actatttttt     47160
     ctagaacatg actgtcttct atccgatcaa aacctcttat tgtaggagtt tgctctaata     47220
     gtagaataag accttcaaag gagtagtacg ttttccaaaa cccattcttt gttgagactt     47280
     ctgtaaataa atgagaaaac tcctctctaa attcaatctc tcgttcacct tcatcataat     47340
     cacaaaattg ccctcgcaaa cctttactat ctcgaccgaa caaagctttc aagttccatt     47400
     tatccctatc tccaattttt tcaataattg tatgaccgcc tggcttaagt actctgtgaa     47460
     cttcacttgt attgtgagga gcaaccattg cagtaacaac atcaaacacg tgatcttcaa     47520
     aaggaagatc ttctgctgat ccactaacaa tagaaatatt atccaaattt gcgagcttaa     47580
     tattctcttc agccttgaag cgcattcttt cgttcggctc gatccctatt atctcttgat     47640
     agttagtaat tgaagctaac tgaattaact ttgttgcagt cccacaacca atatccaaga     47700
     gtctatgctg agttttcact acttttctaa tttcataaat caaatcccat ggacgatttt     47760
     cattaatacc tcttaatata tccatttcgt atgattcagt gtaaggcata agtattatta     47820
     atttggtaaa gtgaattctg caatgaaatt gggtctagta ctatatacga gtagactaat     47880
     tatcttgtat taagtaaata atgctactcg tatacaagac actagtaatt tgaatcgctt     47940
     aaatacactc ttgtcatcga catatcaaat ttcaatagaa tcataaaaat aatatatatc     48000
     tagtaagcaa ttgactctaa ctaatgataa aaaataaaat cagtctcaga aaagccatgt     48060
     atgtcaggct cgagttaagt ttttatattt gaatgcaatt gcttactata ttcttattag     48120
     gattattttt taatgaataa cttattttgt ttatattaat atgggatgcc tatagctaaa     48180
     tcttaacaaa gccttttact atcaacaatt ggttttctct tattactcta acataggaat     48240
     tttctgcaat attattctta atgtctttcc aaaaaaatta ccatctcagc aacaaaacaa     48300
     gcgatcgcac gtttctcctg ggtatatcgc agagatttct ctaagaggat tccttgtata     48360
     gcgaagtgat tcataatttc tgattttaag gctagattaa aggcccagta acgattcgtg     48420
     gaaaaaactt ttactttccc caaaacccaa ttctctacac tagaatggcc gcaagtccga     48480
     tcccagggag gttctcatgc cctctgcatc tatcgataag ctgaaccagc ttaaaaggca     48540
     gcttcaggat tgtattaacc ccactgctgc caagctactc aagagtacga ttgcaaagct     48600
     tgaagcccag ctcaacttag gccaggacca gatcgaggta tctaagatag accagataaa     48660
     gacaactaac acgaattctt ccaaggtagc tcaacggaaa gctgcacaca agaaatcaga     48720
     gaggaaatct aggcagaagg catctcaaaa acaaagaaca acgttgaaag ccccttcact     48780
     caacaaagta gagacaaaac catcagtaat ctctcagaac aagaagctcc caattccagc     48840
     ccaggaaaag ccgcatgtta agactgtaga cactcctaac agtaagaatt caaattcaaa     48900
     aaatcaaaaa caagcaaaga caacatcaaa gtcaaaatca ggtgaacttt ccgagaaacc     48960
     tccactgctc cctggaaatg gcactcatcg ggcttggtgc cgtattcccg gaattattcg     49020
     agtacgagag aaggagtttg aagacgggag aacaaagtct ctgtattttg tggaagttga     49080
     tggacaaccc atcaaactct tcctatcgaa gaagagcttt aagaaagtca agtcagtttt     49140
     agacaaacca gtcatagtgt ttggttatcc caatatcatg aatggtcaga ttacatcttt     49200
     gcagttaaca ggtacctcgc aacgggcatc agcaaagaca gagaactggg tattgatcgg     49260
     agtatggaga gcagataagc aaagggtttt gatacagcgg gatcaggagc gcgacccaga     49320
     gattcatatc cgccagcatt ccccgctcgt gagagaggac tgcctggaga agctcaagga     49380
     tggaaagctc tatgagttca cctgccatag agatggcgtt accatcaagg ttgtggctgt     49440
     tggagaacgt tcaacgcaga agagtaacgc tactgaatca actgaccatg aaatcactga     49500
     tccagaaatc aaagatcagg aaatcattga ccaagtcttt tctaaattgg agtcttccac     49560
     tctccaggta tgattgaatc tcgaccttcc ctcagcctaa acgttcgact aaccgaagag     49620
     cagcttggat ttctcgacta tttgtacccc aatattgatc cagaagatgc tttgatcagg     49680
     attcttgaac gggctaggaa ccgagctatc cgcaaggccg aacagcaggt acatatctta     49740
     catccacgcc aggaagaagc cgagcaacct gagacctccc ctgatcagcc catcagccag     49800
     gttgatgaac aggtgaagaa tccgattgga caattgcaag agctttgcca gaaacagcaa     49860
     atatcgttgc ccaggtacga gttttcagag atatcagaag ggtttcgttg tttagtacag     49920
     tcgatgggat tacagggagt aggcgaggga gcatcgaaga agaaagcgaa gatgggggct     49980
     gcggagatgt tgttgaagag agcagaggaa ggtctatgtc acatttcacc ctctaaaggc     50040
     taaggatgcg attttgaagt gatgtgaaca ttaaatttat ttttcgatta aagaaaagca     50100
     aatttcttca tggaagaatt aagacatacc tctgagcaag taatagcatc attctgtgaa     50160
     caatttagtc atattcccag gacaatcttc atctgaaata tatttgtcga atccgagttc     50220
     ttttagggag gctaaagaag cggcacattg cttgaagaac ggacaactgc tactcgtcaa     50280
     tttagaaaat ctatctccaa agtcggccca gagaataagt gattatcttg caggttgtac     50340
     taactcttta tgtggtgaat atacagaagt aggaaatggt gttcatctgt ttgctcctca     50400
     aacttttcca attgtgaaac aatccaagta ttgagacttt agtgcatttg aggattcccc     50460
     aatgactccc ccaatcgtcg ccctcaaccc caagcccgta cccaagacca tcccacaact     50520
     acctaagtcc gtcccttccg cacccaaact ggttagtagg acagcatttc ctaagaaaac     50580
     accggaagga acccggccag caaagctaga acaagggcat gaggagctgg gaggactacg     50640
     ccggagtttt aggcgtcctt ctcaatcaac taaacctgag ttcactccta agacacgatc     50700
     ctcagaagct ccccaggtca atcaaccgag aacccctaga gtgtcggcag agctggagag     50760
     gcgattcagg aatctggagc tgaagcagaa gaatctggtg gagcagacca ggacgcgagg     50820
     ggagctggag tatctggctg tttccaaaaa tagctcaggg agatactgga ttacagtggc     50880
     gggaacgggg aagccctttg tgaggaatac gtttgcttcg gctgagttca gttggggaat     50940
     cgatgttgag attgaaggca aatttgagaa tggatatatg attgagctct gcccattgaa     51000
     gacaatgaac taggttcagt agataatata aaatttccaa cttatgtatc cactgaatag     51060
     ccttcaaacc aaatggaacg ttgtggaaaa ggtattgtaa tattcgcctg atcaaaggct     51120
     tgtttcaaac gacgtcggta ctctcgcccc acatcccaat gtttcattgg ttgggtctta     51180
     atgagtatac ggattgttat actgctttcc ccaaaggcat ctacccctaa gatagttgga     51240
     gtttcattga tcaaaactcc ccaaatagga tcatgttgta gtttaattgc aacttcttca     51300
     atcactgcca ttgcttgatc taagtcagtg gaataggcta cctcaatccc tagattaatc     51360
     cgggaccatt ggtgagtcag gttgatagca gtggaaaaac taccattggc aatcgtgaca     51420
     agttcacctt ctaaagtcct caactgagta actcgaaggt tgagatactc aactaatccg     51480
     acaatgccat tgattttgac tacatcattc ttcgtgtatt gatcctccca gagaatcaga     51540
     aaaccattga taaagtcctt aatcagattc tgagcactta accctacaat tcctatgcct     51600
     gttaggacca gtgctagtgg tgcttgaatt gcatccagaa acattagaat gccaataatg     51660
     attacgacat agcgtgtaac ttcctgcaat acattggtta tggtgggagt tctaagagta     51720
     atacgttggt taggtgtatg gttaaaggca tcattctcag accatcgatg caacccataa     51780
     acaatcagaa tatcaatgat tttttttgaa atacttagaa ctaagagaat gccaataaag     51840
     ctgacaggta cacctactaa ccaaagacct gcttgacgag tttgaggaaa taacagtaat     51900
     gcaaatattg caaagctcaa ccaaatagct acttgactcc accacaatag agatcgtaac     51960
     gttagattga tatttttttg ttgcggcaat gaaagctttg gcaagtgttt tctaattggg     52020
     tgaccaattg ttgtctcctg ataagactca atggaagtct gtccatcagg aaaatcatta     52080
     ttttgtgttg ttgatggatt tttgatgttt ttggaattaa gttgtgtcca ttggtgcttg     52140
     agcagaattt gcagatacct cagaattagg ctaatgataa ttaccgctac caaaataatc     52200
     aaaaggtaaa aaagttgttg ctttaaatgc tcaggctgac gctctctgtt cgcttctaaa     52260
     agtgcagatt tgatcttact ggcctttact tttgcaattt cagaaattga gtaagatgta     52320
     ctatcaattt gacggtctag ctctgtgatg gtcataaggg gtagtttcca gtctttcccc     52380
     tgagcgatta tcacttcttg gttatttaag gtactggctg taactctaag ggcattaggg     52440
     tcaataccac tatttacgat tttttctaag tgggtttcaa tttcatttac tcgccattca     52500
     atgggcaaga tattgctttg actgtcggga tcatcaatcg ctgtgggtgc agcgacttga     52560
     aatagtgaca caccatcaag gcgcacatta gcaatgtgca tattgccacg ctggatgtag     52620
     tgaatattag gttgccgatt tgaactcgtg tcaagatgag agaagctggg aaactgggca     52680
     tgggctaatg acggccagaa gtagctcatt ccgcaaataa ggcagccgac gattcctgta     52740
     agaaagaatc ttgataaacg ctgtaacttt ctaggataca tagctatggt cagtaccaca     52800
     ttctcctgct tctacttatc cttaggttac agtctcatat atgctcaaca tccccacttt     52860
     tcagccatct tccagactga ccatccgcct cgcttcggac tttgcagcaa gatttcttga     52920
     gttctcctag aatccaggcc atagcttgga ttagctcttt tttatgggta gaatttaata     52980
     cagagaccta tcttttgtag gctttgcaga aatgcttaac tatgtttctg taggagtgac     53040
     agacattgat caagccacat cattttatga tgtgattctg gggatcatgg gatatgtccg     53100
     attgtatgaa gatccgggtc aattcgttgg ttatggggaa acgtggccag agttttggat     53160
     tacacaaaga tcagatttaa gccaagattc cgaggttagt aaagaaacat atatttccat     53220
     ttcagcacct tcctttgaag cagtcgatgc attttataaa actggccttg aagtgggtgc     53280
     ggaatcatcc gactcaccag gataccgacc aacttatggt caggaatttt atagtgcttc     53340
     aatctatgac cttgatggga atcacataga ggcgtcttac tatgagcttt ctagctttta     53400
     aaacagagtg gaaaccttga tgattactga ttaatctgga ccgtggagtc ggttgatctt     53460
     atcaacgaca aggctagcct gctgctccac atattcctcg ttgccgtctt atgagtgact     53520
     ttgtttatcc tcagttgacc ttgcaaaatg agttggtcgc cagcttgtaa tgcattgtgt     53580
     gctttctccc cattttctcc ccaatagatg gccttgagat tttccctggg gtcttcttcc     53640
     ctcagagggt taatttcaac gacgaattcc gcgatcgcac gtctttcctg ggtatatcgc     53700
     agggatttct ccaggagtat tccttggaaa gcacaagtgt tcataattca ttgattatta     53760
     gcctgggcat gcactgtgtg acgttttctg gcgataatcc cgaatttaac ccaaagacca     53820
     acttcatatc ttagaatagc cgcaagtttg ctcctagcga ggttctccca tgccctcagc     53880
     aactatcgac aagctcaacc aactcaaagt tcagcttgag cagtgcaaca atgacactgc     53940
     tgctctactc ctaaaacgga cgattgcaaa actcgaatct caactccaga gagagcagct     54000
     tacaacacag tctgccaagt tgactccaca agaaccgcca aaaacctccc agactatttt     54060
     caaacaacaa tcttcagtcc aggataagaa agtagtacct caacaacagc agaccacaaa     54120
     aaatcttcag gcaaaatcca agcagcgaaa ccatcgcaaa aagagacggc ctctgctccc     54180
     tggcaatggc acccatcgtg cctggtgcag gattccagga atcatccgag ttcaggaagc     54240
     ggaagcggag gcagaacagc cagtatattt catagaaatg gatggtcatc agctctcttt     54300
     gagagtaaag aagcgcttca gaaaattgat aggagcgtca ttggatactc ctttgatggt     54360
     gaaatgctac cctcaaatca ttgaaggtca aattgttttc ttgcagtttt gtggtgctgc     54420
     tgaatcggcc cctgagaccc cagaagactg ggtgatgatt ggggtgtgga attcagagaa     54480
     tcagagagtc ttagtacagc gtgatcagag atgcgatcag agcaggcgca tccttcaaca     54540
     ttctccgcta gtgaaagagg catgtttgga gaaactggag ggtggaaagc tttatcggta     54600
     tcaatgtcag agagagggat tcaccgtgac gatcgtgggt gtggaggttg ttgagggtga     54660
     ggaaggggaa attgttcaga aagcctcata gctctgaaaa accattgagc tatgagatca     54720
     gattccatta ttcaaattag ctctaccaac gatttccacc tcctctgttc tcacggggtc     54780
     tggctttatt cactttcaga gtgcgtccca tccattcagc accctctagc tcatcgatag     54840
     ctttagcttc ttcagcatca ttacccattt cgacaaaggc gaatccacgc ttgcgtcctg     54900
     tttctcgatc agtaggcatc ttgacctgtt tgacagttcc atattcagca aaaacggcgt     54960
     ttaggtcttg ttctgtagca tcaaaggaga ggttaccaac gtaaatcgac atgaagtaat     55020
     atccaagatt aatcatgctc atgctacccg atctctattt cccctttagg agtagaaagc     55080
     aatctttatg gagatcatag aatcggagag gcagtttatg aataggacat gattaaggga     55140
     cttcagttaa atgttgggag cttagcatcc atcaacccca atgcgtgacc caaatttttt     55200
     tggtgatagt gctttatcgc aaatcttagc taaacacgtt tcatttggag gttctatgtc     55260
     atcttctatc aatcaaggta tattggtcac tgtcatttgc gaagcggttt tacagcatcg     55320
     tatcgttcaa ttactagata ctgtgggtgc ttcagggtac accattattc cagctcaagg     55380
     tgctgggagt tatggtcagc ggatgggaga tattgaaggg tttaatacca atattcaagt     55440
     gaaaacaatt gtctcactag aggcatctga tcagatactt gaggatctgc agcaataccg     55500
     tgaatcacat gcactgatcg catttcgaca acaagtggat ggattatttg attaggttat     55560
     taacatcctc tcctactaac ctttcaggta cagagggaga ggatgtcaac tataccccaa     55620
     cgaagatcta gaagactgcc tgatcaagct tctagagtga gccaagagac aatccatccg     55680
     acgagcagaa caacaaacga gggtctttta tcttggtcat ttaaaaaatg ctgaacgctt     55740
     caatctcaca tgaagatatc gataatcaac aggtcacggc tataatttca cacttggttc     55800
     ggcttggtcg ggagcaagat tatgaagaat ggatccgtgg cttcagtgct gttgctcagc     55860
     agtttcgtgg ttatggggga ttaaatatcc ttcgaactag tgaacaagtt catcctgaat     55920
     atgtcttagt gcttcgcttt gactgctcaa gcaatttcaa agattggcta gaatcggata     55980
     ctcgaagtga atggattgag cgtctgcagc ctttgatagc aagaccagaa gatattcaag     56040
     cgatgaccgg attagaaacc tggtttgtgt tgcctcaaaa gctgcataag ccatcaattc     56100
     ctcgctacaa aatggtgtta gtaacctggc ttggagtatt tattgttcta gcgatcctga     56160
     cgcggatttt ggctcctctt ctatcgatgt tacctctgtt gctcaatcag ttggttacaa     56220
     ctgggttagt tgcattacta ctcacctatg tcgtgatgcc acagctaatg aagctctttc     56280
     gtcgatggct atcgtcttga cgatcactcc attcaatcaa atcctccata agttttcaat     56340
     cggttcaaat cccttcaccg tattctcaaa catggcttcc actcgttcaa atcaacctgc     56400
     ttcaattagc accgataaag tgtttctagc aaaccctgcg ccatctgatt taccttcaat     56460
     agtggccatc aagctagcac ctccaatcaa cagtaaatat tgctgtgaaa atgcttcagg     56520
     ctcccgaaca cctgcttcag tcgctaaccg cataacatac tgtcgaatcg attctctcac     56580
     actcatcgag atgtgatggg ccggatgaga ggcatctgca atttccaaga caacgttgat     56640
     gaacggacat cctcggaagc ttgggtcagc ataccactct tcaagtacat caaaggttgc     56700
     tagtaaacgg tccttcgcag tattaccccg gtcttctaca gccacttcaa accactctag     56760
     ccactgcatg gcgcgatgct tcatgactgc ttcaatcagt tcatctttag aggcaaacca     56820
     acgataaagc gtacgcttgg caacaccaga ggtagcaata acttcattga taccaacatg     56880
     ctgagtccct ttctgataga acaaatcaga agctgtattc agaatctttc gctgagtttc     56940
     attgagtttt tgattcattt ctgattaagt agacaagttt gtctccatag agttacgata     57000
     tcaccaaccg cagggagaca gacttgtctc tcaatagata tagttatgaa actgaactta     57060
     tggacttcaa aatttacacc cttgagacag ctccagatga gtctaaggga gcactccaac     57120
     aggctgaaca aacgttcaaa tttatcccaa atctggaagg aatccttgca gaatctccag     57180
     ctaccttaaa aagtggtatg gcactttggg atctattcga gacaaccagt tttactccca     57240
     ttgagcaaca agttatttat ctcactgcta actatgagca cgaatgtagt tattgcgtgg     57300
     ctgcacactc tggtttagcc aagatggttg gaatgtctgc agaagatatt gaggcaattc     57360
     gcaatggcaa acccctaata gaccaaaagt tgcaggcact acgacatttc accaaaagaa     57420
     tgatttcaga aagaggttgg gtaggtgatg aggagattga agaatttttg gcagcagggt     57480
     atacccggca acaaatttta gaagtgattt taggtattgc cgtaaaagtc attcacaatt     57540
     acacaaatca tattgctaaa actcctttag ataaggcttt tcagccctat acatggtcaa     57600
     agccttctgt cccttagaaa gccatcaaca taacatgcta tatgatgcag tttgttgaat     57660
     tagaaacccc aatctttagc ctcaacccca gccccccgac tgcccaatcc tgacactcca     57720
     attcccaagc tctcagatca gacagcattt cccgaaaagt acctgaaagc acatggcaaa     57780
     atgagcggga gccaggatct gcaaagtgga aaagaaccat cgaaattcac ggctatcttc     57840
     cagaccactc caaaattatt tatacaatgt cccttttaat gaacgcatgc tggtcagggt     57900
     atctttgaat tcagttcaga tttgtccacc tcttataaaa gtctgattaa tcgatttttt     57960
     gctaccttag ttcaaagtaa cggttccaaa tctgattcaa ggcaagatgg ataaatattg     58020
     aagtggtctt aacatgtttt ttccaaaact ttgtcggttc ttgaaagaac ctatagatcc     58080
     actcaaaacc tatttccttc atccaagtgg gtacgctgga attcaaacct gcataagctg     58140
     gaaaggctcc accaacaccg atcatgactg cctcaatctg attcttatgt tcagccatcc     58200
     aatattcttg tttaggagag ctataggcaa tcatcaccag ccctgcacca ctgtgtttaa     58260
     tccgctgtat cagcttttgc ctttgatcta gtgttaaggg tcgaataggt aaaggttcca     58320
     ttcctgcaat cagcagctct ggaaaatctt gtgcaagtcg atgtctcatc ttttgcagta     58380
     tcaggcactg tgaacctaga aagaaaatgc tgaccttctg ctgagaagct ttctgacaaa     58440
     ggcattgcat taaatttaag ctcgttacta tttcttgtgt tttcactccc attctcttca     58500
     gcagccacac caatggcata gcatttggtg tgactatgtc agaatcgttc agcacttcac     58560
     caaagctagg tttttgatga gcatcaacta gcatatgagt atttgcaatg cagaccattt     58620
     tacttttgtg ttgctttgcc caaactagga ttacattaac cagcacatca ataggggctg     58680
     cagtgatgag agagccaatg acatctattc gaagcggttc catatcagtt gagaatagct     58740
     ctgaattagg atctttggct agcatttcca tagactcctt caaataaaaa gtaggcaaaa     58800
     aagctacttg ggaggaaggg ataaaagctg taacactttc tactaataga gcaataagca     58860
     taattgagga ttaaagcttg gctctatttc cagtgatatt agcgacctca agaagaagaa     58920
     tatttttaaa tgcttagcat gtcagtctaa aacggcaagg aaaaagtgaa aattatgtag     58980
     aagacagtga tacgctatat ggaaaaatat gtaattaagt agaatagaaa gatataagat     59040
     ttattctctc aatatacgta aataatttta aatcatattc ttatgaataa gcttattcag     59100
     ctagtgatct aaatatagac accagttaga attcttgcta gattgagatt tatcccaata     59160
     gagtagtcag tagctaagtt aatttacgtt ttttacttca tgattttagc cttttcattc     59220
     tgttataaaa atagataaat ggagaattgt taaaaagatt tgtagacttt ttagatagtc     59280
     agtatttagc aagtataaag acagataact agggattgat taaagtcggt ttaactaaga     59340
     aattatctca tagactttat cttatagaat tgcttaaaag gtacagtagc tcataataat     59400
     cccaatctta aaccttggtt aaagagtaag tgatgtttat tagtaaagac ctcgttcttt     59460
     ctcaactttg aagtctctgc attagaataa ccgcaagtct gcatctatgg agcttcctcc     59520
     atgctctctg tgactatcga aaagctcaaa atagatttga cattctcgcg tgttgaccgc     59580
     aagataggat acccagcctt aagtgcatgc gctcaatatc gagcaaacta tagggtcgaa     59640
     gaaagttgtt cgacactaac tggtttgatc aaagagggcg tcaattttcg tgcttatttt     59700
     ttgtatatag accatcgata ccgacctcac tgttgttcaa ggatgaccga atttatgtct     59760
     acgacgatta gcattctggc tggtatccct gaggagcttc atgagacgtt gataaattac     59820
     ttggaagacc atcctgattg ggatcaagat cgggttttct cagcggcact atcattattt     59880
     ctgatgcagt acggtcaatc agaccgtagg acagctcgtg tttatctgga tagtctattt     59940
     aagaaagatt tgccaaccgc ttgttaatgc cgacccccca gccaatctcc agtctaacca     60000
     tccacctcac ctctgaacac cttggcttcc tcgcctatct ctaccccaaa gaagatccag     60060
     aagacgcact gatcaagctc ctcgatagtg cccgaacccg agccattcgc agagcagaac     60120
     agcaagtgag agtccttcat ctagaccagg aagaacccga ggcccccgag gaagaccccg     60180
     aggaacccgt gaacttgtct ggtgatgtgg tggagaatcc gattgggaca ttgcaggagt     60240
     tgtgtcaacg gcagcaaatc tctatgccca gctatgagtt tgagacaata ccagaaggat     60300
     ttcgctgttc agtgcaggcg atgggcttgc ggggagttgg tgagggggtg tcgaagaaga     60360
     aagcgaagat gggggctgcg aggaaattgt tgggaagggg ttgttttggg atggatagag     60420
     aatcccagca atcagaataa attaggattc ataaagtcgt cgagagacca atctttatgg     60480
     gaattatcta gtacccgaac actattttta tccattccct cattgaccac cttagaacga     60540
     actcttttag gctttacttg aatcccaaat tgattaagcc aagaaatatc tagctcccat     60600
     tcatacttgc ttcttttgat ccaaacctga aactggtcat cgacatattt ttgggtttta     60660
     ggcatcgtcc agtggttgac tttagcgaga tgctgatcag caatctctcc tctacccttt     60720
     acattagcta aacccctgtg tttgacctca tgacaggatg ggcaaagagc gattaaccct     60780
     tccaactttt ggatatgctg gtcatcatcg tagtgccaaa tttcgtgaca ttcaacaggg     60840
     tgcttgggtc cacgcccacc acaaacctca cagcgattat tagccttctc atatgtcatt     60900
     ttccttagct cattccaatc ctctttactc acttcagaac gaacattaga gaaccagcag     60960
     gatcgaggga ctaattcaat agtcaataat tggcgtggct tagctttccc ttctttagtg     61020
     ttcttcgctt caatcagccc ttggcttcta agggattcca tcacatcaac taagcccagt     61080
     ggtttgcatt gataatataa ccaccctggt tgatacccct ttgctttacg cttagcttcc     61140
     aactccaaaa cccggtcggt atccagagta gaaaatttag ataaattagg tttttctgat     61200
     tgcattttcg attatttcaa ctcttcatgt ttagcgtcag cgattgcatt agttttgagt     61260
     aatctaatga aatttttaat tcagaaaagt ataaaagcaa tattccgatt gaataagaag     61320
     aatttgctct agatcataaa tatatttcaa gatttaagct gttttaggaa tttaaataaa     61380
     attaaaatcg aggttatagg aaaggaagta ctctttattg gggctttcag cgagtattct     61440
     agaaatcgtt ctcttggaca ggattaatcg tgccttcgcc aacagccaat gatcatcaag     61500
     gaccgacctc agagccgatc aaccatttga ttgacgagca gatggatcag attactgatc     61560
     ccaatctccc gttcatggag aaatttggta gggcggcgct tcaggttgca atcgctgtcc     61620
     acgaaacaga aggcagaggc atgatattgg gattgcagag tcccagttcc aaaaagtttg     61680
     tctacgttca ggaggagaaa actgccatcg cattgtggat gaccgccgtc tccattaagc     61740
     gcaaggtcgc tcaactgatt gagcaatatg accctgatcg agaagctgtg gtagtcatgg     61800
     tcgtttcccc gaccgttcag ttgtatcgag catcagcagg caagatggac ctggttgaaa     61860
     ttcaagaggt ggagcaaacc tccatcaaac tacccgctgg tgtgaagatt aaatctgaac     61920
     aacaggggca ggtttttacc tacaacttca cccatcagaa gttagggaaa ctgggtcgaa     61980
     ttgtcgtcaa acctcatcgt ggcaatcaag ctcaaattga ctacgagcta gctgatactg     62040
     gatttgatcc aaaagccaaa cagcgacagg aaatttttgt ccctcttgct caggaactga     62100
     tgcaacgaat tgatcttggg ttgatgcggt agctgcggaa ctattggctc cttctagtgt     62160
     cattgggagt aaccgatgag gtacgatcct aggcttgagc atgtatgaac agactgcctg     62220
     gagtattcac gaaacgctga ggatgtgcct ggacttggtc gcagaggagt actggtttat     62280
     gaacaatctt cttccctttc aagcaatatc gccccataaa atccgtgtgt ttcaccccaa     62340
     gtcatttgaa gatgctgaga aagcaatcaa cgcgatgaaa acggatgata tgctcctagt     62400
     gaatttggcg gctttagaaa ccaagctagc tcagaggcta acagactact tggctggtag     62460
     tacttttgcg ctgtcaggag agcaaatgga gattggtaga ggcatttttc tatttgctcc     62520
     accatcattc ctgatctcaa gaataatggc ttctggttga atcatgcacg cctatactct     62580
     actgatcgca catcaggtct tcttacgaga cttttgagcc tttgagtttg ttgctttaga     62640
     ttcagcttgt aggcttggat cgtagatata gcacattggt acgtttgctt ttttccaaag     62700
     attattttta gccccctggt acatggcggc tttaatccta ccccgctcag ctttctgatc     62760
     atctttactc agttcaccaa acagtctcac aatcaaatca tcgtaatgca tgactttccc     62820
     aggattttcc tgcatgatct gtgtgatcgc atcaattttc ttcatctggt catagggctt     62880
     gttcattgtc agaacgctgg atgaagggct gcttgttttc ttctgatttt tcttctttgc     62940
     tgttgcttga gatacagctt tcttgggagt tgaggatttt ctcttcccgg atgagggcga     63000
     agcttttgga gcggcttttt ttggggtagc ttcagctttg ggttctacgg ttccctttgt     63060
     ctttgcagtt gacgctggtt tctttggagt tgcagacttt ttctttgatg cagctttttg     63120
     agtagttttc ttagacttgg ctttaggttc tactgtgttg gtaactgttg agtctggcgc     63180
     ttctgaatct attgagtctg cttcaccttg aaggattgaa aggatatcag agcctaacaa     63240
     tgggtcttca atcaacgtat ccagagacgt gattttagtc ttgagttgag ttgtttgagc     63300
     ttctagttca gcgagtgtct cctggtagtg agtctttagc tcaaggagca ctgtggagta     63360
     tttgttgtca gcggccatag tttgttatag atcggtgtag ttttagcaaa ggtaagaaag     63420
     ctaacctata gcattcccag aattatcttc ctttgtatct aatcattaat gggctaaatt     63480
     cggaatttct ggaaggttta gacatttttc tcttagcact caatctttgg ggttgagaaa     63540
     tattgaagca ggctcgaaat aatagactgg gggattcttg agtacctaac tcatgcattc     63600
     tttccaaatg ggagccatcc agcctccacc cgtcactcca gaaccactct gagagttatt     63660
     atcattgcct gtccatcttg ggtctgtcgt aaatatttag attgaaggat ggtctgaaaa     63720
     gcatagcggt tcatagtggc atggatcatc aggcggagta gtggatttgt gacccttctt     63780
     agctaaacct cagctttttc tctaatgcca ttctgcttaa actagaatca tccccaccta     63840
     gcgattggtg gaattcacca atgatatcca tttctccatc acaataagag gaaggcagaa     63900
     tgagagaact gacgtatttt gtagcttgca gtgtggatgg gtatattgca catattgatg     63960
     gttcacacga cggcttttcc caagatcctg aatattttgc agatgtcttc gccacatttc     64020
     ctgaaaccgt tccatctcac ctacgtgatg cattgggtgt tcatggtgag aacaaatggt     64080
     ttgatgtcgt tctaatgggg cgaaagacct atgagatagg gttgaaggaa ggtgtaacaa     64140
     gcccatactc acacctaaag caatacctct tttcacgcag tataaataca agcccggatg     64200
     agaatgttga acttgtgtct aacaatacaa ttgacttggt gacaagtctc aagagtcaat     64260
     caggtaaggg gatctggctg tgtggtggtg gtgatttagc tacaacactt tttgcgcacc     64320
     acttggtcga tcaactcatt ctcaagatca accctttttt gatggtttca ggtataccac     64380
     ttttctcagg tgtgattcag cagacggctt tagaactgac ggatcataaa atctatgaaa     64440
     atggtgtact gcttctttat taccgagtaa agtgattaat catttgattt atttgcatta     64500
     gccctagact gatggaatca tccagtgcct agacctcagg aaaactctaa cactgacctt     64560
     ttgttgtagt tagtcataat aggtttaaca gccaatattt ttggttagct agacaaaaat     64620
     ccgaaactat ttgttatcaa tgtgaatgct cggctcggct aacttattgg agagtagccg     64680
     aagtctaccc agacttgatg gtatccctta atgttgattt gtggcgtgat ctaccaatac     64740
     tatggtctca cctcatagga atcatcagtc aagctttact cgtcgattta gtgttccaac     64800
     gctcaagaaa gaatcattct tgaaaatgga tatctgttat gacaactcac atcaatccag     64860
     aaacagaagc tctggaactg aacagtccaa aaccacgatc agccgctgta gagcagccgt     64920
     ttaattggct gaagcagtgg tatccaatca gcccgctgag ttatttggac agcacttgtc     64980
     ccactcccat caccatactc ggcaaaaagt tagttgtctg gcaccatgaa agacagtgga     65040
     cagtgatgga tgatacttgt ccccataagt tgacacagtt atccctcggc aagattcagg     65100
     atgacggcac tttggtctgc cgccagcatg gttggcaatt tgactgtagt gggcagtgtg     65160
     tcaagattcc aatgctggca gactcaggtt cctcagcagc cgtttaccgc aatgtgagat     65220
     cccacgtatc cacttatccc actcaagtcg cccaagaact gctttgggtg tggcttgatt     65280
     gcagttcagc cgctcaggaa gaatgtcagc aaaagcagcc tgcaactcta ccagacccta     65340
     gtgagcaatg gactgaggcc gaatggcatc tcagcgatgt ccccgtcggc tataccgtct     65400
     cgttggaaag cagccttgac ccgtctcatg cccaatttct gcatgagggg atcttcgggt     65460
     tttccccagc aaccgcgatg cctatgcgcg accttgaact agaaggtgag atgagtgccg     65520
     aggatggttt tatgctcagg catggaggct acaatgcctt taatcaaggt atgagagcta     65580
     cacgcaggtt ttgtccaccc tgtgccaata tgactcagta tcatttgccc acaggtggca     65640
     tccagatctt ccaattgtat tttgtcccca ccacaccggg ccattgccga tatattggga     65700
     agtttgcgat cgatactcct cctcctgcac cccgattcaa cttttttcag tgggccaacc     65760
     gccagttatg gggattgcta cctcaggatg tgcaggtggg tctccaacat ttgggagctt     65820
     acaaactcag tgatcaggac atcactgcca tgcatgccca agagcagaac gaggcggcag     65880
     accccgaaca ccgccgaaca tccttcttcc ctacccctgc cgatcagggc attctaactc     65940
     taagaacttg gttcaagcaa tttgctgagg gtggacctgc caccaatact ctctattctg     66000
     agggagtgga aaccaccagc gatgaacagc tctacgatcg ctggcatcgg cacactaaac     66060
     tctgccccag ctgccgtcat tcggttgaca ggctggcgaa tgctcaaaaa ctgtgtcagc     66120
     gtctggccat tgtatctgct gttctagggg cagtgatgct cttgctcccc atcctcccct     66180
     tgcgagtgag tttgggatgc ctcgtgatct caatctttag tcttttgggc taccaaggac     66240
     tatcccaatt gcaacatcgc tttatgagca gcatcccaca gcaaggaagt ccaaaaataa     66300
     cactctatgc cgaatgagaa aaccattgtt gatgtagttt tttcagaaga tatcgggtga     66360
     cctgatcttt atgtctcctt gttgttgaaa catatcagcg tcagcaaatc tctatgccca     66420
     ggtatggatt tgaggtgata cctaaagggg gtcactgcat ggtgctagaa atgagactgt     66480
     ggggagcagg taagaggcgg tcaaagaaac aggcgaaggt gggagctgcg taggattagt     66540
     tggatagatt tcggtcagat cgagatagag tgattattaa tcttgaaaac acattctgaa     66600
     agacttaaga agtggagact aattgcggtc agttctggct tgtactaaga tttggagcac     66660
     ttctgcatca gtaatctgag aaaaatcatc ataccaatat cctactgaca taagatattg     66720
     agattttaga ggacaaacga tttgatccac atcagcttca agttctttgc tagtcgatgt     66780
     tgatgcgaca gggacggcaa cgattaaaaa gtctggttgc ttcctttgaa caaaagcaat     66840
     agctgctctc attgttgctc ctgtggctaa accatcatcc accaaaatga cggattgatg     66900
     gttaattctt ggaaaaaatc gcttgtgttc ataaagctgt tcatatcgga gtaaggtttg     66960
     tctttcttga gtggtaatca gttcaacctg ttgatgggaa atcataaatt catcaatcat     67020
     ggtcagattc aaaatgcgaa ctccgttcgg agcgatagca cccattgcca gttcagggtg     67080
     ctcaggaacg catagcttac gaacaggaca gacctctaaa ggaagatgca atgcttgggt     67140
     aatttcatag gccaccggaa caccaccccg aggtagtgcc agaaccactg atgatgaaca     67200
     ttgagcacag tgttgtaaat gtgtcgcgag ttcttttcca gcctcagatc gattacgaaa     67260
     gcggagcatt atgatctgga ataccttatt ctgcccttgc tgtttgagtg tatcactgag     67320
     tttttgagga ttagaatctc agtcgtggag aaaattcagg gggattccct tttggtacct     67380
     gcattagcta gagggtaaaa agctctatcg gcatgaatgt tagagggagg gaattacatt     67440
     cgtgatcgtg ggtgtggagg aagtggagaa atctgagcat ataatctcat agcccaaacc     67500
     aatgagctat gagatagatc ctgtaataca aattgtctct agaagagatt cccagcaacg     67560
     aagttatcac tacccattct atttacccga ggttttgcct tatatactgt gagagtcttt     67620
     cccatccact cccccccgtc cagttttttg attgctttgg cttcttcagc ctcattatcc     67680
     atttctataa aagcaaagca ttgcttcttg ccagtctcgc ggtcaatggg gagcttgacc     67740
     tgtttaacgg caccaaactg tgaaaaagca gtttttagat cctgctctgt aatggcataa     67800
     gagaggttac caacgaaaat cgacatgact tatcatccta aattatcaat gtgtgtagag     67860
     atttagctat cggtgtatgg gcttgaaaat taaaccggat aaaaccagtc aatcttgaaa     67920
     gcaaacacta aaacgaatgc ttgtacctca ctgctgatgc aagcttatcc ctaatattac     67980
     tgactgctat aagtttcgtc ttgacagacc tagcaaaggc gcacttgtgg gagtgcgcca     68040
     gacaaaatca cctatgcaga tgtgtattta gcgagatgca aacttgacaa gcatacatag     68100
     atcttagcaa attaaaatat agatatagat tgattttagt ctatgtataa aacaacgaaa     68160
     acttaaggtt aaagatggcg aggaaagcat ggatgtacgt aagttttaca acaatctccc     68220
     tcctcaagaa tccttaccgc taaactaacg gtgcgttaga ggactccccc ccatgaccac     68280
     ccccatcatc agcctcaacc ccaagcccat ccctcagacc accccaggcc aacccaagcc     68340
     cgccccttcc gcacccaagc tcctaagcaa aacagccttc ccaaaaaagg caccagaggg     68400
     aacccgacca gctaagcggg aaccagggaa aggagagctg agagaaatac gtcggagtgt     68460
     taggcaacct ccccgatcag ccaaacctga gtacattcct aagacacgat cctcagaagc     68520
     tgcccagact agtcaaccga gaacccctag gatttcagca gagctggagc ggcgattcag     68580
     gaatctggag ctgagccaga agaatttggt ggagcagacc aggacgcgag gggagctgga     68640
     gtatctggct gttgccaaga atggcttcgg acgttactgg attactgtgg ctggaacagg     68700
     gaagcctttc gtgagggaat cgtttgctac accgagtttc tgctgggagt gtgtggttga     68760
     aattgaggag aactttgaga ttggggaagt gattgagctg cggccagggg agactatgga     68820
     gcggattgag gagatgattg gggtgtggtt ggagcgggag agggtggctg ggatctgggg     68880
     gtgattgagc tactcacaaa atgcaggtct aataataaag attgtgatga gacagtagtt     68940
     cccaaagcta aaataaatag ctattcatag caaatttaac ttctaaaatc agacgactcc     69000
     tcgacatagg aagagttaat ttgtgaaaac aataaaaatc ctcaacaaaa ccacaaccag     69060
     ctttaccgta gatattttct atattgttat gaccataata attgatgata cccatatccg     69120
     tagagtctct agttaaggaa aattgatcct tcagtctttt gtttctatga ctacctttga     69180
     caaaaacatg attcccctct gatacaggca catcagtaag gtagaacatg aattttataa     69240
     agcgatagtc ttctagatca taatgaaaat tgaagaatcc tcttacagcc tcattcaatg     69300
     gtacggttac tggaaaagtc catcgaattt gactatctaa tagcactgga attgtttcta     69360
     aatatttggt agcgatttct ctaagcttag aatcattttc aagtttttta atagctgggc     69420
     atattaggga actatgaata tgattagcag taacgaaaat ttgttgatac tttaactctg     69480
     acttttcttt gtctgacagg gtgaacttca acttaggatt actattagca tgatattcta     69540
     cttgagttga aaaagctaat acctcatgta aaatatctga tggtaagtta attccaaaga     69600
     atagaccatc ttttttcaaa tgttcaacaa ctttgttgac atcaagagat ggaaataatg     69660
     tattaccccc ttgttctaaa tcttgatata tctgagcaga agaatgttta gtaactaaga     69720
     ttgcaagaga tctcagtatt tgtatccgag tagcacaaaa cattacaaac cactttggat     69780
     ctgctattgc ttgataagag tattgaagac actttcgttt aagtttcgac caaagacgtt     69840
     ggtagtaacc actcatcata ggctattcat caggaatgtc tcgctgttca ttaaataacc     69900
     tgagttcata gagagttgag caacactcta ttggactacc ctgtgattgg aacattgcga     69960
     aacatttctg tctttggtat gacaatatca atggtggtgg ttctttcggg tatttcaagc     70020
     caaaaatagc cctctgctga tgcgttaagg ggaagggtct ggagtgtaat gaggccagtt     70080
     gagttgatga tttgtttata cacttcgttg gtttctgaat gtcgagcttg agtatcacta     70140
     agatcaaatg tttcattctt ggtcgcattc tctgcaaggc gacggaaccg gagacggaca     70200
     tttacaatat tgcgggtgcc tttctcaggg tgcttaatac gcttaacaga tattaattcg     70260
     acggtagctt tactattgaa tgctggttgg ataaattcgt ctgctttgct ctctgagacg     70320
     ctttgaggcg cttcaattac agtatttgaa tcaggcactg ctgtaggttc agaggaaatc     70380
     cctcctaaag gactaggatt tttatctttg tcatgagtag gatcttccga taggtttgct     70440
     tgtgggtaaa gaaccccacg tgtcgtcaaa tctagataga gaacggcccc actcatgagt     70500
     aaagcgagtg tagaaaatac taaagcgata ccagacaaga aattattcat ggtctcacat     70560
     agattgaaaa cccaaaaata aaaatatgca gacaaatgga acccctattt aggagaaaac     70620
     agttactcca caccctaaga gaacctctac cctacattgc ttttaagaaa ctaaggttat     70680
     tgccataggc cgttaagttc ctctattttt cagatggcga aggttcgagt atacggatat     70740
     ctctagccga aactactggg tagtgttttg gtgatatggg ttatttctca gagcctacga     70800
     ggtaaaggtg aataatgtga gaattttgct taagctagtt tatctacagt tagtttgata     70860
     ctggtacgct actttagatg atttgtatgt gcttcctggc tcagtacagg acaaaaagct     70920
     tgaaagattt atagaggtgg ggtttcaata ggattaccac aatccctaga aaccccatga     70980
     cacaatatag cgaactcaaa cgtgcactcc aaccccacct gaactggcat ggtgcccgtt     71040
     tatcatttct gaccttattc ttgttggcct tgttcaaggt aaaaaccgtt aacctgagcg     71100
     aattagcact gggatttgac gggagcgctc aatccgactc caagtacaaa cgtttgcaac     71160
     gtttttttcg agggtttgac attgagtatg aaaccatcgc caagcttgtc atcgactgga     71220
     tgcaaattcc acagccatgg gttttgagta ttgaccgcac cacctgggag ttgggtactc     71280
     actgcttcaa catcctcagc attggtgttg tccatgaggg agttgctttt cctctgttgt     71340
     ggtggatgct tcagaagaaa ggcaactcca gtagtgatga acggatgcag tttattgacg     71400
     cactcctgca tatctgccct gatcctcaaa tccgatgttt gtgtggggac cgagaattca     71460
     ttggccagct ttgggttcgc tatttacgct tagcgccact cttgccattt cggctcagaa     71520
     ttcgagcgac ggataaaatt gagcgccagg gcaaggccct tcaaaccaag gtggtttttg     71580
     ctcatcttca agtgggtcag cgccagcgac tcaaaggtga atgtcgtgta tgggggcagc     71640
     cggttgcagt ggaaggactg cgattggaag atggtgcgct gctggttgtg attggtccga     71700
     cacaagatga ccagcttatt gaggattatg ccttgcgatg gggaattgaa actctatttg     71760
     gtattttcaa aacgcgaggc ttttgtcttg aatcgaccca ctttactgag gttgaacgct     71820
     tacgaaagct atttgctcta ttgactttgg cattgtgttg ggcgatgaag acggggctgt     71880
     ttttacatca actcaaaccc attgcactca aaacccatgg acgtcgagca aagagtctat     71940
     tccgtttagg atttgaccat ttacggcaga tgattctcaa tccttctccc gataatgaac     72000
     gtgagtttct gaaagcttta caacttttgt cctgtactta ggcttcctgg ttgttttagg     72060
     gtgacgcttt gaggcagttt tagagctaga gaatacgtat atctttcatg tagcacaaca     72120
     gaattagacc attgcgccaa atttactatt gactaggttt ctaaagacgt tttcgatcta     72180
     ctgatgatgg gtagtttcag ccctagcggc taaggttacc cattactgtt ggttcgatgg     72240
     gtgtgaatat gactggaaat ttaatagttg actgtcgaat ttctgtgcaa gtttagatgt     72300
     ggtcatcgaa gggatgttgt catttaggcg tccaacaatt agcattgcac ctaaattatt     72360
     tcttcgaaaa gcaaccattt cagaaaacaa ggagacattt ctcgcttttg caatcactgc     72420
     cataccagtg gaaacttgac caatcttttg cgataaggaa ggggcaactc tttgctcaac     72480
     aatatttact gaacccaaat aataattact ctttttaata cctgtcacaa acttttctaa     72540
     agcactcggc tgctctaacc ctagatcaaa catctgaaca gcattctcat tatttagcgg     72600
     ggtaacaaac ccaatgatga gggtccattg attcagattc atgtaagtga ctaaatctct     72660
     gatctggatt tcgttactac caaagtggtc actaatggtt gaagatatgg caccacggat     72720
     aagtgaactg attggggtgg ggacttctcg aaatcctgga ggtaaatctg atgcgactaa     72780
     ctttggcgga cgaagactac ctgctgtatt ggggattgct acagcagatt gcggagtaaa     72840
     acacttcagt atgtataagt caataattcc aggtattatt cctataatca aactaaaaat     72900
     tattagattg gtaattttgg tagttttatt cattggaaaa aatagtcgtc tctgttgtct     72960
     aaatgagtga gagatcggaa ctgcgttacg aaatatcaac ctctgaaaaa ttgaaattgc     73020
     tcaagtcaat aaaaacactt tataagtagg ttaaatcttt taagctaagt ttgatattag     73080
     ctttaagaaa tttctttaat tcaaagggtg tgttactgat tgcttgggag gtgaaacgcc     73140
     gagtctatca ccggcttcct tgcctatggt aagttcaaat taatagcagc gtatgctctt     73200
     gtttctgaat gcacaatccg atatctaggc attttaagaa ggtcgttctc agtctactca     73260
     tcatcaattt gatggtatcc tgctttattt ttaaggctgg aaacactgag ccatataatg     73320
     agcagcggat tagaggagct atcgttaagg tttattcagt tcgcaataag ccagactacc     73380
     agaagccttg ggaaacagtc attaaacgca gtactggttc tggttttatc atcgcagaca     73440
     acaaaattct gacaaatgcc catgttgttg ccgatcaaac ctttgttgaa gttcgacgtc     73500
     acggtcaagc caagcgttat agggctcaag ttgtcagtgt tgctcatgaa gttgatctag     73560
     caatcttatc ggttaagaat aatgcttttt tttcaggtgt aacaccctta gaatttgctg     73620
     atctgcctga gattcggcaa gaggttgctg tctatggttt tcccacaggt ggaaacgctt     73680
     tgagcactac aagaggcatt gtttcacgta tagaacatca gttttatact catagcagcg     73740
     agtactttct agccgcgcaa attgatgctg caattaactc aggcaatagt ggaggacctg     73800
     ttctggatgg caatggccaa attgttggtg tagcgatgca agcaaggaag agtgctgaca     73860
     atattggata tatggtacct gtacccgtca taagacattt tcttcaagac cttgaggaca     73920
     agaccttcaa cggtttccca ggcttaggac tcgtttatca aaagatggaa aaccctggca     73980
     tgaaacgtag ctatggaata tccgagaact taactgggat actagttaga catattcttt     74040
     cagaatcccc tgctgaagga ttcattcgtg ccggagatgt catacacgcg attgatggac     74100
     atgctattgc tgatgatggc acagtcgtat ttcgacaagg agatcgaaca aattttaatt     74160
     actatataga tattcatcaa gtgggtgaga cagtcagtat tgaatttttt cgaaattcca     74220
     agctgaagac agtaatgctc actctaaata aacaaaaaaa agatttccga ctagtaccac     74280
     ttgagcaata caatgagcta ccaagatatt ttatatttgg tggaattgtg ttttctccat     74340
     taactaaaaa tctcattaaa tcatggggaa ttaactggtc aaaaacagca cccaaagagc     74400
     ttttgataga gctgtcaaat tggccctcta gagagaaaat agagatcgtt gttgcaaccc     74460
     gagttcttgg ctctgaggtg aatcgaggct accatggtat tgcgggttgg attgttaagg     74520
     aagttaatgg aaaaaaattt aaagatttta gcgaattttg tcaactcgtt acaacttcaa     74580
     attctccttt tgttgccttt aaaggtgcac gtaattttca aattgttata gacaaaaagg     74640
     aggctgaaga aagccttgat gaaatcctga aaaattatcg aattggagca gcttattctg     74700
     aagatttaaa aatcctttca gctgttggag agccgaatag ttagtaggga ttgtataagg     74760
     agtattccct tatttagaac taatttttta caatattatc gagggttaga acgtgtcctc     74820
     aatcaagtac ttggatagta cttgattgaa ttggtgaact aggagttcca ttaagattca     74880
     ttagtagttt agattcaaaa aaatagataa attcctataa aatcagaata agattctgaa     74940
     tataccaaaa ctacttgtta ttggcgcaag aatatttcga agattatcac caacctttgt     75000
     caggccagac cgaccaacta ccaccacatc attgttccga agggcaggat tgttctcctc     75060
     gttcagtggc tgttctaagt caatcttaat ttctctttga gtcacggttc catctggatt     75120
     taagcgaatg agttttactt tgcttttatt cgctctgcga tcatcaaacc cccctgcagc     75180
     taacatggca gtattaagag gggtattggg ttgaatcttg attattccgg gccgtttgac     75240
     ctcaccaacg acattgacgt caatagtggc gggggcaaag cttattgtgg ataactcagt     75300
     caattcggca gcagataaac caaccgcttt gggaacaacg atggtatccc cagcctgcaa     75360
     ggcgatatcc tgtgataagt ctcctgcctt gagtagttcc cacaaattaa cgattatctc     75420
     ttgaggattg ccattgtgag ggcgccggat aactttcact tggcgaatat ccgcttcagg     75480
     tttaatccct ccagctgttt gtatggcttg agtgacagtg ggaagttcag tggaagcggc     75540
     tttagcatta cccaatgtgc ctgcttcttg gacatctgca ctacctggac ggatggtatg     75600
     aggaccaggt cggtaaacct ctccaataat agcgatgttg atgggttcag accgatctga     75660
     agaaaaactg gcattacgta tgagtaatgc gttggagaaa tcaacggttg tagtggtcgg     75720
     aattattacc gtatctttat cacgcagttg cagattttga cttaaatctc cttcttgaag     75780
     cagttgtaat aaattaacac tgatgaattg ttctttccca ttctcctgtg gacgacgaac     75840
     cttaatttgg ctgatatcag cggactggga tgcaccacca gcaagctgga tcagttgggt     75900
     gacggtagga atttgggtag gagattcaac gggatatgta ccagggtgcc gaacttctcc     75960
     agaaatagct aacgtgacca ctcgggcatc caccaaaact atggtaataa aaggacgcct     76020
     atagaatcgg atatatcgtt tagctatctc tcgttcagct ataccgattg agcgaccttt     76080
     gactaacaca cgaccaatta gaggaaggct caccgtacca tcgactaata cccggtaatt     76140
     agtggtgaat agattgggtt gtccaaacat agtgagctgt atttcatctc caggtcccaa     76200
     gatataggcc tgttgattga ttaaagtatc accagcttgg gtattaggat tttgagcgat     76260
     agagttagat ctgatcgaag agtttaactt ttctttcggt gaaatctcag ccattgcaag     76320
     gcttggagac atcgtagaaa ggatcgtaat gaatgcaatg gtctggagag agcgaatcat     76380
     cgtagacacc ccagcagtag atccacttgg aaataatatt aagtataaaa ctattgctta     76440
     tacatgaata tgacgttttg attaggattt aaactcaacc ataccattct taaaatgagt     76500
     gaggtgtttt aagattatca agagcgattg aaattgacca tcaacatcga ctaaagcatt     76560
     attgctatat caaaaatttc agttttcttt ctcttaatta gtcgatgctt ctattattaa     76620
     ggataatttg agtactgttt gtcaattagt taatgtatga atctagtgaa aatataaaat     76680
     tactctaatg ccaggtttac agaatattct tctagaattc tataactatt tcggtgaact     76740
     accatttatt ggagtcactc tcatactcgt tggtttagtt agttttcgag ctattccgat     76800
     gtcaactgat ttggcaacaa gctcggctgc tggcttggta ggtttaatat ggggcaactc     76860
     tcaacgaacc ctcgttatta attcaacaac taatctccca gagttaggga tcatgcttgt     76920
     gtcattattt gggctaggtc gactaggagg aattgcaaca cctcttggat caaatttatc     76980
     caacgtttac ttaatcttta ttgtttcacc tatagtttta atttgcaaat ggattttgat     77040
     taaaaatcca aatcatatca acaacttgat gatattagca aagctagaaa agcaattgat     77100
     tctctggcat gtatttatgg cactattaat gttctttttt gctagttttg cctacttaat     77160
     tttaatggga gactttcaat ttattcagca ttcagaaggg aatgccgtat tagacataat     77220
     gagtttggta atttccataa tagttagttt atgcggtgtt attgtttttt tgatatttga     77280
     gtcaaaacta aaaaaacgtc ggccagagct atttgaagat atcgatgata ccaactttga     77340
     ggcaagctgg tctcgctttt ttcttggcgt aattatgttg tgtttatctt gttatatctt     77400
     gaatgactta tttgcagttt ggaccgaact atttcagaac cattttgtag aatttagctt     77460
     gttccccaca atccattact ttattggtag cttaatctct tctttaccag agatgtctgt     77520
     agcggtaggt aattatgagc gacttagtag cccagactta aatactgcct tagggtctgc     77580
     tagccagtca tgtatgacca atttgttgat tgctggttta ggtagtgtta tcgctttggt     77640
     gctctcaatg gttgggctgc ttcaagagat ctagaaagtg atgggcaatg agtataacct     77700
     aatcagggca agtccttaga tgtaaaggtg tttacgctat tttctagaaa ctgtttccaa     77760
     taaatagtag acaagtaaaa tgaaggatat ttaatagcta aatatggata agatctggct     77820
     aagcattcct tcacccgata tgatttcagt cacccaacct aatagaaacc caagcatggc     77880
     gaggcgacca tttaaagtct cagcgaaatg agtgaaaccc cacattggtt gtagttctgt     77940
     gctcatgttc attacctcaa ccaagaatta gcagtaagta aagcatagag gaaaaactaa     78000
     tttcttaaga gagattaata acttttcaaa actgaactgg cagttgcttt gtcgtttgca     78060
     acatcaagaa tatgacatgc tgatagtaag ttttggcatc ttcgaccgct aaggaagaca     78120
     gtcattactc gaatgatagc tcagcctcgc tatatatcat cagtagttga ttccaacgaa     78180
     ttcgttttaa accttccata atccagtcat catcactgct atctagagtc tctagcaaat     78240
     gttgaacgag gtgttgcagg gtatgagtct gatcttctgc tagggtggtt ttcaatgctg     78300
     gagcgaacaa gaggggttgt tgttgtctag gtcgataaat caatagaggt tgatcgacct     78360
     caggtatcag ttgagtgcat ttggggcaag gatgtgtctt aaagctcccc tccactatct     78420
     tctggatcaa gtccggctga gtagattggt ccacaatcca ccaaacatta actcttacac     78480
     tttggtgaca gtgaggacac tctacatctg tgaatttaga atatgagtgc tccaaggatc     78540
     tcttctttgg agaattgttc tgggtatcct cttgatctat ttcagacatc atctgaatcc     78600
     tagaatgagc aagctgacga taggtcaacg atataggatt taagcattat cctaaaatca     78660
     ttcttcaaca tttcaatcag tactgtgaac aaaatgttga ggggcttaat tgaagttctc     78720
     ctccatccac tgaaccccaa attgggttag agactgagca tccaataggt acgatcttgc     78780
     cccgccgacc tttcctgtct gagcagggtg ggttgccaaa taatctttga cgatagtctc     78840
     gaagtagttg tctggccagt ccacaatccc attagtcgta tcaaattctt caaagtccat     78900
     ccacacccgt tgaccattct ggagtatggg cattcggtag cgatcaatcc acttattagg     78960
     cacatcagcc aaatgctcag catggtggag cagggtgacg tcaccaatag gtgaacccag     79020
     cagaagcaca gagccactca cctcacagag ttttgctagc ggtgaacccg gaccatcccg     79080
     atattgccaa ggctgttcgg ctgtgatcca ttgggcaagt tcacccaccg cgacgtatga     79140
     gaacggatga cggctcctat gcgcacctgg ccaagttcgg agatattcgg tgagaattcc     79200
     catttctctc caatcggccc gagactgaga cggatcatag gctgggcatt cgcacagata     79260
     ggcttcttgc ctgtgtttgg gccatcggga caaatcgtag ggattatctt cccagcttgc     79320
     catcatcatt aaagtgccag cgtctgttag gagtgacaga atagctgcca gcacaacatc     79380
     tggtccaccc acaacccatc caatattccg aacagaggaa tgaagcatga tcgtctgctt     79440
     cttgcagact cctaatttcc tgagatcttg aatcaactgg ctcttagtaa tgagctgttt     79500
     cttcttcatg tggctcatga tgaagttgtt gtttgaagct taagataaat caaaaggaat     79560
     atctactgca actcgctctt gtccttcagc cttgacctga gacagagcta gatcttagcg     79620
     ggaatggcgc taactacacc caagctgatc aagatgcgat ctcacccgta agcttttaca     79680
     acaatccctc tccaatcggt gagcctagtc gataaactgg ctgtgtgtag aggactccac     79740
     ccatgactcc cccaaacatc agcctcaatc ctaagcccgt gcccaaggca atcccacaac     79800
     cacccaaggc caccctctag ctctctagaa cggattcttt actgacttcc cctacgactg     79860
     attccacagg ctcccccgtg aacccctggc atcgctttcg taacttcggc tgacggtagc     79920
     gattgagaag attccgctag ggcatcggta tgtactcgat caggctagtt aagctcaagg     79980
     ttggacagcc caaggctctc acagatttgc tttgagccaa tcatcacagt gatgctcaca     80040
     gccattctgg gtgtcttggt ctttggaaaa accacctccg agatagataa ctctgtcctt     80100
     aagacttgat gacgcaattg caagatggga tcggggatgg tctggttgaa ggtagtcaac     80160
     tatccatgtt gatttagaag ggtatttgca tttgcgttcc ggtccatttc tgaatttctg     80220
     aatctttgag tgttagttga acaacacata tttgccgctg gatatccaat agtttacgag     80280
     cgagactagc ctgtccaata gcccgagagt cctgttcagc ttgtttagca gcagcatggg     80340
     tctgtgttgc tagattcttt agactccgaa tatgtttccc taattcatta tgtccgtgca     80400
     tggtgtcagc catttggaac ctccgattgt ctgcgttggt gaggttgagt cttttgatag     80460
     ctaaatagtt ccccgacaac tgattgctaa ggacatggga tcgcacaaat taactttaat     80520
     cgtctgtgga gttagtctgc cgacctgagt gcgctgcttg ttgctgcgac gattagaatt     80580
     aattacgaat ggatggcttg tctgcaatca ttcccatacg caacgctgta aggcatcgaa     80640
     gaattagtca cgcgataatc gataatatac cgccagaaga aataataccg taaatactag     80700
     ggtcaatgtg cctaaatcta ttgcccgttc agagtttatc tcgttgatct tgcagctttt     80760
     aggagtggca ctcaggagta attcccttcg gatagtcttg attacaagaa tgatggcatc     80820
     cgcttgattt gtgtgaggag tcttggctga accctgctat atcagcaatc tcccatcagg     80880
     acttcttagg agatttctgg gttttagccg tttaggatgc ctcaggttta gcctgtgact     80940
     tttcctcagt gaaataactc atggattctt tcggatcttt gcgccaacgg tttttataga     81000
     cgccactctg catggttttg tacactcgat ctcgctcagt cttgaggtcg tctccactca     81060
     gttctccata aagctgcaaa actaagtcat caacgtgaac cgaagtgcct gccttttctt     81120
     gcatgatttg tgcgatggca tcagtcttaa acatttcagt gtagggccat tgcattggcc     81180
     gactgctgga tgaagcttta gttgctttgg cttgcttttt ctttttggcc tgtctttgag     81240
     atgctgcttt cttggcagtg gaaggcttct tcattgaggt ggagggtgaa gcttttgagg     81300
     tagctgtctt tggagtagct tcagctttag tttctactgt tccgcttgtc ttagcagttg     81360
     aagctgattt tttttgagtt ttaggctttt tgtttgaagc agctttttga gtagttttct     81420
     tagccttggc tttaggttct actgtgttgg caactgttga gcctggtgct tctgattcta     81480
     ttgaggctgc ttcaccttga aggattgaaa ggatatcaga gcctaacaat ggatcttcaa     81540
     tcaacgtatc tagagaggtg attttagtct tgagttgaat cgtttgagct tcaagttcag     81600
     cgagtgtctc ctggtagtga gtctttagct caaggagtac tgtggaatat ttgttgtcag     81660
     cagccatagt ttgtcgtaga ttagtgtagt tttagcaaag gtaagaaagc taacttatag     81720
     cattcccaga attaacttcc tttgtatcta atcattaatg ggctaatttg ggatttctgg     81780
     ggcgtttaga aatttttccc gtagtactta acccttgggt ttggggaact tggaaggtgg     81840
     ctcaaaatac tgaacaggtg tatcttttaa cgcctcactc ataaactctc gccacacagg     81900
     agccatccat cctccacccg ttgccccaga cccaatccgg gcgtaattgt cattgccagc     81960
     ccacacggcc actgaaagtt gaggcacata gcccacaaac caaacatccc gctcggagga     82020
     agtggtaccc gtctttccag ctgcggggcg accaatctgg gctgctaccc ccgtccctga     82080
     ttgcacgacg gtttgcaacg tactgttcac ggcagcagca gcccaaggat tgagcaccaa     82140
     cttgggttgc ggggtattgt taatcaacac tttacccgta ggatctgtga cttgcaaaat     82200
     ggctgttgtt ttggactgcc agccattatt ggcaaaggtg gcataggctg aagccatctc     82260
     tacgggtgtt aagtctactg cccctaaggg aagtgaaatc acattgggga tcgggctggt     82320
     aatccctaat ttgcgactga catctatcac attcttgatg cctacttttt gccccatgac     82380
     aatggcaggc acattgcgcg attgcgcgag cgcttgacga atggacatcg agccctgaaa     82440
     gctgcggtcg tagttttgag gcttatatcg ctggagccca ccatcattga agctcacggg     82500
     agagtcttta accatagagt ctggggtgta cttccctgtt gcaaaggctg tgtaatacac     82560
     caagggttta aaggccgagc caggttgtcg atacgcttga gtcgctcgat taaattcact     82620
     ctttttattg tccactccac cgacaatagc cttgatgaag tgcgttcttg gatcaaccgc     82680
     gactaatgcc atttggtctg cggcataggc atagtgttga tgattcctgc gaacggtctc     82740
     ctcagcgatt ttctgcattt tccagtcgag ggtcgtttga actcggaatc cccctctaac     82800
     caatgcctct cgaccaaatc tttccgttaa ttcttgaatg acggtattgg taacatcagg     82860
     agcttggctc cgttgatagg aggtaatttc tcctagagtg attttctcag cccgagccgc     82920
     ttcagcttca gcgggtgtaa tccatttcag ctcctccaaa cgtccgagaa cgatgttctg     82980
     ttgttctttg gccaggtcta aatccacaaa tggactatac ccttctggtg ctttgataat     83040
     cccagccatc atggcggatt cagctaaggt cagatcttca gcagacttat tgaaatagct     83100
     ccgggcagcc gtttctaccc cataggtgtt atggccccaa tacacctggt tgaggtacaa     83160
     ctgtaggatt tcatctttac tgagtaattg ttcaattctc agggctagca ctgcttctgc     83220
     gagtttgcgg ctaaaagctc tttctggggt cagatagagg tttttagcca gctgcatact     83280
     cagggttgaa gccccttgca ccgtttggcc tgcctggtaa ttggtgatgg ctgcccgtag     83340
     aataccgacc ggattaatgc cgtcatgctg ataaaagttg ctatcttcaa tggcgagtac     83400
     agatagtttt aggtggggcg agattttagc tagagggacg acctggcgat tctcttcctc     83460
     atgcaagccc gtgagtaact tgccgttgat gtcatagata taggttgttt cgttgggtga     83520
     aaagctagct aatgaagtca catcaggcag atcacgataa ctaatcgcta cccccatcag     83580
     tcctcctgct aagccagcac ttcctaggag ggtcagggtc aatatggtgg tcaaggtagc     83640
     atcgcctatc ccccttaaaa agagggtgga ggttgatcta gaggagaagt cctgaggaga     83700
     agtggcacta gatgacatgg gtgtattaat gggcaacctt aacacactaa atttagagtg     83760
     tgaggttact gataaaaaat gactgagaag cttgctatac ctaaagtctg cccatattca     83820
     acaaaagttt tacgctcgtt cttaaagaac catcatctct gcaaagtaac tcaacaatat     83880
     ggggatttca tgagttagtt aaacaaccca gagtatcgat gactatgtta acgacccgtt     83940
     aaagaattgc ggaagctagt gattcgttgg ccttgggaac acctcccaaa cgtcgctcaa     84000
     gcaaggtgta tcgttgccta tctttgatct gcctgacggc catgctaatt gcgttcttag     84060
     gaccaacgag catcgctagc ttttttgccc tcgtaagtcc cgtataaagc aggtttcggc     84120
     tgagcattat gtaatgctgc atgtacatgg gcaagatgac gacgggatat tctgacccct     84180
     ggctcttatg aatggtgacg gcccaggcta acccaatttc atttaaatca gccaaatcgt     84240
     aggagactga ccgctccgca tactgaaccg tcacggcaat ttcttctaga ttgatggcct     84300
     caatgactcc catatcgcca ttgaagacct cgcggttgta gtcattaacc tgttgcagca     84360
     ctcgatcccc cacccggagt gtgagtcccc ctcgcgtgag ttcagccttg tcgggatgag     84420
     gaggattgat caacgcttgt aagacttggt tgagcttgcg agtccccact tccccacggg     84480
     tcatgggaca gaggacttgc acatcccgtg ccggcacata cccaagttga gggataaggt     84540
     cgttgattaa ctcttgaatg gcttgaactc cttgctccgg ttccggtgct cctaaccaaa     84600
     ggcaatcgga cattggagat ggactgacgg attctaactg ggggaactgg ccttggttaa     84660
     tacgatgggc attgcggata atgtgactgg cttgggcttg gcggaagatc tccgtcagtt     84720
     ccatgacggg aatctgttta gcggtgatca gatccagcaa aacatttccg gggcccacac     84780
     tgggaagttg gtccgtatcc cccacgagca agagttgagt ctctgggcca atggccttga     84840
     tcaaagagtt tgctaaaaac aaatccagca tagacgcttc atcaatgacc acagcatcag     84900
     ctactagggt tcgctctgaa tccctttgaa acttcatcgt tttggggtca aactccaaaa     84960
     ggcgatggat ggttttagct tcatgacccg tgacttcact cagtcgctga gcggctcggc     85020
     ctgtgggaga tgctaaaacg atttcttttc ccatcgcctt ccacagcgcc acgatggtcc     85080
     gagtcgtgaa ggtcttgccc gttcccggtc cgccagtgag aatcacgaca cgctcactag     85140
     cagccaactc caccgcctgc tgctgttgtt gagagagatt aacatccgtt tgggccataa     85200
     agcgctctag ccagctgcga acgcggttct tatccacctt gattgggtga gccaagaggt     85260
     ggaggagtcg ccgggatagg tgaaattcag cccggaagaa cggcggtgca taacaaagca     85320
     gctccgtcga agtttctcgc tctatctgtt caacgatcag ctcagcatct gagatcatgg     85380
     catggatcag atattccacc tggtctggct tagggtgata ctcagggagg gtcagctgct     85440
     ttacagcgcg gtcaatcagt tgtggttgag gaagatagca atgcccttct tctgatgatt     85500
     cgctgagaac atgtaaaaga ccactgcgat accggtattc agagtggggt gagataccta     85560
     agctgcgggc tatctgatct gctgtgataa agccaatgcc gtaaacatcc gtcgctagtc     85620
     gataggggtt atgggtgacg gtttcaatcg cctcatctcc atattgcttg aagattttga     85680
     cggcataagt tgttgagacg ccatgccctt ggagaaatac catcacctct ttgatagctt     85740
     tctggctatc ccaagccgtc tgaatcatct tgactcgctt cttcgcaatg cccggtactt     85800
     cactcagacg gtcaatgtga tgctcaatga tgtccagggt atccagacca aagtgagcga     85860
     cgatgcgttt agcagtgacg gggccgaccc ctttgatcaa gccactgccg aggtacttct     85920
     caattccagt aagagtggcg ggtttggttt ctttgtattg cttgacctga aattgaggac     85980
     catatttggg atggtctcgc catattccct ggagttgaag ggtttggccc gcttggatat     86040
     tggcgaagct acccacgatg gtaatcaatt cacgggttct gggagctttc aatctggcaa     86100
     ccgtataccc agattcttca gaatgaaagg tcaagcgttc tacgacccct tgtagttgct     86160
     caatgggggg tgaactcatc gtggcagaac cattggacat gggtggttac ctcaatgtta     86220
     gatgctgatc ttctctgaag aaatgaactc cattgaaatg aaggggaaac gttttgttta     86280
     agaccgccga aatcaagccg cttcaacttc agctagaggt gattcatctt cttcaccatt     86340
     tgtgtcagca tgggctgcac aatcagctcc caacgccaac ctctggcgga cctgttgctc     86400
     aactgcttgt gcaaactctg gatgatcggc aaagtactga atggtattct ctcgaccctg     86460
     accaatattg tcaccctcat agctatacca agcccctttg cggacgatca cctctgcttc     86520
     cgcagccatg tctactaagc aaccgatggt ggatattccc tgcccaaata gaatgtcaaa     86580
     ctccgctagc ttaaatggag gtgcgacctt gttcttggcg accttcactt ttgcccggat     86640
     accatacatc tccgtgcctt tcttcaaggt ctgaacacga cgaatatcca agcgaacgga     86700
     cgcatagaac ttgagggcgt tccctccagt ggtgacttcg ggactgccat aagtaacccc     86760
     aatcttttga cggagttggt tgaggaaaat gacggtgcta cctgacttgc aaatgttgct     86820
     ggtgatcttg cgcagggctt ggctcattaa tctggcttgc aaacccatat gggagtcgcc     86880
     catatcccct tcaatctcag cccttggagt gagagcagcg acggaatcga cgaccactaa     86940
     atcaacggca ctggagcgga ccagctgatc caccacttcc agggccattt ccccagaatc     87000
     cggttggcac acgagcaact cagagacatc cactcccaaa gccgcggcat aaaccggatc     87060
     taaggcatgt tccgcgtcca caaacgctgc cactccccca gatttttgga tttcagcgat     87120
     cgcatggagg gccaccgtcg ttttcccgga actttcaggg ccatacactt caatgacccg     87180
     acctttgggg agccctccgc ccaaggctag atccaggggt aaagcacctg tagagatggt     87240
     ttcaatctgc atccgagcgg catctcccag ccgcataatc gcccctttgc caaaggtctt     87300
     ttccacgttt ttcatcacca aatcgagggc tttttgcttc tcggtcattt ccgttttggc     87360
     actcataagg ggatctccaa aggatcaaga tggggatgct agaccaatat agtaatcttg     87420
     tactaaaatg gtgtcaacat gatactttta ttcacgattt gccgcctcac cgcgtggttg     87480
     tcatggcgat agagacactg actgatttgg taggattccc agatggctgg ctcgttggcg     87540
     tctcatgttc cttggagtgg ggataccagt gttgggtgat taccccagaa aggcaggtcc     87600
     atactgacgg tgagttctat gagagtagtt ttgtggcttt gtctgcgggt cgattcttgg     87660
     ttgagcattc cttggaggtg gagtgaaaag tgaacccatc gttatgtctt gggaagagta     87720
     tgaactcatg ccttggcggt tgggctggaa gcatgaatat ttcaatggga tggcttacct     87780
     cacgcccaga cagcaatctg ttctgaccgt catcgaggtt gccccccgaa acgataccct     87840
     tcagtccatc aagatccgac ctgttgtgcc aacggatgca actgaactca agcatctgtt     87900
     ctttgaggtt tttcacgact ctgttgaata ttgcaattat gaagagcaga atattcaaga     87960
     atcagcccaa agctgtattg ataactattt tggcgcggtc aaaggtgaac cctcaaaagt     88020
     gtcatgcgtt gccacttcaa cagaggggga actcatagga acagctctag taattgagca     88080
     gcctgaacgg cacccctatc ttcgtttgtt aggcatctcc ccatcatggc aacgccgtgg     88140
     tgtcgcaacc aacctaatgg cgacaatact caaccaactc gttaacacct cttttaccca     88200
     gctagagagt cgatatttcc tagcgaatga agcgagtaga aactggcacc atcaatttgg     88260
     attccaggat cagctcgact tatttgtcgc tcgtctgttt taccggcatg cccagcatga     88320
     attatggcgg caggaaaaac tcggtcaact ctcgaagata gacctggccc gtttggcatc     88380
     tgaagtcgaa tactggcagg ctgaagtgga tcgtcaagaa gttgcctttg aatcaactta     88440
     cccccgtgaa ctgtcctaac agattgactt ctcatcatca acggacaaag cccaccgctc     88500
     tgcattagaa tgaccaaaag tttgtcccag ttagctacct atgcctactg ctacttctga     88560
     gaagctgatt cagctccgag cgcagctcca agactgcacc aaccctactg ctgccaaaat     88620
     cctcaagagt acgattgtta aacttgaagc ccagcttagt ttaggacagg ctcagactaa     88680
     ggtatccaag attgaccaac ggaaggcaac actaaagaat tcaaataagc agaccaagcg     88740
     gaaggcagta caacaacaac caataacgct gaagcctcct tcactgaata cagtagaaac     88800
     aaaacctaaa gcggaacctc agaaagaacg acccacacta cccgcccatg agaaaacatt     88860
     gttagcggat gatgtactga cgcagaacga aaatattgca actcagaaaa gccttgaatc     88920
     aaagtcagaa acatccccta agagtaagtc ccgtttctcc cctgatgtca ttaaagtagc     88980
     caagcggctg gtcctccctg atgaactctg gcaacgtcct caagtccaag gcatcaccat     89040
     cgatggtcct acttcgcggg acttggacga tgccatctgg attgaagcga ctgagtcagg     89100
     ggcagtcctc tccgttcata ttgctgatgt ctctgaactc gtggagatgg gctcaatatt     89160
     ggataaggtt gcactctctc gcacagtcac acgctatttc agcaatggga atgcacccat     89220
     gctgccaaga cccctgtctg aaaataagct gagcctgctg gaaggtgaag cccgacctac     89280
     cgttaccgta caggttaccc tcaacccgaa cgcccagatg gttgacgtca aaatctttga     89340
     atcctggttg gtgagtcaaa aacgctttac ctacgccgaa gcctcccagc ctaaatcatc     89400
     tactcctttt cataacactc tggaaatggc tcaccaatgg gcctcacatc tgtaccgaaa     89460
     tcggctgaca tcaggttcga ttggggcgac ccagacggct caaggccagt ggctcacaga     89520
     agaaggcagc cttatccaag gtaaacttca tccaagccat atcctcattc aagaatttat     89580
     gatcctggcg aacctcgccg tcgctcaatg gctagccgat caggatatcc cagcgctgta     89640
     tcggaatcat accgccagag ccattgcccc agatcgggaa acgatgtatc aaacgttgtt     89700
     gacgttaggg tcaaatgcag ccattcgtca gcggttgcac agttggatga accgggccgt     89760
     gtatagcccc gtcttaatag ggcactttgc cctgaacctt cccgcctatt gccacttcac     89820
     cagtccgatt cgcagagtcg ctgacctgat caaccatcgg attgtcaaag cccgcctcaa     89880
     acatcaaggc ctaccctata cccagtctga actggtgaaa ttgggacagc atattgccca     89940
     ggtcaaggat gagcataaag agcaggcctc ggagtttttt aaagcagccc atcaaaaggt     90000
     ctaccaggag caacttcaga cccccgaaga cttagcaaat ctctctggga aagaattcac     90060
     acgactcctg aaatatgcgg ttgagtctca gggggttgat caccttcgca gtgaactatt     90120
     gacccggtta tacgctgagc aactagccgt acaggatctc tacctattgc tctttcagtc     90180
     caaagaactt gagctacatc agcaagtgat tcagtatctg tctagccata tccatgatgc     90240
     ggcgagtgtg atcaccattg cctccaatcg agaagggaac tgggaagcat ttaaatatct     90300
     agaagcggag aataaaccac cattccatgt ttggctagag gtgaaaattt ctggagacac     90360
     tttaacgacg attcatcccg ctacccattc ccgcaaacaa cccgctcgtc atcacgcttg     90420
     tttgatatgg atagaagctt atctccagac tagcttagtc tcaccagagc aacgagcaca     90480
     gccagtacta cctgagccgc agttcaagtc tggtaatgaa gacataaaac gagtaacagc     90540
     acccttatcc aaatcaatgc atacggcatt ggtgaagccc cttaaggagg ggcagaactt     90600
     tgtcgggatg ctggttgatg tttgtcaaac cttaagatgg gagacccctg tgtacacaat     90660
     ggacagctcc gatgaatggt ttatctgcga gtgtgagtta tcggttttag gtcagcagct     90720
     tgaagggagt ggggtagcaa agaagaagaa attggcgaag agtatcgccg ctagagagat     90780
     actggagcaa ttgagagaac gaggtcaaca gcaattgcaa gagtggctgg agagagcaac     90840
     ttaaccgcat agagaaaact ctctcccagt ccattcttcc tgagactggg agagcccatc     90900
     atcgaatttc agattgcgtt aaaaacggtt tcgaccacta aagttgttat tacctctatt     90960
     gttctcacgg ggtctagcct tgttcacttt gagtgttcgc cccatccatt cagccccttc     91020
     gagttcttca atagccttgg attcttcggc atcgttgccc aattcaacaa aggcaaatcc     91080
     tcgcattctg ccagtctcgc ggtctttggg aacatgaacg ttagagacgg ccccatattc     91140
     agcaaacacg gcctgaattt catcttgggt aacgtcgtaa gaaaggttac caacgtaaat     91200
     cgacataaac aaatatccaa aatcaataag gtgaggagat atagatttcg gtgcgcggtc     91260
     ttgggaatta aactggcgga taccaaacaa ttctgaaaac aaacgtaaaa ccgatacttg     91320
     catctcaatt gcaatactaa ctgatcccca attttccgtt taggtgaact aataaacttt     91380
     acagatattt aggttagtaa agattaaaat tttatcccca gattttcccc acatttccca     91440
     caatatttcc catgttatcc acatctgatg ggatgatttc cacaggtcaa tactgtaggg     91500
     cttgatgttc agctatttct gtggaatatt ctagaaactg aagtcagctt attctatgat     91560
     agatatggct ttgaggccat taaatgtatt tcaaaaatag attgacattc tcgtaggttg     91620
     gtagcaagat ataactccca gcgataaggc ttgcactcaa cttaacaagc tgaagggcgg     91680
     aggagtttta ccaccagctt ggttagctca tgagggcaac atttgttgtg cttagttttt     91740
     gaaataaaaa ccatcgttga taaccctact atttgagaag agtaaccact tcatgtccac     91800
     tacgattagc atattggccg atatccctga agagctacat gatgccttgc gaggttattt     91860
     agacacccat cctgattggg atcagagtcg ggttctttca gcggcgctgt cgttattctt     91920
     gatgcagaat ggcacaacag atcgccgtac aactcgtgtg tatttagata gtctctttag     91980
     aagagaacta cccactgcct gctaatgacc aatctccagc cctctttcaa tctgtccgtt     92040
     cgacttcaaa gccaataaat aacgatcgca atagccagtt tcatttgcga aaaaccttca     92100
     cttgattgct aaaggccata gcagcttgaa tcgaatcaca attagtggtg actaattctt     92160
     cactaaaaaa tggaaactat gtcttggaag aacaggtttt ataccggata gttacaattt     92220
     tgtccttttt tatcattgcc actttattcc tcaaccgcag tgatgccttc cccgtcaatt     92280
     taccccgggc aaagacagta aaacctcagc tattgcccaa ggtaacggtc acgattgatg     92340
     tgcaggggga ttcagccctc aatcgagaac ccattcagct caattctctt gaagcataag     92400
     tgaaggagct aactgattca gctgacaagg ttgtggtggt gattcatgca gatgaccaag     92460
     taaggcatgg ccgcgtcgtg acggtgatgg atcgcattcg cgtaattgaa ggcgcgaaat     92520
     tagccatgca agtgtctcag gtcctagttc ggtgatatta ctcagggcac ctagctacgc     92580
     tttttataga ttatggaaac atcaaataac cctatttcca gatgttccca tatatcgatg     92640
     agctccccat cccagcaaca attgattcat taccttcaaa ccgatttagg ggtttctgaa     92700
     aaagcgattg atcttgcttt gcgtcttcaa cagcctttac aggggtcgct tcatatcctc     92760
     ctatggcagt atggcttgat caacatcgaa cagcttggca aagctattga gtggttgatg     92820
     actgaaagag gggagactac aagcaaggaa tgatactctg actgatgcct tggaggggca     92880
     ccgttagact gttggcgatg ctacttctgg tgaaattttc cttgctactc tcactgatgt     92940
     tgagagaaag cgtaaatatt tcacagcaat tttcaactct cttgccaatc attgatcagt     93000
     caatacctga agctgcgaga atattcctta gatcaggtat tcagaactga tattcccata     93060
     aatttttagt atatcacggc aaaaacttta gtatttttag acttccaaca aaattcgcct     93120
     cataatctga ggcatcgcaa ggtaagcccc accagctcaa agctgaacat cagaaaagtt     93180
     tgtctgattc ggcaaattat ttctcctcaa aaccacggac gtttcggcaa atttatattt     93240
     tgtttggaaa ttatattgag taatttccct gtcgtcaggg agatgggata aaagccacga     93300
     tcaagggtgt gcagtagggt acccctgttt ttcccaatat cttcagttgg cggaatgtcc     93360
     aagtgtctca ttatcaataa ttcccacttg agagggttag tgaaacacct gaccattttt     93420
     gaaaagaacg gtctttaccc aaacacatac agcttggtcg agctgggtca actaatcagg     93480
     agaatacatc atgagtaatc cattcgctca gctgctggcc cagcagttac acactcttgt     93540
     caaaataaga aattgctcat cgcatcagga gaaggggttc gcactccctc tcgccatggg     93600
     gttaggcttc gttatgatct tgctggggat gtcctccatg attatggcgc agagtgatcg     93660
     gatcactgct tggaatcgta aagaatctgg tgcaagttta gccgtatcag aaggaggaat     93720
     ggctcgcacc ctggcccaac tcactcaaac ggataaccgg atcttattga ctcgaaacta     93780
     tgacaccatc aatcccaaga ctggaaccac ctatctaggg cctgatggca ttctcaattc     93840
     tggggacgaa gagcctgcca cagtggatga atggacaggg tatacgggca gcagctcaac     93900
     gccctgtgat gcaactgcaa agacaataac cccaaatgtc actttttcag gagcgatgag     93960
     ctcagggggc caatttcagc tcaaagccta tcgatataat cccacggatc aaaccgggac     94020
     actcctcgtt gagggtcaac atggagagag aatatcccat attctctcta ccttggtcat     94080
     ccagtcagag attgagaatt tcccaggggt tctggccatg cagggagccg ttattcgagg     94140
     acgtactctt attggtcaac atgccaatct ttactacgat cccgcctggt ccgcggacac     94200
     cagcttaacg gataagtcag caccgagtga tagcgaccgt gcgagctatc tcaatgcggt     94260
     ttactcaaca gcgcaagatg gtccaggtaa tgatttgatt gctggcaaca ttgtgggatg     94320
     ccagattacc caaacactgt cggtggattt acccacaacg gtgacgagtt taggtgaagt     94380
     taagagtagc accactctta ctgcagccaa cagcccctac catatcgaag aactggaact     94440
     ggatggtacc gatgtcgtta ccgtggacac gacagatggt cctgtctacc tgtatgtcac     94500
     tgactccttt gaattacgag gcaatgctca actgagaaat atccgcacgg atggcgaatc     94560
     tccacgagtg ggtgatttga ggattattgt tcatgatgca gacgatggaa cacctcccat     94620
     cgaactgtac gatcaatcct gcattgacac cgcttttgtc tataacaaga ttaacgacct     94680
     ccagctacaa ggttcaggcg atggctgtcc cagcagtggc aatactaact ttgatggggt     94740
     ggcatgggtc gaagatgtca tcagttccat caacataaat ccccataccc gaatcgtgcc     94800
     tgctgaggat gatgacatca tcacgacgaa tggcagtaca tccggcattc gggtgcccaa     94860
     cgatgtgtcc agtctggctg atgtcgtgag tggtattggt atcactccga cgaataaatt     94920
     tggctatgtc aaaagttggc aacgggtgag gttttagtca tgcatctcaa tcggtggttg     94980
     tggttgtact tgaagcgacc gaaagcatct tcaggggttg attctttaaa atcactctct     95040
     gcgaagagtg gagggtttac cttaatcgag gtgttggtgg cgatgattgt tgctgctgtg     95100
     tttgtctcca tgaccatgca ggccatggta acttcagcag cctttcgggt ggttgctaca     95160
     caatacgacg aggccgtgag ttggattcag gaagatttag aaaccgttgt caatcaagcg     95220
     gcacaatatg agattacgac gcaaccctac tcctctcggt gtctagccac cctcagtagt     95280
     gatgggtttg catccggatt tctcaatgac tcagctacgg gattaggggg agcttccaca     95340
     accattggcc ctagaacact gggtgggaaa tactataccc tcactcgtac tgctaactat     95400
     gcaagttctt ctgaccccta tcggttgtta aatgtcacct atcaagtgac ggaacaaggg     95460
     gatagtaaac cgattgccac ggtagatact gaggtcattc cccatgccgt attcaaatgt     95520
     ccctaactcc caggtgatgt tttctgaatt gctgtccctt caccaaagct tgatgtctaa     95580
     ttccagatat atcgacaaca gcctgcgatt attccatgaa tttagggtct cttggtcaac     95640
     aacgacttca gtgtaagtat gcatatttat cggatatcta ttttcctctt ttggtggaaa     95700
     ttcagtacta ttcctgtcgc caaagactta taggcaaagc cagaattagg ggagagcgtt     95760
     caaataaact aattggtttg gtcaatattg ttgatttgaa ttaaccaccc agtgaaattt     95820
     tttataccca ttaaagattt gtaattcctg gttctagctc attctctcgc tagagaagaa     95880
     cctccaatag gcactgctaa gaattgcgtg ggtaattgct tcgcccctac cgaagcaact     95940
     tcatgcgcct tagttctgaa attttcggtt gagaatttct ttgccaaatt ccttgagtaa     96000
     tgctgagttg ccatcaattt agtaacgctt catcgctctc agggcctctt tcgagccctg     96060
     tttatattgc tgctgtgatg ttccatgttc catttcaatg ctctcattcc tctaagatct     96120
     tctccttcaa atgcgggatt taccctccca gaaaagatgg tgatttgctg cattatcggt     96180
     attgctgccg ctgcctctgc gcccagccta atggcttcca tgaatcgggc caaggtgaaa     96240
     cagacgatga cggaggttca gtctgctctg aatgaaaccc aacgagaagc catcaagggt     96300
     aacaaaattt gtacccttac tctcaacttt gtagaagaga agattactgg tccttgcctc     96360
     aaatcggggg atcggacgtt ggatgctgat gtggccatcg ccacaaacct gacagatcca     96420
     agttccagtg agaccccgga tgaagggcaa cctgttctga tcggttcaga tgtgcaaccc     96480
     tcactggggc tgagcgatgg tgagactgtt tcacagattg ccttagctcc cgtttcagaa     96540
     gatgaagcca atatttccaa agcaggggtg atggttcagg ttatcgctaa atgtaaaggc     96600
     aatactgaaa aaggattagg gttaggaacc tgtaaaaaca aaaacaatag caatccagag     96660
     aatggaagca atgagccgcc ttcaacccca gggacattga cgagtatccc catcaaatat     96720
     ggggtgttag gtaatcctga atttgctatt gtcagtgctc aacaaacgcc aacggacccc     96780
     accggcaaaa ttgtcttcta caacccacaa gattcccaag tgacgaaacg ctgtattgct     96840
     atttcaaaca cccttggact gacccggatt ggtacttatc agggagacat caaaccgacc     96900
     gccatcactg actccggtcg atgcactgcg gagaactggg aagagcaata agacttcaaa     96960
     tggggggaca tggtttgaat cagcaatggc tagatacgaa ttccaaggct atcaagggct     97020
     ataccctggt ggaactttta gtggccacta tcatcacaag tctcgtcatt agtatggctg     97080
     gttttggact cgtttcagcg acccaagcca acaagcggac ggaagcgatt gcagccagac     97140
     ggcatgactt gagtcgagcc tttgatttca ttagcaatga aattaggatg gcgaatcgga     97200
     ttaatcaatc ccaaacgatg caggcaacga acacttcatc cttttctacc cttttatcga     97260
     gtgcaggttt gaatacctca gactggggaa accccgtcct ttatttagaa attcccatca     97320
     ccgcccaaat tccagaggtt tgccctgcgg gtggccctaa tgctggctct ccacctcccc     97380
     aacctgcgac atatgatcgg gtggtttacg atatccgtcc gagtacccaa gattggttag     97440
     cccccaattc gatatacaga tatggtcgaa ttcctagaag tgatggcagt atcgacccct     97500
     gtagtgatcc cgttgcgagt gataccttag tggatgcgat cgcaacgaac gttgatacaa     97560
     cacctgcctg cccgacccct ggggtactca tgggaacagg agggtttcaa gcatgtgtca     97620
     atggtaacca ggtggattta ttcatgcgca gccaaatctc tgaggtagag attcaccgtt     97680
     tgagcagtac tgccacttcc cgctcaggga atagccagcc tatccccgta cttactgccg     97740
     ttcagcaacc aggaaccaat aaagttgatt tgaactggca atggcctggt tccacaaagg     97800
     gggtcacctt tgaagtcaat caagacaata caaccaccgg cataacaact aaaatcaaaa     97860
     cgggttcaga tagtagtcaa tcatttgaga tgcaaaactc tcccggagat cagcattgtt     97920
     attcagtcac tgcaaaattg ggtcagatta ccagcccgga gagcaacaaa gcctgcttta     97980
     ctcagattgc aaatcccatc aattaggctg aacagtcagc gatagatcat catttgtcgc     98040
     ttttctgaat ccatctgcac gaattcatat aatctcaaaa tattgttttg aatttcacaa     98100
     tttagaattt ttctgaatga attcaataga aaagcaagct gatttcagcg ttcttactga     98160
     gtgtttttct tcctattctg cttaccctat acatatctgg gagcaacaat attcgattgt     98220
     gactctccat ttcaattgag tcaccaattc taagacctga tcatgttcgc tgacgatatc     98280
     accgattatt attttgaaca ttctcagccc acactaacag cctctaacac ggtatcgctt     98340
     aatgtgccga tcattgaatt ctggcgctgc tacgatatca gcaataatgt gataattcgt     98400
     ggacaaatct ttaaccaccc caagtaccca gcagggaaat cgctaaaatc ttcacccatt     98460
     caaggatgct tgaccaaagc aggtcgagtc tatgtgacca cgaagaattc tatgtatgaa     98520
     ctgggtactc cgcatcctaa atctgcaggg gatgctctaa attggccaaa ccacacggac     98580
     catcaacccc tggagaaact cacttactgg ggagagtagt taataagtgg gaatatgaaa     98640
     aataaaatat taagtttaaa cgatagccgt aactacattt aaatcaacgc tttcaattac     98700
     ttcaaataac cagattacca atgtggtttt tggggattag agagtggatg gattgtcccg     98760
     aattcttact gggttagctc atggaattga atcaatccat taggaagatt caggaattgg     98820
     gcaccaacgg catcaactgc gatgtcgaaa cggaggatat cgttgaccga cggatagcct     98880
     ggccccaaag atttgagctc atgggaagga ataagcaaat ctaggcatta gatgaagtca     98940
     aatcactctt gctgtcaaaa aaaggtcagg gataatacgg tttaattaaa tctgagcaca     99000
     aattaaaatt aatagtgaag aatacctaca aaactctctt catattactg atgcaagttc     99060
     ccctgattaa tctgagctct aatgttgcaa gttactgata tatccgtttt tttccaaaag     99120
     aatacttctg atattccaga cgatcatttt gaaacaccaa aaaaaataac cgttattgag     99180
     tcctggactg caatacgaaa gggaaagagt gctgttatca aaggaagact cctgggccat     99240
     cctgattatc ccgacggggt taagatgatg acctcaacag tccatcgtta cttagcgggt     99300
     gatggtcacg tatacatcaa aactcaaaat tccctatatg agttgggtca acctctgaaa     99360
     acaactgatt tccaaaaatt agaacgaatg acccagtaag aaatttcatt catcataatg     99420
     cagactacaa atgatttgga catcatcctt agaagaggat aggaatgcct aacctatagg     99480
     ttgagtcttt agtggtcaca caaacatgac cttgataaac aaaatatcgc tgaatagcag     99540
     aagattctaa atacttacca ggtggaagtg tatgatgctg aaataaatgc ccatgaattt     99600
     ttgtctgatt attaatatca acacaatccc atgattgaag aataggtatt tccacagcag     99660
     cgtttccagt cgcatcaagg gatgaattga aattgtttaa ataatagtca atcagatcct     99720
     cagctatcat cgttagtcct aatacttctc actgttattt gtcttaattc tgcgactgtt     99780
     attagacctc ttgcataatt taactaacga tatgctagag gactaaaatc tgagtcagat     99840
     cgctgaattt ttttttcgtc agtagcacat catgaaacga atatttcaag aggtctattg     99900
     ttgaataact actagttcaa caaagggcag accgaatcgt taaattgaac tttaaagtct     99960
     agcgtccccc aaactgctgg gtgcttgggt aaattccaat gctggactgc tctttctagc    100020
     atcgagcatc aaccaaccga ttagtgtaca gaaggatagg atcgctccag ctataaccat    100080
     ccacatctgg cggctgacag gcttgtttag ctctttgagg atctcctctc tggataaccg    100140
     aaccgtctct tttgcctgaa gaggagtctg ctgaagcgag tcatggtcct gttctggggt    100200
     gggtgaatga tgacatgcta gaacggtgtt taattcagcc aatgtaccag tggctgaatt    100260
     aaacaccgtt gccttatggt ctagggtgtc agatttaagg ctcttgtaag agagcgattc    100320
     aatataattc agcaattcca cttggcccat ctcaagcgtg agataagtcg ctttaatgtc    100380
     cttgccaaag ttaatgagat cttttgtctc aagttcacgg gttgaagatg gctgaccatt    100440
     gatgtaaatc ccattagcac tgggtttacc ctgagaattg ccatcaatga tgcgataccg    100500
     atgagcttga tgtgggagag ggactctcac tagcatggca tgttgtctgg aaatagacgg    100560
     gttattcaag acaatggcat tggttgcgtc tcgaccgatt gaataagcaa cttcggttaa    100620
     cttgacaatg cgccgttcct ttccatcatc aatcactagt agatgatgtt cacaagcctc    100680
     tgatttgatt ttttccatag cagtggaaga aaactttaac tattaaaata actagacttt    100740
     atttaggtaa tgataagtat caaaacttga atcccaatat aagttatatc tttaataata    100800
     ctcatccaaa agtgttcttg cacagaagca tcggaagagt tgaataattt attgaataat    100860
     catgaaaggg caaagcataa tatccattta gttcattaca gtgacaatta tttcaagcta    100920
     ctgtgatctg aatcacaaaa cgcttataat acctgtttga agtgctttac gtccgcttaa    100980
     cctaacaaag attatgggca tgattgagta aatattactc ataattaaat tttcatgtat    101040
     atccaataat gtgtgaatcc aaaactaaca ctataattct attttttaga ttaaaacaga    101100
     atagaaattt gataaatcat gcattaaatt ataatcgcag ggaaagtact aaaaaataca    101160
     ctaaattcaa catcgtaagc atcacttcaa tcataaatat aaatctgtga ttgagataat    101220
     gattagtgtt aaatgctgaa tctgagaata aatttttact taaaaaaaga tagttcttat    101280
     atcatgagct atcaaatcat cttctctatt tttggttagg aaacactact tgctcaatag    101340
     agtgatcggt gaaaatcaca caactgcaca tcagaggtag tccattaacg gattcatgat    101400
     tttagtggga ttaagacctt atgggcatgt atgaagctta aaaccctatc tctgagcttt    101460
     gtttattcat caaagtctgg aataagtcac ggcaatcaaa accgttgttt aggcttgtca    101520
     tcagcggttt ttcgcttgat cctaatcttt ttgttgtcaa tattacccac accaagtagg    101580
     tcttgtcttg cccaattcaa gacaacagaa tctgtaatcc taaccctaga cattagcttg    101640
     acaacgtctg actttttgat gtgggggaaa gacttttgta gacggaaaaa tagtaagtcg    101700
     tccatttgga agtccccttg aaatcacaaa gtttacaaga aaccactcat caatattacc    101760
     catcagtaag cttcatcagg ctaatgcaaa taagccttac atgccccttc tttatcctgc    101820
     atagcttata gccattaaag acaacattat tctcaatcac cctaggtgcg atcaaagaag    101880
     caatccggga gcatgtcacc tttgcaatca agtatttata cttattccta aaaccctttc    101940
     tagccatgct ttcagatatc aagtttgtgg ttcccaaatt tgtgcatctg caaaggtgac    102000
     atgctcccag caatcctcga tctactaagg ccttaaaatg ctttccagga aagacttttg    102060
     aatgggtcag agttctggct cagaatgacc ttaacttctc aataaataaa ttaaattttt    102120
     cttgaaatat aatattattt gggtgtataa aatacccgct ctcgtatggt ggctctggtt    102180
     cccccggagc ctttttcttt cctaggattt tcttaaggaa gccaagtcga tgatagagat    102240
     tattaacaaa aacacccgtg gataaaccgt tcactccacg ggtgtgcttc actatggtgg    102300
     tcaatcttgg tcagtgtgcc cagtctaaaa cacgattatc ctattgtgag aatattctta    102360
     ttttattgag cgtggactaa taaaatcccc caacagttgg tgactactgg gggtaaggat    102420
     tttctgaatg gatagaaagt gcctctgtta aaaagccctt gagaaggggg ctatccaggg    102480
     cgagagactt tgacatttag tttcaacttc ccaaattaaa gtaaagagag ggtgaaaacc    102540
     tttttgtgcc agatgcatca ttaacgtctc aagtaatgat gaatacatca tcaaaaagtc    102600
     aatatcacta agctaaagat caacgtgcta cgtatctcca tcaccccagt ttggctctgc    102660
     tctggggttt ttgctgtggt tagctaaaca atgcagtttc gttaaagaat agcggtgact    102720
     attgaaggct gctttgaact cgatttatcc cacttcaaat tcgcgaccat gttgctgaaa    102780
     cacatacacg agaaattgac ttgggatttt tattggatat taaacttcgc ttaactaaaa    102840
     atatcctaat tgatgaaaat attgaaacat tacccaagac atacttttcg cgaccccttt    102900
     cccgctgggg tttttttctt gccagaacgt catgagagag agcattcata gggctagaag    102960
     caggtggatt cgtcttggaa tttggagacc tctacacaca acgaacccgc gtgaacaaac    103020
     acaacgcggg gagagcaaag tgtttacttc ttggaccagc gggggcattt gaacagaaag    103080
     ttatggtttc ggctataacc ctttcctaca aagcttttag aacattttca ataggaaagc    103140
     cgggaaaacg tacagttttg aattaggaag tgccttccta gtgatcagct tggactttat    103200
     ttgcccgtta cgttatcaag taagcgctgt ccagattctt tcacagaacc gtccccattc    103260
     gcctatgcat agaatcggag aaactttggc ttttaagact gaaccaattg gtatgtaaag    103320
     gtttcagggc ctaaatattg atttttgcct agctaacttc aggaccccgg atatcagcgg    103380
     gcgctcagta ggatgatatc tgactggaat tgacgccatt tgaacgtttg tgaggagggc    103440
     attgctaggt tgcggtcagg gcatctcagc ataccaaggc agggctaccc agttttttgc    103500
     aacacaaccg tttcagccca acagtgcttt gattacgcgt ttcatgccca aggcatatgc    103560
     ctcactggtt tcacttttca gcaacagccc ctttgacgca aggttaagaa caaaggttgt    103620
     ttcttccgct tcacgctttg ttgggaaaac ctcgcgtaac cataagaacg tggtgatggc    103680
     atctacaaat tcaccttcat aattccgtga agccttggcc acagaaatga tagctgcatc    103740
     aaggatttcc gcgccgtgtg gagtgccgcg aagcagcgga acatgatcac ctgtccacaa    103800
     ttggaacgac ttggaaagta ctacggcagg ttcaccatcc gtagtcttga gctgatgaat    103860
     aacagtgtcg gttatattgc ccaggaaagt ggttacagcc cattccagca cggcctcttt    103920
     ggagccgtac tgattgtaaa tcgactgccg cgatagatcg gcggctttag caatgtcgct    103980
     tatcgaggtt ttgcgaaatc cataggttgc aaagagcctg agaacttcta agacgttgtc    104040
     atctgtcttc atttgacatt ttttacattt tgggactata ttgtaaacat tgtacacgtc    104100
     ataacacggc ttatcaattc aaactataga catcccatgg aacaaaaaat tagcaactca    104160
     ggcttctctg actggaagcc atctcaattg cttgatctga ctggcaaaac ctacgttatc    104220
     acaggcgcaa attctggcat tggctttgaa gcagctaaga tgctgagcga aaaaggtggc    104280
     gatatcgtca tggtgtgtcg ctcacgcact aaggccgaag ccgcgcaacg aaagcttgtc    104340
     gctcacgctc aaggcaaagt cgatttggtc ttgatggact tgagcgatct gtcctcggtg    104400
     cgtaaagctg ctcaagagct gcgcggtcgc tatcagaaaa tcgacgcgct aatcaacaat    104460
     gcgggcatca tgatgacccc tcaggaaaag accgtagacg gcttcgactt gcaaatgggg    104520
     gccaaccacc ttggtcactt tctgtggacg ggcctactac ttgatctagt ggaggccgct    104580
     gaaggacgta ttgtagtgct gtcgagccta gcacataaat tcgactcgct cgatctcgat    104640
     gacttcatgt cagatacgaa atacacgccg ataaaggctt atgcacagag caaactgtcg    104700
     aatcttatgt tcgcctttga actggatcgc cgccttaagg atgcaggcag caaggcgatc    104760
     tgcatcgcct gtcatcctgg atataccagt actaatctac aaagtactgg gccgaccggc    104820
     ttttccaagt tcatcatggc aatcatgaac aagctagtgg cacaacgcat tgacgcaggt    104880
     gcaacaccta cggttcttgc tgctgctggt gtggaagctc agcgcggtgc ctactatggc    104940
     ccacaaaaga tgaacgaata ccgaggtccc gtcagcgatg ccaaggtaca ggatcacgcg    105000
     ctagaccgtg aaaaccagcg gcagctttgg gcaaaaagcg aacaactcgt tgggttccag    105060
     tattcattgc ccgtcgtggt gaatgctgcc tgagcatcac aagaagaaaa acgatgagac    105120
     tttacgattc ctctagccca aaccctgatg tcgtgtcgct gtttgctttg gcagaggagg    105180
     tggcttttcc cctggcctgg ttgcccccag aaggagggtg ttgaaaatct ttcaacagac    105240
     aatggaaaag agctcgtaaa aaactgtaaa cctaactgta aatcttacga aatcaagaac    105300
     tttagccagc aaggagaatc atcatgactc aacaaactgt tctgattacc ggggcttcgt    105360
     cgggcattgg taaggccact gctcaattct ttcagcagaa ggggtggact gtgattgcca    105420
     cgatgcgaac tccagacaaa gaaaccgaac tcactgccct cgacaatgta ctggtcaccc    105480
     gattagatgt gttggatgtt gactctattc acgctgccat tgtccaaggc atcgagcagt    105540
     tcggcaaaat tgacgttgtt gttaacaatg cggggtatgg tgcctacggc cccttagaag    105600
     caacgcccac ggaaaaaatc agacgacagt ttgatgtcaa tgtgatgggc ttgctagatg    105660
     tcaccagggc aattcttccc cactttagac aaaacaaaga tggcattttg atcaatattt    105720
     catccattgg tggcaaaatg acttttccgt ttggctcgct ttaccacggc accaagttcg    105780
     cggttgaagg gatttctgaa gccctcattt acgagatgga ggccattggc tgcaaggtca    105840
     agattgtcga gccaggtgtc attaaaacag attttgcggg gcgctcattt gattttaata    105900
     atgatgaaag catgacggag tatcagccgt cgatcgataa gttcatgagt ggcatgggat    105960
     ctagcgtaga gagcaatgca tcggagccaa ttgtcgttgc tgaggtaatt tatcaggcgg    106020
     ctacagatgg taccgatacg ttacgctaca ccgcaggtga ggatgccaag gtatttgtgg    106080
     ccaatcgcaa agcagcggat gatgcaacct ttatccaagg catcaaaaca cagtttggca    106140
     tctagcaaag aagggggcgt gacagagcag ctgtcatatg gggcaattag cttacacgca    106200
     acgcctaaaa cgttgaaaaa tcgctgattt taatgctatt ttcggctaag ttgtcatcat    106260
     attctgtcat tcaagacgaa ggctgaaagc cttatgtatt agtgttttca atcctattta    106320
     cccctggtga tacctacgct tgcatgacgc catatagctg gggtatttcc atctggacca    106380
     gcgggggcat tgaacagaaa gttacggttt cggctataac ccttttccta caaggctttc    106440
     acaacatttt caataagaaa gccgggaaaa cgtacagttt tgaattaaga agtgccttcc    106500
     tagcgatcag cttggactta tttgcccgtt acgttaccaa gtaagcgctg tccagattct    106560
     tccacagaac cgtccccatt gacgtaggtg tagagagtag ccgttgatat tcccagcttt    106620
     tgcgccacct ctttcgcgca cgcctttgga tcgcccatag cagtcatgga cagccccagc    106680
     ccatgtgatt gtccagaggc tgaccaatag ttttccggct gaccggctct cgaaggcgtt    106740
     tacgaatctg gggcggatcc tcaagaccca gcacaacttg cgctatctga cggatgccaa    106800
     tttgatgcag atggtttagc ttcgctcaac aaaggagagt accataacta gctaccgcga    106860
     cgggtgttct ttgcagatca aggggagttc acgacgggcg attacgagga aatcatgaat    106920
     aaggcgagct gcctgagtct gttctccaat gcgatccttt actggaatac gctcaagatc    106980
     aatgacattg ttgaaagcct cagagcgaaa ggagtggtga ttaccaatga gaccctatct    107040
     catatctcta tgctgggtac ccaatgggac ttactttatt gatgatttat agctgaaaag    107100
     gctgtggaga aagggattga ggtgaaactg taactttttg ttcaaatgcc cctgctggtc    107160
     caaataagag tattatgttg gagcaaacaa tcacactatc aggctagcga aggtgtttca    107220
     attttggttg ctcaggactg acttatttgt ctcaacagga tggactaatt gaccagcaat    107280
     aaggcggtga tttccgttaa caatgacttg atcattgttt tggagcgtac cgcgcacaaa    107340
     caccttatct ccctgggtat ggagaacttc tacatctctt ttctcaaccc ggaaggtgtt    107400
     tggggggtga atggacattt ctgtttctcg taaagcataa caagaccata gacctcgaac    107460
     gcctctgaca agagctgttg taggtagcca gtaaccaaaa tcgtcaatgg tttcagttaa    107520
     ttttaatcga gtgatttgac cacttcgaac ttccctggaa gctgatggct ctatgtggag    107580
     cactacggtg agggtgcgag tcacagggtc tatttggggt aaagttgcta taacttcggc    107640
     ttcatactgt tctttcccaa tcacgaggtg ttggttacta cctataggaa tctgggtagc    107700
     ggcttcaacg ggaacaccta catgggcctc cagggcttgg tcttctaaga gggtgagaat    107760
     aggttgaccc gctgaaacga ctgttccttc gtctaccagg cggttggcaa ttctgccggt    107820
     aaacggtgct ctcaagatgc tttgtctcag atcaatttct agtccgtcta acctcgcctc    107880
     taattgttct aatgcagctg tttgagcctc aattttttca ggtcgtgacc ccgtaagaac    107940
     cttatcgagc tgactttggg cttcattcaa acgagcttgc acagtgttga cttccgtagt    108000
     agcttcatcc agatgctcac ggggaatggc accagcggta taaagcgcct gacgacgttg    108060
     atgtctcgat tgagcgagtt tcagttgaga gtctaaattt ttaaccgatg atctcgctgc    108120
     tgcaatggtt tcggagcgtg agccagttct caattctttg agtaatgcat tggtctgatt    108180
     tcttccagcg atcagttcct gatgtttgac tcggagtttt tgggtatcaa gataagctag    108240
     gggcgtcccc ctttcgactt gatcgccttg atcaatagtt agcctcagta acttaccagc    108300
     tcgctcaaag ctaagtggac tggtccggcg aggaacaatc gtgccagtat aagtccgctt    108360
     aacttggtaa gtatggactt tggtaacctg aaaagtttca acaggaagaa ttgttgttgc    108420
     ttccgaatca ttagcatttg ctgtttgccc ggctcgaaaa gctgacagca ttcttagatt    108480
     cgatgcccat tgccgaccgt taggtgttaa tccaataatc atcaagccaa atatcagcag    108540
     aatactggct cgactggaaa atgcaaattt gggaatgttg tgtctatcag tattctgcag    108600
     gagctgtttc aacaatcgct caacccaact tccctctgag tcctttttgg tatgttgttg    108660
     gtcggatgac tctttcatga tgttgggttc cctgaaagtt taaaggattt gggataggtt    108720
     tgaccaaaca cgatgaggta agcacaggga acaaagaaca atgccaggaa agtagcccca    108780
     cccacgcctc cagcaataca aatggctaaa ggaggccaaa gttctccacc atcaagcaag    108840
     aggggaataa acccagaaac ggtcgtaata gtagtggtga ggacatggcg agttgagcgc    108900
     acaatcacat caaccattgc tgggcgaaat ccttttcggg ctcggggatt tgtgcggata    108960
     gcggcgagca ctacaattga gtcattaatg gctactccaa ctaaacccac cgtgcctaaa    109020
     atggccatga aaccgagtgg ataaccaaaa agccataagg aggcaagtgc aaggcctact    109080
     gaaccaacag caactaataa gatgatgccg gcactccgga aggaattaaa agagagaaca    109140
     aggacagaaa ccattaaaac aataaagatt cctgcagtgg aaagtaaatt gccgactgct    109200
     tcattacgtt cagctgcttc tcccccccat tccattgaat aacctggcgg aagttgaaaa    109260
     ttgctgttat ttaggcgttg ttggaaatca gctaggacag ttgacggtaa tacccccgct    109320
     gttatgaatc cttgaactgt attgactctt tgaccattgc gtcgagtaat gatggccgtt    109380
     tcggggatca ggtcgatttg ccccagagct gatagaggga tagaagtgga tttttctggg    109440
     cttaacggag gtttgggtac taaaccaatc gtcgtaatct ggtcgaggtt agcacgatta    109500
     tcgctactta gacgaactcg caagggcaat tcaactgtat cttcgaggat agaccccccg    109560
     acagtgcctt ctaagtttgt attgagttgc tgggcgattt gagtgttatc tagccccgtg    109620
     agttgagctt gttcttcatc caaggagaga gttaattttg gtagaaattc tcccaagctg    109680
     gtacgtgtat ggataacttg aggaacttga actaattcag agcgaacttg gtttccaagc    109740
     tcctcaagaa tatccagatc agggccataa actcgcaatt caataggggg aataggaagg    109800
     gcctgcttta actgttcgac aaggattcgg gcagagggaa aaccttgatc tagttccctt    109860
     tgcaaattat gaataagctt aggaatagat ctcccagtat ttgtttgaac cattgcagta    109920
     gcatagtggg gaacttctcc cttaatccca tgtcgggcaa ccgtatagta gaaggtaggt    109980
     gcgtatgttc cgataaacca atggagatca gtgacttcag agtgttgagc gatcagattg    110040
     ctcgctttct caacgataga ttttgtctgc tccatggagg tagacagagg aagttctaac    110100
     ttgatttgaa attgatttcg ctctgctgga gggaaaaact gttctgggat atgacctaca    110160
     gccataaaac ctataatggg caagataatg gctagtccta ctcctaatag cggagttgtt    110220
     aaaattgagc ctaagatacg gcgataaact ttagtaattt gtgggttcga gaaaccggtt    110280
     cgccaccaag ccatgtttct ttggtgaatc tcccctttct gatacatcct actcatgatt    110340
     gcaggaataa ttgttaggga gaataatagg gagctactga tggcgacgat gacactgatg    110400
     gagattgttc ttacatattc gccgatatgt ccccgtaaaa tagcaatagg aaagaaggta    110460
     agaacagtgg ttagggtaga ggccagtaag ggaatagcta gataactgac cgcccgggca    110520
     atagcttttt ggggatttaa gccctcttca aataagtgtt ttatttcatc aaccacaact    110580
     atggcgttgt caattagcat ccccaaagca atgactaaac ccgttagtga catctgatgt    110640
     aggggaatct ctaataacct catccctcca aataccatca gtatggataa gggcagtgat    110700
     aaccccaaca cgagtgcaga ttttcctccc attagaaggg ttgtactggc aacgacaaat    110760
     actacgccga tcatcagatt catgaaaaga ctattcaatc tagtctcgac ataacgattt    110820
     tgattaagga taatgtccaa accaatatcg gatgatatgg tgccgcgaaa tgcttctaaa    110880
     gtctggttgg cctcttccat ccattggtca acccgcctgt taggttcaac taaaactgct    110940
     aaggtaattc ctggtttgcc attgataatt gctagttcgc tcggtgggtc tcgcctactc    111000
     ttttttacta gggcaatatc ccccaaaggt attaattgtt ctgaattttt gtcagtacgg    111060
     attggaattt gacgaatccg ttcaagagag tctatttcac tatttacttc aagtaatagg    111120
     tcattattcg ggctaagtaa ccttcctgaa gatactttgg cgtcgctgag gcgaatttgt    111180
     tgagcaagct gctggggagt aatccctaat tttcctaata cgactggatt aatctcaact    111240
     agaatttctt cagaaggggc accccaaaac tcaatctcct ctatacctcc aatgccccgt    111300
     agttgttgtt taagattctc ggaaaggcga ttcaagatgg cataattggg tggagtatct    111360
     aattcccagg tgagggcaac tatcagggtg taacccctac cgtcattcat gtcctcatat    111420
     ttgggagcta atacacctga tggtaattgg ggagtaatat cagcaattcg atcacgtatg    111480
     ctagaccata cctcatcatg atttttaaca gtatctttga gtactataaa gattaaggat    111540
     gtacctagct gtgaagtgga ttcaataaat tttatttcct caacttcctg aagtttttgt    111600
     tctaattttt cagttactaa agaatctact cttgtggcac ttgcacttgg aaagcgagtg    111660
     gttattttgc cagtccactg gcttatggca ggatcttcca ttcgaggtag aacatgaaat    111720
     gaagatagtc cccacactaa aataatgcat attgtcagaa ttagtagccg ggtattccgg    111780
     taaaaatggg tccacatttc tattttcaat gtgattagag tattactgaa tagatgctct    111840
     atagacccac aaaggaacag aactagcaga ttgataagct agttctcgtc atattaaacc    111900
     tattcagcat gaagtcactt ggttacaaga gacctatgca ccttgttaat gaaagaatac    111960
     ccaattaagc cattaactat gcctcgtaag tctccgatat gattggggca ttcgatcatt    112020
     accatggtca tagccgcatc caacaaatcc aggagctctc aaacccatag gtcttaactg    112080
     acagacccac ctcagggtga caacctcatg ttatggagat acgctgccag caacagaaaa    112140
     agtgtggatt tataaccagc ggttaaaccc ctctttaaag cgggttttaa agcctctaat    112200
     ttaaccggaa atttttgcct ggagagactc catcgcaacc cctttgagac tttaaaatac    112260
     cttgagtcat ttcgatgagt ttatttaaat gttgctttat attttaaaca gattaatgat    112320
     tctaatctca tataatatct accgaagctt gacaacttac aacctgaaga aaatttctga    112380
     ttttattttc caattcctcc cattctgcct ctggttgaga atctgaaatg atacctgctc    112440
     cagcaaataa aatcagttta ttcctttgaa ttaaacctga ccgaattgaa actaaaaact    112500
     cagcactgtc aagagctacc catcctatag gagatgcata aaatcccctc gaaaaagtct    112560
     ctagactagc gattagttct aatgcttttt gtctaggata accacctact gcgggtgtag    112620
     gatggagttg attaataatg tccgcatcac ttatttcagg attcagaatt ccagaacaat    112680
     gagagtataa atgttgtact tgattgaggc gcaataaatt ggggtcttcc gcgatattaa    112740
     cctgatgaca taacgtgcta agagtttctt gcaaaccttt caatactaat ttatgctccc    112800
     taatttcttt aggggaagat agcaactctt tagcaaaatt attatcttct tggtaagatg    112860
     cccctctggg gcgagttccg gcaattgcct cagtttgaat ctgactactt tgtcgccaat    112920
     aaagacgttc aggtgtagaa ccaataaaag ctttatctct atctagctga aagcaaaatt    112980
     gaaaagaaca gttttgctcc ttttggatta aactcaacaa atgttctggc tgacaagagt    113040
     ctacaattgt aaactcagtt tgtctagcta aaactacctt ctcaagtata ccttgatcaa    113100
     gataagttaa tcccttattg acattgttat accactgtag ctgattagga aaatcgactc    113160
     gcttagataa ttgaggtttt tcgcattgtt gatgaggtaa gttaaaatta atagctgcta    113220
     gttcttgcaa tgtttgctgg atctttttat ttgcattatc gctgtgatgt aatagtaaat    113280
     tcaacgctaa ataggtgcca gcttgatcct tgaaaacttc aaatttggga acaagaaaaa    113340
     aatgatttcc aaaatcctgc caaggataac tagcaatctg attttgcgaa aaacatatac    113400
     ccccatagta acgaacgcag gaatatttgc aggacagaaa ttttcttaag cgtttaaaga    113460
     gaacatggga gcttgctttt tccctgctaa atactaaatc agctgatcca ataccagcca    113520
     tttcaaacct atcatgcctg tctgaccaat aagtttttat gatggatttt tgttggctta    113580
     accagtgcaa tggttctata tcatgatcta tagatacttc taaacgaaca attttactct    113640
     gagaattttc tgctagtgtc ttgagttcat caacaataaa atctataatt ttcctatgta    113700
     agcacatagt gttaatcaaa ataatattct tttaaagtgt ctatattttc ctaagttcag    113760
     aaaaagcaaa ctcaaatttt ttagagttta acttacatct gtttggataa aaattaggtg    113820
     tattaggtag gagtgagtat agtctgatta ttagaagtga tcttgttaat cttcgagtct    113880
     tggaaccatc tctgggagag aattccagat tctggtagct aaaccccaga cttagaacag    113940
     ctttacgtgg gtggagacat taaatcccaa atctgtatcc agtattccca aggtattgtt    114000
     gaatgttcca gcaatgaaca attccccagt ggtcgcattg aaagtaatct cactcaaatt    114060
     cgaaaactcc aaaaccgctt ggttaatttc ttatgtatca ccctccgtgg ctggaaatct    114120
     gtgatccagt cgatgcccca tgatgcccca ttcacctcaa atacgaacgt atccgccaac    114180
     cttgactatc atctaataag gaagagtaga aaatcatgaa ttaggtggtt taggcttgag    114240
     attctgaata gactgggaag tctgtgtatc cttccctatc gaatgagtac caaatactct    114300
     gctctgcagg tgggtttaag ggccagccat ttgtgaaacg ttccactaga tctggattgc    114360
     tgatgaacgg tcggccaaaa gcgattaaat cagcgtgacc gttcgaaatt ctatcgtctg    114420
     catcctcttg actatatcca cagttgccaa tgatagttcc gttatagaca gaccgaaatt    114480
     cagataattg catgggctca cctaactcat ggaatccaaa ggccagaccg tctaaaacgt    114540
     ggagataagc tagatcaaag gtatttagct gcttagcaac atacaagaat gtttcacgat    114600
     agtcttgtga ccccatgtcg ttatagatac cattcggtga aagccgaaca ccgatgcgct    114660
     gagttggcca gacttgggaa attgcctcta caacttcctt tagaaatcga tagcggtttt    114720
     ccaaagttcc accgtaacga tcttgacgtt gattggtttt actttgcaag aagcaatcaa    114780
     gcagataacc gttggcactg tgaatttcca caccgtcaaa gccagccgtt ttggcattga    114840
     tagcagcttg tcgataatct tcaacaacca gtggaatctc atcggtactt aaagcacgtg    114900
     ggttttcata gggctgcttg ccttgtgggg tatgaattga gtccccctca agtttgatag    114960
     ctgagggggc tacaggtagc tgatgatcct gatgaaagct gctgtgagaa gctcgtccac    115020
     aatgccaaag ttgtagaaaa accttacccc ctttttcatg aacagcttta gttactactt    115080
     gccaagcttg ggtttgctct tgggtgtaaa ttccaggaac atgctgccaa ccgatggctt    115140
     ggtctgagat aaaggttcct tctgtgacaa tcaagcctgt tgatgcccgt tgagcgtaat    115200
     attcagccat cattgcattc gccaacattt cttccccagc tcgcgatctt gtcatgggag    115260
     ccatgactat acgattggcg agtggcaaat catgaagatt gaaactgctg agtaatgtcg    115320
     gggatgttcc tgttgccgtc atttcacgat tctattgaat taagtaataa ccagaaaatt    115380
     gtatcttgaa gcgtgtgaag tcttagttac tagcaacaca cacctaacat aaccagttac    115440
     ccagagctaa tttaggaatt ctccaaattt tgcaaccaag cattcaaatc atctaagctc    115500
     tcgaattcca aaagtgcttc gctcagtgat tcaagttgat caacctctaa ggattgaatt    115560
     tgagtttcca tttcgggaga aagctgctta aacttccgat taagttgacg taaaacaata    115620
     ctcacctctc ctttttgcca acccctttct tcccagctag tcaaagtttg catgatggct    115680
     tctcgttctc ctaattctaa tgtatcaatt tctgtttgaa agcgttgctc ctcgtttgct    115740
     tctagtcgga gatacgtgtc gataaattga gaaatgaact ctgttctagc tggatcaagc    115800
     tgcaaggtag ccagcatcct caaacactcc actttgactc gtggccgatc ctctttagca    115860
     atctgcatct tagccatcaa tgccgaagcc acaggattat gctgcctcag atagtctcgc    115920
     cagttcaaac gattgagttg aatggctcgg aaattgaact gcaagacctg gaaatcggga    115980
     aactcaactt tgtagctgct ctctgcttcc ttttgaggac tgtcatagga gaaaatcacc    116040
     acaggataaa tgggcaaatc atatttctca tgcagcctcc caaagtagca gaacatgcgt    116100
     ttctcaaagt ccgcttgaac tgacgattgg ggttctatgt gaaatagaaa gtagctgtcc    116160
     tgtcctcgaa actggacttg agccagcaag tcaatgatac gcttctcctc cgcgccaata    116220
     ctgctgaaga cttcctgata caaaaacgtg acgggtccgc gctccacata gtctaagact    116280
     tgaggtaaaa acaaatctaa gaattcccaa aagaacgtct cgatcagttc tttgaacaga    116340
     ccatcatggt caatggattc ccgttgtgtc acccgctgct ccgtgattcg tattcgattc    116400
     gctgattgag tgtatcactg gcatatcatc cgagttatcc aggtacggct tcttgcagag    116460
     gtcttctaaa aaagtgtgaa agtcatcaag actggctgtt caaggcaccc gacttaatcc    116520
     agacattctg atcgtaaaac ccaccccgct gctcaaactg aaatccaccg agtagcattc    116580
     ctagccagat aggtaccagt gacagctgta gctcctgttt tagctcgacc aaaggcacca    116640
     tcccagatgt cccctgtaag tacgttgaga tggcatgtac ccatgccaaa acatcctctt    116700
     cttccaagac ttgcaagact tcatcaggtt gctcaaccct taactcagtc tccagctctt    116760
     ccagcaacga tgccttgtcc ttgagcacaa cgatcgactc acactcctct ttgggcaatg    116820
     ttcgccgagt caccgggtcg ggttcagcaa ttagatcatc gtctaacacc atggattgcc    116880
     gaaccatccc catttcgtca tccaaatcaa ggatgggacc gtcatcgttg tgggcatctc    116940
     gccagtccct gaggaagacc tccgctcgcc gactcaagat ttctgccatc tgcaataggg    117000
     cagtccccgc cgtggataac ttctcctcta atggcaactg ggcgactact aagtccaatc    117060
     gctcctgcaa ctgctggagg tcgctctcca ctggaaccgc ttccgcttga ttcaactgct    117120
     gccaaagatc gagttccagt tgcaatgcca tcgtgaacaa cctcctacgg gaacaaaggg    117180
     cagggacgaa tcgggcattg acttggatcc acttcgactt gtgaatcaaa ctgatgcagt    117240
     acttttccgt ctaaatgctc agagaagcgg ttgagtatat tcctggagta tttcgtcaca    117300
     tcagagttag tccaccccag ggtatggaca ggctcaacga tcgcaacccg cttttggcct    117360
     atccacagct ccgctgacat ggcatgaagg ggcgcatccc ttctcgctcg atacatccgt    117420
     cgaatagccg caggtttgac ggggacttcc accgtaactt caggaatcag cttccccgtc    117480
     tgtagttgat atttccgttt cttatttcgg ttatagcgat cgcggtgctt atacgaggaa    117540
     cgtcgcacat ggcaacgctg acccacccag cactccttta actttgcttg gtccacgggt    117600
     agcttggaac atcgacggca tttttctgcg attgcacggg ccatcgtcct aaaccatttg    117660
     catcatttga ggggcaggca aagtccagcc ttccgcttcg tagaattcca tcaaagattc    117720
     tatggcttcc tgcccatgtt tggcagcctc ttcataggtt tggccatcag taatgggctg    117780
     catcacccgg tcaaattctg gtaacgacac tacatagcat tgatcctctt ccgaccactc    117840
     gatcaccatt cgatacttag tctgagtcat tcgataatgc ctccaattgc tgtagcgctt    117900
     tctgcacttt gcgttccaaa tagagtgggg catctgcccc atctttgcgg gcaaccgtga    117960
     tcacctgggg caattgagga tgcttccagt tactgtgaga gcctttaccc ggtcgggaga    118020
     taaacccagc ctccttgagc atagccttga tctcacgaat cttcttgggc atccacctct    118080
     ctctccagcg atgatgtagc agatgacctc actctatcat gcttattagt caaagtttag    118140
     tcaaagtcca aataatgatt tattggtcta tgggtacgga aatgaccatt gacgtaagct    118200
     taattttcta aattaggtca catcaatatg accatagtta taatatttgc ataatcaatt    118260
     tttaaggggt tgaacatgca gcagatggga gcgggtcaat tcaaagccca atgtttgaag    118320
     ctgatggatc aggtgcagca gacccatgaa gagattgtga ttactaaaca tgggcagccg    118380
     gtggctaagt tagtgccggt tgagaatgac tcccaaacgt caattttggg ctatatgaag    118440
     gactcggttc aggtgacggg tgatattgtc tcgccagtgg atgaggtttg ggaggcagat    118500
     acctagtgtc tcaggactta ctcgtgttgg atacccatat ctggatttgg ctcttgaatg    118560
     ggaatatagg ccgtctgtca tctgagggac tatctgccat tgagaaggct agtcaatcgg    118620
     cacagttggg ggtcagtgcc atctctgttt gggaggtggg gatgttggag tcaaagggac    118680
     gactgcggtt gtcaaagggt tgtttggatt gggtgcggga agcgttgtct gcccctggct    118740
     tgaggctatt gccgctaacc cctgaaatcg cgattgaaag ctctcggttg ccagggcaaa    118800
     tccatggtga tccagcagat cggatactgg cagctacggc tcggatctta aatgggacat    118860
     tggtgaccca agatctaaag ttgttgtcat atggagagca ggcttatctt tctgtgttgc    118920
     aagggtagtg ggtggatgaa agatatcgat gggatgcgat cgcaatggaa acatcagggt    118980
     tagttcgctt agaaatcgat gagtcggcag ttgatgtcga tttgcttaga gcagtcttgg    119040
     tagagaaaac caaaccctcc acgcgggaag ggtataccaa ggatctggtg gacttctttt    119100
     tattcgtgac ccagggagaa tcggtctatg aaattgaggg gccgaagcgt aagagtgaga    119160
     taaaggctca ggtgaaaggg gaactatccc ggctgagtca gtcttttgtg gggattggcc    119220
     gattgaaagc tttagaatta gccgctcggt atcgagaatg tatgatgcag cgagggttgc    119280
     aggcgaatac gattaatcga cgattgtccg cagtgaagtc catggtgagg atggccagac    119340
     gtttggagat gtgtgattgg acattagcgg aagtagatgg tttaacggta aacccctatc    119400
     gagataccag agggattaca gcctctcaat ttcgactgat gatggtgttc gtcaatcggt    119460
     tttctttggc tggagccagg gatttcgcca tgttgacgct gttgtgggag gcgggattgc    119520
     gacggtctga gctggtgggt tgtgatgtcc gtcattttga ctcggagcaa aaacggttgt    119580
     cgattttggg gaagggaagg aacgaaagag agtggattga tttgacggaa agtggggtac    119640
     tagcgatttc agagtggctg gaaaagcgag aagtttatgc cctcacggag ccgttgttta    119700
     tctcgttgga tcgggcgaat tgggggtcga ggttgtcggg gacatcggtg tatcggattg    119760
     ttcgggctct agcaaagaag gctggggtga gcgagaactt tgggcctcat aagatacgtc    119820
     acagtggcac aacaacctat ttggaaatga cgggtggaga tttgcggggg gcacaagcct    119880
     attcccgaca cgccaatctc aatacactca agttctatga tgacaatcgc aagcagcttc    119940
     agaaaaaggc ttctgcaaaa ttggcagaga ccatttcttg gaagaagaat actgatgaat    120000
     ccgcaaatga atagggttgt attgacgata aaatcgccaa gagaggaatt gggcctaaag    120060
     aatttgtcag tcttgatgcg tgtcaatttc tctttactaa ctgagtactc agtaactctt    120120
     ggatttccgt aaactctcgg atacagaaca cactagagtt tatttactat agaggaataa    120180
     ataaatatat aaatctagta atcaataact atgtcaccgt tagaaaaaga acttcttcct    120240
     atagatgaga ctgaagtatt cccagaaaat gacgagctag agattgtaga ccttgatgat    120300
     ctactgaaag aactacagca agattgaggc ttagaaatac tactcgaaaa gattaaccct    120360
     acatggatcc taatagcctt gcagtctgga aaaacttaga gactcatctg ggtactcctt    120420
     tcaggagaaa tatggtggat ctcgtgttgg agagtgttca aaaccggggg agacccttat    120480
     ctgctgtttt tagaacatca ctctgtagat atggacttcg actgctgccc gaaatccaag    120540
     attcttatgt catagacgaa gatcaccgat cagaatactt actcttacat ccaagtattt    120600
     aggaaacaga acccctttct ctgcaggttt tttcccggtt tcgaacactc ttcaggttga    120660
     tctgaaaaat agctcatcat gacaactatc atatttagat gtcttccagt gcttggtgac    120720
     caggatgaat acaggatcgc ctacctctac tactattagc agttaataac agtcagattt    120780
     agctcaaacc gcccaaccga atacctaccc ccatcaccac gaataataca gctagggtag    120840
     tgacaccaat aatgtgaaag gccagctcat tcaaggtctc ttgggtcagc ttcggaatga    120900
     taaaaaagcg agcatgaagg gcgagagcca atgtgcccag aagtagagac agcttaatag    120960
     ctatatagat cgatagatat gactggaaag ccaagaagtt ctggaagccg gggaaataaa    121020
     tccaggtcag ccacacccca gtaatcgtct gaagcagcaa tgacgcaaga ccaaatcctt    121080
     caaagtgctc ttcaaaggta tggatgcgat ctggatctcg attttgcatg gccaaaggca    121140
     acaccgtaac tgccaggacc aaatgtccac ccgtccaaac tgttgcaccc aatgtatgca    121200
     gaataactag gagtttgaat agcatcgccg tggtttctgc ttcctgaacc tgatagaaaa    121260
     ttgagcaatg tccactgttt ataatcgata tcccttaccg ctcaaaaaaa gagatgaggg    121320
     aactcaagat tttcagcaag aacaaactta ggacactacg ggagcatctt cagcagtcaa    121380
     tgcgggggga gtatgtggac tgagaaggga ttgctgggct tcaggttgct ggcaggccac    121440
     cattgttttg acatgttcca tctcatcatc gcggatggcc acaaatacgt catacagtgt    121500
     atcaacctga ggacggcgtt ctgctgcttg atgtgcggtt tggaattcat caaacatgta    121560
     gagatcacca tctcggtaat actgaatcgc gacgtctggg gctggtaggg ttttgaggtg    121620
     ttcagcttct gtctgcaaga acttgtcgta ggaggcatag gcatgctctt ccactagctc    121680
     cataaaatgg taggccgagc ggggagaaac tacgtataac accgcaatca cccagtagta    121740
     aatcaaggcg gtggttttgg ccaagaagcg atcaccccaa aattcggcac cccctaaaga    121800
     ttccataatc aggaggtgat gaagctcatt ccaagattcg gcaaagtgaa ttttgagcca    121860
     gtccgcctta cgccagaggc ctagcgtttc gtacaagtgg agaacggata gataggaaaa    121920
     gtaggggact cgtgcaacgg tttcaagtac gtaaaaacgg ggatagggac gattggcata    121980
     gatcttattg atgacaaaca ccaaaatgcc aacaagaata cgaatcatac tggtaagcct    122040
     ctaaaaagca acagacatta gggtatggat gaaatcaaag agaggtaatc tcagtagtaa    122100
     gtgctggagg ttgtgcttga gtgggctgtt gccaaatggc aatcacagct cgaccaacgc    122160
     tcatcaccag taccaaagcc cccacagcaa agaccatatc gccaggaatt ctcagccaaa    122220
     cggtccagtg catccaggcg gaattgatga cctctgcgct gcgggcatac caagtgccat    122280
     ggttgatgga ctgcaccagt tgatagaagc cgttgggaat caagccaaat accatcatga    122340
     tcactaagcc cccgttaatc caccaaaaag agaagttgaa atttttctca tcccaggcat    122400
     gatccggcgt gatttcccgt aaggcaaata gcattagggc gatggcgagg gagccatata    122460
     cgccatacag ggcggagtgg gcatgaatgg gagttgtatt tagaccttgg gaatagtaca    122520
     gaacaatcgg tggattgatc aggaagccaa acacaccagc acccactaga ttccagaaac    122580
     aagtggcgat aaaaaactta aggggtagcc gataaaagcc ttgagcctct ttagagagct    122640
     tcagggactt aacgacttca aacccgatga gggtaagagg gaccacctct agagccgagg    122700
     ctacagaccc catcgccgta ataaagaccg gggtgcccgc aaagtagaga tggtggagtg    122760
     tgccaatcac accactccct agatagagaa tcgtggtgag gtaggtggct ttcagtgcag    122820
     tcgatcgttt cagaaagccc agttcgctgc aaaggtaggc aatcgccacc gtggcaaaca    122880
     cttcaaagaa tccctcaacc caaagatgga ccacccacca acgccaatat tcggcaatgc    122940
     tcaagggcgt atggttggaa tacatcaagc cggacgcata aaacaaggga atggtaatgg    123000
     cgctgtacag gaagaaatga ttgagtcccg ttttgttgcc ttccgcctta agggcgggtt    123060
     tcagggctcg gaacatcagc catagccaaa acaccatgcc accaattaac agcaactgcc    123120
     aaagacggcc cagctctaca tactcatagc cttggtgacc gaaccagaaa cttttatctc    123180
     ctagccagcc ctggacaccg gcccaagtgc ctaacaaaga accgacgaca accacggtaa    123240
     gggcggccaa tagtccgcca ttgccccagg cttgaaattt cggttcatgt ttgccaaagc    123300
     gggggccaaa atacagccct gctgccaacc agcaagtggc aatccaaaag acagcaagct    123360
     gtaagtgcca ggtgcgggaa gcagcataag gcatatattg ctgaatggga attccataga    123420
     aaccctctcc ctcgacagca tagtgggccg tcaccatgcc catcaggatt tgaaccaaac    123480
     aaaggatcat cgccacacca aaaaagaggg ttgtcacttt ctggctaggg gtggcgaggc    123540
     gaatggcagg gcgggtggtg acgggctgta cgtcttccgc atcttcttgg gtaatgtaga    123600
     caaacaagaa aaaagcaatg gctgcaatta agaccaccac tgacacaatg gaccagatca    123660
     gaaattgtcc aggcgcttga ttaccaatca gatcatcgtg gggaaagtta gcggtgtaag    123720
     agaagggagc attggggcgg ttggctgagg ctgcccaggc ggtccagcta aaaaaggcag    123780
     taaccgagtg gatttgtccc tcatcagcaa accagccact aggaatggag tggatcgaag    123840
     atccttggga gagcaaggtt tgatagtctt caaagaccct ctgtagtcct tgagtttggg    123900
     ctgaggtgag ggccaaggtg tccgagtggg tatcgtaacg attggcctta aagttctgct    123960
     ggacttggac ggtcagggtg gcgcggtcaa cctctgataa ttgttcgaaa tccgcttgac    124020
     tgaagtcagg atcaccgtca tacaggacac ccgcagtggc taatccccag cgatggagga    124080
     catctgcggt ccagtctgga gctagatagc tgccatgtcc ccagacactg ccaatatgct    124140
     ggccgcctcg ggccaggtag gtttcttggc cggattgaat atcggtctgg gtaaggatcg    124200
     tttcctgttg aggcgacacg atctgagcgg ggatgggcgg tgcattttta taaatggctg    124260
     cccccgccgt gagtagaacg gtaaaggtga cgatacaaat cagggctagc catgcgggta    124320
     agcccataga tgggcggcgc gatctcaagt tcgtcgctac agtgttatca aaagctgggt    124380
     tggccatcgt tgcaatcccc aaaaatagtt ttgctcctaa cagccccttt tataagtggg    124440
     gaggagtcga acccgaagag ctaggttcgt ccaatgctga gcgggtctgg aggagatgcc    124500
     tctcactcta agagactcag ttcggctcat tctttgactt aagtcaagca accaattaaa    124560
     agatacttaa atctgagtct cggctattta aagttgcaga gtcttagcaa ggggctaatg    124620
     tgctgtcgag gctgtttaca ggccttcgtc atacttggga ttctgggcag agtgtaggta    124680
     gatgatagac accgctgacg tagcagattg gttagagaca accgtgattt ttcgtggctt    124740
     atccgcagaa caacgccagg ccctgaccca aactgctcaa attcaaccct ttaagaaggg    124800
     tgagcaaatc ttccacccag accaagaggc gacgggattt tattttgtga agtcggggcg    124860
     agttaaagtt tttcagatgt ctgccaaagg caaagagcaa attttgaata tttttaccga    124920
     gggggataac tttgcggatg ttccggcttt agatggccaa tcctttccgg cttccgctgc    124980
     agctctggaa cctgcagacc tgattttttt tccgcgctac ccgtttctgg attttctcca    125040
     tcacaatcct gatgtggcgg tacaaatgtt ggttagcctc tttagccatc tgcgccatct    125100
     ggcccaattg gttgaacaac tgtcgtttaa gagtgtgcct cagcgtttgg caacctacct    125160
     gttaagtttg ggtgatacgg tcagcgatac ggtctatctg gacctaacca aaggccaact    125220
     ggcagcaagg ctggggacta tccctgctac tctgtctcgg gcgttttatc aactcagtag    125280
     tgatggcatg attgcgatct caggttccaa agtgacgata ctagatcgag atcgcctcac    125340
     agtcttaatt caatccccag aaactcctga ttaggctttc tattccgcgt tgcaggtact    125400
     acacaaaact aatttgctcg gatgaataag acttgggttc gaggtgagtc gtggcccgga    125460
     caggggcata cttttggtcc agaatggctt ccaccttttc tgtgatttga tgggccactt    125520
     caacactatc tgagtcaacc accaggtgca tttcgataaa agcttgtcgt cccaacaccc    125580
     cccgtgaagc aatatcgtga cagttgagga ctccaggcac attaatgacg gcgtcatgga    125640
     tggcttctgg ggcaatagcc attttatcca ccagccaaca ccaacacgca gactggaaat    125700
     gccaacagca catcgaccca ctgatagcca aaccccacac cgaccaagcc gagcataacc    125760
     atggcagtga cccaaatatc gctcatcgta tgttgggcat ctgatagcag aatactgctg    125820
     tcgacccgct cacccactcg acgttcatac accgccaccc caatattaat gaccagcacc    125880
     accaacaata gctctaagac ttgaggagac atctctacta aagaccctgg gttaaccaga    125940
     tggcccaccg cccttctaaa atctcaaaac aggcaattcc taaaaaggct gcaatgccca    126000
     atgcgccaat ggcatcgaat ttctggtgtt catagggatg ttctcgatcc ggttcggggg    126060
     atgccaatcg gttcatcgtt aatcccagga cattattggc actatccgta atgctatgga    126120
     gggcatctgc aaataaactg agggaccctg tccaccatcc cagcccaacc ttaatgagca    126180
     tcacggtcac atttaaaaac aagactgtga cgagcacatt acgcacatct tggcgattat    126240
     caagggtcat ggagctactg gggatgtttt tacttgagac ctgctattga gagcaatcat    126300
     caatcattga tgtggcttac tgcaactttt agaagccagt agaacaagta atttattgat    126360
     ttaaatcaaa attattattt attgttatgg aaactcgata acccattttc tgagtcgaat    126420
     tgattgtagt ggaggaattt ccacggtctt gacgaacgac aacttcatta aaacagtcta    126480
     aaaagagtag acgcaaaaag gctgcttatt gataattact attaattgaa taagctatac    126540
     atctagcatt tcatgtagac agctcgtgag ttagttagga atggctatca aatgtccaac    126600
     agcttgctgc tgcgatcaac agtaatgctt tgatcttttc aaaattatat ttttagattc    126660
     tgctgatacg actggtcagc agaccgtttc tgattctctt gttgaggaaa ttctggttgt    126720
     gacgattaac ctgtatggac ctacctaatt cttgtcagag cttggcaaat atgcaaccgc    126780
     cacaacaact gtggattgtt ggctatcaaa aaagtgccaa gacgaatcaa ctaatcggta    126840
     tggggctggc acccgggacc gccattgaaa tcttacagat ggtcgctggc aatttggtgg    126900
     ttcgcatcgg cgaaacccgc attggtctca accaggatat tgctgagcaa attttagtgt    126960
     cggatcagcc gttaacagct ccagaaaacg tcatgagaga ccctgccaac atggaacaaa    127020
     tcgccccctt aacccttaaa gatttccagc ttcaccaaac aggcaaggtc aaaggttttg    127080
     cggatacgga taccccagac cttagagcct ataaaaagaa gctattggcc atgggtctta    127140
     cccctggcac tgaatttacc gtgacccata tagctcccct cggtgatccc gtagaaatca    127200
     aagttcgagg gtttcgcctt agccttcgtc aagcggaggc tgccttattg attgtccaag    127260
     aggtgcagga atagtcatgt caacaccgac cattgcctta attggcaacc caaactgtgg    127320
     taaaaccact ctttttaacg atttaactgg aacgaaccag agaacgggta attggccagg    127380
     ggtgaccgtt gatcagaaaa cgggacacta tcactacaac ggcaccaaaa cgacggtggt    127440
     ggatttgcct ggggtgtatt ccctagatgg cgaagatgac agtacggggc tagatgaagt    127500
     gattgcccgc gactatctac tgtccaccga ggccgattta attttgaata ttgtcgatgc    127560
     ctctaacttg gagcgaaatc tctacctcac cacccaaatc atggaaatgg gactacccat    127620
     ggtggtggcc ttaaacatga tggacattgc tcaggatcac gacttggaca ttgatgcgca    127680
     ggtgttatct catcgcatcg gctgtcctgt gagttccatg agcgcgtttc taggagaggg    127740
     catccacgaa atcaaagata ttattaatag ctatgttgat gatccgaaaa atcatcccac    127800
     ctttgtcacc tatccagcgg tgattgaaga tgccatccat cagctagagc ctattgttca    127860
     gcagcagggg cataatccta aaattgcccc tcgctggacc gccttaaagt tgctggaata    127920
     tgaaaatcgg gtggccccag agttgcaggg acagcagctt gagcaaatca ttgccaaaca    127980
     tcgccgccaa gttcaccagt tattgcatga agatatcgat attttggtag cggatactcg    128040
     ctacggctat atccgcagcc tcatgcaagc agcggttcaa caaacccatc aggttagcca    128100
     ctccaaatcg gatcagattg atcaggtcgt ccttaaccgc tggattggca ttcccctatt    128160
     tttggtggtg atgtatttga tgtttttcat tgccatcaat atcggtgggg cctttatcga    128220
     ctttttcgat attgccgtgg ggacactggt tgtagatgcg cctcaaacct ggctggagtc    128280
     cgttggtgca ccgggctggt tcacgggtat cgtcaccgcc gccgggagtg gcatccaaac    128340
     cgtcgcgacg tttatccccc aaattggcct gctgtttctg attctggcat tgctagaaga    128400
     ttcaggctat atggccagag ccgcgtttgt gatggataag ctgatgcgat ttgtcggctt    128460
     gccaggtaaa tcgtttattc ccatgctggt gggatttggc tgtaatgtac cggcaattat    128520
     ggcgactcga actttggaaa accgacgcga tcgcctgatg acgatcatga tgaatccgtt    128580
     tatgtcctgt ggggccaggt tgcctgtata tgcgctgttt gcagcggcct tttttccccg    128640
     taatggtcag aatttggtat ttggcctata ccttattggg atcgctgctg ccgtatttac    128700
     tgggtttgta atgaaaaaca cgattatgca gggcgaggcc tccccgctgg tgatggaatt    128760
     gcctccctac catattccta aacttaaagg tgtttttctg cgggctggag accgactcaa    128820
     aaccttcttg ctgaaagcgg gcaagatgat tgtgctgatg gtgatggttc tggccttctt    128880
     aaattccgtg gggacagatg gttcctttgg tcagcaggat agccaaaact cagtgttgtc    128940
     agctagcagt cgaaccatta cgcctatgtt tgcccctatg ggcgttcaag ccgagaattg    129000
     gccagcgacg gtgggcattt ttacaggtgt ctttgccaag gaggccatgg tgggatcgtt    129060
     ggattcactc tacggtcaac tggctgaaga agcagcaccc caaggtgagg cagatcctcc    129120
     ctttaatttc ggtgagaatc ttcaggctgc cttggttagc atcccgacca atatggttag    129180
     tttagggaat caactgctcg atccgctggg attaaatgtt ggcgatgtcc aagatcagag    129240
     tgcagtggct gaagaacaag aactttccac aagcaccttt ggtcaaatgg ctcagcggtt    129300
     tggcacttca acggcggcct ttgcttacct cttgttcgtg ctgatgtatt ttccttgtgt    129360
     ggcagcgact ggggcggttt accgagaaac caatttagga tggacggcat tagtggcagc    129420
     ttggacgact ggcttggcct attgggtggc aacgatgttt tatcaggtgg ccacttttgc    129480
     ccaacatcca gggttctcta ccgtctggct gggtagcgga gcagtggtga tggtagctgt    129540
     aatcggcctt ctaaagaccc tcggtaccaa gcgaaatgct gtctctatca gccctagaca    129600
     aaacacaagt aggccaaagg caaccgcagg aaaaagttag aactctctgc ccttggggat    129660
     aataaggcat taaggttcta ccttacttat tatcctcatt gggcttcaac tcctcaaatc    129720
     agagcaagaa taatgattct caaagagtta caagactttg tcctcgatta tcaccgagtt    129780
     tccctggcag aaatggagct ccattttcat atggatggtg atgcccttcg acatatgctc    129840
     actaaactcg ttcacaaagg aagggttcgc aagttaccaa tcccagaaca ttgccatggc    129900
     tgtacattct gtaacccgga cacgatcgag ttctacgaat gggtcgatca agctcagcta    129960
     ggtgcgtccc atttgcccaa aaaattgatg acaaaagctc aaatccacag catccattcc    130020
     ctggaagaag aagatccaaa aaaaagtgag caaaatgcta ttaaatatgc agtgatttta    130080
     catgactgca aggccggaaa gaagccaaaa gaggagtgat aattgcatca ggagaatcac    130140
     aatgtcttgg ttttctcgtt cagctccaac taatgaaatt caacttcaca ttgaagattt    130200
     acactgtgaa atgtgcgctc aaaccgtcaa ggaagccttg aaaaaagttt caggagtcaa    130260
     aaaagtacaa gttaaattat ccaaaaaaca agtgaatgtt gcgatcattg agaatagaga    130320
     ggttgatttt gcttctttgg ctagcgcttt agaacccact ggataccaag cagattgttg    130380
     gcaggaaaaa aggtctgggt taaagcactc tgaatagata ttgattcttt agttatgttc    130440
     tgtcagataa atctaatggc tggaatgact gatgatcagc gcattagctc ttgataacga    130500
     aagaattatt tctcccgaga ttaacaaacc atcattagtc gactaaaaga attaacatct    130560
     agcccagacc ttatcgccgc caacttgttc gatggagtgt ttgttggttt agctgatgac    130620
     tgctgatcta tagctactgt atataaaact tagttctaga gaacgagatg tgttgattct    130680
     cagcaatatg atttcagcct gggcggtaac agtcaatcta tcacttctct gtcgaaatac    130740
     tattgataac caatttcaat aaagttatag tggaatttcc tcacacaaca ccgtctagag    130800
     cctgatccta tttcaggctc tagacggaaa aaccaattct agatatcaga gagacattcc    130860
     cacattgcag acaatcattc actcaaaaga tgatggtatg attcagcctc acttaggtga    130920
     tattcagaat attcgcacta tctctgcacc aaagtatctg gcgctaagaa gtgggcaaga    130980
     tgataggctc gctcttcagt ctcaactagc attttttcgt acaggaatcg ggttccccga    131040
     tcgcccaagc tctctgcctg tgatgtctgt cggcggagta gttctattaa tgactgttct    131100
     gcagccaaat catgttccac catagtgcga caatcaaagg cgtcatctgc ttctggggta    131160
     aagcagcaga gttccgccag tttggtaaag ctcgcagccg gaactccacc caggccattg    131220
     agacgttctc ctaattcatg aacatggcct tttacttcac ccgcactctc atggaaaaat    131280
     tcatgaaggc tgtaaaattc agctccctca actacgaagt gatgtttctg atactgaaga    131340
     tatagcgcct gaaagctggc tagcaggatg ttcatcccct cacaaacggg ttctgtaatc    131400
     gagcgttcta gatgcaatac attttctgaa atttgattga atgattgtgc aacggtatct    131460
     ggcataacgg tctcctctca aaactcaaca tttcaattga tagggctaaa caagaaaacg    131520
     aataaaggta tcaaaaagcg agtcaatcct cagtaaacaa aaaccctata tccgtcagtc    131580
     aaataaccac atataaacta ttgacaactc atttatctca gcaattttaa ccaattaata    131640
     tgcttcagat gcctttatcc taacagcctt tagagtttta ttcatcgaca ggttcaacgt    131700
     ggttcaagca acagaattct aagttcaaat attattgata attattttca ttctgccctg    131760
     aatatatgtt caagctttga tatagaaatc ataaaactca acatagtttg ttagtaggag    131820
     tgagaggtga aaaatggaat ctaaacgtca ggtctcaaag aacagtatta ctgttgaaat    131880
     acattgtcag aatcgatggg tgatttatcg ccgtctccag gaacttgata ttgcctgtga    131940
     ttgctcagct tatcaaccat tgacgattca ggttgatact cctgaaaagg ccattcagct    132000
     atggagtatt tcacgtcggg tttcgcaacc ttgccagcag ctcatatggg aactagagaa    132060
     atgttggcag ttatattcat atcggtttaa gaaataactc actcaaaggg tgatgctatg    132120
     tttcctttta gcttgcaggg cgtttttgaa ttggagcttc ctcacataaa ggatgaggaa    132180
     attctgcatc gaataattcg agcattagag atagaacggg ccaaaaatat tcgatattct    132240
     ggtcattggg tcagatttcg aggtgggcag tttcgagcag tgaggcgtgg gaatcgactg    132300
     agttcaatta cgacgggtac gattacgatt gagcgaaaaa atgagcgtag gctgagagtt    132360
     cactattacc ttgctgtttg ggagttgttc ttgattttta cgggggtggt ggttgttttg    132420
     tttgggccaa tcatttggca agaatactca tcaaatcctc gcactgtgat gctcatttta    132480
     ggggggatgt ggttttggct atttggagtt agtttaatgc gagtccgact ctgctttccc    132540
     tggtttctga aggattttat cagcctccac caataggaga caaagggcga tcccccttgc    132600
     tccattcagc catcagtaga aaagacttct tcaaacaaag atggtttgcc tgagctaggg    132660
     aattacctcc agacttatct ttctcgcttt tgtaatcgat ctaagcgcag ctgatgctca    132720
     ggagtgaaca aaacctgaaa cgccagcatc acaatgccca tgcaagccag tgccgttccc    132780
     gctgcaatgg tgaagaagat aacaatttga tagcgcacgg catccgtggg agcaactcct    132840
     cctaaaattt gccctgtcat catccctggt aagctgacta atcccacgac catcatggaa    132900
     ttgatggtgg gaatcatgcc cgtccgaatt gcatcccgaa tcatcgaatt ggctgcttcc    132960
     cagcgggttg ctcccagtgc caggagagct tcaatttgag attgctgtct gactaaatct    133020
     tccatcaacc gatccagtgc taaggatgtt cccgtcagcg tgtttcccaa taccattccc    133080
     aataacggaa tgacatactg cgggttatac caaggatcaa tctgaatgat tccacccact    133140
     aacaggcccg taaccaatgc actcgaagct aggattgaaa gcaaactccg ccaaaaaatt    133200
     gcggggaatc gccgctgagt ccggttgacg gaggcattcc ccgcaatcac actcatcatt    133260
     aaagcgacga aaaacactaa ccaaggatta tcaagagcaa agacccacgc caagatatat    133320
     ccaactaata aaagctgcac gaccattcgg atggctgcaa tacccaagct tttggcgaga    133380
     cccaactgca aggcaaaaga aagaccaata ttgacgaaaa tcaagcctgc agcaagcgcc    133440
     agttgaaaat cactgattgg aatataactc tggttcattg cggctttctg gtgagggtca    133500
     aagatcgatc cgtcacccgc tgaagttgtt tcacattatg actagtccaa atacagcagc    133560
     gtgaagaatc ttcctgttgc cattgattca ccaaaacttc gatttgctgg gcggtacttt    133620
     catccataga ggcagtcggt tcgtctaaaa gcaacacttg gggcgagagc tgtaaggccc    133680
     ttagacaagc cacaatttgt gcttctccac cagataggtt gttaacagaa tgatgcagga    133740
     actcaagctg acgtccaagg ggccataaat attctaagat ttgttcttgg ttataagctt    133800
     tagggtggtg aatggccaat tgataaacct gctgcaaatt aaatacaacg gtcccttcca    133860
     gcagtgcagg ccgctgatgg aggtagatga cttgggcacg atactcaggc attgaaaagc    133920
     ctgacaaagg ctgaccgtga aaggtgagtt gacctgcttg caacgcatct aaaccagcaa    133980
     ttgctctgag taagaggctt ttgccgactc cagaaggacc aatgatagca agacgttcac    134040
     cagggaatag ctcaaaatct aggtgctgcc aaatccagtg atgttcaatc ttgcgaccaa    134100
     tctgagcagc ggatagaagg ggagaggaca tagctgggta gaaatagagt gatgtctcat    134160
     ggggagtagg tttgatgctc tttttggttg cactgtattc tgaattctac tggtaatccg    134220
     gttggcattc agcattcgag tgaaacagat tgaggattgg ctagaagtga atagcgaaca    134280
     ccaaattggg tgttttagca tctgcgctgc ggcccgctta gtccagcgtt tagtgtttac    134340
     atcaagtcgc ggagacgctt cttcaaaaat aactagctct agatctttga ggaaaattcg    134400
     agaaaggact agaatttggg tctgtccagc caaaagaccg tcaccgttag tccctaaaat    134460
     agtgactaag cttgtgggtt aggatctcgg aacgtcccgt gcgagttttg atcaacttaa    134520
     acatcttctt gctataaatc agtgattaca agtacccaaa aagaggtgtt tcagtgctag    134580
     ttagtaacgg gcatcgtctt accaacttga cgtagtacag gtaagcagta accacctatc    134640
     cccacccaga ttaacgctag cgatgtaaga acgtatagca aggcaatacc tgcaccaggc    134700
     tgagtcccaa acacaggccc aatcgttcca gtaacgacct ttgattgcac tagcggttca    134760
     aagatgcgat cggcaagagg accggcaatc agagaagcca ctgccttcag tcccttatgg    134820
     accagcgagt tggccgcaaa tacgcgcccc tgaatctctg gtgctgtatt ctccatccag    134880
     agggcggttt cggagctgtt taacaatgga aagttgagtg aggaacaaaa ttgacctgga    134940
     atccagacct gaagcgatcg cccaaatcca aagatagttt tcgcgagacc tgcacccatg    135000
     aacccaatca atatgccctg catccggcgt ttgggtccac cccaaatagt gagaataatc    135060
     gcgcctatca ctcccccaat tccagcagcg gctccggtgc tggctaagac ctgagcactg    135120
     ccgttgctac gggccaaaag catggggtta taaatggctc caccgagatc atggaaaaac    135180
     caaaacaggg ctgtgatcag caagagtgcc ttgaggtgag gctgtttcca gatgtagcga    135240
     aacccaaagg taagcgaatg tgttaatgtt ttcggctcag gatcagtatg cacgggttgg    135300
     ggaataatgg caaaaatcag ggtggcaatc gctcccgcaa aagtaaccaa atcaatgcct    135360
     aaaataccaa gcagcccgat agcgggatac agtaccccgg ccaaggcggg gctgagaatg    135420
     gaagaaccat aatgtactgc ggcattcatg ctattggccc gtatcagttg cgcctcggaa    135480
     acgagcaaag aaacggaggc ttgataggcc aactgctgaa tttgcccaaa gccaccgtta    135540
     atggcggcaa aaagatagag gtgccaaatg gctaggccat cagtgagata gagcgtaccg    135600
     aggccaaggg tagatagagc ggcgatcgca tccccaaaaa tcattaaagt tttgcggttg    135660
     acccgatcga caattagacc tgcgatcagg gtgatgggaa tctgcggcac ttgaaaaaaa    135720
     aagcccacta aggccagggc cgtcgccgag ccagttaact gccaagccca gagaatcagg    135780
     gcaaagtagg tcatgtagct gccgacggtc gagatgagct ggccgaacca aatgaggata    135840
     aaggttcgca ttgattcggc tcacttcacc ataactttag taatgtcatc caagacccga    135900
     tgggctgcaa gaatattgcg accaccagcc caaacctctg atggcacgtc atagatttct    135960
     ccctttttga cggctgataa ttgcgaataa aggggatcct taataaactc gttcagggaa    136020
     agctgctgtc taactttgcc cgttaatagg aaaatatagt ctccatccag ttgttcaaag    136080
     gattcgttcg atactaaacc cacgtggatg ggcggtcggg tttgaatggg ggggcgctta    136140
     aatcccagtt ccttaaagat tgtgcccgca aagctttttt cactatagaa atagaccgct    136200
     ccttggtgag aagcaacgat ggaaacaact gtctcttgag cattctgcat ctgttgtttg    136260
     agagcggcaa ttcgatctcg ataggtcttc aacagttgct cggcaagatc acgcttaccc    136320
     aaagcatcag cgtacagcct taagttatca ggccagttgc cgtcacggcc cgtttcctct    136380
     gtcagcactg tcggtgcaat ttgcatcagt tgtggataga tcttctctgc gacaacctta    136440
     ctccccagaa tcaggtcagg cttaagttcg attatggctt ccaaactggg tccattaggg    136500
     gttcctaccg cagcgatacc aatcgtgcga tcacccagat attccgcaaa ttctccatcc    136560
     cagcctgcgg aaccaacagg ctttacctca agggctaagg cggcatccaa gggggctgaa    136620
     tccaaggtaa ccacgcgctg cggcactagg gggacttggg agcgtcccat agcatgttcg    136680
     atgagacggg tttcggtcga tactccagtg ttttgaaccg cctgatggca ggctgccaac    136740
     agacagaaaa tcagggcaga gaggaccatc cgccacccga actgttttag acttattttc    136800
     atctcagttt ggtcatcaga caaagcgttt ttaactaaaa ctcaaaggaa actgaaccaa    136860
     taatcgtaaa cccctctccg ggtctgttct caaagacgcg gttcccttca gaactatcaa    136920
     taaagtcaac atcaaagaga ttgcggaggt tgagggccac tttccaattg ttgcgctcgt    136980
     agaacaaggc agcattagtg aggaaatagt cctctaaaac aaaactgttg gcattgtccc    137040
     cgaaacgatc gctgacaaag ttaaatccca gcccgaaccc caatccttca aggggacctt    137100
     gctgcacctc ataggtactc cacagattga aattatgtct aggaacccca aacacgcgat    137160
     ttccctgaat gccatcattg ctttgggtaa ttttggcatc ggtgtaggca taatttgcga    137220
     ccaaattcca acccggcagc agctcgccaa ttaaatctag ctcaatccca cggctgcgtt    137280
     gctctccagt aggaattgag aaagactctc caggtggaga attcggatct agggtggcga    137340
     cgtttttctt agtgatttca aaaaaagcta aattacccga gaatcttccc ccaagcagtt    137400
     cagtttttag acctacttca aactgctcac cgcgctcagg gtctaataaa tcacctgcaa    137460
     tagttgtacc agagttggga gagaaggagg tactgtagct ggcaaacaag gatagctctt    137520
     cgatgggctg ataaacgata cctgctcggg ggctgatggc atcatcactt tgggttgaac    137580
     ggttccctac ctccaaatcc tcggtcgttt gccgaacagt atcgtagcga gcacccacca    137640
     gaagatgaag attatccagt aaggtgacct gatcctggag gaagatcccc aatgagtcag    137700
     tgcggctaaa gtctgtttgc ggaagaggat cattaaaact agcgggtcga gggataccat    137760
     atacaggatt gaagatattg aagggtggct ggggtgaaaa gtcaatgcga ccgagggcat    137820
     agaaatcccg tcgataaaga tcaacgccag ctaagagcgt atgctgaaca ggccctgtag    137880
     caaactttcc caccacatta gtttgcagtt caaagttgtc aattggctga gcgttctgca    137940
     cccagattcg attcaaatcc ccagtggctt cgttaattct aaatccaaga ttagatacaa    138000
     actccgggga gtaactatag aatgtaaagc tattccgtac tttccaggca tcgctgaagc    138060
     ggtgttcaaa ctggtagcct accctcaaag tttcaatggt tgtatcatca cctggctcgc    138120
     cagtgatccg ctcgaagggg acatcggcaa tccgattacc aatagctggg agaccgccga    138180
     agtctgtggg caaacgatcg taggagtagt caaagctgag tagtagatcg gtctgttcgc    138240
     taattttcca gctcaagacg ggggcaatgg aaaatttttg aatactcgtg tcaaaatctc    138300
     gaatggaatc ttcagttcga tagacgccat tgattcgata ggctaagcgt ttatcttcag    138360
     taagtggacc tgagatgtca aaactgggtt catacaaatc tcgatttcca gctcgaaacg    138420
     atagcttata aaatggctct tccgtaggtt tcttgctgac caagttaatc acgccacccg    138480
     gttctaagaa accatacaaa atagcggcgg ggcctttaag tacctcaatt tgctcataat    138540
     tagagagttc tggaaagccg aaattacccg ttccgccatt ggtaaggcgg aacccatccc    138600
     tgaggacgga tccagaattg aagcctcgga taataaaccg ctggcctcgc tgatcgttag    138660
     agctagaaac cacgccacta gaattacgca gggcatcatt gagacgcagc acctgctgat    138720
     cttcaatcac ttccttagga atcacctgga tcgattgagg gatgtcgcgc agcggcgtat    138780
     cggtccgagt tgcagtactg gcattgggca ccacgtagga gctatcccga tctgctgtca    138840
     ccgtaatttc aatctcttcg tcctcgccat cggctatcgc tcctggtgtc actgctaaca    138900
     ctagacctgc ggatgttgca gaaacctcgg ccacaggtgg tgcatttgtc cctactatct    138960
     ctatctgcac cctgtctcca agcaagcttc gcacactcac ccggtcaatc ccaagtgcgg    139020
     gattaggttg ctcaaagtca ttcccctcag gcagttgtag cactgcgttg ggaatctcta    139080
     ctgtcagcac attcccggat accgtggggg taggcaagga caacgcatca acagccgttt    139140
     caagaaccac ttgcagaccc gtcgctgttg actgtagacg aaccgccgta atttccacct    139200
     gggaggcttc aatttgagcc atccactcag cgaccgttgg ggacgcttgg gagggtgtct    139260
     caatcggggt agagatcgat tcgacagggg aactctgagc gttctcaaca ttgagctgct    139320
     gggcaaccgc agctaggccc caacctgatg acactatcgt cattaaactg atgactcctg    139380
     aatgcctcag ggcaactttc tcaagcttac ccggttgatt acggaccatg cctcacaccc    139440
     aaaattgttc ataattattc ttaattagga catcttaggt cggctgggat cgagcgtcag    139500
     ttcccagcgg gatctttttc atccccagca ggatcggatg aataatggat gtgattgata    139560
     cggtttaact tccaaaaggt ttgggcaacc cttttggaat tagacaaatt cttacagcct    139620
     atgtctgata aaggttctaa gctgagcaat gtcactttag tttgactaag cgactgagac    139680
     gatattgggg aacaggtttc aactgtaccg cttctccaag tttcggtgat tttcccgcag    139740
     tcatcacgct ctcactcatt tcgacccgag caaagtaggt acctgctctt gtttggtctg    139800
     ggctggtaaa ttgaatctgt acttctgccc agatcgcatc ccgtgtccac tgttccaaga    139860
     aaaattgaac tcgctttagc ggaatgagct ttagtagtgg gtacaaatat cgcttgattc    139920
     ctatcaaccc tttgcgggta gtcttgccag atttgtcctg agtaagccag tcccacccct    139980
     cacgcatcca aatatcccgt tcggcaatct gctcaaactt acttaggcca ctccaacctc    140040
     gataatgtga tctcagtttt gcaacctcac cttgctgatt gacaagtaaa tcaacgatct    140100
     ctggctccaa atgcccccaa tagtgccccc gaggtaaatc aattagggtc ggggcaaatt    140160
     tgtggccgcc aaaatggctg caccgccata cccgcagatg gttgttgggc tgagtcgcgt    140220
     aaccttcccg taggttttta tatatggggt aaccaaaccg agcgcatgcc gcatcgacat    140280
     taccatgggt gcagacgagg atctcgcgta tatgggtagt ttcttgccga aagtggtgga    140340
     acgccgaaaa ctcgttgggc tgcttcatca aatgctttag taacgctgtg acaagccgtg    140400
     gaaactcagc ttccgggacg atgaactctt gttttttata ttgagtaaag agcttctgag    140460
     cccgatggaa atagatgatc cgtgtctctc cagggcgcga atacacctta tccggggcaa    140520
     tcaaaatggg ctgtattact acgccatact tcgtaaataa atgcctgaat agtttaatca    140580
     gtggcgcaat tctcggatct tccttgaaca ttttttcaat ccagggttga gctagctcga    140640
     tcaggagcca gtggtcaacc gttctggccg tcccaatcgg gtcttcgcca ttttgcttag    140700
     acaccaggga acaaaatcga cagtcggata aagctgtctg agtcaacata atttctctca    140760
     agtactcaac aacagacggt gttgtggggc ggtcgcgttt ttaataaatg caaattttat    140820
     ggaatttttt attattttac ttagatgaaa atcatgtttg atttttcaag gttcggcaag    140880
     cttctacaca aataagcccc tttgcctcaa cttaaaggct cggattgggc gtcagttccc    140940
     cgcgggattg ggaaggaact attgacgcag tgttcgtgga ttgacgccga actgctgccg    141000
     aaacgctgca gcaaaatgac cttggctaac atagcccacg cttgcagccg cctgagtgac    141060
     cgtgctgcct ccgatcaaca aaagctgctt ggcccgctcc agtcgctgca cctttacata    141120
     accaaacacc gtttgcccga acacctgccg aaatcccacc ttgagcttgt attcattcag    141180
     tcccacccga cgagccaaca ccgcaatcga ggggggatgg gacaattcgc gatcaagaat    141240
     gtcagcagct aaatgtacat agtccagatc tgctgccttg aggggggtgg acgcactatt    141300
     tccttgctcc aaggccagcc actgttccag ttgtagcacc agtagttcct gcgctttact    141360
     ctcaaggtag agccgcctca tgccctgttt atagggacag ttaagaattt gctgcagaat    141420
     cgcatgcatg gtgggtgtca tctttcccaa acactgatga aagcgatagg gagggtctgc    141480
     attcaacagc atttggagat ggagcggaag taccgaagct cccagctttt gcaaccagca    141540
     tgggtctaca tatatgcgca acagatggag tcgctgattc gctaaataaa tttctttttc    141600
     ttcgatctca ggaagggaaa ataaatagct gtaccctgct ctctcgcaat attctgttgg    141660
     aatattggga atattagggc tgtgaacatg atgttcccca gatagataaa acttggcaac    141720
     cagttgtggt tgggcatcat gagtgttcct gacacacaaa tcacggtgat aatagctatc    141780
     tgatgcctct aaacaaaaga tgggggagaa ctgtataccc caaacctgat ccttgctaaa    141840
     tcggtgactg caactagcca ttacatcaaa gtcgctatgg aaaacaattg atccgtgact    141900
     atctaacgta ttcagccact gctggttgta ggcagtacga gtcataattt ccatgtaaca    141960
     tctctcgctt gtatgacttt gcgaccaatg ggaatacata aaggtgttcc tgcaaccgga    142020
     tcactcacaa tttgactttc cagaccaaaa acttcctgta ccattgtttc cgtcatcacc    142080
     cgttcgggat ggccctgctt gtaaactctg ccatctcgga tcgccactag atgatcgcca    142140
     taacggcaag cctggttcaa atcatgcaac accatcacaa tggtgcggcc ttgttcttga    142200
     ttcaagtcat agagcagatc gagcacttcc atctgatgag ccaaatcaag ataggtggtc    142260
     ggttcatcta gcagcaatat ttccgtatcc tgcgctaggg tcatagcaat ccaggctcgc    142320
     tgtctctgtc caccggacag attatctaaa gcgtaatggg aaaactcatg catctgggta    142380
     atcgataagg cccagttcac ctgcttttca tcgtctttag accattgctg cagccaaccc    142440
     tgatgaggat agcgaccttg ggctaccaaa tctctcacgg tcaatccttc tggggcagtg    142500
     ggtccttgag ggagcaaccc taatcgttta gcaatagcct tgctggacag tttggcaatc    142560
     gattcactcc ccagatacac cacgccatgc ttgggcttga gtaatcggcc taatcccttg    142620
     agcaacgtag actttccaca accgttcggc cctaccaaaa tcgtgatttt gcccgtagga    142680
     atggctaaat ccagggactc aatgataact ttgccttcat aagctagctt gagcttccgg    142740
     gtcgtgaggg cgtatgcagt agtgtcagtg atcatgagtt gcgatctcga atcaacaaat    142800
     acagaaaata aggcgctccc acaatcgccg taataattcc acagggcagt tcaatcggtg    142860
     caaacagaag acgacccagt aggtcagcga ccaccaccac aaatccccca gttaaagcag    142920
     ctacaggcag taatccttca tgggaagggc ctaccatttg ccgtcccaaa tggggggcca    142980
     ttaaacccac aaaaccgata ccgcctgctg tcgccactgc agaacccgcc aaggccacac    143040
     cgctgagtaa caatagaccc cgctggagtt ccaagcgact gcccagactg cgggcaacgt    143100
     catcgcccaa ttggaggaca ttcaattccc ggctcattaa caggctgagc aagccaaacc    143160
     cgattagcca tggcacaaat acattcaact gctcccaact gcgcccatag acactgcctg    143220
     cgagccacac cagtgcctga ctgacgttgt agatattgcc aaaggtgacc atcaaattgg    143280
     tcagtgcccc ggcaatcaag ctgaaaccca cgccaactaa aatcaagcga acaggggaac    143340
     taccgccctt ccaagccaac agataaatca ggacagctac agtaaatgcc ccaccaaagg    143400
     cagccacagg aattaaagca acgggcaatt ctgggtacag caccactaag gtgacagcgg    143460
     ccaatgaagc cccagcgttc acaccaatga tgccggggga tgctaaagga ttacgcgtaa    143520
     tcccctgggt aatcgtgccc gcgatggcca gtcccatgcc caccccccag gctaccaagg    143580
     ttcttggcaa acgcagggtc atgacaataa aggcaaagtc agaattactc gtttctaacc    143640
     ccaaaacagt tttaatcaca tccagaggag gaaccggata ctcaccttgc cccacactca    143700
     ggaccatcac gactagcgtc gctagaatca gtcccaataa aatgccagga actcgtcggt    143760
     cgagatgaaa cgagatcggg atctgtggag gacgaacaac gagccactgc ttcatcgtcg    143820
     cacctgccag cgggttaagt agataaagaa gggtgcacct actaaaggca tcaccagacc    143880
     cacggggagt tcctggggtt gaatgatcag cctggcccca atatctgcaa ccagcaatag    143940
     aatcgctccc gtaatggcag agtagggcaa aatccaacgg taatcgacgc cgacccagaa    144000
     ccgaacaatg tggggaataa tcagacccac aaagccaatc ggtcccgcga tcgcaaccga    144060
     cccacccgcg agcaaaataa tactcaccgc tgcagtcacc ttgatccaag ccgtattctg    144120
     gcccaaacct tgggcaatat cctcacccaa gctcagggtg gtgagctgtt tgcccaacgc    144180
     catagcaatc accattccca ccactagata cggtagaacc tgaaccacta agtctaaatc    144240
     ccgccctgcg acagaacccg cgagccaaaa gcgaatctcc tccaaggttc gctgactcag    144300
     gatcaggact cccgtagtaa tcgacgacac caaggccgta aacgcagccc cagcaattgt    144360
     cagattgagt ggcgtcaatc cgcctctacc caaagaaccg agggcataaa ccgtgatggc    144420
     tgcaatcgca gctcccagta gggcaaaccc cgcatagata ctgagggacg tcgttcctag    144480
     ccaaaacact gaccccacaa cagccaatgc agctccagca ttaatcccca aaataccagg    144540
     gtcagctaaa gggttccggg tgagtccttg catcatggcc cctgccactg caacggcacc    144600
     ccccacgagc aaagcggtaa tggagcgagg aatccgaact gtccggataa tcagttgatc    144660
     cgtcgaacca tcaaaggccg tcaaggcttc atagaccgtc ttgggactga tatccgcaac    144720
     ccctaaacca acactggcca taaagcagac aaacaatagc cctaatccca gaatcaaccc    144780
     aaatcccaag gggagagtgg accgaattga cggacgttgg tgtgaggtcg tagacacttt    144840
     agtcctcgat tgaaatacgg atcaagaaac acttcctgtt agttactgct ttttctgagc    144900
     agcaatggca agtttcgccc cttcaatttc tcggatgcga tccatgaccg tgatgacgcg    144960
     accatgaccc acctcttcat ccgcatggat caccaccacc accttttcgg cagtgtcggt    145020
     taggtccctg acttcctgct ccagcgcatc cagttgaata ggttcgcgat tgagggccaa    145080
     atccccttcg gcatccaccg tgacggttac cttagtggag atctggggct tcgccgtttt    145140
     agcttggggc aaatttacgg gtaaggcatc actgcggtta aggaataggg tggcaatgat    145200
     gaaaaaagac aaaatggcaa aaataacgtc gatcatcggc acaatattga tttgagccgg    145260
     tggattggga tcatcgggta gacgcatagg ttgcccctcc tcgttcatag cgatgacggt    145320
     acatcaactc caactggccc ccatactctt gaataaaggc cagctggcgt tgatataaac    145380
     tgcgaaacat attggcaaaa attagggttg aaatggcgac aatcaatccc gcagccgttg    145440
     aaattaaggc cgtacttatt cccccggtga cgcctgctga ttcactaccg ccaatattgc    145500
     ccatgtccag tgaagaaaag gagttgatga gtcccaacac cgttcccaat agtccaagca    145560
     agggcgcaat actgatgact gtatcgaaca tcgtactgaa tcgtctcagg gtgggtagtt    145620
     cagcttgagc ttcactttcc aacgccaatc ggaactcttc tggagtcgga ttttctaaag    145680
     ccagagcagc taaaaagatg cgagcaatcg gaaactttgc ctgctcttgc aagtagccca    145740
     aggcttcata gacattgtct tgacgataaa gtttaaaaac ccgtcgaacg atgggtaact    145800
     gattgcgatt cagtttcgac cagaagatca agcgttcgat gacgagtgca atcacaatga    145860
     gcgaaaacac catcagaggg agcatcacta ctcccccatc ggaaattatt tggcctaact    145920
     gcatttatgt cgctccaaga atcacagtga aaaagaaggt caagttaggc tctatccaaa    145980
     accacaaccg agagaccaca cgtagagcga actcagtatc aacgaacttg aatagagaca    146040
     acgctgacag caatttcccc cactgtcagc gacacaaccc aagagttacc gaaacctcgg    146100
     tacgataagc cataatcgag accgtatctc ttaatagaat ccattgtcaa gtaataagaa    146160
     tgtataaacc tataccaaaa catttttaat gagatcaaca atctcctaaa aatacaaaaa    146220
     tataggtcat taaagcctaa aaatgcttga atttagtcag gccaatttct gcttatatgc    146280
     tcagtacgct ttcatcaaac aaaattattg tgtatggttt aaaacaatca attctcagta    146340
     agtgaatgag ttttaacccc ttctccaact ctcagcgagc gcaagaagag catctagtac    146400
     gtacgatttt ggcgttcacg ttgccgggct ctctggttct ccactcgtta ttctttggca    146460
     ttagtgtggg gattccctct gcagaggaag tcgatctgtc tgaagatgcc attgaaattg    146520
     cggtggtgga tgcccctgaa gaggagattg aggagattga agaagacgat cccattccct    146580
     tagaagaaat agaacctgaa ccgctggaag agctggaaga accagacatc actgagtttg    146640
     tggaagatat accagaacct gtcgcggtca acccagttcc tgaacctgag gatattcccg    146700
     aggaaactga gccgactgaa cccgctgagg aagcagagcc cagtgcttcc agtgaagaag    146760
     aatcttccga ggagcagtct gagtcttctg aaacaccggt gaagacaggg gatgatcaac    146820
     ccattgcctc ctccaacaaa tcaaagacaa cgaaatcctc aaccgctaag aagccaggaa    146880
     agtctaaggc caaaacgact tcacctaaac gcaaaccctc aaaaaaacag caaaagacag    146940
     cggtcaatac tcaacccaag cctccccaaa agcccaagaa atctaaccaa cgaggacgct    147000
     ccaggctggg aattggctac agaaaggatg ccaattccaa aacgacagca ggtttagccg    147060
     aacggtttat ccccgtttac gaagaaggca agctggttga cctgaagcta gagcggtcaa    147120
     cgggtgatcc tgccctggat aaagccattg aaaaagacaa gcagaaattt tttaagcagg    147180
     ttaaaaagca gcttaagtct gttccagaag gtagacgcag caaacccatc aaaatccgat    147240
     ttgaatcgaa tgatctcacg gctaaagagc gggaacaagc gcggaagaat cgggcacttt    147300
     ctcagcaacg cgcacaggaa cgggcagccg ctagagcccg tcgagctagg caaaaacctg    147360
     caccagcacc cgctccggca cccgcttcac agcccgctcc agctccgctt cctgcatcta    147420
     ctccagctcc cgtgagacag gtcgatgcac ctgttgcttc tcctagcaca ccaacgccag    147480
     ccccggctcc agtcccttca tcaactccag cgcctgcacc tgctccagct ccagcgcctg    147540
     cacctgctcc agctccagct ccagctccag cgcctgcacc tgctccagct ccagctccag    147600
     cgcctgcacc tgctccagct ccagctccgg ctccaatccc ttcatcagct ccagcgccag    147660
     ctccagctcc agcgcctgca cctgctccag ctccagctcc agctccagcg cctgtttacg    147720
     tacctccgcc agctccggct ccggctccag cacctgttta cgtaccccca ccagctcctg    147780
     cgcccgcgcc tgcccccgct tatgttcctc ccccagctcc agcgcctgct ccagcacccc    147840
     cgcccccaat ggctcctcca ccaaccttgg aataaagaca cctcttagca cagaacgctt    147900
     aatgcatctc gttcaacgga gggtttagga agcagggcct acactttggc gtgggtcttc    147960
     catttcaggg caattcaatt gcaatatata aagatggacg gagttgttct tttctcgatg    148020
     aaaaggactg caccatctct cgttcaagca gcgttcactt tttggctatg actcgactgc    148080
     cccgatggtt gcaaggactg gaaaatccga tattcgccag actctatctt gcacagacca    148140
     tcaatctgat gggggatgcc ctcacctggt tgggcttggc cctcttagca tttgaactag    148200
     ctggagaaca gtcaggcacc attctggctg gggcattaac gttgcgagtc acagcatttg    148260
     tgctgctgtc acccattgcg ggcgttatcg cagatcgcat ggatcgtaag cgcttgatgg    148320
     tcgccaatca tctcctgcgc atgggcattg tttgtctgtt gccttgggtc acgcagattt    148380
     ggcaaattta tgccattgtc ttggccctca acatcttcta tgccatcttc acccccactt    148440
     acaccgccac cattcccctg atcaccactg aacagcagcg tcctcaagcc attgccctat    148500
     ccagtgccac gagccagcta ttgggagtct taggtccggg tatcgctggc agtatcgccg    148560
     cctgggttgg cacccgacag gtctttttct tagacagcat cacctttctt ctagcagcga    148620
     tactgatcat caccctacct ggacgaatgg tggtcaacac tcagccatcg actcaaaccc    148680
     cttctagaat ttggcaggac atgcaaacgg gattggcctg tctgtggttg gatccattga    148740
     ttcgatatgc gctagctcta caatttattg ctgcgatcgc aggggcgcaa attctggtga    148800
     atacggtcgg ttatgttcaa agcaccttgc agctgggtaa aacagaatat ggatgggcga    148860
     tggctgcttt gggcatgggg gcaaccctag catcgattgg tttaggacat ttcaggaata    148920
     aatatcatcc cattagcctc atcaccctgg ggactctgtt gattgtctta gcgctcttac    148980
     ctgctcacga agtgttactt ggtggattat tgttgctttg gggcattgcc ggtatcggcc    149040
     aaaccctagt caatgtcact acacaaaccg ttattgctga ccgagttgcg gtggaggtgc    149100
     aaggccgcgt gtatggagca catttcgcgt taagccattt gtggtgggct tttgcctatc    149160
     cagttgcagg ttggatgggc agctctcttt cgacctattt tttctacagc agcctgttcg    149220
     gtttagcgct tttcggtgta atgttcgcca tatttcgccc ccatcaatta atgcaactta    149280
     agcgagggtt atggcatgag catgaccatg accatagtga cccctcccat caccaccatg    149340
     ggcacttagc tatgcaacac acccaccttc atttccatcc cgcgccctaa ttgaagcgat    149400
     ttaaccctac aactgaggac taaagcgaat gagacaagtc aggtgtgagt atcagccttc    149460
     ttgtcattgg tcctctattt tgcgatggat tagctgagtc gttaacggcg catgcaaaat    149520
     aatctaccta caaaaataag aatattttca ttaagaggct aggcaaaaga cattaggatt    149580
     tctatatcct gaaaattgaa tttgccagat atggctttga taatgggctt tttaaacttg    149640
     tttagctaga gaggctacag gtattaatct tgatagttta tacaaagtat tcttaatagg    149700
     cttgtaaaac tcctttgtgc tgctttagct taagacacca tgcaagttca tctgactgct    149760
     cctaacttct gcgatttagt ccaaaatgtg gctcaacaag ttaaagccga tctgcaggag    149820
     actgagctac tgcaacagtt tcagtttcct gttgagtttg gtcaaggctg ggtccaacgt    149880
     ctcaacattc gtcccggtgt aaccttaacc ctggaacgaa tgaccttatt tgaaccgctg    149940
     actatcttgg cgagccaggg gatgtcgacc tctacgcttg atatttgctt ttgcctctct    150000
     ggtcaagtgc agggcagtca ttgggatagt caccaaacca caactctcag tgccaatcgg    150060
     ggatgtttag gatttagtcc cgaaattcgg ggttgtctag aatatgcgtc ggctgagccc    150120
     gttcaattgg tcaatattgg gattgatatc catgaattgg ctagtgtttt acatcacccc    150180
     gttgagatgc tgcccttggc gttgcagcac agtctgttgg ggaactctca gtgtccctat    150240
     atccagcact tcaccacgac gaccgcctca caagttgccc tacagcagat tctgaattgt    150300
     ccctacaatg ggttgccccg tcggctctat ctcgaaagcc gggtgattga gttgctagcc    150360
     catctgttgc agtctctctc tccgtcaacc gcgagttcct ccaagctgag ccccgatgat    150420
     attgaacgga tttatgctgc tagtgagatt ctcaagcatc agttagagca tcccccgtct    150480
     cttctccagc ttgctcatca agtggggctg aatgattaca aactgaagtt aggctttcgg    150540
     gaagtgttcg atacgaccgc ttttggctat ctctggtctg tgcgtatgca agaagctgcc    150600
     ttgctgctca agcgcaatcg catgggggtt accgaagtcg ctctctcagt gggatattcc    150660
     agcgctactt ccttcagtgc tgccttcaaa cgaaaatttg gcacctctcc ccaaaaatat    150720
     cgacaacatt gctgaggttt aaatccgttt gagagaaaca aaaatccgtt tcaaagagga    150780
     cggtacccag cattcatggg tatcgtggcc ctcagtctaa cttgagaatg attcttattc    150840
     tctggatttg aggtggcacc tatgaaacgg atcccttggc atgggctggc agggatggca    150900
     gggatggttc tactgctgca acctgcccaa gcagcagaac agagtgaaac agaaacgctc    150960
     gaaatagtcc cccacccgcc tagcatatcc aggtccccca ccctgccgtt ccccgccgct    151020
     gcagtcccga tgatggatca acagtcatcg ctgaaggatc ggttggctgc ggaaccggac    151080
     ccagagattg catctaccgt ccaaatcacg ggggtggagc tagtgcccac agaaacgggc    151140
     ctcaccgtta acctgattgg ggatactccg gctgtgagcg ctccgaccgt taccacccaa    151200
     gaccaaacgc tcacagccat cctcgataac accgctttag ctctacccga agggaacagc    151260
     tttgtctcgg cggatccagt cccaggcatt cggcaagttt ctgtaacagc gatcagtgat    151320
     caccaagttc aaatccaaat catggggacc acggcccctc ccaccgccac cgttatcaca    151380
     accgagaccc aactggcact tcaggtcact tctggtgagg cgaattctcc agagaatgca    151440
     gatgcttcag aaaatgcaga tacttcagag gacacagaat tagaaattac ggtcaccgct    151500
     caaagacgtg aagaaaaccc ccaagatgtc ccgattagcc tgacggtgct gacagaacca    151560
     gaaatcgaag atgcagatgt cacctccttt gagaaagtgg cgggtaatac ccccaacttt    151620
     aattggttct cccccacaga cagtcgcagt ttctctttct acagtgttcg tggattgtca    151680
     aactttaact ttgcttcgcg agattcagtg ggcttctttg tggatgatgt gcccctggac    151740
     tatggtggca ccctggagag tgactttcct gacctagagc gggttgagat tttgcgtggc    151800
     ccccagaata cgctgtatgg gcgcagtgct caggcggggg tcgttaactt gattacccgc    151860
     aaacccacaa atgactttga aggcaatgct gccctgagtt ttggtagtga gaataactta    151920
     aacctgcgcg ccggtatcag tggtccactg attgaggatg cactgttctt tcgactggca    151980
     ggaacctttg ggcgacgaga tggcttttat aacaacttgt tcctagacgg ggaagagttt    152040
     gatgagaaat taggaggaaa catccgcggc aagctgttat ggacaccttc tgaccgctgg    152100
     gagatttcat ttaatgcttt ttatgagaat aatcaagacg gtacctatcc gtttgtcccc    152160
     cttgatgaca ccccctttga aatcgagcaa gattttaatg gtttcaatac gctcaagacc    152220
     aatagtcagg ccttgaagat tatctatcgt gacgataatg ttcaagccac gtccattagt    152280
     acccgtcgat tctcagaatt taatgtacaa acggatctcg atcagtccac gatcgatggg    152340
     ggcttttttg aaaacgataa cgcttcaacc atcttttccc aagaactacg gatccaatca    152400
     ccggatgatt ctgagtcgcg ttggcaatgg ttaattgggg gttactttga atcccggacc    152460
     tttgatgaaa atggtcgggg ggtcagactt ggaaatgatg caggattaat tttgcctgcc    152520
     cccctcaacg tgccaggagc cagaacagaa agctttgggg agttggtgga taccaccttt    152580
     gctggttttg ggcaggtcag ctatcgtccg gttgacgcct taagattaac cgtggggctg    152640
     cggtatgaaa atgtcagtag cgttctgaat tccttgcgtc aggttctgac ctttcccggt    152700
     gcacccccca tcccgttggg gaactttgat gggacagaac aaacgagcac tgctctgctg    152760
     cctcgatttg ccatcgatta ccaactgagt ccgaatgcca ccgtttatgg caccgtggcg    152820
     agaggcttcc gacccggtgg ggtaaatatt tttgctgatg atgcaacatc cctggtctat    152880
     gagccagagc gatcgtggaa ttttgaggtg ggggtcaaat ccaactggct cgataaccgt    152940
     ttaggcatta atctctctct ctttaccaac tcgattgaag actatcaagt gataacggtt    153000
     gaccccatta cctttacacc ggtcggaatt tttaatgggg atgccaatgt gaagggtctg    153060
     gaactagaaa tgcgagccac tccagttgaa ggactcgacc tcacggccag tttaggtctg    153120
     ctagacgctg aatttacaga ttttacggat gtggctactg gcactgattt tacgggcaat    153180
     cgcctgccct attcgcccag ttttactttc aatgtggctg cccagtatcg cagttccttt    153240
     ggtctatttg tgcgggggga agtgcagggg gttggagaga ccttctttga agaagctaac    153300
     gcccaaaata ttaggcaggg ggcttatgtg ttggtgaatg ctcgccttgg ctacgaattt    153360
     ggcagttctg gtatctttct gtttgccaat aacctatttg atacgcgcta tgtcactcaa    153420
     gcttttaatt tgggcgtggc tggcgttgct tcaggcagtt atggtacccc tcgcaccttt    153480
     ggggtgcaat ttagaactcg gttttagaca caatggctaa tcgcttctct caattggggc    153540
     tgttgggcag tttatacacg gctcagttga ttcccaatat gtttttcacc gtggcgctgc    153600
     cggtctatct ccgcagtcga ggcgcttccc tagaaacagt gagcctgctc agcttgctgt    153660
     ttttgccctg gtgcttcaag tttctttggt ctccgctggt ggatcgctat gggtacaccc    153720
     gttgggggca ctatcgcgcc tggatctttg gtacccaatc cattgccgct gtcttaatcg    153780
     ttatttgtgc actttttgat gtacaggccc acctcggtag tctcgtgggt ttgatgctct    153840
     tgattacgtt tttctgcgcc acacaggaca ttgccaccga tgcgtttgca gtgggactat    153900
     tgcccgttgg cgatcgcgaa gtcggtaacg gcatccagtc gatggggggc tatcttggct    153960
     ccattattgg agccgggggg atgttggttt tactagacca ctgggcctgg acccccacga    154020
     tgctgctgct ggcagtggta atgatcctct ccatgatgcc aatgctaggg gtacaagagc    154080
     gttcagttcc ttcacccgct gcacctgaac cagcatctat atggcgctac tatggccagc    154140
     aattttctgc attttgtcag cgacccggca tgaagtcttg gttactgctg ctggttctat    154200
     atgccacagg tggctcgatg ggctacacca tgctgcagcc attgatggtg gatttggggc    154260
     tgtcccttgg gcacatcggt tggcttttag gtattgtggg ttctggtgcc gggatagggg    154320
     gtgcgatcgc agccatccct ttgatccgca ggcttagtcg taagtgggcg ctaagtgcga    154380
     tcgccattct gcaggcgatt gtgttgctag gatgtctact ccctgctctg gggcttcaac    154440
     agaccgtggt ccctgtggtg attctgtttc atgtcggctt agggttcgcc agcaccatca    154500
     tgcacacgac atttatggat cggaccactc caaccactgc tggattcgac tacagcttcc    154560
     agtcttcggt ctcctatatt ggcggtatcg gtgcggctgc catcagcggt ctattggtga    154620
     cccatatggg ctacccatta ttttttggct tgtgcagcct gttgtctctt ctcagtattg    154680
     ctgtcattta tgggtgttta ggcaatattg agcctcaaag tccgatctta aacccggccg    154740
     aagttgcatc tgggcaacgt tagcagacca aggctctatc gccctggcag cagcttgatc    154800
     cgtttgcgat agggaaaaat ccgtttgccg caggcgctct cccacctcct tccctacaat    154860
     atttttcaag tcatcagcgg ctgcttcatc tctcttttta cagttctctt ctttacaggt    154920
     atatgagttc tctttttgcg caggccccgg ctggattatg ggccttgatt gcccctgtgc    154980
     ggggcagaat tggggttgcg atctcactag caatcggcag tgcaacgact acggtgctag    155040
     ccctggctgg aatagctacc ctgatccaac gcttgctctt ggcagacgcc agtttggctg    155100
     atgtgggggt aagaggatta gctgttgcga tcgcactagc gatatccgtt ttctgtcggg    155160
     cctgggcctt tcgcctctcc catttagcgg cctttgactt ggaagcatta ctgcggacag    155220
     aactgaccca gcatttagcc caggtgcccc tgggatttgc gattacaacg gggtcggggg    155280
     ccattaaaaa agtggtccag gacgatgtca aagccctcca tgcctttgtg gccgatacca    155340
     ctccactgat cggccttgcc ctaacgacgc ctattctagc tctggtaatt ttgctggtgg    155400
     ccgactggca gatgacggtg gcctccctgg cgatcttgcc cgtaggtctg atttgtcttt    155460
     ctctggcgac ccaagatcag gcccaacgac ggcaacaata tgacgaggct aatgaacaga    155520
     tcaatgccac ggtgattgag tttgttcagg ggatgcaagt cgtccgttta tttgatgatg    155580
     gcactagctc ctttgcccgc tatcggtcca ccctagacac gtttactcag accctaaagg    155640
     actggacagc agcgaccgaa aagccgggtc gagccggtga gctgatgttt ggccctttac    155700
     ccgtcttact cgtggtggct gtgatcggga gttatggcgt tcgccaagga gatctcacct    155760
     taccgacgct gctgctcttt ctcttgctgg ccccgcaaat caatagtgct tttaagccga    155820
     tcttgaccct gtctttattt atcaatcaat ctcaagccag tgctttgcgg atttgcaagc    155880
     tgttggctga gcccatccta cccttaccca gccagcccca aaggcccaag gatgcctccc    155940
     tgcaactgca acaggttagc tttgcctatg gggatcgtct ggctctggat caaatttctt    156000
     tggactgttc ccctggctcc gtgaccgccc ttgtggggcc atcgggggct ggcaaatcca    156060
     ccctagcgcg actgattcct cgattttggg atgttacgga gggagccatt cggattgggg    156120
     gagtagatat tcgcgagatg actgaagcag agctgatgtc gtgggtggcc tttgtctttc    156180
     aggaaacttt tttggtccat gacacgattc gtgccaatat ctgcttaggg gctacagacg    156240
     cgagtgaggc ccaagttgtc gctgcggctc aagcggctca ggcccatgat tttattctgg    156300
     cccttcccca gggatacgac acggttgctg gggagcgagg taccagcctg tctggaggac    156360
     agcgccagcg cattaccctg gcccgagcct tactgcaaaa tcgccccatc gttattctgg    156420
     acgaggcaac tgcctttgcg gatccagaga atggagtgtt gattcaccgt gcgatctcaa    156480
     ccctgactcg caacaaaacg gtgattatca ttgcccaccg gctcaccacc atccaatctg    156540
     ctgatcaaat cgtggtcctc gatcagggcc aaatcgtaga gcaaggtcaa caccctcagc    156600
     tccttgccca gcagggcctc tatgcccagc tctggtctca ccatcaacgt gctcaaaatt    156660
     ggcagctcag tgccaaggtg ccccatggtt aatctttatc gcaccctgat caaagttgct    156720
     gggtcctatg ccccccaact ccagcgatct ctggggctgt ccttactggc ctcgatcata    156780
     cagggatgta ccttagcgct attgtttccg cttctggatg ccctagcttc gtttcaagag    156840
     caactccctg gacgcttact ggtgctgatg gcagggggaa ccgtcttaga agcgcttttg    156900
     cggtggcggg agctagattt tggctggcgg acctccattg aggtcaccca tgagctgcga    156960
     attcgattgg gagagcagct tcgccagatg ccccaagaag acctaaatcg ttatcagtcc    157020
     ggcgatctca atcttatcct cagcagtgat gtggccgatt tggtgttgtg gatgggcagt    157080
     attgtctccc tgattcttca ggcgattgtg gttcccagta ccctagtgtt ggtgacgctc    157140
     tgggtagatt ggcggctggc cattgccctt ttgatcacgc ttccaggcgc gattcccttc    157200
     taccgtcaac tgcgccgcca tgctgcgaca gaaatgcccc agatggccca ggcagatgcc    157260
     atcgccacct ctcggctgat cgaatatgtt cagggactcc ctgtcctccg tgcccaccag    157320
     caagtggggc aacagtccga tagactccaa gcagctctcc agcatcaacg tcagatacag    157380
     attgacagcc aagatcgcac gactcggcct accttgctgt tagccggaat ggtacaagcc    157440
     agtctgtgct tgatcctcag tttaggaata tcactggttt ggctgcagga cctaaagatt    157500
     tcgactctca tggccatcat cgtgattgtg gtctgttgta gcgaccctct cacttacctg    157560
     gcgggtttaa ccacgctctt tgatctgatg gaaagtgccc tagaacgggt tgaacatctg    157620
     atggccattt gtcccttacc cgttgcccca aagccaaaaa taatcaccga ctataccatc    157680
     acctttgacc atgtctattt ccggtatcgt ggccaggaga actggatcct caacgatgtg    157740
     tctcttgaac tgcctgaacg cagctttacc gctcttgtag gtccatccgg tagcggtaag    157800
     accaccattg cgagactgat cagtcgctat gccgatcctc aatctggaac cctggcgatg    157860
     ggtggggtaa atctgcagac cctatcacct gccatcttga tgcctcacct tgctgccgtt    157920
     tttcaagacg tgtatctgtt taatgacacc atctacaaca atattcggat ggccaaaccg    157980
     gtagccagcg atgctgatgt gatcgccgct gccaaaatcg cgaattgtca tgggttaatt    158040
     caacgctttc cccagggtta tcacacccga gtgggagaag tgggcggcgc actgtctggg    158100
     ggggaacgtc agcggatctc gattgcccgc gctatcctca aggatgcgcc cattattctg    158160
     ctagacgaac ccacctctgc cctggatgct gagagcgaag tgctggttca acatgcgatc    158220
     gatcggttag tcgcagacaa aacggtggtg gtgattgccc atcgactatc aacgattgtc    158280
     ggcgctgatc aaattttggt ggtgcaagcc ggcaaaatca ttgagcgagg cactcattcg    158340
     gaattgctaa accagaaggg ggcctatagc caaatgtggt ggagtcaaca gccccaatag    158400
     cagtatcgat acgtcaccgc agggaaggaa tgacgagcta ttttctcaag ggcgagtcca    158460
     gcaatctacg gttgtcgttc agcagtaata aaatccacat ttcgcaggtt aggttctgaa    158520
     aattggcaat taaatctaga ctgtttttga agtgtgaaca cgcatagatt tggagcaaaa    158580
     accccaagtt ctgatcaatc tctgtggaca ttacagatca agtggctgtt atgaggggtt    158640
     caacttagcc gaatggccat aattttcaaa ttattgaatt gacaagtcaa cctgtggaat    158700
     gtccgtctat cgatagagat gctaatgtaa acccagaaag acttttctga ggcagacaaa    158760
     caattagctc gtttcaggtt tgtaggacat taaccttctg actaatcgct agtcggaccg    158820
     aaacggatgg gacggatcac agacggaatg acacctcaaa aagcagcctc tattcttcgt    158880
     gatgctgggt tcgaagtgga tcctctgagc ttacgcctgg aacgcaggga agaactctgg    158940
     gtgatgcctc ttagcggaga tcggattgca tggttctcaa cgacgtccga gtccgctcgt    159000
     ctcctggcat tcgaacggcg ggtgcaggag ttagttagtc gtcacaccag cctttgcgtg    159060
     ccagtttcta cgtttatgaa tgacgtggtt gaagttcgga acgctgttcc tggactggtt    159120
     gatcatgggg tactcttcaa gacatttctt gccgattcct cgctcgcaca gcgcttcggt    159180
     cacgagcttg gccatgctct cgccgacctt catggttcca ttccggcaag ccagcatgga    159240
     gactggcttc ccaaacaact cgaatggccc ttgccgcacc atgaggtgat cgagaagata    159300
     gacgtcgtta tcgacgaccc aggcttagtc gcacagattg accatgtttt gaccatgcat    159360
     gagaccatcg ttgttgatcc aagcgacctc gttctactcc atggcgacct tggttttcat    159420
     aatgtcgctg tggagtacga gaacctggcg tttcggggac tttttgactt caaagatgcc    159480
     gcgcgtgcag atcgccacct cgactttcgc tatctcattt tcacaccggg gcgcttcgat    159540
     atgcttgacg cctgctgtgc tgaatactcg agacttaccg gtcgcacctt ggaccagcag    159600
     cggattaaac tgtacaacgc aatttgggca atcagccact tggctcaccg ggccggaact    159660
     gctccagatg aactatcctg cgggcggact ttggaaagag atctgtggtg gactagaagt    159720
     gctatcgctt cactgtctgc ttgaccaagc attgagcgag ctgactaaca aactttgaat    159780
     ctgacatggg cttcagaaat gtcgagaggc cacttcaatt gcacatcccg ccggtctgct    159840
     cagctcaatg agacgaacag gcctacaatt cctgcaagga ttcctagatg gtcaaaacct    159900
     tggacttgga tccgcaaggc tttgagctta taaaacaact cagatgaagt taccaatttc    159960
     tctaacccaa cctgtggaat gtttgataga acgctatccc tccaccataa tttttcggta    160020
     aagtgcttcg acgggatttt gatgctctac catgccaatc ttgaggaacc ggtatcaggg    160080
     atgacgcttg agtatccaaa atgacggtgc atcagccgca atttgttgtt tacgcgtgat    160140
     ttcaaaccca tttttttggt aaaaccgcac tgccaactct gtcgctgtta ccacagaaca    160200
     aggaagaccc tccttacttg cctgcagcaa aatgggttct agtaagcgag ttcctatccc    160260
     ttgcccttga ctgtctggat gtaccaccat gagccccaaa tcccaataag gagactcgcc    160320
     catatcttgt tgctgggctt tttcgatggc agacaagacc ttgagccatc gtgccaagcg    160380
     attccaaccc accttcaccg gtaactgata caccttcaac tgcagtgcca tcttaatttg    160440
     ctggagccaa tggctggaga cttcccctgc tggtggtaac caaactgcta ctccctgtat    160500
     atctgatgtc gtataggtat acccatactg gatgcaatag gccattaatc gactcgtcag    160560
     ccaagttaat gcctgaaatc tcagttccgg atcatctggt gttaaattgc taaataccgg    160620
     atctgatatc aatgcatgtg ctgccagttc actggcctct tcaatttgcg acggtcgtaa    160680
     ctggagtata ttagagtgat ccatcatttg agaacctaat aattggtttg aaaagctgtc    160740
     ttgaatgtgt tcaacgaaca agtcaatatc ctgaccaccc tcgatgcagt cgtgcaaatc    160800
     ataggatgat atctaggttg taaacgccac cagctaatga tgttcagctt ctgcaattac    160860
     catgagaagt tctgcaccga gaccatcctg ttctaagctt ctggagtgtt ccctcctcaa    160920
     gggcgctgac tagagttgga ttgcggatgt ggtaaatcgt agcgccagat agagtcatgg    160980
     tttgctgctc aacccaatga tttaagcctg atcagtcatg gcctaacttt caaaggagat    161040
     gcgctatcgt gtaagcatcg gtctatcttg ccggaggcat cgagatggta cgtccctacc    161100
     taacaggcct gagtgcttcg ctactaatgg tgatgagtcc actggtgagt caggcatcgg    161160
     agctgccgat tgtagaatct gctgcattag ggattggtaa aaatccaccc tggtctgagc    161220
     ctgttcaggt tgaagatccc tttgaaggtc aatttatcgc cgtttttgat cggcatcgtt    161280
     ttagtgatcg cttcttaaat acccatatgc ggatcgaagt ccaaagcctg tggacgcaag    161340
     agtatgtccg cttattgctt accgccaaag atcgggattg ctatggtcat cacggtttct    161400
     tatcatcatc ctattgcagc gaagtaatcg acactaaaaa aatcgtcaaa ttgtttgtca    161460
     agattgatga acaaatctat caagtctcgg ggcagcacaa tacgtttcct gtcaatttag    161520
     agttagccag cgcccttagc agggcttcag agcaagagat tcaaattcgc ttagtcaccg    161580
     aaagtggcac ttcggtggat agcaaaattg gcccaaaaac tgtaaaagct tggcagaccc    161640
     tttatacctc tacgctatct cacaatttga agtagcaaac tcaatcatgc tgttagcaat    161700
     tgagtatgga tgtctattgg taattcgagt tcagttgaga attacacttt gctttgcaac    161760
     tagtgctgtt gcttgggtgc caattcgtga aaaatatcac ctaaattccg tctaatatga    161820
     ccatatattc gctattttct atattttggt aaaaatacta cataatgttt gcattcccat    161880
     acactgtgag ataactttcg atatgtcatt cggtctcctt tgaagtcttc aaaggagacc    161940
     ttgctaccgc agtataggtg aaacctgacc agtcctgcgc tcaaagcgca ggcttataca    162000
     ggatagttat taatcgttgt tgacaataat tatagataat atctggagaa catcctaatt    162060
     tcggaattat catgccttgt ccgtttaatc tatcgttagg cagctaagtg gtggaaatac    162120
     gtcacgaaat attgttcgcc gaaaattcag acatcgaccc tgaagaactc aacgctctat    162180
     ttcagctagt cggttgggat aatcaaaagc ggcgcactgt atccgagacc agagtgatgc    162240
     tggatgcaac tcacttctat gtccatgctc atgtaaacag gaagcttgtg ggtttcgctc    162300
     gtgtatgtgg tgacccatat gtcgcccaag tgcttgatgt cattactcat cccgagtatc    162360
     gatatcacgg cattgcaact gaatgtatgc accgaattgc atcctttctc agtcaatcca    162420
     attatgtcac cgttaccctg ctggatgact ctggtattcc gtgtttttat gagcgttttg    162480
     ggtttcgagg gatagatgaa acgcctatga aatggtgttc gtagcatcac cataattgcc    162540
     acgaatattt cacgattaat atacagtacg catcaggtag gtcatctatg aaagctttta    162600
     gtattgaggc tgctccattg gcagcgaagc cgcaaattgg atcgatgctt tcagcatatc    162660
     ttgctgaatt gggtgtaggt gaaccgtatc aatattttca ccaatactgg gttgagcctg    162720
     ggcaacgcta tccattcttg atccggcatc actcagacct agctggtttt gcatttgttc    162780
     gccgtgttga acgatttgag atggcagagt tttacattgt gcctggattt agaagggttg    162840
     gaattggtcg atttgcagta gaagaactcg ttagacaatt cacgggcttg tggatcgttc    162900
     gcgcattccc tggcaatgaa agagcgttgt tattttggag atcggctttg aggagtcatt    162960
     acattaagca tttggtggag ggttcagagg gtgagcgcat agtgttcacg tttgaatcac    163020
     tcagggcgcg ttaatggctg atcaggttat tggtatttcc gagttagctc aggtgatttc    163080
     tacccatctc aattgccgaa tactatatcc accgacggca atcagcatcc cgcaggtagc    163140
     aaaaatagaa acctgtaatg ccatacccgc acctaatcct gtgccaaaaa taggtccaaa    163200
     gaaccctgct aatgccccac tgggctgcat ggctggttca aagaaatgat cagctaacgg    163260
     acctgcgatc gcatatccga tcggactact caactgggtc agcaaaaatt gcgttgcaaa    163320
     cactcgccct tgcacctcag gttccacctt tgacatccaa atggtttgat ttgcactctc    163380
     tggaaacggc gaacagaatc cacacactag cgctgtccca atcttagtca ctgtttgctg    163440
     tgcaagagcc aacacaataa tgccgaactt ccacagggca ctggcaatca aaacaccgtg    163500
     aatgcggcgc ttcggtccgc cgctaatact aatggtgagt ccgcccagca gaccgcccat    163560
     gccaaagaaa gcgagaagcg ttccccaaat tagcgggtta ttattgctcc gagctaaaac    163620
     catcgcgggc aaaatggcga atatcgtact gccaatcagg ctattgacga tccaaaaacc    163680
     cagtagagcc atcagactag gccgaaccca gagatactgg agaccaaagg ctaaggaaga    163740
     ccaagacgtt tttggtttag tcggctgttc tgatggctga gggattttga ccaaggctag    163800
     actggtgatc gccatgccaa aggtgacaat atcgatgctg agaacccccg ttaacccggt    163860
     ggcagcatag agcgcacccg ctaaagccgg agccaaaaca taactcccag acatttggac    163920
     agaacccagg gcagtagcac gggcataatg tttttcggcc acgattaaag ttagagaagc    163980
     cgaataggct agaccttgga tgtagccgaa taagccgtta atggccccag aaaggtagag    164040
     atgccacacc tgaagctgat ccgtgagaaa cagcatcagt agggtgaggg tagacagtcc    164100
     tgcagctaga tcacctagca gcatcaagtg tttgcgagag tatcgatcca cccagatccc    164160
     ggcaaagggg gaaaccagaa gtttgggaat ctgagtgaac accataatca aagataaggg    164220
     ggttgcttgt ccggtgattt cccaggccca taaagtgatg gcaaagttgg ttagttctga    164280
     acccaagagt gatgcaaact gtccaagcca gatgatcaga aaggtgcgca taggtcctgg    164340
     cattcagaaa taggaacgac gaatagattc agaatttcaa tcggattaac ctgcagggag    164400
     gtgaaagata tatcgaggta agccgataag ccagtcgccc tcaggtggag tcaggattca    164460
     ggttaaagat ctcgaaaaca ctccataagt attggtagtc gttgttcaag catggaagac    164520
     tgtcaaacat tcaatattca ttgatgaccc gcagatcaac ttcaagactt gaatcgagtg    164580
     ggcatacggc tggttttaat ttttgagagt gacagctgtt ggtagaggtc actgaggaaa    164640
     acttcagtgc caataggccc taagagggca tggcataggt atacaggggt gaaatagacc    164700
     ttaccttctt tgctcggtgg tagtgattgt gcgatcgcat tctcgctcca ctctgttttg    164760
     atggctttga cctgctgttc ttccggggtg ggagttttag cagtgttttg gctagagaag    164820
     ccttcgatca aaatccagtc catatccaga ttggtcaacg attctaaaga aatcacatga    164880
     ctcggttcct gagattgact taaatcagcc gggaccacca cttcaaatcc aacgtcttca    164940
     agcaaggctc cacaggaact gtttgcggtt tctaggcgca cgccctggct cagttgctca    165000
     gacagcagca acagaacttt agggtcttta gccacgatag gctgtaactc ttgcttgagt    165060
     ttggcaacct gttgctgaga ctctgcaacc atcgtggtgg ctttgtccgc tttctggaga    165120
     gcttggccga gagcttccaa atcggtctgc cacgcagacc ctgcaccact gtagtcaaac    165180
     agtaaggtgg gggcaatttt agacagcagt tcatactcat ctttattctt aatgctgtcg    165240
     gccaaaatca aatcgggttt caattttgcg atcgcttcta aggatgggct ctcagcagtc    165300
     cccacattat ctggctgtct tgtcaggtac tttcccaaat agggaatttg ctgatcgggc    165360
     tgatcaaatt ggcgactcgg gaagggaaaa tactccgcat gggcaatcgg ctgtacctca    165420
     agagctagta agagttccaa taaattggga ccaatggtga ccaccttttg cggttgacca    165480
     cagacctctg tttcacccag atcatgggta atggttcgac agtccgttcc tgttgaggtg    165540
     gatggagtgg gacgggtaca ggctatgccc actatcgcta aggccatcag taggcccatc    165600
     gtgttcaatt tcagtcgtgc catacgctag ctttcctaaa agggctgggg cttattgagt    165660
     gggagaattc actgcaggca gtaaatcagc ttgcaattgt ttgagtaaca gctcggtgcc    165720
     aatgggaccc ggcagagcgc gacagacata ggcactgtga aagtacactt ggttcgattg    165780
     gctggcgggt aacgattgtg cgatcgcatt ctcctgccac tgctgccgaa cggctgagat    165840
     ctgctgcttt tctagatcag gccccgcatc gctaaaatcg gtattccaag ctagaaaaaa    165900
     gatccagtca gatttcagct ctggcaatac ctcaggggaa atattgttaa cccctcgtgt    165960
     ccctgtaccg atatttttag gcgctagtac cttaaacccc agattttcga gaagtccacc    166020
     acagcgactg tcgcgattct caatcgccag ctcctggtcc agttgctcag atgccaacaa    166080
     taagacttgc gggtatgtct ggacagcagg ccgtaatgtt tgacggacct cagttaccaa    166140
     ttggttgtga gcagcaatca cctgctccgc cttctcagaa cggtttaata ccttagccag    166200
     aaaacgaagc tggacctgcc attcctcgtt aaccccatag gaaaacagca gtgtcggagc    166260
     agcttgagat aaaagtgagt actgcccctg attcgctaga gtacttccga caatcaggtc    166320
     tggcttgagt tttaaaatgg cttccaggga aggactattc caagtgccca cttttttgac    166380
     ctggcctgtt agccgttctc ccaggtaagg aatttgagat tggggttgat caaaattgtc    166440
     gaaaggtagg gcatagtaat ccgcatagcc aacaggctgc atatccaaag ccaacagcaa    166500
     ctccaaaatg ctggggccaa tggcaacaat ggtttggggt tgcccgcaaa tctcagtttc    166560
     acctccatca tgctgaatgc gttcacaacc gctggttgga gtggtttgat cgggctggtt    166620
     acccgttgtg ccacaagcca gcgttagagc accaactagt agcccaataa atagagactt    166680
     gataacggta gccattacaa ctcaacagag atagatcctc gaatagtgaa cggctcccct    166740
     gggtagatac ctctggctct ccccccattc acagaacgga taaagttgac gtcgaatagg    166800
     ttgtcaatgt tgacagcaaa tttccagcca tctcgccgat agaagatagc agcattcgtg    166860
     aggaaatagc tatcgaccct aaagctgtcc tccagatcac cagcccgatc acccacaaaa    166920
     ttaaagccca ccccaaatcc tagtccctgg acatccccgg cttggatttc gtaagtcgtc    166980
     cagagactag cactatgttc agggacaccg atcaagtcat tgccgatggg gaaggtattg    167040
     tcttgggtga ttttggcatc aatataagca taggaggcaa tcacattcca gcccggcaaa    167100
     atttcacctg agatatcaaa atcaatcccc cggctatttt gctcccctgt agtgatgaca    167160
     gcaaaaggga caaccggatc ggcggtggcg acgtttgatt tagtaatatc aaaaaaggca    167220
     agggtggctg ataaacggtc tttgatcaac tccgccttaa ttccaacttc aaacccttct    167280
     ccccgctcgg catccaaaag ttctcccaaa tcatccgttt caaaggtggg gttaaaggat    167340
     ttggaatagt tggcatagag tgcaagataa tccgtcggct gaaagaccag gccaacccga    167400
     gggctaaacg cttcgtccac ttgggtgtct tcgacccccg tcacaatact gatattagag    167460
     cggtcgacga tatcgtagcg aataccccct actaagatta gattatccag caggtagatt    167520
     tgatcttgca gataaacccc caaccgattg accgaattgt cattaccaaa ggcaatcggc    167580
     actgtatcaa acgcaggttt ggggtcgtat acggggttaa aaatatccag aaaactgaaa    167640
     aattcagggg tgggagaaaa tctcgttgcc ccattgttgt ctgcacgaga tagatcaatt    167700
     ccggcgacga tattgtgcct aatcgagcct gtctcaaact cgccctgaag actggtattc    167760
     agattgaaaa agttgttctc attaaactga gccgcaaaaa cccgcgtcaa tgttcctgtc    167820
     ggttcatcta gggcaaaggg caaagcgagt ataccgtaat catttttgtc atagatatag    167880
     ctaaactcat tgcgaagttt ccacttgtca ttaaagcggt gttctaggtc ataacccact    167940
     ttcaagtagg ttttatctat cgtatcttca gggttattgg tgacccgtga gggtgggata    168000
     ttagcaatgc catcgccaaa agccagggtc ccaaagtcag caggattatc ctccttgatg    168060
     tattccaggc taaaggtcac atccgtttga tcactgatgt tccatgtcaa agaaggtcct    168120
     acgaaaaaac gatcaaaact agttgtatag tcccgaaaac tatcttcgcg gcgataaagg    168180
     gcgttgaggc ggtacagcaa attgccttct ttatccaagg gaccggatag atcgacactg    168240
     ggactgataa accctcggtt accgccttga atttgtagct tatagaaagg ttccgataag    168300
     ggttgcttgc ggaccaaatt aatcagtcca ccgggttctg actgcccaaa caaaactgag    168360
     gcaggccctt ttagaacttc tactcgctct aagttcgcaa tttcaggttc aacagaatca    168420
     tcaccaaaca gccgaaatcc attttgcaag acaggaacgt tatcaaagcc acgaatggaa    168480
     aaattcagtc cgcgaccatc gttattccct aaaaaggtga cgccacccac attctccact    168540
     atctcttcga ggccaattgc ctgctgatct tcaatgatct gcttgggaat gacttgaata    168600
     gattggggaa catctcgaat gggcgaatcg gtccgtgtcc ctatgctggc attaggtgga    168660
     gcataacctt cttcaggatt agccgtcacg gtaatttcca catcttcatc ttctgccaag    168720
     gtatcgggtg ccgattctga ggcaatagaa aaggtgagtc ctgagtctgc attgctaacc    168780
     gtcgctgtgg gagctgaatt ggctcctgtg atcacgactt gcacctgatc atcggccagg    168840
     ttcgtgacgc taatttgcgt aatctcaggc gttgggttgg cttgctcaaa gctggggtct    168900
     tctggcaaag ctaatacagc attgggaatc acagcactca gacgatttcc ctcggtggtg    168960
     gtggtgggaa tactaagctg tcctgtctta gattccaaaa taatattgag accctcagga    169020
     ctggggtcta ctcgcacagc cgtaatctca acgatggatg cctcaatctg ggcctgccat    169080
     tccttgacgc tggtcgcggg ttgggaagaa gggggcgtag agagttttgc gagatcgata    169140
     tctggagtct cacgtcctcc tgcagcctgt tcagcccgaa cgggaagcgg agctaaaagg    169200
     cccaaggtgg caatcacgga agggagacca agtattatcc tacctggtag ttcaagaatc    169260
     atcgtcttct gaatcaatct tcatacaccg catagacatc attgcttcgc acacaaagct    169320
     agctggttag tataggggaa aagtcctctc aaaatctttg cgataagtac tttttccttt    169380
     gtgaaatgga ttttttagat ccgagccgtt ggctttgttc agaaatggcc aaaaacaggt    169440
     aacacttgca cgacaaagca ggccatctct atcaacacgg atggctactt gagggattag    169500
     agttgcgatt tcactacact tctaaatcaa tgctcactgc aaaacctctt gcagttgggt    169560
     gcaggcagct tcaatcttgc taatgctgcc aggattgaca aggccgtaat aatcaaaggc    169620
     attaacccgc ttattctgcg tcgccttcag cttgctccaa aacggttcag actcaaaagc    169680
     cgctacggga tcttgctccg ggtccaccac caggacaata tcgggattcg cctctaacac    169740
     cttttccgcc gagagggtga catagccttc tactgggctt tggccttgca attccgccgc    169800
     tagatttttg gccttaaatt gttgaagtaa atctccagcc caactatttt tattgggggc    169860
     taagatcggt tgtcggctga ccagcaccag ggttgaggct gattcagcag gtaatttact    169920
     caggcattgt tgatagcggg ccaataaggg ggcgggatcg gctccgattt tgtccgcaat    169980
     ctcttccgtt aacacgatta aatcctgcca gcccttgact tccgtcgtca atgtagcaat    170040
     gcccaaatcc ttcactttgc agaggggctg atcatgaaaa cctttagcac caatcaccag    170100
     cgtcggcttc agggcaacaa ttttttctaa atcaggggcg gttcgtcctt gactgacttg    170160
     ggggagatct tgaaatcgct ggtcggttcc aattaatcga ctacctggaa ttcccaccag    170220
     cttggtgtca tccaggtgat gaataatatc ggctgtgagg gaggtcaagg ctacgacctt    170280
     gaccgattcg ttggtcgtgc atcaaagaag tgtgggtttg ttaaaccgat agggagtcga    170340
     gttgttttat ttcctcatgc aatgtcctct atgtggtcat cctaaaaccc acaaacatgg    170400
     caagaccagc aaaggcagtc aacgttaccg ttgcccccac tgtcaacaga cctttagtga    170460
     gacctttgac accctgtgtt atcgccgtca gatctctcct gaaacgatcc agaccatcct    170520
     tcaagctcat gttgaaggga gtagtctacg aggactctct cgcatcacgg gtgtagcgta    170580
     taacacttgt gtgagtgtgg ttcgttcagc gagtcataaa tcccaaatga ttcacaatgg    170640
     ggaagttcag gccgttgcga ccgacgtcat taatgcagat gagttgtggt cctttgtcaa    170700
     aaaaagcaaa agcactgtga gccgaaggag ttgagggtag gcgactgctg gatagcattg    170760
     agtcttgcga aagagagtgg tctcgtgctc agtggccgta ttggcagaca taccgacgag    170820
     ctagctcaag aattgattga aaatactgag ggcaaaaccg cctgtcatca ttggcaaacg    170880
     gatggttggg aagggtacgc acgacaatta cccgatgagg tcgtccatga agtgagtaaa    170940
     gccctgaccc aacgcttaga gcggaccaat ggcatcgtgc gtcagcagac cgggcgttgg    171000
     catcgacgac agaataaatt tggcaaagtc tggcaacaga gtgcgatgac tttaagattg    171060
     gtgctgagct atttcaactg gatttggtgc cactctcgat tcaagaacac ggctgcccaa    171120
     cgagctggat tgacggagcg tccttggaga tggcaagact tagcttccta tcccacactt    171180
     tgttgatgca caatcgattc gttggttgtg gcatctgccg tcacaggctt ttcgctattg    171240
     gcagaggggg gtgggctaga acaggcaaac agttggctac tgagcagtag tgcggctagg    171300
     agcagccgag aacggttagt catgggaagg aacggttgaa ggaacaggta tatcggctgc    171360
     gcggatggca caaatttgta agcccacggg gctatccatg agggcagcgg tgatgccaaa    171420
     aacttgagcc agattatggg gcgtcagcac ttttgatact ggtggcgaaa tattgcttaa    171480
     tttgtttaaa gcaccgatat agcgttatca gctatgaagg aaaattgtag tgttgtaatt    171540
     acatcaacgg cggaataagt attttagaca ttaacaaata tttcgccacc agtatcactt    171600
     tttgaggagg acccaaatca aagagctgtc cttgtttcag tgggcactat agcgaatcgc    171660
     gagattgaca tcatggagaa cagtcagaat tgtcagtcct cggtcttgat tgagggattt    171720
     cagaagctct agcaattcga gctgatggtg taaatctaaa aaagttgtgg gctcatctag    171780
     cagcaagacc ttgggatttt gagctaaagc caaggctaaa aaagctcgct ggcgttcgcc    171840
     acctgacaag ttttccagcg gacggttgcg aaatgacaac atcccagttt gagccaaggc    171900
     tcgcttaata tgctcatgat ccgtgggtgt taacgaccat tgccaccagg attgataggg    171960
     gggccgccct aagcagacca gttggtgaac ggttagcccc gctgggagag tttggtgctg    172020
     gggcaagacg gccatctgtt gagcaacggc ctgagtggat tgctgttgaa tggctttgcc    172080
     atccagaaga attgtgcctg cttgcagggg caacatgcgg ctgatcagct ttaataaagt    172140
     cgatttcccg gagccattcg cccccaataa actcagccac tccccctcct gcagggtaaa    172200
     agcaacgtct ttaacaacgc tggtttggtc atacccaccg ctaatttttt gcaggtctag    172260
     gagcatagtc atacccctaa cggagacata cgacgataca gcagccagat aaacagagga    172320
     gaacctaaga gagcagtaac tgcacctacc ggtagttcaa cggacccaag tcgagccagc    172380
     agatcggcca aaatcaacac ccaggctcca ccaagagcag acaaaggaac gacccagcaa    172440
     tagtccgtgc cgactaaaag gcggacacca tgggggacga ctaaaccgac aaagccaatt    172500
     aaacccgcca tactaacggc actagcggct aatagagtgg ctatcccacc gattaagaga    172560
     cgcgatcgcg tcaacgatac ccccaaacct accgctagtt catctcccaa attgaggata    172620
     ttgatattgc gggacagcaa acagcctgca atcagcgcac cgccaatata gggaccagca    172680
     ttgaccactt ctgtccaccc tcgtccattc aaactaccaa tcagccaatt gagggcggct    172740
     tgaatccgac cgtcatcgga caacaatagt agggtggttt gtactgcacc tagagctaac    172800
     cgcaacccca cctaacacta aacgttccac cgcaatcccg ttggcagtat ggcctaaacg    172860
     atagacctta tcggaaatag cgtagacacc tcacagaagc gcttttttct ctcacatttg    172920
     tgattaggca gttccaaatt gcccggtagg tttcccacga cggtgagtca accggaaatt    172980
     atggagccca caagctgttt ccatggcatc atcaacatag tggtcaaccc aatttctaaa    173040
     tctctgaacc actatctgac aacgcttaat ccccccgatt tggtgttcta cctccactcg    173100
     aacctgtgaa atttgtcgat tctcctcttt ttgtatgttt gtcaattctg cgttgcgagg    173160
     tttcttcttc ggttgtttga tgctcactcc gcttggggca aatccttgga acccagtatc    173220
     ttgccaaagc tcactccctt ctgggaactg atacctgacc tttactcgaa aaagtggaca    173280
     gttcatttaa gctgcaagtg tttgatttag tgtcctccag taattttctt caaattggac    173340
     aggggtgcaa tatccaatgg ttgaatgcag tcgttgtcgg ttgtagaaca cctcaatcca    173400
     ttctgcaatg accgtcttag ccatcgctcg gttagcgaac gttgtgggat aaattaactc    173460
     agttttgagg gtcccaaaaa agctttcagc aaccgcatta tcccagcaat tggctcgacg    173520
     actcatacta caagtgattc ccctcttcaa tagagcctgt tgatagtctc cactggcata    173580
     ttgactgcct cggtcagaat gaaagattaa tccagtctgt gctggtatcc gttgtcctaa    173640
     agcagccttt agggcattga gaactaatgg tgtgcgcata tgctcagcca tggaccaacc    173700
     caccacccgt cgagagaaca agtcaataat cacggccaag tataaccatc cctcatgggt    173760
     tcggatatag gtgatatctg caacccaagc ttggtcaggc tcctcagtcg taaacgtcct    173820
     gtctaggata ttcggggcaa tcggcccatc atgctcagaa tcagtggtga ctttgaatgg    173880
     acgtttcgct tgggcacaaa tccccagctg tgccatgagc cggactaccc gttggcgact    173940
     ggctcgaaat cctcgggcaa tcagagatgc atgaattctc ggtgagccgt aggtttgacg    174000
     actctcatca tgaatctgtt gaatccgctc tgacaagatt gcattctcct gatgtctagg    174060
     ggagggctgg cgcttcatcc aggcatagta gccacttctc gataacttga ggactttaca    174120
     catcaaggta atggtgacgt tcaccttctc tgactccatt aactcatagg gtctgagcgt    174180
     ccctgagcaa agaaggttgc tgcttcctaa gaaacacaat cccctgtacc aatggattca    174240
     agcttaaatc cgaattcggc tgctttacga tggaggtttt taagaacccg ctggcggtat    174300
     ttttgctcgt attgatctgc accaggatct acatagtcca tgccatagcg gactgcattg    174360
     taaaagagca cagcgagttt gcgtgctgtg gccgtcacgg ctttcgcctt tccaattcgc    174420
     gcagctaggc ggcgatagaa agcgcccaga gccgtattag ttcgcccaac agccactgca    174480
     gctcgtcgca aatgtgtcgt tactcggttg gttgtcttac cggagtaagc agagagcaat    174540
     ttgccacctg attttttgct tccgggtgac agtcttagcc atgaggtgaa atgtttagct    174600
     gtcggccacc gactgaggtc aaccccacac tccgaaatta agcgtagtgt agataagggc    174660
     caatcccatg aatttgagtg agatcccttc ccactagttg atagagtgac gctcgaacat    174720
     caaaattgat ggcattaggt tggcgcgttt tagaacggat cttcggtatt ggcgaagtag    174780
     gctctggctt gtcttgattc agttttgcta atgagcgctc aatttcaata tcgcattcct    174840
     ggactcgggc ttgatagaag tcatacaggg taagggcttg agtgagggca aagatatgct    174900
     ctggttggtt attaccacgc agcgacgcct caatcgtctc ctgacttgct cggcaacgca    174960
     cgtcccgcat ctgggccaac ttgaccgggt cacgctcgcc agcaacaata gcccgaataa    175020
     tcttcatccc tgtcgcaccc gtgatgtcac taacgacatt ctgaagctgc atattcatca    175080
     aggtcagggc tttttgcata tgctgaatat gagcggccgc ataatctaag tgccgctcac    175140
     gtatccgtag ataggctcga agggcagcaa tatctcgacc gggccgaaaa cttgcccgca    175200
     gtagaccgca agcgtgtaac cgctgtagcc actgagcatc attaacatct gtcttgcgtc    175260
     ctgggacatt acgagcctct cgtgcattga ccagtatcac gtctaaccct cggtcctcaa    175320
     ggatctcaaa cactggcacc cagtaaacgc cagtggactc catcgccact gttttaatgt    175380
     tgaattgaat caaccagtca gcaagacgat gtaaatcgga ggtaaatgac tcgaaggttt    175440
     gaacggattc atcagctatt tcaggtggta ctgcaacaac atgaaaccgt gacccaatat    175500
     caatccccgc tgcaaatggt tgcactacag gcaagcccgt tcgttcagat ttatctgaca    175560
     tggatagtcc tctaacaagt ggataacccg gatgggaact cgggttaaat cactttccta    175620
     aacggggtcg tatgaaacgc caccaatatt gagtccgcag ctttccctgg gcccggtttt    175680
     ttgacggggt gctacctcca aaaagcagac ggccactatc cgggtacttg acagtgtata    175740
     gtccaaacca gtggaaaaca tacctccaaa atgagtctaa aagcttttca cagaaggagt    175800
     tgtagctcaa cgagaatggg agtcccatcc tcgtcgccag tcagatcttt ttgtgtttct    175860
     agtctattgg ggcaggctga agcgtggaga tggtttttta ggaaatctcg ttccatttga    175920
     acgcgtttga ggtctcgacg taattggttg agttcttgac gctcagcaga tgtcaagggg    175980
     ccaccgggga tagggtgttg gtcgatttgg gcttgtttga tccatttgcg taaggcactc    176040
     ggggttaagt ccagttctct cgccacttga ttaacagatt taccagactg ttgaacaatt    176100
     ttgacggcct cagccttctg ttcagtagta aaggttcgac ggggtctttg tgtcatgtaa    176160
     acattctcct agggtatcga ctctgcgaga atgtccactt tttcgagtaa aggtcagcaa    176220
     caattttcag atttcattag ctgcttttga tttgaagagg tcaaaattct gcatcaccaa    176280
     aagcttgcaa gagccgagtg tttccggaat tcacaagtag taaggttggg gcaactttag    176340
     acagcatttg atactgatcg gcattgttga agtcagtccc tatgattaaa tcaggcttgg    176400
     tctttaggag cgtttcaatg gctggctggg acgctaaacc taaattcgtt aggggctggg    176460
     tgacaaactc accgagatag ggaatatctt gactggggtt attataggcg tcttgatgcc    176520
     acgccacgtg atcagcgtag gcaaacggct ggatgtccaa agcaagcaaa ggttccagaa    176580
     caaacggtcc cagcactgcg atgtgttgag gttgaccaca gatttgggtt gcgccttgtt    176640
     gatgctcaat catacgacag tcctcttgct gcgaaggggt tgacggagtc cgaacatcca    176700
     agtctttttg acaggcaact accatgaccg atatggcaaa aaccagtatc cgatgataaa    176760
     tcattctcct tctttagaca gaacgctaaa attgaatcgc aactgagccc acgatggtga    176820
     aaggagcacc aggttcattg agactctctc gactattttg agtggcagcg atgtaatcaa    176880
     cgtcaaagag attgcgaata ctaaggttta ctcgccagtt atcacgccga taaaaaatag    176940
     ccgcgttggt aaggaaataa ctctcgacat caaatgtatt cgctagatct ccagcacgat    177000
     ctcccacaaa attaaagccc agtccaaagc ctaaaccctc taaggtaccg gactgtaggg    177060
     tataggttgt ccataaactg gcactatgct caggtgtatt gaacacacga ttacccacgg    177120
     gaatatcatt atctgccgtc actttggcat cagtgtaagc ataggatgcc aaaatattcc    177180
     atccgggtag aatcttaccg acgatatcta actcaatccc ttgactgttt tgttcccccg    177240
     tagcaatcaa agcaaacggg tcattaggat cagaggtcgc cacattctgg cgcgtcacgt    177300
     caaagtatcc tagagtagcc aggaagttac catcccataa ttcggtttta ataccaacct    177360
     caaagccctc tccccgctct ggggccagtg ggtctccagc acttgtcgta ccaaaattgg    177420
     gcgtaaagga ttgagaatag ctgccataga gggataagtt gggaattggc tgatagacca    177480
     ggccgaatcg aggaatccaa gcatcatcat ttcggattgt ctctgtggta ttgggatcaa    177540
     aggcattcgg gaaagaggta acggtttctt tgaccgtttc gtatcttaat ccagcaacaa    177600
     gaatcagatt atcaagcaga tcaatttgat cctgaagata gatcccaagc cgatctcggt    177660
     ccaactgttc atctcgaaaa acaggtaact ctccaggatt gacgccatta aaggtgccat    177720
     agacaggggc gaaaatattc aaaggctgga aatctgcaaa atcactgaat tgggcagtat    177780
     ctctttcttc gctccggttg agatcgacac caaataatag agtgtggtca acgggacccg    177840
     tggcaaattt gccaattacg ctggtctgca acgagaagtc ttgtggattc ctgacttgac    177900
     gacttaaccc tcggccaaga atcccattag cttcatcaaa aaagaagaga ggaatagcgc    177960
     ctgtatttaa gatgtctcgg cgagtaaaac ggaaggtgtt ttggaccttc cagcggtcgt    178020
     taaagcgatg ttctaggtcg tatcctaccc gaagaaattc aatatcggag aagtcctcca    178080
     gctcacccgc aacacgacta gcaggtacat cagctaccct attgccgatc acaggcaaac    178140
     ccacttcaaa tggcccactg taatccgaat attctagttg aaccgttaga tcggtctgat    178200
     cgctaatttt ccaactgagg gtcggcgcta caaaaatacg ctctatattt tgttcgtagt    178260
     ctctaaaact ctcttcattg cgatatagga cattgaggcg atataaaagg cggttatcgg    178320
     aggtcaaggg gccagtcaga tcgatttgag gactaatcaa ccctcggttt ccaatctgga    178380
     gttgtgcttc ataggtcggg tccgctaatg gcttctcggt tactaagtta atgactccac    178440
     ctggttgtat ttcaccatag agaattgaag caggtccccg cagaacttct atccgctcta    178500
     gattggcggt ctctggaata ccatcattcc caaaaccaaa ctgtcgaaag ccatcgcgaa    178560
     ggataggaac gttatcaaag cctcgaatat tgaagttaac atctaatcca gcgaagttac    178620
     caccataggt aaccccactg aggttactga gggcatcttc aaggcgaatc acctgttgtt    178680
     cttctaagac ctgtttcgga attacctgaa tggaagcggg tgtatccaga attggggtgt    178740
     cggttcgtgt cgcagtactt gcatcaggga caacataacc ctccaggaat ttctctgctg    178800
     tcaccgtcac atcaatctct tcatcctctg agattgcttg tgctgcagca tccacaacca    178860
     acaccaatcc tgtgtcctca ttctgaatcg agaccgttgg gggtgcgtcc gtccccacaa    178920
     tttcaactgt cacctgatcc gctgttaaag aggtcacgct gacttctgca atacccgtag    178980
     caggattcag ttgccgatat tctgggccat ctggtagggc taacactgca ttgggaatca    179040
     ctgctgttaa tcgattctcc tgagctgtag ttgtgggaac actcaattca tcccgtccag    179100
     tctctaagat gattgaaagc ccttgagctg ttggattcac ctgtactttt gtaatctgaa    179160
     ttattgcttc ttctatctga gctagccatt cagtgacgct cgtggtaggt tgctcacgct    179220
     cgtgattact agcttctgca acctctgtgg aattttcaga tttatctacg gcccaaacgg    179280
     atggtgctgt aagtatattc gctagggtaa atacccacag cagcaaagat ttaccaaata    179340
     accgtgtaac catgcctcac ctaaattgct agagcaaact gttgctaata aaaataattt    179400
     ctattagccg agtgagtgca tcgtatcggt aaagcgagat aaaaaccttt gtaaaaaaga    179460
     cttttttttc tttgtgaaac tgacaaactg ggcattgcta aggtcgccga cccagttgat    179520
     aagctttagg gctaatcgca aactgctgtc tgaaagcagt actaaaagcc tcaggattcc    179580
     gataaccaac tgtagcagcg accttagcaa tgctcagatt gggattgtgg agaagagctt    179640
     gggcttgctg cagacgatac tgctttaaat agccaaaaac agtggtgcca aacagatgtc    179700
     gaaaaccctg attgagcctg tgttcgctaa gacctacttg ttgcgcaaat tctgtgaggg    179760
     agggcggctg ctgggcttgc tgtactaaag tctctttggc ccagtggagt tgttctattt    179820
     catcgatatc caggttggtg gtctgacgtg agttatactg ccaagttgat aattggaggg    179880
     ttagcagctc aagtactttg ctttctagat aaagttgctg cattagccct gtatagggac    179940
     aatgaaagat tttctgaatc tgttgctgga ttgagtcagt aatgcgtcca aggggctgat    180000
     gaaaccgatg agttctatca cctgccagta aagactgtat tggttttgga agagctgaat    180060
     gtccgtgatc cagtccattg aagtagtcag gatcaatgga gattatgact acttttagag    180120
     cctgactggc aaaccactct tcaatttcag tgtggtttgg gaggtgataa aggtagtgat    180180
     gtcctgccag ttcttgatag tcacaatcga tgtccgttgc atctagcgtc tgtactcgtg    180240
     aggttcccga taggtagaat ttagcgacta gcggaaatgt tgtctcatgt tggcgaatga    180300
     ccctcaaagg ctgatttaac cgaccgtgaa gaacagcaat ttcgagcccc tggcgaagtt    180360
     gcatgactcg ttcgcctgcc tgcccaaact gtatcggcaa gttgctttgc accccatact    180420
     caagcagttg gtaaattgtc tcgcccttat tctctgcttg ctccatcagg tccgtcaaat    180480
     cagcttgggt aagggtaagc gccatattag ttaatgccct acttgtaagt aagaataatt    180540
     ctcatcaatt tttaaactta gcagacctct aaagtgattt acaaggaatg ttgatccact    180600
     cccaccgctg aagcaggtgg gattcgggac tcaagcagcc atagccgtct gagacggtct    180660
     aacatcgccg actgccagag acagagatcc tgcctctttg atgttgttgg ctgcgttgcc    180720
     atcacggtca ttgaccgtct gacaactggg acagcgccag cgcctaacgt ccaagggcaa    180780
     cgactccagc acatacttgc agtggttaca cgtcttgctc gacggatacc actgatccac    180840
     atagcccaag gtcttgccct ttttgaaggc aacgaactct agaatttgca ggaattcacg    180900
     gaaggccaga tcgttaactt tacgacccca tagtcgctgc attcccttca aattcaaggt    180960
     ctcaaaaaac aggtggtcat actggtctgt gagctgatga gccagcttcc aaaaccagtc    181020
     tgtccgcttg ttcttgatgg cttcatggat acgagcatag tgctttctag cttgttcacg    181080
     acccttggaa cctttctgct tacgagaaag gtggcgattg gccagtttgg tctgattgat    181140
     cccttattac aagacaagga aataggtgag tgagaagggt cttgtgtgaa tctgcgtgga    181200
     ccgcaattaa aaaggataaa gagttaaggg aatcttttga gaggctttat cctaaaactg    181260
     gaaagaagaa agcaatcgta gcagtagccc gtaaattagt aggtcgaata cgtgctgctt    181320
     ttcgtcaaaa aactatttac caaatgagta ctattagtta actaaaaaag tatcactaag    181380
     gaaaaggttg agagacaata gaaagattta tcaacacatt ctggctttgt aaccacgatg    181440
     aaatgtcggt gtgtattgga tatcaatatc cacgtgtata ttgtttgcgg tgcaaagttt    181500
     ttaggacgaa taaggaaaga gtggcacagc taaggcagtg actacgaatg actgacagtt    181560
     gcaaatctat cgactaatct ttcagcgtaa attatcccga taaaaaatca gagaactcgt    181620
     accatggaat ttattatgac tctccttaga agttaaagga gaaaatttct tttggatact    181680
     cttgacaact catcacgact gactttttac atttgctaac caaccagata tgtttcacct    181740
     aggaatagta aattcgtgat actcatccaa caatcacaaa atagataatt tacagattaa    181800
     gtgtagatga actttgtgat tgtagaggag tcacctaagt tttcccctct cccagtgagc    181860
     tttaatactg cactttcccg tgtccaataa aggttttggg cttactccga atgtggatcc    181920
     ccggagagaa agcttcaagc ttccaatatt tctaactgca agaaaattta acttcactca    181980
     tatgatacag gaatcacaag cactcgaaaa atgtaggaaa ttgtcaccga tcgatttgat    182040
     ggaggatatt caatcagcat gtggacatga tctttactga ccacgccttt tagtatgcgg    182100
     atatcctctg catcgcatat ctggatgagc aactcacggc atcagttttg cacttcgcct    182160
     ttgagcacct gataacgata cttggtgacc catacaacat gaacagttaa gcgggtgacg    182220
     gtatgattcc cacgaagatt ctcgaccata gacttctgga tgctgctgct ctatcctgca    182280
     taagagctgt gtagcaatta aagtctcgca ctgaaagtgc gtagtttcgg actagcgtgt    182340
     ttaggacaat gaaaaacctg tcaactataa aagtgagaca aatatgaaat tactgaatta    182400
     ttattaatac tatttattga tttttttatg atcttgattc agcaaaataa tgctattatc    182460
     gttccaaacg aaggggagta gctttagtcg aacaaggccc atcgtctgag tcaacatact    182520
     ggtgttaagc ctggttcaga cggcaattta gaattttcta gtttgcaagc gagaccttca    182580
     ttaagtccac aacaagagtg ggcttgatgg ggtctttgga aatacctatc atgcctgctc    182640
     atgcaataca gtactggagc agcaaatgag cctcttgcct ggatttacag ccggattgtt    182700
     actaattacg ctttcagaat tgggtgacaa aacttttttt atcggtgcca ttctagcgat    182760
     gcgtcaccca cgacgctggg tttatggggg agtaaccgtc gctctggcta caatgacggc    182820
     cttgtcggtc tggattgggc aggtagcaac agtctttcct cagcagtatg ttaaaggaat    182880
     atcggtggtc ttgtttcttg gctttggcct caagctgctc aacgacgcga tgcgaatgtc    182940
     cggcaatgag aggatgattc atgagcaagc tgatgcatta gaggctatcc aatgtcggga    183000
     gcagggcgtt actgcttgtc caggcagagc ggtatggatg gaagcgttta ctttgacctt    183060
     tgtggcggag tggggggatc ggacccaggt cgcgacgatt actttagcaa ccgcccaaaa    183120
     tccttatggt gtctttttgg gagctgtttt gggtcatgct atttgtgccg caattgcagt    183180
     cgtctgtgga aaattgattg ccggacagat ttcagagcgt ttactcactg ccataggtgg    183240
     tgttttattt ctgatattcg gcatcgtcgt tatccagcag atgacctgat ccgcaacgct    183300
     gagggatact gagaatgaga attccttaaa ttcaaaaccg taattttttg ttcgaatgac    183360
     cccgctggtc ctacttagta aaacgcggca ataatggaga ataagtctta aagcaacccc    183420
     gatcgctgcc aaaatccatg gcaattacaa gatccagcgt tgttggaaga tcaatcggct    183480
     gatggccgga gatgggggag cagctgtctc tatctgcaca ggtacaccca actgttttgt    183540
     cgctcaaaga ttggcttctc ctagagagct aaagactcta ccagggcagc catacaaatt    183600
     ttgagtgacc ttggccacca ttggccccca cagggcaatg agcttagcgg aatcggggac    183660
     catagccaca ccagcacaat attcagaaat caatggctta tgttttttgg tccaatcaat    183720
     gccctctttg cggatttgct tggcttcagg tgatttccct tgtttctctg ccgcttcagc    183780
     attatcccgc tgcagcacta aggaaacggt tcttccttcg ccaaccattc ctcgaagcag    183840
     gcatagaatt gcgccatctc ttcaggcgtg ccaagtcctc gaaaacgagt tgagacaagg    183900
     ggccagcggc tatcatcaat agtgagcata atccatcaca aagttagggt gggctatggc    183960
     taaacggttg tttctagaat caaacaagca ttgcgtaagg gcggtaattt actcagccaa    184020
     gggacccgac gaaaaagccg atgcgatgcg gatatcgaca gtttgcttga atcaaggatt    184080
     gaacacttgt gagggacaat cccatcgctg cgatgtcctg ttcatttttg ataaaccagt    184140
     tcaagggggc accgagttga gccaactgtt tggctccttt gctatttgaa gtaccaccca    184200
     atgcatcaaa tacaagcgtt gcacctggaa gtcggtggcg aagttgatca attaagtgct    184260
     gtacttggtt ttcttcgaaa tacatcagca atccttctgc aatgatcagc agattttcag    184320
     gatttccagg taattcgtcc atccaagtga aatccagtgc agattgagcg aggaatcgat    184380
     ggtggtcagt ttctgtatct agctggcgtc gaagggtggt tatttcgggt aaatctaact    184440
     ctagccaata gcggtagcct tgtcccacgc gatagtagcg ggttgacaac cctgctccca    184500
     gctcaatggt gatcgcttcc tgatgactgg ctagataccg ttgggtaact tggtcgaata    184560
     gatgagcgcg tacagcccaa gtgagttgcg ctagtgaacc actatagaag atatctaatt    184620
     caggatccca ttggagcaaa gaccactatt ccattatttt tgggtcatga aagatggcat    184680
     cagaacgttg gtgctcttca acacgagcac gagtggtcat cagcatcgta cggggaacgc    184740
     ccgtcagttt agactcagat gggctgatca ttattcctct cctacagcgt agaggtctag    184800
     ttatcgaaaa atagatggac tctccctttg agttcaagga tataaattat tgaaaatctt    184860
     tctcaactgt gtatgcacaa ttataaatga cctactgtga atctgttgta cgccaaacgg    184920
     ttcttttcta ataggaactg aaaatcgacg caatagatcc tggatcagtg gcatatttgg    184980
     gctaaatggg cattgttaaa tctgtgcccg attgtaccca ccatagcctg gcgtagactc    185040
     catcaagggc cagtaattca gaatgaatac cctgttctat aatctgtcca ccatctatta    185100
     catagataca gtcagcatta cgaatcgttg agagtcgatg ggcaattaca atggttttcc    185160
     gattttgtgt aatcttggct aatgatttct gaatagccgc ttccatttcg ttatccatgg    185220
     ctgaggtggc ttcgtccaga atcaaaatcg gtgggccttt gagaatggca cgggcaatgg    185280
     caattcgctg tcgctgtcct ccagaaagct tctgtccgcg ttctccgacg atgatgtcat    185340
     agctgcttga tgaactcatg gatttccgct aactaagcag ccagaataat ctgttcatgg    185400
     gttgagctaa aacttccata gccaatattt tcggtgatgg tgccatgaaa taaaaagata    185460
     tcttgactga cctatccgat gcatcgtcgt agataacaaa ggtcgagttc acggatgtcc    185520
     ataccgtcaa tcaaaatggg atcttgtccg cttttgatac tggtggcgaa atactcctta    185580
     acgcatgaaa ggggcatttt tataactaca tacaatgagc tgtaatcaat tctagtgggg    185640
     gcatttaggc gatttctagg aaagacctca catacttctg accacagaat gtaatagtga    185700
     tgcattgaat ctaactctga gcatgcgtga ccaattaacc tggaatcaac ttgaagatct    185760
     gaaatttgcc tcctcgaaaa tgacaggagc ccgccgccgg gctttccagg cagacatcgc    185820
     cctcaaatac tgtgacggga accccaatct cacagaaatt atctttggct ggggtcgaaa    185880
     tacggtggca acaggtttag gtgagaagcg aacaggcatg atttgtgtgg gtgctcagtc    185940
     gggtttctgt ggcaggaaac gttgggaaga ccttcaccca gaggtcgcaa ccgccttacg    186000
     ggagcttgca gaagcccatt gccaacaaga ccccaccttt tccagctcaa ctgcctatac    186060
     ccgcttaaca gcggctgccg ctatcaccca cttgagagcg caaggatttc cccccaagtc    186120
     tgtaccggca aagagtacca tggccgtcgt cttgaatcgg ttaggctatc gactccgccg    186180
     tgtcctcaaa gctaaacccc caaaaaactg ccggaaaccg atgccatctt tgccaatctc    186240
     aaacacaaag acctgaaaga ccatgacggt accgtcaaac gattgagcat cgattgcaaa    186300
     gccaccgttg aactagggga gtcctctcgt cggggcaaga ctcgaaccca aacgaaagcc    186360
     tgtgatcacg atatggggag tgggccaaaa tatattccct gcggcatcct agaggaggac    186420
     accgatacgt tacacatcat ctttggccat tctcacaaaa cgagcgattt tatggtcgat    186480
     aatctccagg attggtggaa caccctggcc cccaccgaac agcaaaccct gcagctcatc    186540
     cagatcaagt tggataacgg tcctgagaat agtggggtac gcactcagtt cctcaatcga    186600
     ctggtggcat ttagcgatca catcggcacc gctattcaac tcctgtacta tccgccttat    186660
     cacagcaagt acaaccccat tgagcgatgt tgggggattt tggagcaaca ctggaacgga    186720
     accttattaa ccgatgttga taccctgttg ggatgggcta gcaccatgac ttggaagggg    186780
     aatcaccccg ttgtaactgt gacacagaag atttatgaaa caggaatttc gcttactaaa    186840
     caagcaatga aaggcattga gaaacgattg gagagacatc ctcagttacc caagtgggac    186900
     atcctaattc atccaattta gtacggggct tcttttcagg aaatcacctt acatgtcact    186960
     tcatctgcaa gctcaatatg ttgtaccagc tgaaactaac aaaattgctc atgccgtttt    187020
     cccaaaagga aacctatgca ttacgatggc caatgcactg agtgactttc ttagcgatca    187080
     ggatttcaaa gatttctttg gggttcgggg gtaaccagct gaatcccctt ggcgacttgc    187140
     gttagtgagt atcctacagt ttctcgaagg cttaacggac cgccaggctg ctgatgcggt    187200
     acgcagtcgc atcgactgga agtacctact gtgcttggac ttgagtgatg tgggctttaa    187260
     ccactctgtg ctcagtgaat tccgaacccg cttagttaca gcaggagtcg aatctcttat    187320
     ctttgaaaag ctcctacagt tttgccagga acgagggtgg ctaaaacctc gcagtcgcca    187380
     acgaacggac tcaacccatg tattggctgc tattcgcgca gtgactcgcc tagagtgtgc    187440
     tggagaaaca ttacgagcgg cattaaatgc cttggctgtc gccgctcctg attggctgat    187500
     cgcccatagc caaccagagt gggcagaccg ctacagtgag cgaattgaag ataatcacct    187560
     gcccaagtcc aaaagccaga gaatcaagca agcagaactc tacgggaaag acgggctaga    187620
     gctgctaaat gcagtgcttg ctggcaacag cccaaggtgg ttacgtcaaa ttctggcagt    187680
     ggaaattttg cgaaaagtct gggttcaaca atactactgc tgtgagctca gcatcatctg    187740
     gcgcacacaa caagaagccc ctcctgcctc agtgatgatt agttctcctt acgaacctga    187800
     tgcccattat gctaagaaac acacaacttc ctgggtaggc tacaaagccc atttgagtga    187860
     gacctgtgaa ccgggcgaac tacacctgat tacgaatgtt gaaacaacag cagcaccagt    187920
     tgatggggat atgacggact ctattcatac ttcacttgcg aacaacacat tgctctccag    187980
     caaacacatt gttgatactg gctatcttga tgttgaactt ttagtcaccg cccaagagca    188040
     atatcaggtc gatttactgg ggccaacccg aaccaacctt cggtggcagg cgaaggaagc    188100
     caaaggattt gcagctgacg actttaaggt aaattggcaa aaccaatcac tgacttgtcc    188160
     tgaaggaaaa tcgagtgtct cttggacacc tgctattgat ggtcgaaaca atgaggtggt    188220
     caagattaaa tttgccgctt ctgattgctc ggtttttcca agcctacata tatgcactcg    188280
     cagtcaacga cagcgtcggg cagtgaccct tcgcccggaa gcacagtaca aggcactaca    188340
     gcaggctcga caacgagaac caacgtctga atatcaacaa gattgatcca ctcccaccgc    188400
     taaagcaggt gggagtggat caatgctatt gtgaccggag tcaaggactc ttttacttgg    188460
     ggatagtggg acaaactcca ctaagagaga aggctctcca ctcattgggg agattgatta    188520
     atccccaaac atttgacttg ctacatcgcg ctgctattgg aaagcctata cgatagtgtg    188580
     agtagattta ttcaacttca tctaattgag cttttcaagg ctgggctact taataaatat    188640
     ttcttatagg tattggaaaa atatgtctgg gaccctgatt agatattgct ctcagggatc    188700
     ttgagacaca aatttgtgag agaggttcat gaaaacgata gaatttccac tttatctaga    188760
     ctcctcccag caggtaaaag ttactgattg gatggacata ctcaaacatg tttacaatcg    188820
     cggcattgct cttcttgagt ggaggcagtt ttacaaccga ctacaaaaag tgagagaggt    188880
     tgacccagaa tacaatatcc cggttcaact aaacgtcaac cggttagggg gagagtggtc    188940
     tatgtcctgt gaatgcagga taaagactcg tctcgacaag agcaaatcct gggacgaagc    189000
     gaatatcgaa catcggcctg cttgtactct cgtcaagccc cactggctca ctgtgcctct    189060
     aatagctggt tttagccctg tagacttgcg taagtctttt gcccgcaaac gctacaaaaa    189120
     cttgggggat ataccccaag tctacgttaa cgactttatt ggcctagtgg tcttcaaagc    189180
     ttgggcgaac tacttagacc aaactcgacc tgaaattaaa cgacctcgtt ataaaggaaa    189240
     gtatgcgcgt gtcaatacaa ttccgtgtga atccttccgt tctctagtta aaatcgattt    189300
     tgcgactgat catctgcaac ttccagggtt aggttggatt agtgttcctg ccctttctac    189360
     ccgattgaag agtgtgatgg atagacagcg gttacatatg gagcagcatc ctgaccatta    189420
     ccctgaacta gcaaagaagc tgattgaaag gaatgcattg ttaagggtgg ctcactggtt    189480
     agaacaaggt gtgccgatgc ccgaggaagt ttttggggat attaaaaaag ctataaaaca    189540
     cgctgaacat gctatcgaaa aaactggcaa cgtctcattc gcaattacaa agttacgaga    189600
     gttggccatt aagcgtgagt taaatcaggc aattaatgac ctatgcactc ctggggtatt    189660
     taggatttgc cggaaggcgg ataaatttta cctacaaatc acggtgcgct cagttgtcaa    189720
     tcaaggcaat cctagaccag aacccattgg tttggatatg ggattgaatc tgctatgtca    189780
     cacaaccaat ggagtgaaag tcaaacatcc agacttatcg cagttgacca acaagatcaa    189840
     tcgtctaaag cagaagcaat caaagatgaa actaggctct cagaactggc atcgaatcca    189900
     gaagaaaatt agcttagctg agcaaaggaa aacaagagca aagaggagca gacagcacta    189960
     tattgcaggt tggttagtgg atgccaatca gaacatggcg ataaaaaaat tcagtcataa    190020
     agatgttgtt gctcgaccat taccgcgacc aagtaagaag actgagcaat atttgaagaa    190080
     tggaagagaa gaacagcgga tcattaataa tcaagtcaga gaagctgctt taggccagtt    190140
     tactagtttt atccagttaa aagctgctga tagagagaat cacgtgatag aattcataga    190200
     gtgtgactct agtgccacac caaatgaaat tttggaaaca tcaagtttcc actccggtgg    190260
     tccacaatcg gagaaagccc aaaacctaca acggacacgg gaaggtggga gggtaaccac    190320
     caccacgcga gaggaaagtg aaagcaactc ctcaacaaca cgtagattga agcaagcccc    190380
     cttgcttgta aatccagccc aaagccccaa gcctttcaag cgtttacggc gtatgccaca    190440
     agcagaacgc aaagttctat agttgcttac ttcctgattt gttcgtggac aagtcatttc    190500
     cagtacctgt gaagaccaaa tcacgtgatt agagtgagct ggtgtttcgc atcggctctc    190560
     ctttgagggt gactcaaata gaatcaggaa caatccggtc aagaatagcg tcatctagag    190620
     tcggttcatc aatcttttga tgccattggg attgggttgc aaacaaacag gaggctcgtc    190680
     ggtaccgctc atctaggaag tcgagtattt ctctcgcatc atgggtactg agagggtctc    190740
     tcaaccattc atccaaaacc accaactcaa aggctgctag ttgtttgcgc agtttcagga    190800
     atgagcaatc cactttggcc atcttgagtt gaccaatcaa ctctgccgtt ttgaaatagc    190860
     gcactctcac tccctgtcta cacaggtgtt ctgaaaggac gcaactgaga aaggttttac    190920
     ccacgcccgt cggtccgatg atcatcttga gatgcttggt caaccattgc ccttgcgccc    190980
     attggagaaa gtgagccttc tgtaaccccc gcttgacctg aaaatcgaca tcatccaggg    191040
     ctgcattcgt aaacaactga gcctgtttga gccgccgtgc atacgctgat tttgtcgcct    191100
     gagatattca ctctcgacca ggagggccaa gcgttcatca aaagagagat cttgataagt    191160
     gggttgggct tgttgctgtt gccatacctc cagcaagcca ttgagcagga gactttggag    191220
     ttgtagggca agcgctttgg cgtagagcct tcatttaagg gcgattcaat tgcaatatat    191280
     aggactgagt tgttcttttc tcgatgaaaa ggacttcacc atctctcgtt caagcagcgt    191340
     tcacttattg gcatggatca aaaccgggtc acagtgtcag gaacgagcaa ggtaatctga    191400
     aaacttgatg tcacttccct taattgatcc tcacgtatga tttcaactcc tgcaattgca    191460
     gccactcttc cgccaaagat ccgcaaagat atcggtattt aggcactatc aagatccatt    191520
     cccattgctc gtattactag agagaatcaa accagtcgca agttcgtcta tgggtagaaa    191580
     gcaattgccc cacaagcgtt agatgaatcc tttctcgccg aaaaaggaga tgacgaggta    191640
     ctgttctatc tgccgatcac caaaacttgg atgttccaac taattctggc tttggtgttg    191700
     atctgctatc cttcctatcg aggggtcgtg gaatcattgc atgaattatt tgattggtcc    191760
     atcagtatat gaagcgtcta taatcttccg caagctgttg catgcttttg tacatgagtc    191820
     cctaacaact gatcaataat cttaacgatg ccaatctcat cgactatacc tgcaatgatg    191880
     ccgagatgat taatattctg aaagccgatc tcttgagttg aagacatgac ctacctctga    191940
     gggacaaccg caaaaatatc ccctcatgtc aatcacctgc ggaatgtagg ctagattttg    192000
     aatcgaaatg gcatactgca tatccaatct aggtttcaag gaaatcttaa gtcgaactaa    192060
     tctactaacc aagtgaatat tttgtgcata tacaaaatgg cagtaaatcg cagtttcgtt    192120
     tgtttggggc caacctctgt ctaagcttaa ctggcccaat tggcaccgaa ctttattttg    192180
     aggaactcga acaacaaatg ctgacagata acttatacaa ataaattgat gttctctcct    192240
     tcccccaaat tgaatcactg gattaaagct attacggtta ggtccaacgc gggtttgagg    192300
     ctattttgct ttcactatgc tggtggaaat gcttttgtct ttcgaaattg ggccaatcag    192360
     gtactagacg gggtggatgt gtatgccgtt gaactcccag gtcatggtac acgactggca    192420
     gaaccgcctt gcaatcgcat ggaatgccta atccaagacc tgaaagcggc tctaatgcct    192480
     tatctaaaac cacctttcgc cttttttggt cacagcatgg gggcattgat cagttacgaa    192540
     ttagcccagg ctctgaggaa agaagatttg tccccgctgc atctgtttgt atcaggctat    192600
     cgcgcccctc acgttcccga tgatgagcct ccgattcaca ccttaccgac agccgatttt    192660
     ctcaatgccc tacgttgcta taatggcacc ccagaagcca ttctgcaaaa ctctgagcta    192720
     atggaacttt tgctgcccac cctccgagcc gactttgcgc tgctggaagc ctatcagtat    192780
     cggtctcgtc cactcttgga ctgcccaatt acagcgtttg gaggtgcaga agactggaaa    192840
     gcctccgcag aagagatcaa agcctggcgt agccataccc aatccaaatt tttgttctac    192900
     cgatttcctg gcgatcattt tttcgtccat tcagctcaat cctcgctgct gcaggtactc    192960
     aatgcagcgt tgcaagattt agtcggagta tgacaatgcc tcaatcgaga aagtctcgac    193020
     cagcaaggga ttcatcaata gaggccccgt tataacgagt aactcagggc tgtttcaagt    193080
     tcctaagagg aaacctgaaa ctactattct tgcggggtat taacttaagc cgggcaacct    193140
     tatccctcaa ggatcttaaa ttagtgattt catagcctaa actgccggat gttccagcgt    193200
     tttttagctt gcagtcatct ctctaagtgt ctcggtttat gctggtagac caatattttt    193260
     catttgagtc tcttcattgt gaccgctcaa tggggatcac aatgaagaga ctctgcactg    193320
     aaagtacaga ggttatttat cgactgaaag tccgattctt ctcaggacta aagtcctgat    193380
     tcactccagc atcaacgtat ctacatcgtt attggacacg ggacggtgat gctccaaata    193440
     ttcttctacc atttgctcac tgatattgcc cttactccag gcaccatagc ctatcgacca    193500
     caaatttttc tcccaatatc gcttctctaa ctcttgatac tcctgcggaa gacatcttga    193560
     tgttcgtcct ttcaaacgct tcactatgtc accgatcgat ttgatgagga tattcaatca    193620
     gcatgtggac atgatcttta ctgatcacgc ctttttgtat gcggatatcc tctgcatcgc    193680
     atatctggat gagcaactca cggcatcagt tttgcacttc acctttgggc acctgataac    193740
     gatacttggt aacccatctg agatgttgca ccaagggtcc tgactatgag aaaagggcgt    193800
     gcagttatat agaaacaagc atgccaaaac acatccttgc ccacgcccaa gggctagtct    193860
     acaccttgct ccatctgatg ccgagcccct atcagcaaga gaccttacaa gccttattgg    193920
     agttgttttt agaagcaacc ggtcaatctt tacccgctca cagcaaagtg aaatccgcca    193980
     gtgccatcag tcgatttctc aatcagtatc aatggcccac tcgccaagtg attcgtgcgg    194040
     tacgtcaagc agccattgaa cgactattga aggtcaggat gccaggacgt cagccctact    194100
     tacaagtgat tctagaccta actaccctag agaaaacagg caagttcaaa gccatgccgg    194160
     gtttgatacg ggtgtatcac ggcaaacgag gactgcatct ggtcgtgatg tatctagtcg    194220
     tggggaaatg gcgtatacct tggaacttta gggtctatcg agggaaagac acgccttctc    194280
     ctgctcaatt gggactacag ttgcttcggc gattacccca ttccttaaag gagcgatttc    194340
     agatattggt gctagccgat acagcctttg gcagcattga atttttagaa ggaacgaaac    194400
     acctggaata ttccactatc gttggtgttc gtaaagaccg aaaacagcaa gcgggtggac    194460
     ccatttctca actatctcat cggggacagc aggcgcgctt ggtcggtttg agttttccgg    194520
     tttgggtgtc ttggttttgg ctgaaacgag agaatggcaa acgagaactt cggtatgtgc    194580
     tttccacaaa gcctttgaag ggtagcacga ttaccagatg ggggagacga cgatggcaaa    194640
     ttgaaggatg gttcaagaca gccaagcatc ggtttagctt agatcggttt gcccaaggga    194700
     cactgacggg agtgtatcga tggttggtat tgtcgatgat tgcctatttg ttagctcatt    194760
     gggcctatct caccactgct aggtcaaggt taccggaatg ggggcaagct gctcgactag    194820
     cgatggagtt atggttcccc catctactgg tgatgacgtt gattgcggat gtcgaacaac    194880
     tcagacctcg catgcagcaa ctggggctgg acctccattt atcttggtgc aagatatgag    194940
     ccatacaaca tgaacagtta agcgggtgac ggtatgattc ccacgaagat tctcgaccat    195000
     agacttctgg atgctgctgc tctatcctgc ataagagctg tatagcaatt aaagtctcgc    195060
     actgaaagtg cgtagtttcg gactagcgtg tttaggataa tgaagagact ctttcttaga    195120
     ctcctggaat tatcaaactc tgcaagtcct ctggctttgc cagagattta ccaggaatta    195180
     attaggttga ttgggtagta accttttcag cctcaaaata cttcctattc aaacagatcg    195240
     gttggttatt gtaataagtc tagtgtataa cttaacttaa taagaatgac ttgcaattaa    195300
     ctggagtgca tttgcaatga cagtgagcat ttcttcgccc tgtgacacgt atacgctgac    195360
     ttcagcagaa ttgattgagt tacttcaaca ggctcaaaaa gagggtgaat caatcttctg    195420
     ggaaacagag ctgcatgagc aattcaatct tcctaaagta ttgggagatg ggggtgatcg    195480
     cgtcattaag ctacgaggtg ggttaactct tcatattcgt aatgcaactc tgcaccaaaa    195540
     tcttcgaatg gtgcagcagc acacctccca gtttccctta acagcaaagt tttatctatc    195600
     gggatcttct agggttcaaa cccgcggttt ttcaggcatt caagctgaat atgaagaacg    195660
     agccaatagt cactatctct actacctgcc ggatatgatc gaagtcgaag aatggcaggc    195720
     caaagagcct acgcaaatcg tcatggttta tgcagaaacg gactattttc atgcatttca    195780
     gtgggcggat agtactctac cagaaccatt acagtttctc aaacaagcga gcttgaaacc    195840
     agttgccgat ctacgatttc accaaaacct tggcaatgtt accccagcta tgtatcaggt    195900
     gctccagcaa attcttcact gtccgtatca tggcgtgata gagcagcttt atcttgaaag    195960
     caaagcgtta gaacttttga ccctacagtt tgcccattgg caagcgaatg gagtcatttc    196020
     tgagcaaaag ctgactaaaa aggtgctact gcgctcagaa gatttagggc gacttcatca    196080
     tgccaaagaa attctaattg aacggttagt tgagcctcca tcacttgtaa aattggctcg    196140
     cgaggtgggg ctgaacgatc gcaagctcaa acagggtttt cgtcaactgt ttgggacaac    196200
     tgtctttggg tacttgcaag actaccggat gcagcaggct aagcagttac tccatgactc    196260
     agacttatcg atcgcttggg ttgccaaaac tgtaggctac aaaaatccag aggctttcag    196320
     tacggccttc cgacgaaaat ttgacatcag ccccaaagga tatcagttaa gccaacgaaa    196380
     ttatatgcac ggttgaaggt gtaagctcgg tgtcttcgca gaaagtccgg ttggcaaagg    196440
     aaaaagtccg gcttgcaaag aaaagccaag cgtctgtccc ctatgatttg caaagaagta    196500
     tttgagaatt attcttattt gctttgctgc caccgaaaag atgtgaggaa gttgctctat    196560
     tcgctacagg gttagcaatg ggcaacgctc ctcattgcta gctccttttg aaccacatga    196620
     tgttcatccc gctgctctac gttggagtcg tcgtatgacg aatcaagccg ttggtatccg    196680
     ttcccttgcc gtaaagtttc cgagtgtaat tcacactcca gaagcttggg gtgaggcatt    196740
     tcctgagttg gcagctcagg cccaggcaag agtccggttg ccgagaaaac ctcaacctgg    196800
     cattgatcag gatgcggaat cggacttggc gacttggtca caggaagttg caccttatct    196860
     cagcgatccg tttcgcggca atgtcgagcg acgcaggttg gcagtgcagg agtcgccgcg    196920
     agcgatcgaa tgtcaggctg ctcaggatgc catagcggcg gcaggtcttc agcctgatga    196980
     tattgagttg atgattgcca gtacgctctt ttcagaatcg atgggcatag gtaatgcccc    197040
     agctttggct cagcaattgg ggttgcgctg tcctgcctgg acgctggaat cgacctgctc    197100
     cagtgcattg gtcgccctgc aaacggtgcg atcgctagtg caggctggcg agtatcgcac    197160
     tgtgctcgtc atcgtttccc actttggatc gcgagttgta gatccggctg atactctgtc    197220
     gtgggcgatg ggagatggtg cagggtcgtt catcgttacg gcacagcccg atcagcaggg    197280
     ggttctcgcg actcatgtga tgagtaccac tgacacctgt ggcgcatatg cctacgaatt    197340
     tgtaaccaac gatcagggaa tgccccaact gcgaatgcgt actggcgaga gtgcgggggc    197400
     gatcgctgaa acagccgttg ccagtgtccg cacttgctgc gaaagtgctg cggcaaaagc    197460
     agggattagt ctggatcaaa ttagcctgtt tgcgttcaac acgccgacgg cttggtatgc    197520
     cagcgtctgc acccgcgcct tagccatccc gccggaacga gtgatgaatc tctatccgcg    197580
     ttacgccaat attggcccgg tgctggcagt ggccaatctg tatcatgcgg ctgagtccgg    197640
     tcggttatac caagatgatt tggtgctggt ctacacccac ggggctggtg caacagccgc    197700
     ggcaacagta atgcgttggg gcgaggtggc gctggggcca aaacccactg cccccagccg    197760
     cgttacgcca gagcaggaaa cagtgcgact ggcttcatcg ttaacgtctc tgcccgttac    197820
     cgcatcagac atggaaacgg tggcacccat acttacgttg tctagggcga tggtgcaggc    197880
     ggcggtgtca aaagaccgac tgcaactggt agaaacctat ctgctggact ggatcaggcg    197940
     atctctcccg gctctggcac catcgctcag ccctgatcag ccattggcga cagtgttgga    198000
     ttcgctgatg gggctcacgt tcaaaagcca gattgaagtg gatcttcagg tgcgagtgcc    198060
     aatggagcag ttcttcggcg aacacacgat cgcccacctc gcagaataca tcttaaatca    198120
     gctagaactg tcggtcttac gggcgttgcc gtctgatcct cacgctgaga cctgtgctga    198180
     cagccgagaa accttacgtt tgtgattgtg atatggagct acattcgcta ctcaccacac    198240
     tttcaaagca aggcatcaag ctttcaactt gtgaaggttt gctggaagtc gatgcgccgc    198300
     aaggagtgat gacttcagac ttgcgtcatg ccttgagtca gcataaggct gagattgtac    198360
     ggttgctcaa tcaactgccg gcggcggggg aggtaaatgg ctctgcgaca gaactgccga    198420
     cgttggtgtc tgatcccagc cagcgctatg caccctttcc cctgaccgac atgcagtacg    198480
     ccttttgggt cggtcgtagc ggggtgctgg aactgggaac ggtagcaaat cacggttatt    198540
     acgagatcga tggacaaaac atagagctag agcggctgaa tcaggcactg caaattctga    198600
     tcgatcgcca tgatatgctg cgagcgatta ttctgccgga tggacggcaa caggtgctgg    198660
     aaacgctgcc gccctaccag atgcccctgg ttgacctgcg gggccagagc gatgatgcgg    198720
     ttcacagcgc cttagcagaa attcgcgatc gcttgtccca tcaggttgtg cccgctgacc    198780
     agtggccgct gtttgagttt tccgccacgc agttggatgg gggacgggtg cggctgcata    198840
     ttagctacga tttgcaggtg tttgatgcct ggagtctgtt tcgactgttt gatgaatggg    198900
     tgcaactcta caaaacgccg gatgtaccat tgccaccgct ggagctgacc tttcgggact    198960
     atgtgctggc cgagcaggcg ttacagaaaa cggagctgta tctgagatcg caaacctact    199020
     ggctaaatcg gctcgacagc ctgcctcctg cccccgacct gccgttagct cgacatccca    199080
     aggagctgaa gcagcatcgt gcccatcgcc atgaagatca cctccagcgc agcgactggc    199140
     agcagctcaa acagcgggca atgcaggctg ggatcactcc atccgggctg ttgctagctg    199200
     cctttgctga tgtcatctct ctgtggagtc agagtcctcg gttcacgatt aatctggccc    199260
     tatttaatcg cttacctctg catccccagg tgaacgatct gctgggagac tttacgtcag    199320
     tcacgcttct ggcggttgat cagtctgtcc ctgcttcctt taccgagcga gccgcgcggc    199380
     tacagcagca gctctggcaa gacttagaac accgctactt cagtggagtg cgagtggtac    199440
     gagagttggc gcgacgacgg gggacagccc ccagcgttat gccgattatc ttcaccagca    199500
     ccctgggctt tcgctccttg ggacaggaaa ccctcacctt cagccacttt ggtgagcggg    199560
     tttatggcat cagtcaggca tcacaagcct ggatggatat gcaggtctgg gaagagaacg    199620
     aagaactgac ctttaattgg gatgtggtgg atggcctgtt tccagacggg ctgattgacg    199680
     atatgttttc cgcatatgga cgatggctgc ggcacctggc tcgctcagca tctagttgga    199740
     cagaatcggg gcaaccattg aagcgatcct cctacggagg ggtttcacga acgctcctac    199800
     ctccggacca acaaacgcag cgagcgttga tgaacgcaac tgatgctccc atttcagacg    199860
     cgctgctgca cgaactcttc gcgactcagg tacgcctgcg accccaggct ccggcagtaa    199920
     ttaccttgca gcagacgctg acctatcagg atctcttcgc ccgcgccaat cagcttgaat    199980
     atcacttgcg tcagatgggg gtgactccta atcaactggt agcaatcgca atggacaagg    200040
     gttgggagca ggtggtagct gtcatgggtg tgctgatggc tggagctgcc tacgttcccc    200100
     tcgatccgca cttaccacag agccgattgg aggctctttt ggacaacagc gaggcggcca    200160
     tcgtcctcac ccaaactcgc tggctagaac agcaagtttg gccggatagg gttcactgcc    200220
     tatgtgtcga tgattggagc cgtgacggtt ctgattttgg attttcgatc ttagattttc    200280
     gatctaaatc agatggtgtt gatgttaatt ttgatttggc gcaggtagat caatcaaagc    200340
     aatcggagca cctggaaccg ctgtcctcag tgcaaacggc tgatgatctg gcctatgtga    200400
     tttatacctc tggatcgacg ggcacgccca aaggggtgat gatcagccat cgtaatgtgg    200460
     tcaacgtgat cacccatact aatcagcgtt ttcaggtggg ggaacaggat cggatgctgg    200520
     cgctgaccgc actcaaccat gacctgtcgg tttacgacat ctttggtctg ctcagtgctg    200580
     ggggggcgat tgtgatgccg gatgtcgaag cggtgaaaga tccgagccac tggctaaccc    200640
     tgatggctcg cgaacgggtg acgctgtgga actcggtgcc tgcctttatg gagatgctga    200700
     tcgatgaggc cgaagcccag gcaatcaatc ccctagattc tctacggttg acgattttag    200760
     ggggagattg gttaccgttg tcgctgccag atcggctgcg ggcgatcgct cccaataccc    200820
     aaattttcag cattggcggg ccgacagaga caaccatttg gaatattggc tatctgatcg    200880
     ataccgttga tcccaactgg gcgagcatcc cgtatggaca gccgttagcg aattccaagt    200940
     actatatctt gaacgaaatc ctagaggact gcccgatctg ggtgccaggg cagatgtatt    201000
     gcgctggggt gcagcttgcc aagggttact ggcgggataa ggaaaagaca aatcaccaat    201060
     ttatcacgca tccgtatact ggcgaacggc tttacgccac aggggattta ggccgctatc    201120
     gccccaatgg caccatagaa atcttgggtc gtattgattt ccaaattaag ctgcgggggc    201180
     tgcgaatcga agcgggtgaa gttgaagccg cactgctcca gcatccagcc gtgcaagcgg    201240
     cagtggtagg cggcatcggc gatcaccatc cagaacggct agtggcctat gtggtgcccc    201300
     agtccaccgc tccctcgctg gaggaactgc gggattttct ggctcagaag ctcccctctc    201360
     acatggtgcc ctcggcgttt gtcttcctag agacactgcc gctgtctgcc aatggcaaag    201420
     tcgatcgtaa agccctacaa gcgcaagcga tctccgttca gtctgtaaat acggcctatg    201480
     tagctccgca aaatcaattg gaaaccgcga tctcaactat ttttcaaacc attctagaca    201540
     tcccaaacgt ggggattcac gacaatttct ttgacctggg gggcaattcg ttgctgctag    201600
     ccaaggtgta tcgggccctg gtggaggagt tgcctgaaga aacgcggtcg atttcgctga    201660
     ttgatctatt ccgctattcc tctgtgcagg cgatcgctca gcggctgagc cagacaacgc    201720
     ctgaccttga actagaaagc cagatggtgt ccagaaatca acagttagca caggggaaaa    201780
     atcgtctaaa aacccgcttg gaaaagtcaa gaaatctccg gtagaggtta gctaaacggc    201840
     aatgaatgtg catcgcaacg gcttagaaat tgcaattatt ggactgtctg gacagtttcc    201900
     aggtagccca actctggatc aattttggca aaacttaaag gcgggcgttg agtcaatttc    201960
     tgtcttttct gatgccgatt ctcaactcgc ttcggctcca tccagtgcca ctcaaaccgc    202020
     agtcaaagcg ggcggcattc tcaccgatat tgagtatttt gatgccccct tctttggtat    202080
     taatccgcgc gaagccgaaa cgatggatcc gcagcatcgg ctgtttctgg aatgtgcttg    202140
     gcaggcatta gaacaggctg gctatgctcc tgggaggggg aacgatgcgg tcggcgtttt    202200
     tgccggagtg ggcatgggca cctatttgct ctacaacctc agtccccatc cagaggtgat    202260
     ggcctcccgt ggctttttgc aaaccttagt cggcgtggat aaggattatc tatccacacg    202320
     cgtctcctac aagcttaacc ttagaggccc cagcatcagt gtgggtacgg cttgttccag    202380
     ttcgctggtc gctgttcact tggcttgtca gagcttgctc agcggcgaat gtgatatggc    202440
     gattgcagcc ggggttgccg tgaaggtgcc gcaaatgaat ctcaccctgt cgccggacga    202500
     aattgcttct accgatgggc agtgtcatgc ctttgatgcc agggccaacg gaactgttgg    202560
     gggtaacggt ctgggggccg tggtgttgaa gcgattggag gatgcgatca cagatcggga    202620
     tacgatctac gcggtgatca aaggctcggc catcaacaac gatgggggga tgaaggcggg    202680
     ctataccgct cctagccagg ccggacagac ccaggtgatt cgggcggcgc aggcaatggc    202740
     agaggtggag ccggacagca ttacctacat ggaagcccac ggtacgggca cgcctttggg    202800
     cgacccgatt gagattgcgg cgatgaccga ggcgtttcga gccagtacga acaaagtcgg    202860
     ttactgtgcc gtgggatcgg tcaaaaccaa tgtcggccac ctggatgcgg cagcgggaat    202920
     tgctggcttg atcaaaacca cgctggcact gcatcatcgg cttttaccgg ccagcctcaa    202980
     cttcgatacg cccaatccag atattgattt tgccaacagt ccattttata tcaatacagg    203040
     gctaaaggag tgggtggcca acggtacgcc tcgacgagcg ggattgagtt cctttggctt    203100
     tggcggcacc aatgtgcatc tggtgctgga agaagcccct gccccggcac cgtcgagtct    203160
     gtctagaccc cagcaactgc tgctgctgtc tgccaaaact cgctctgccc ttgatacggc    203220
     cacagctaat ctggttcagc acttgcatct gccagatatc aatctggcag atgtcgccta    203280
     tacgctacag gttggacgca gcacctttgc ccatcgccgt atagtggtct gtgccacggg    203340
     ggcagaagcg attgctgctc tagtagacaa ggcagactgc caagctcccc aatcggaata    203400
     cggattgacg gacagcgaca cctctcaacg gcctgtcgtg tttatgttta ccggacaggg    203460
     tgcccaatac gtgaacatgg cacgagagct gtatgatacc gagccgctgt ttcgtcagac    203520
     ttgcgatcgc tgtttcacga tccttgaacc gcacctgggc tttgatttgc gctcggtgct    203580
     gtatcccgat gcagccagtc ccgaatttga catcgaccag gccacgcagc agttgcgcca    203640
     gacagcaatc gcccaacctg ctctatttgt gattgagtat gccttggcgc agctctggat    203700
     gtcatgggga attcgaccga cagcgatgat cggtcacagt atcggcgaat atgtggcagc    203760
     ctgtttggca ggtgtctttt ccctggagga ggctttaccg ctggtggtga ggcggggtca    203820
     gttgatgcag cagttgccgg gaggagcaat gctctcggtt aacctgtctg tggacgaagt    203880
     agcgtcactg ctagatgaga tagataagac aatctcaatc gcggccagta atagccctag    203940
     cttaacggtg gtatctggct ccaatgcagc aattgctgca ttggagcagt ggttaaccca    204000
     gcagcagatt ggctgtcagc cactgcacac ctcccatgcc tttcactcca gcgccatgga    204060
     tgagatcgca actcccttcg cccaggcgat cggccaaatt cagctccatc ctccccagat    204120
     gccgctaatc tctaacgtga cgggcacctg gatgaccgcc gccgaggcca ccgatccgca    204180
     atactgggtg caccatctgc gccagaccgt gcgttttgct gagggcatcg ccgagctatt    204240
     gcaggatagt catcacctat ttttagaagt ggggccaggc cgcacgttga acaccctgac    204300
     tcggcagcaa gcgaccgatc gggcggtgct gtcatccctg caccatccca aggatcacgc    204360
     ctccgatgtc gccttcttgc tgcaaacact ggggcggctc tggctggctg gggtgacggt    204420
     caactggcca ggcttctatg cccacgaaca gcgcgatcgc ctacctctac ccacttatcc    204480
     atttgagcga cagcgctact ggattgatcc acccaagacc ctccccagta aggcgtctct    204540
     cagtcaggcg gttccactgc gacagaattc cagtcaagcc aatgatctcg ccgactggtt    204600
     tcatgtaccc tcttggcagc gttcgtctcg attatccaca cctattcggt caagctcatc    204660
     cgccaacata ctaatcttcc ttgatcaggc aggtgtagga gaagtactag tggaacggct    204720
     gcaacagcaa ggacatcgcg tggcaaccgt ggacattggc tcagaatttg cccagcttag    204780
     cgacaccaaa ttttgtctca atcccgatca agcggatgac taccaggctc tattcaagac    204840
     cctgcggacg cagcagttca gtacaaatgc cattgcccat ctctggtcaa taacaactgc    204900
     ggcagagatg ccctctggac tcgacccgct tgacgcgacc ttgagccgaa gtttctacag    204960
     cctgctgttt ttggcccagg ctctgggcga ccaaccagga accgatccgg ttcacctcac    205020
     ggtcgtctct aaccagctac agtccgttat cgggaatgag cggatgtgtc cagaaaaagc    205080
     gacgctgctg gggccagtgg gtgcgatcgc acaggagtat cctcatctca actgttgcag    205140
     tattgatctg gaactggatg aacccctatc cgaggcgaca gacccagatc tactcgaatc    205200
     actgctggct gaaattacgg caccatcgga tgatgccctg atcgcctatc ggggtcgcca    205260
     tcgctgggtg caaacgatgc agcccattcg tctggaggaa acgctagccg acccagccaa    205320
     tttacggtcg ggtggtgttt atttgattac cggaggactg ggcggtatcg gcctaaccat    205380
     ggcagagtat ctcgcccaag ctgtacaggc caagctagtg ctaattgggc gttctggatt    205440
     accagatgac acagcagcag cagatggaca ggatgctcca gttcgtcgca aaattgctga    205500
     cctggaggcg ctgggagcag aggtgctggt tacccaggct gatgtcacgg atctggcgca    205560
     gatgcaacgt gcgatcgcag aggcggaagc tatctttggt tcgatcaacg gcgtgattca    205620
     tgcggcggga ataccgggcg gcggcatcat gcagcgcaaa acgcgagcgg cggctgaggc    205680
     agttttagca cccaaggtga agggaactcg cgttctggag gcggtactgc ccgcagacct    205740
     ggactttttg gtgctctgct cctcactggc ttcggtgatt cctctgcccg gacaggtgga    205800
     ctatgccgcc gccaatgcat ttctggatgc ggttgcccaa gctcgaacgg ccagagatca    205860
     gttcacgacc tgcatcaatt gggatgcctg gacagaggtg ggcatggccg taaaggcggc    205920
     gaacccgtct gtgcaggata cggatcagaa ccctgatcct attgcagttg agcatccact    205980
     gtttgaggtc tgctatcccc atgatgccga tcaggtgcgg tacgtttccc gactgagttt    206040
     ggatcagcat tgggtgctga atgaccatcg ctggggtgag caggggctcc tacctggaac    206100
     ggcttactta gagatggcac gggctgcctg ggccaatcat catcagacca acccgaccga    206160
     tggcatagaa cttcgcaatg tctatttcct gacgccgttg ctggtggacg ctgaacaaga    206220
     agtccatacg gtgctgacgc agaaagacac ctacgtcgag tttcaaattc agagtccatc    206280
     tggcgttcag atatctggtg cccagccgct agaatggcaa actcacactg tcggtgaaat    206340
     cgctataccg cagccagcac agccccggac attcgatctg cctgcgctga aagccacctg    206400
     tagccaaccg caagccggga gtgcggcacc gtctctggat catctgctgg atggtccgat    206460
     tcagtttggc gatcgctggc gtagcctgaa gtggatcaac cgctccgaca ccgaagcgct    206520
     ggctctgcta gagttacccg atgccttcca tgctgaacta tccgttcatc gcctacatcc    206580
     cgcgctactg gatgtcgcta cggggtttct aatgatgcag ctacggcagt ctgacaccgc    206640
     gtatctgccc ttttcttatc gccgattgac gatgtgggga acgttgtcag cgcagatctg    206700
     cagctatatc cagtggctca acccatctga ctctgacagc ctgaaattca acatcgtgct    206760
     tatggatgac cagggcattg agctgattga catcgaagac tacacgctga ggagaaaggc    206820
     caatgacgca actacctaat gcgctggatg ccccgatcaa cccgccgtac tcgcacgatc    206880
     tagacgcggt tgagtcaatg cagatcgact ctgcatcagt cactgaagca accgctgagg    206940
     aaacgacggc ggaaaacgct tacctcaccc tctcaactcc cggactacta gagacgctgc    207000
     actttcagcc caccactcga ccataccctc aaccgggaga agtggaaatt gaagtggcgg    207060
     tggctggcct caatttcaaa gaggtcttgc tggcactggg gttaattccg gctccatccc    207120
     caaacgttca atttggcctg gaatgtgcgg ggaaaattac ggcgttagga accggagtag    207180
     agggctttgc cgtaggcgac gaggtgatgg cctttggtca gggctgcatg agtcgctgga    207240
     tcactctgcc tgctcagtcc gtcgcgccca agcctgctca gctcagtctg gaagcatctg    207300
     ccacgattcc gatcgccttt acgaccgctt attacgccct gattaccgta ggtcgcctgc    207360
     ggctgggcga tcgcctgctg attcactcgg cggcaggtgg tgtggggcaa gccgccgttg    207420
     cgatcgcaca gtgggtggga gccgagatct ttgccaccgc tggtaatcct gagaaacaag    207480
     attttctgcg atcgcagggc attgcccatg tgatgaattc ccgttctctg gactttgccg    207540
     agcaggtgat gcaagacacc aatggtgagg gagtagacgt ggtgctgaac tctctaggcg    207600
     gcgagtttat tgccaaaagt ctgagcgtgc tgggtcgcta tggtcggttt ctggaactgg    207660
     gtcagcgcga tattttgaac gataccccag tgggactggg agcgtttgag aagcggcttt    207720
     ccttcttcgc gattcaagtg gaaccagatg cgccagggtt tgacgaaact tggcaagctg    207780
     ttggccagca gtttcaaacc cagcactttc aaccactacc ccaccgggta tttccggcag    207840
     cagccgtagc agaggcgttt ggctacatgg cggcggcaag ccacatcggt aaagtcgtga    207900
     tttcgctagc cgattgccaa tccttagcct cccgccaatc tctggcctca atcccacagc    207960
     ttgccctcag tttgccaacc gattcttccc ggaatcaggc aagtgcgccg agaaatcagg    208020
     gtattgcttc aacccagcca agtgccccct cccgccgggg cctgcccact gatttttttg    208080
     atgcaggcat ctcgccagcg gacgggatga ttgcctttag acggattttg ggcagcaaat    208140
     tgccccaagt ggtggtttcc acccgcgatt tagacctgcg gctgagttcc cgcaaagttg    208200
     gcagcgagga gcggattcag atgcgcccac agatgccgat ggctgaatct gaagcgccca    208260
     ccattaaccc atcgagtcaa cccggaaacg ctgccagtca tgcccgtccc gcccttgttc    208320
     aggactatgc tgctccccgc aatgctacag aacaggcaat cgctactatc tgggaacagt    208380
     tcctcggtgt cagcccagtg ggtatccatg acagcttttt tgagttaggc ggtcattccc    208440
     tgatggcaac gcaggtcgtg gtccagatgg gcgtggccac ccaggtagat ctgtcactca    208500
     acattttatt tgaccaccca accgtggctg ccgtggccca atatgtagag caggtgcagc    208560
     agactgctac agccctacaa gcttctatca atagtgactc agacgatcgc gcggagattg    208620
     agttatgacc ccatccatcc atgagttttt atttcagctc agcgaacagg gtattaagct    208680
     gtgggtcgag ggtgatcgcc tccgctgtaa cgcgcccaag caggtcttaa ctgaagaatt    208740
     gcgatcgcaa ttagctgact gcaaggccga cattgtgcag tttttgagcc gagcagatgc    208800
     ccgttccagt ggtgcctcaa atggtacagt cacccctgac ctacctcaga tcaggccatg    208860
     ccccgacgat cgctttcagc cctttcccct gaccgacatt cagcaggcgt actggattgg    208920
     acgcacccag gcctttgaac tgagccaggt ttcaacccac ttttatagcg aactggactg    208980
     tgatcccgat ctcgatctga acttattaac tcagggctgg cagcgactga ttgagcgcca    209040
     tgatatgttg cgggcaatcg tgcgacccga cggacagcag cagattttag cacaggtgcc    209100
     gccctacgag attgcggtgt tggatttgcg gggcgagtcg gcggagaaaa cggcagttca    209160
     gctaactgag ttgcgcgatc gcatctctca tcaagtactg cccagcgatc agtggcctct    209220
     gtttgagatg caagcgacct attacgatcc cgctcatctg cggctgcata tcagcttcga    209280
     cctcttaacc agcgatgccc gcagtattga gatcgtgttt cgggaattgg ggcagctcat    209340
     gcagcagcca aacacagagt tcacgcccat cgagctttcg tttcgcgatt atatcctggc    209400
     cgaaatcgct tttcaaaact cagatgctta ccgtcgctca cgggactact ggcagcgtcg    209460
     gctggccact ctgccaccct cacccgaact gccgttggct gtaaatctag ccgggattag    209520
     tgccccgcgc tttgtgcggc accatcagct tttggagcgc gatacctggc agcggctcaa    209580
     gacccaagcg gctcagattg gcatcacgcc ttctacacta attttgacgg catttgccga    209640
     aattcttacc gtttggagca aaaagtctcg cttcacgctt aatttgacgc tgtttaatcg    209700
     gttacctctg catccccagg tgaatgatct ggtgggcgac tttacttcgc tgacattgct    209760
     gtcgatcgat cacacccagg caagttcatt gattattagg gcacggcaga ttcaggctca    209820
     gctctggact gatttggaac accatcatta cagtggcgta caagtcttgc gagatctggc    209880
     tcgttcccag ggcgagggaa ctgctccgct gatgcccgtg gtgtttacca gtatcctcaa    209940
     cccagaggcg atgggtgaac gcccctttcc gctcgactgg ttgggacagt tgacctatgc    210000
     cgtcagtcag accccacaag tgtatttgga tcaccaggtc tcggaggtgt cgggagcgct    210060
     gaagttaacc tgggatgtgg tggaggccat ttttccggct ggcttaatca aggagatgtt    210120
     tgccgcctac tgcgccctgc taaatcggct ggcccaggag gatgacctct ggcatacccc    210180
     ccagcgacag ctactgctgc ctcaccaact gaagcagatc gaggcgatca atgccaccga    210240
     taccaacttt gtcaccagcg attcggctcc cctgctgcac acgctcttct ttgaccaagc    210300
     gatccggcaa ccggaacaga ttgcgatcgc aactcctgac cgcaccctca cctatcagga    210360
     attgtgcgat cgcgtccatc agctcagtta tttcctgcat caacagggca ttcagcccca    210420
     ggatcgagtg gcgatcgtca tggccaaagg ttgggagcag attgttgctg cccttggtat    210480
     tctcagcttg ggagccgttt acattcccat cgatgcggct ctcccccaag cgcgtcagtg    210540
     gcaactgttt gcagaagccg atgtcaccta tgccctcacc caatctgtga tagacgcgac    210600
     gttagagtgg cccccatccc tgcctcgtat cagcgtcgat accctatcat tctcatccat    210660
     ctctattcca tcatctccca catcccccac cgatctggcc tacatcatct acacctccgg    210720
     ctccacgggc caacccaaag gcgtgatgat tgaccatcgg ggagccgtga atacgatcct    210780
     cgacatcaac cagcgattcg gtgtaacttc agcagatcgg gtgctggcgc tctcgtccct    210840
     cagttttgac ctgtcggttt atgacatctt tggcacgctg gccgcaggcg gcactctggt    210900
     catcccagca gcggacggta atcgtgaccc agctcactgg ctcaacctaa ttgagcggca    210960
     tcatgtaacg atttggaact cggtgccagc gctgatgcaa atgctagtgg aattcgcggc    211020
     aagtcaaccc gatcgaacgg cagcaacatt gcgtctggtg ctgttgagcg gcgactggct    211080
     gccgctgagc ctacccgatc agattcgctc aattgcgccc cgatctcagg tgatcagcct    211140
     gggaggagca accgaagcct ctatctggtc aattctttac ccgattaaag aggttgatcc    211200
     cacctggagg agcattccct atggccgacc gatggcgaac cagcggtttt atgtgctgaa    211260
     tgcggccttg tcaccttgcc ctgtttgggt gacagggcag ctttacattg gcggcattgg    211320
     gctagctcag gggtactggc gcaatcacga aaagacccag gccagcttta tggttcaccc    211380
     ccacactcag gagcggctat acaaatcagg cgatctaggc cgctatcaac ctgatggcac    211440
     gattgagttt ctgggtcgag aagactttca ggtgaaagtg aatggacatc ggatcgaact    211500
     aggcgagatt gaggctacac tgcttcagca tccggcagtg agacatgcga tcgtaacgac    211560
     cattggtgcc cctcgtgatc agcagcagct agtggcctat atcgtgcccg attcaccagc    211620
     ggcgctgact cctgcctctt ctccatcgtt taatgcccaa gttgaagccc atgagcctcg    211680
     cccactagac ggtacgctca ccgatccagc cgaacgtcta gatttcaagc ttcagcagcg    211740
     gggagtgcga tcacccgctc ctagccaatc gggcgttcaa ctgcccaagc ccgaatttga    211800
     tgatgcgctg gtgcaagctt actggcaacg ccaaagccat cgtcagtttc tcgaacagcc    211860
     gatttcatta gaggcattta gccagtttct cagcagcgta cttcagatgc aggtgacggg    211920
     cttgccgcta ccgaaatacc gctatgcctc ggcgggcagc ctctatccgg tgcaggtgta    211980
     tctctatctg caacccaatc gagttgagga tttagccgct gggttttact actaccatcc    212040
     ggttgaccat cagttgctgt tgctcagcga ttttgcagaa gtcgcagccc atcgctatgg    212100
     aattaatcag gctgtgtttg cggactcgtc gttttcccta tttttaattg ggcagttgca    212160
     agcgatcgcg cccatgtatg gcgaactcgc ccgagatttc tgtttattag aagcagggta    212220
     tatgagtcag ctcttgatgg aagccgcttc tcaacaggag attggtctat gtcccatcgg    212280
     tacgctggat tttgcagcgt tgcgatcaca cttttgtcta gaagatagcc atattttgct    212340
     gcacagtttt gttggaggga aaatcgatcc aacttggaca aaacaagcgg cttctgtcaa    212400
     tctgactatt caggctcaaa atcgcaatat tcaaggtgta caaaagactg atttacaact    212460
     cgaactgagt tctttcctac agcaaaaatt gccgcgctac atggtgcctt cagcttatgt    212520
     agtattggag actttaccgt taacggctaa cggtaaagtc gatcgtaagg cgttaccctt    212580
     atccgataat tttagtcctc ctcagcagtc agttatcaaa ccccaaaccc aaactgaacg    212640
     aatggttgcc cgagtttggc aggagatttt acagctagaa acggccggca ttcacgacaa    212700
     tttctttgaa ctgggcggca attctctatt aatgattcgc acccaagtca aattgcagga    212760
     gttattgcat caagaaatcc ccattgttga gctttttaaa tctccgacta ttcacgcctt    212820
     agccagttat ttaagccagc actattcaag ctcacagcag acagaatcat cgactaaaaa    212880
     aggcggtcag cgtgcccaat tacgaggcga tcgccaagcc ctcagagacc agcgcaaaca    212940
     gtcccgacaa tctcatcgat caacccacca atcatagtga atcagaagat gcttaaagag    213000
     ctatatgaca agcagcaaaa cattttggat cccccctacc ccccttaatc taccgtgtac    213060
     acacatcttg atcactgcct ctcacccccc cttgcccccc ttaaaaaggg aggcaagggg    213120
     ggatcacggg gggttgatcg ctgtaaccga ttaactgttc gagcatcttt tcagtaatca    213180
     aatcatcata atcaccccaa aatccaaaat caataaatcc aaaatcagta aatcaacgtg    213240
     acttcatctg aaaactatga acggtttaga aattgccatt atcggtctgt cagggcgctt    213300
     tccgggtgct cagacgatcg atgaattttg gcaaaactta aagcagggcg ttgaatccgt    213360
     ttcatttctc tcggatgaag aacttctagc atcaggaatt gatgccgata ccctcagcga    213420
     tcccaactat gtcaaagcta acgccattct cagtgatgcc gatgcgtttg atgcccaatt    213480
     ctttggcatt agtcccaagg aagcagaact gctcgatccg cagcagcggc tatttcttga    213540
     acagagctgg actgcgatct cacatgcagg ctatgaccca gccacctatg atggcgtgat    213600
     tggtgtctat gctggggttg ataccagcac ctatttagtc aacaacctct gtcccaccta    213660
     tggcggcatt gctgatttac agatgtttct gggcaatgcg gttgactatt tggccacacg    213720
     ggtagcttac aagttgaacc tgaatggccc cgcgataacg gtgcaaactg cctgctcaac    213780
     ctcactagtg gccgtacatc tggcctgtca aagcatcctc aatggcgaat gtgatatggc    213840
     gctagctggg ggcgtatcga tcactgtgcc tcaaatcact ggatatacct atcaggaatc    213900
     gggtattgcc tcccccgacg gtcactgtcg agcctttgat gcccaggctc agggaactct    213960
     gtttggcagc ggggtgggga ttgtactgct gaagcgactg agcgatgtga tcgcagatgg    214020
     tgacacgatt cacgcggtga ttaaaggatc tgcggtcaac aatgatgggg cgctgaaggc    214080
     aggctacacg gctcctagcc ccgagggaca aacgactgtc attagcgaag cccaggcaat    214140
     tgctggcatc catcccgaaa ccatcaccta tatagaagct cacggcacgg gaacggctct    214200
     gggcgatccg attgaactgg ctgccctaac tcaggtgttt cgccgccaaa cgaacaaaac    214260
     cggattttgt gcgatcggct ctgtgaaaac taatgtcggg catctcagtg tcgctgctgg    214320
     catcacgggg ctgatcaaaa ctgttttgag tctcaaacac cgccaaattc cgcccagcct    214380
     acattttcag cagcccaatc ctcagattga ctttgccagc agtccgtttt acgtcaacac    214440
     ggctttggct gactggccga ctggcaatac accgcgacga gcgggagtca gctccttcgg    214500
     catgggcggc accaatgtgc atgtcgtgtt ggaagaaacg ccccctgcaa tcgctgctgc    214560
     gccttctcgt ccctggcagt tgctgaagct ttcggccaaa acgccctctg ccctagagca    214620
     ggccacagca gagctgatta accagctcaa tcaaaccccc gagctaaatc tggcggatgt    214680
     ggcttatacg ctacaggtgg gtcgtccagg cttcagcgag cgccggatgc tggtctgcca    214740
     aaccctcgat caggccgtgc aggatttgga aaacggaaca tttgcatcag ctagttcggt    214800
     ggatgaccgt gccgctcagc gccccattgt cttcatgttc tcgggacagg gcacccagta    214860
     cgtcaatatg gcgcgagagc tgtatgactg tgaacccacc tttcgacagt ggatcgatcg    214920
     tggctcagac ttgctcaaac ctcatttggg tctcgatttg cgccacattc tctatcccaa    214980
     ctctgctcaa accgaggacg cagctcagca gcttcaacaa actgccgtta ctcaacccgc    215040
     tctattcctg cttgaatatg ccttagctca gctctggcaa gactggggtg tagcacccac    215100
     ggcgatgatg ggtcacagca tcggggaata tgtggcggca acactggcag gcgtgttcag    215160
     ttttgaagca gcgctgacac tggtggcggc tcgtggagca ctgatgcagt cgctacccgc    215220
     tggtcagatg ctctcgctgc cgctgtcaga agccgaggtg cagccgctgt taggttcagg    215280
     tctgtcgcta gcggttatta acggtgcagc cgcctgcgtc gtgtctgggg aaaccgatgc    215340
     cgtgacagac ttacaggaaa agctagcggc acagggggta gaagggcgat tactgcacac    215400
     atcccacgcc tttcattccg ccatgatggc tccgattctg gatcgcttcc ggcagcgagt    215460
     ccagcaggtc tcgcccaacc caccccaaat cccctttgtc tccaacgtga cgggcacctg    215520
     gattaccccc caagaggcta ccgatccggc gtactgggcg aaccatttgc ggcagacggt    215580
     tcgttttgca gatgggctgc aaactctaat gcacgatgcg gctccaattc tgctagaagt    215640
     ggggccaggc cgcaccctga ccaccctcgc taaacgacat cccagtcgtc cggcagacac    215700
     ggttatcttg tcatctgtgc ggcatccgca agatgcgagt tcagacgcgg cgtttctgct    215760
     caatactctg ggacatctct ggctgtcggg cgtattagtg aatggcgcag aattttaccg    215820
     ccacgagtcg agacggcgga taccgctgcc aacctatccc tttgagccac agcgctactg    215880
     gattgatcca ccgcgtcact cagcccaccg cgctttgaca gctctatccg atgccggatc    215940
     gaataacgga acatcgaaaa ctttcgtcac ccaaaagtct gaaattgccg actggtttta    216000
     cttgcccgcc tggaaaccct cggttgcacc ccaggctcag tttgacccat tagcaacgac    216060
     ctgcgatctg gtgctcattc atgaccaaga tcgtgaagtg ggagggttcg taaacgacct    216120
     aatccaacat ctggaacagc aaaatccaaa tcttatcttt gtgcaaccca gtacagcttt    216180
     tgctcaacta aatgaccgtt tctataccgt caatccccaa tcaagcgatg attaccagac    216240
     gctgatccaa acgctagtta gtcaacataa acgactccaa aagattgtgc atctctggac    216300
     actttcaact agtgaaaagc caaacggtaa ctttgcctca gattacctcg cgtcggatcc    216360
     agaattggtc caaagatgcc aattttccgg attttacagc ctcctatttc tagcacaagc    216420
     actcgcaaaa caaaccgagc cagatgcaaa ttcagatggc attcagatca cggtcatttc    216480
     taattatttg caatcagtaa caggaaacga tcctcttgca cccgaaaagt cactgctgct    216540
     tggccctatc cgggtgattc cccaggagta tccaacgatt cactgtcgca gtatcgacat    216600
     caatttgcca tctcctaata gatggcaagc cgaaagactt acggggcaac tgttgcatga    216660
     catttgctgt ccgattactg aaccgattat tgcctatcgg ggacatcagc gatatgtaca    216720
     agccgttgaa aaaattcgat tagacgaacc ctccaaagaa gattttgagg tgcgatcgca    216780
     cctgcggcaa aatggggttt atctaatcac aggcggattg ggtcacatcg gtttgacgtt    216840
     agcgcgatac ctggccgaat cgatgcaagc caaactgatt ttgatggggc gttcaacctt    216900
     gccagaaaaa ggtgaatggc atacctggct atcgacccat gctgcatcgg atcggatcag    216960
     ccgcaaaatc cgccagattc aggcgctgga agccttgggc gcagaagtgt tggtcgtgtc    217020
     agccgatgtg tccaatgaag cggagctgag gagtgcgatc tcacaggctg aatctcagtt    217080
     tggtgcaatt aacggtgtaa ttcatggggc tgggctagtc ggagccgaga catttagggc    217140
     aatttcccaa ctcgatctcg taacctgtga gcagcagttt cagcccaagg tttatggctt    217200
     attggtatta gaaaaggtgc tgaatgacaa gccgctagat ttctgtctac tgctctcgtc    217260
     cctatcgtca gttttgggtg gattgggtca tgcatcctat gccgctgcca atctgtttat    217320
     ggatgcgttg acccattacc ataatcagac ccattcgtct ccgtggatca gcattaattg    217380
     ggatgcatgg aatcaggata gcgacacaga aaaaatggcc tttttcggtt ctagtttggc    217440
     tcagttttca attgaacctg acgagggaat tcgggcactt cagcaaattt tactgcatcc    217500
     agaacagagc caggtgattg tatccactgc tgatttaagc gctcgaattg atcagtggat    217560
     tagaccaaaa gcaattggga agaagctagc gcttgaatcc tctcactccc atgaaagacc    217620
     gacattgagt actgattata ttcctcctga acataaggcg gaaaaaatac tggcggatat    217680
     ctttcagcag gttttgggag ttaaaccgat tggcatttat gacagctttt tcgatctggg    217740
     tggagattcc atgatcggaa ttcagctcat ttccaaaatt cgtagccatt ttcaaattga    217800
     gctatctatt caacatctct ttgaagcacc ctgtattgct gatttagcct tcaacattga    217860
     agcccttttg attgaggata ttctggttga acccttggga actgaaagcc gatgacgagt    217920
     gaactaaaca gagacgaaaa aagaaaggca ctgcgatcgc gcctctcacc tgctcagcgg    217980
     gcgcaactcg accagcgttt gcggggagac agatcgtctg cggtcaacgt caacgcgatc    218040
     cctcgccgtt cgacaacttc accgtcgccg ctctcctttg cccagcagcg gttgtggttt    218100
     ctgcaacagc tcgaacctgg tcaggcgttt tacaacgaac atgcggcgct gcgactggct    218160
     ggggaactga atcttgccgc tctggagcac agcctgaatg cgctggttga acgccatgaa    218220
     gtcttccgca cccgctttga tatcgtgcat gggcaacccg tgcaggtgat tatccctcac    218280
     ctagcgctgt ccttggctca agccgatctg cagacggtac cagcagccga tcaggccgag    218340
     gtcgtacagc gtttgtcaag ggagcaaagc cacgaaccgt tcaatctgga acaggctccg    218400
     ctattacgct ggctgttgat ctggctggat gagcaagact acgtgctgct gttcaccatt    218460
     caccacatca tctttgatgg ctggtcgatt gatatcttga tgcgggagtt gtcgagtttc    218520
     tatacaacgt tctcagcagc agacgattct gacagttcca atgtcctgcc tgagttacca    218580
     attcaatata ccgaatatgc gctctggcaa cggcagtggt tgcagggaga cgtgctgcaa    218640
     gcgcaactag actactggcg gcggcagctt gcccaggctc cgccgctgct gaatctaccc    218700
     agcgatcgcc cacgacctgc aattcaaacc tatcgaggaa aagcccagac ctttcagctc    218760
     tcgcagccga tggctcaggc gctcaaggat ttaagtcggc agacgggtct gacgttgttt    218820
     atgacgttgc tgacgagctt caagattctg ctgcatcgct acaccgaaca gacggatctg    218880
     attgtcggtt ctccggtggc gaaccgcaat cgggcagagg tggaagggct gatcggcgtg    218940
     tttgtaaata gcctagtgct gcgtaccgat ttgtctggca atccaacggt tgccgaactg    219000
     atgcagcggg tgcgacgggt actgctggga gcctatgcca actcggagct gccgtttgaa    219060
     aagctggtgg aggaactcca gcccgaacgc gatacgcact ccaaccccct atttcaggtg    219120
     tcgtttacgc tgcacaacac gccccggcag gcggttgagc tatcggggct gaccctaacg    219180
     cctgtagagg tgagccgcga tcgcgccttg ctagatctgc gcttggacat gacagaaacc    219240
     gaacagggac taacgggatg ctgggaatac agcaccgact tgtttgatga tgatcgaatt    219300
     gagcggatga gtggccatta ccagaaacta ctggagatga tggtagctaa tcaagcccag    219360
     cacattgcag atctgtccct cctgactgaa tctgagttcc accagttgat gcaatggaat    219420
     cagacacagg ctgactatcc ccaagatcgg tgtttatctg agctgttcgc cacccaggtt    219480
     gaacaaacgc cagatgcgat tgcactcatc ttcgaagacc aacacttgac ctatgccgaa    219540
     ctcaatgccc gagctaatca actcgctcac tatctgcaaa ccctaggggt gaagccagat    219600
     gatttggtgg gaatttgttg cgatcgcagc ctcgacatga tgattggact gctgggcatc    219660
     ctcaaatcgg gaggagccta tgtgccgatt gatccggact acccgagcga tcgcttggcc    219720
     tggatgatga gtgatgccca cctagcgatt ctgctcaccc aacgctctct aacggatcag    219780
     ctacctcccc atcaggctca ggtcgttgaa ctggatgggg attggcagac aattgcccag    219840
     caaccccgac acaatctcgc taatctggct acggcagacc acctcgccta cgtcatctac    219900
     acctccggtt caacaggcaa gcctaagggg gtgcagatta ctcaccgcag tctggttaat    219960
     ttcctctgct cgatgcacaa acagcccggt ttaactgcgg atgacacatt actggctatc    220020
     acctcgattt cctttgatat cgcggcactg gaactgtatc ttcccctgat taccggggca    220080
     aaggtcgtcg tcgctagtcg tacagtagcc gccgatggcg aacaactcag tgaactgctt    220140
     agccgcacag gcgcaaccat tatgcaggcc acccccgcca cctggcggat gctgctgacc    220200
     gcaggctggt ctggacaagc cggactaaaa atgctctgtg gcggtgaagc cctgagtggc    220260
     gatctggctc agcagttaat gaacatggga acttccgtct ggaatctcta tggccccacc    220320
     gaaaccacca tctggtctac gatttatcca gtaaagaacc agccacacaa tcacaccgac    220380
     tccgaagtcc cctttaccaa gggggattta gggggatcaa tccctatcgg ccaccccatc    220440
     gccaacaccc aaatctatct cctcgatcgc cacggacagc ctgtgcctgt cggcgttccc    220500
     ggtgaactgc acatcggcgg cgacggactc gcacggggct acctgaatcg acctgagcta    220560
     acggcagaac gatttattga ttttggattg ccaattgccg attttggatt agagccagac    220620
     tcacaaatcc ctccaaaatc cgaaatcgtt cgactgagcg ctcacgacga agtccaaaat    220680
     ccaaaatccg ttcgtttata caaaactggc gacctcgccc gctaccgtcc ggatggctca    220740
     atcgagtatc taggtcgcct ggatcatcag gtgaaaattc gcggcttccg gattgaactg    220800
     ggggaaattg aagccgtctt gcgtcagcat tcagatgtcc atgaggtggt cgcgatctcc    220860
     cgtcccgact tattcggaga gtcgcagtta gtggcctatt tggtctgcca gccagaacga    220920
     caggtagaca gtggtgagct acgcaaattc ttacgggcga aactgccaga ctacatggtg    220980
     cctgcgacct atatgacgct ggaggctctg cccctgacac ccaatggcaa ggtcgatcgc    221040
     aaggcgctac ctgctcctac accggagttg cgtatgatcg acgctgatgc tagtcctgca    221100
     agcccaattg aggacatgct ggcaggggtt tgggcagcaa ctttggggct tgagggggtg    221160
     ggtcgctacg acaacttctt tgagttgggc ggacattctc tgctggcaac acaggttatg    221220
     tctcagatac agcgtttgtt gcaagtagag gtaccgttgc ggtcgctatt tgaatcaccc    221280
     accgtcgcac agctagcgga acgggttgag gcggcaatcc agaccggagc ctccttaagt    221340
     atcccagcta tccagtcccg gtcgaatcgg gacgttgccc ccctctcatt tgcccaagag    221400
     cgcatgtggt ttttggctca gcttgaaccc gaaaacccct tttacaatct gccgattgcc    221460
     gtcgctctgg acggtttgct tgacctcgat gccttggagc aaactctgac agagattctg    221520
     cgtcgccatc aggggctacg cacccgcatt gagactcgcg taggagttgc gatcgctcgg    221580
     attgcagatc ccgttccgtt cccgctacgg cgagttgatt tgagccagtc cgccagccta    221640
     gatcgagagc ctgaaatcca gcgttggatt gacaccgcag cccgtcaacc ctttgacctc    221700
     cagcaggatc tcctcctgcg agccaccgta cttcgcctgt cggagcagga gcatattttg    221760
     ctgttgacgc tgcatcacat tgccgctgat gcctggtctt tcggactgct ggccagtgaa    221820
     atcagcgctc tctatccggc tttctgtgac ggcaacccct ctcccttacc ggaactaccg    221880
     attcagtatg gcgacgtggc ggtgtggcag cgacagtggc tacaagggaa cgccctccaa    221940
     acgcaaatgg actattggcg gcagcagcta caggatgcac ccgcgttgct gaacctgccc    222000
     accgactatc cccgccccgc tgtccagacc tatcgagggg cacgctacgg ttttgagctt    222060
     tctgccagcc tgacgcgatc gctacatcat ctcagtcagc aggcaggctg cactctattt    222120
     atgacgctgc tggccgcgtt caagctgctg ctggggcgct acagcaacag taccgatatc    222180
     ctcgtgggaa cgcccattgc caaccgcaat cgggctgagg ttgaagacct gattggctgt    222240
     ttcgtgaata cgctggtgct gcgaacggat ctctcccatc agccaacggt attgaaacta    222300
     cttgagcggg tgcgagaggt agctctggga gcctatgccc atcaggattt gcctttcgaa    222360
     caactggtag acggactgca actagggcga tcgctgagtc atacgccgct atttcaggtg    222420
     atgtttgtgc tgcagaacac gccgctaccg caggtgacgc tgccaaacct ccagattcat    222480
     ccgctcgaca ctgggagcgg tactactcag tttgatctca ccctttctct ggaggaaacg    222540
     cctgccggac tcactggcgt tattgagtat aactgcgact tgtttgagga agcgaccatt    222600
     actcggatgg caggacacta ccaaatgctg ctggacgggt ttgttgccca tccccagcgg    222660
     cctgtggcag aactgccctg tttgacaact gccgagcagc agcagctagt tgcttggaat    222720
     caaacccagg ccgtgtattc acaggatgcc tgtattcacc atttgtttga agcccaggtt    222780
     gaacggatac ccgatgcgat cgcagttgtt ttccaggatc agcagctgac gtatggggaa    222840
     ctcaaccaga gagccaatca gttggcccag aagttgcgat ctcagggagt acagccggat    222900
     gttcctgtgg gcatttgtgt ggagcgctca atcgatatgc tggtggcgct gctaggggta    222960
     ctgaaggcag gcggcgcgta cctgcccctc gatcctacct atccgtctga gcggctggcg    223020
     tttatgctgg acgatgccca agttaagcat ttggttactc agtccgctct gtgcgatcgt    223080
     attcctcccc atcaggcaca agtggtttat ctggatagac ttgccactga aaactctcga    223140
     ccggattcag gcaatccaat tcactcaccg cagacggaaa atttagccta tgtaatctat    223200
     acctccggct ctacgggcaa gcctaaaggg gtgatggtaa accaccgctc tctagtgaac    223260
     tacaccgaag cgattgcttc agcctatgtt ctgaaaccaa gcgatcgcgt cctgcaattt    223320
     gcctctatca acttcgatgt ggcggcagaa gaaatcttcc cgacgctggc gcagggaggg    223380
     acattggtct tacgcaccga tgagatgctc gattcaatcc ccaccttttt acatcaggtt    223440
     caagcgttag agttgacggt gctcaacctg cccaccgcat tttggcatca gttcacggct    223500
     gaactcgaca gaatgtcaac gactgttccg gattccctac ggctggtggt aattggtggc    223560
     gaacgcgctc tagccgatcg cgtccaaacc tggcatcgag tggtgggcga acagattcgc    223620
     ctcgtgaact gctacggccc aaccgaagca actatcggcg caacgctctg tgatttaacc    223680
     gcctatgctc caactgaatg ggcggggaac gaatcggggg caaccatcct cagttctaac    223740
     gatgtcccca tcggcaaacc cattcagaac gtccaaacct acgtgctcaa cgccgacttg    223800
     caacctgtcc ccatcggcat tcctggcgaa ctgtatatcg gtggcgatgg tctcgcacgc    223860
     ggctacttga atcgacctga gctaacggca gaacgatttg ttgatttgag attgccgata    223920
     tctaattcaa aattcaaaac tcaaaattca aaactctccc cttcgatttg tttatataaa    223980
     acgggcgatc ttgtccgcta ccgccccgac ggtaatctag agtatctggg ccgcatcgac    224040
     catcaggtga agatgcgcgg ctttcggatt gaattgggtg aaattgaagc ggcattgggt    224100
     cagcatccgg cggtgcagaa tgccgtggta gttgacgacg agacggaact gggtacccgc    224160
     cgcttggtgg cttatggggt agcaatgccc tatgccgacc tgtcgatgcc tgagttgcgc    224220
     cagtttttga cagagaaact accggcctac atggtgcctg cggtgtttgt gcttctggaa    224280
     actctgccac tgatgcccaa tggcaaggtg aatcgccagg cactgcccgc tccagatgcc    224340
     acccaggcgg agtctgacgc tactgtggct tccccccgaa caccgactga aatcaccttg    224400
     gctgagattt gggcgcaggt gttgtcagtg acgcaggtgg gcattcacga caacttcttt    224460
     gagttgggcg gcgattcgat tctcagtctc caagtggtag ccagatctca tcaagccgga    224520
     ctacaattca cgcccaaaca gctttttgag catcagacca ttgccgaatt ggcgatcgtt    224580
     gcccagacga agcacgaaac ggagattgag cagggattag ccacggggtc tgttgggtta    224640
     acgcctatcc agcagtggtt ctttgagcaa cagttgccgg atccccatca cttcaaccaa    224700
     gcggtacttc tagaagtgcc gcagccactc gacccagggc tgctggaaca ggcagttcaa    224760
     caggtgctca ttcaccacga tgcgctccgg ctgcggttcg aaccaataga gtccagctgg    224820
     cggcaggaat atgctccacc tgattcagcg ctacttctaa tcaggtggga tttctcaact    224880
     ctgagcaagg cggagcagca ggccgccttt gctactgcag ccgctgaact ccacaccagc    224940
     cttgacctat ctaaggggcc gctgctgcgg gtgggctatt ttgattgggg agatcacctc    225000
     tcggatagcc tactgattgt gattcatcac ttggtagtgg acggtgtatc ctggcgcatc    225060
     ctgctggagg atttgcagac ggcctaccag cacctcagtc gaggagaaac ggtgcagctt    225120
     cccgctaaaa cgctgtcgtt ccagcagtgg tcgcagcaac tacagcagat ggctcaaacg    225180
     gtactggact catcagaacc cgactactgg ctggcacagc agtcttcgac accgctgcct    225240
     gtggatatag taggtgcaga aaaagcaggg gcggaaaata cggttgcctc agcggctacg    225300
     gttcactgca tcttgagcat ggctgagact caagctttgc tcaaagaagt gccgtctgtc    225360
     tacaacactg aaataaacga cgtgttgctg actgccttag tacaaacgtt aacggcatgg    225420
     gttgagcctg atgcagctat ccattcaccc accttcttga tcgatctcga aggccacgga    225480
     cgagagggta ttaccgcaaa cctcaacgtc tcacgcacgg tgggctggtt caccaccgtc    225540
     tttccagtgg ctctaagcct tgaccccaac gtccatccag gcgaagcgtt aaagcaggtc    225600
     aaagaacaac tgcgccgcat tccccatcaa gggctcggct acaggctgct gcgctatctc    225660
     agcgaggaac caagcctcac cgcagcgttg aaaaacctcc cccaagccaa cattctgttc    225720
     aactacttag gccagtttga ctctgcgctg acggacactg ccctatttcg tccgctgtcg    225780
     gaatcggcag ggccaactca aagtccacgc ggtcaacgca gccactggct ggagatcaat    225840
     tgctgggtga gtggcggaca actgcatctg gactggattt acagtcaggc gctgcatcaa    225900
     tccagcacga tggaaacgct ggcgcagcag tttatggaga cattgcgatc gctgattgcc    225960
     cactgtcaat ctccagacgc aggtggctat accccctctg acttttcgga agcagacttg    226020
     agtcaagatg acctcgatcg cttcctagcc cacctcaatc gcaggagtta gcgtccatga    226080
     ataccgctgt ccacaacacc attcaggata tctacgaact gaccccgatt cagaaaggaa    226140
     ttctgtttca cagtttgtat gcacccgaag ttggcctcta cctgatgcaa acgggctata    226200
     cagtgcgcgg ccatctgaat cggctggcct ttgaacgagc cttgcagcat ctggctcagc    226260
     gccacaccat cctccgcacc agctttcact gggaagaagc cgataagccc ttacaggtgg    226320
     tacatcggca ggccaccatt cccctggaat atcaggattg gcgcgatttg agtgagaccg    226380
     aacaagcggc acgtttgcag atggttctaa agtgcgatcg cgaacggggc ttcgattttt    226440
     cacagcctcc tctgttgcgg atgaccatta ttcggctggc cgatcaggac tacgaaatca    226500
     ttcaaacgga gcatcactta attctagacg gttggtcggg ggcgctggtg atgggcgagg    226560
     tgattcagct ctatcaggcg ttttgccagg ggcaggacag tccgttattg cctagcattc    226620
     cctttaaaac ctatctgtcc tggttgcgaa agcaggatct atcaaaggcc gaacgctact    226680
     ggcgacaggc tctccagcca atcaaagcca gtacaccgat tgttgcattg gaaagcggct    226740
     ctatcccgaa tccaacggaa cgctatgacg agcaacaaat caagctctca gcgacactta    226800
     cggctgattt acaagcacta gcacgacagc accagttgac tctgaatacg ctgtttcagg    226860
     gaacttgggc gctgctgctg agccgctaca gcgggcagga ttccgtgatc tttggctgct    226920
     gtgtatcggg ccgccccgtg gatctgccgg gagtcgaatc aatggtcggt gtcttcatca    226980
     ataccctacc tgtgtatgta gatgtccgct ctgatcagcc attgttgcct tggctaaagc    227040
     gactccaagc tcagcaggtg gagatgcgcc agtacgaata cagtcccttg gtggacgtac    227100
     aggggtggag tccggtgtcc cacggcaact ccctgtttga aagcatcgtg gtgtttgaga    227160
     actaccccat tctccaaatg agtaagcagg gaaaagacgg tttagaactg caaaaatcca    227220
     cggtctttta taaaaccaac tacccactca ccctggttgg ctatcccggt tctgaattag    227280
     ttctaggcat tagctatgat tgccgccgct ttgatgccgc cacaattggc gaaattctga    227340
     accatttcga gcgggtgttt caactaatga ttgctaaccc cgatatgcag ctccaagaca    227400
     tttcactatt tacgccagtg gagcagaacc tagcacattg gctataccaa aacgcagcat    227460
     ttgatgactg ttggctacag gaagatacgc ttcatgcagg aggttatgcc catgaacatt    227520
     tttgaacagc gcgagtcaaa cgttagaagc tactgccgta gttttcccac cgtctttcat    227580
     cgggcaaaag gagcactggt ttactcggaa tcaggcaaag aaaatattga ctttctggct    227640
     ggagcgggtg ccttaaacta cggtcataat aacgactaca tcaagcaaaa ggtgctgtcg    227700
     tatctggatg cagatgccat gactcacggg ttggatctgc acacggcagc aaaagaaaag    227760
     tttttggcta ccttctcaga gcaagttcta attcccaagc agttagatta ccgaattcag    227820
     tgctgtggcc caacgggcac aaatgctgtg gaagcggcgc tcaaattagc cagaaaggtg    227880
     aagaatcgca cgggaatttt ctcctttatg ggggcatatc atggcatgac gcaggggagc    227940
     ctttccgtaa ccggaaatac agctattcgc tccggcattg aaagttttgc tcaggtcacg    228000
     tttatgccgt acccatacag gctgatggac ggctttgata ctattcacta catcgaatct    228060
     gtcctgaacg acatccactc aggcattgaa aaacctgccg ccattatttt tgaaaccgtg    228120
     caggcggaag gcggcattgt tgtggctccc atcgattgga ttcagcagtt gagggcattg    228180
     tgcgatcgca acgatatcct cttgatttgt gacgatatcc aggtgggctg tggtcgaact    228240
     ggccccttct tttcgtttga aagagccaat attatccctg acatggtgat tctctcaaaa    228300
     tcgatcagtg gttatggatt tcccatgtca ttactgttaa tgaagcagga gctagatcaa    228360
     tggcaacccg gcgagcatac aggcaccttt cgcggctatc agcttgcctt tgtgggcggc    228420
     accgctgccc ttgagtatcg cagcagtact gatttagaaa aagtggtcag gctaaaagaa    228480
     acatttctca gaacattttt aactgaagaa attgcaccat tacatcccaa aatagaaatt    228540
     cgaggactgg gattgatttg gggcattgat ctagcggctc tagatgatgg taattttgcc    228600
     aaaaaaatcg cgactcgctg ttttgaacaa ggcctgatta tcgagcgagt gggaagacgc    228660
     gatacggtgc ttaagctatt gcctccgcta acgattgaaa tgccgatttt gcggagaggc    228720
     tgcacaattc tgaagcaagc gattgaagag tgcttggcct aaatgattca ctacgttcca    228780
     attctgttct agagaacttt agagattttt agagactcat agctggagat tcctcctcgc    228840
     aatcatgatg attcaaaccc tgacaccacc agactcaatc tctgagcagc ggctccatca    228900
     caaaatctac tggctcaacc agttgtcagg agaacgccca gagacagcta ttctcaccga    228960
     ctatcggcgg cctgaacact acagtcctaa caacgagtct gtaacatttg agctagatga    229020
     tcgcctgtct caagccatcc tccaaatcag tcaggcatcc gacttttcca gctacttact    229080
     gttgctatcg gcgttcagtt gcgtgctgag agtatataac cgcagtgatg atctgatgtt    229140
     gggaatccca gcttattctt tccctgaaaa tcactctgag aatggtgagc ggttaagcaa    229200
     tcctattgct agatccgttc tacctttacg cctgcaaatt aataatcagc tcagctttaa    229260
     agaggtcttg cagctggtta aagaggctac cattcaggcg tatgttcatc aacattatcc    229320
     attagacgat ctgctgggaa cgctagacct accgcgactg gatcaccgtt gtccgctgta    229380
     tgacattgtg gtagcgctcg acaatctgca tcctcatccc gctgatagaa agcaggatct    229440
     aacggtgtcc tggcatatcg atgcagccag tatttcaggg cgaattgaat accgcaattc    229500
     tctatatcaa aatggaacaa ttgaagcctt aatcaggcac ttaattaatg gactggaata    229560
     tgcaatcgca catcccaatc gtcctatttc acaactaaac ctgttgagag atgaggatgt    229620
     cgatcaatta cttaaagctt ttaatcataa ttctcaatcg tatcccgctg atcagacgat    229680
     tcaaggctta tttgaatctc aggttgagca atctcctgat caggttgctg ccgtttgttg    229740
     gaatgaatcc attacctatc aagaactaaa ctcgcaggct aatcggctag ctcgatgttt    229800
     gcagtcagca ggtgtgcaaa cgggcgattt tgttggcatt tttcaagagc gtagccttaa    229860
     ttttctgcgc tcaattctgg ccattctcaa ggcgggtgca gcttatgttc caatggatag    229920
     tgcctatccg cctgagcgta tccagtatat gctgcaaaac agcgaagtta gcgtcctctt    229980
     aactgatgct aaaacgagag aatcaattgt tgataatagt caatactatc ctcacttaaa    230040
     gcacatcatt tatttaaaaa ctgatggtaa gtttgaagcc tatcttacgt cttcaaatga    230100
     gccagcatca tgtgaaaatc tgtctgataa aaatctagag ataacctgcc atagtcgtga    230160
     ctgggcgtat atgctctata cctcaggctc aactggattg ccgaagggag cgattattcg    230220
     ccacgatgga gccattaacc atatttatgc tcagtttgat gctctgaaat tagatgagaa    230280
     tctacgattt ctgcaaactg ctccggcctc ttctgatatt tcagtctggc agtttttggc    230340
     tccgctgctg attggaggct gcaccgtcat tacggatacg gaaaccgttt gcgaccctca    230400
     agccctgttg cagatgcttc aaacccacag catcaccttg gtggaactcg ttcctgtggt    230460
     gctgaaagga cttctgaact atgcggctca gttgccggat caggtgcgat cgctgcacca    230520
     gctcaactgg atgatggtca cgggagaaga tgtctcggtc aatttggtca atcagtggct    230580
     acatctctat ccgtcgattc cagcagtgaa tgcctatggc ccaacagaag cagcggatga    230640
     tatcacgcag caaattatcg caactccatt gcctgaacat cagcgatcgg tgtccatcgg    230700
     taagccgttg gcgaatctga atctctacat tgtggatgct caaatgcagt tggttccggt    230760
     gggggtgccg ggtgaaattt gtgtttccgg cattggtgtg ggtgagggct actggcagaa    230820
     ttctgagaaa acaacgctga gctttgtggc caatccattt ctgaactcag gtcacattac    230880
     gacccagcat cattcatgtc tctataaaac aggagactta ggccgctggc tactgaatgg    230940
     ctcgattgag tatttgggtc gcctagatca tcaggtcaaa attcgcggct tccggattga    231000
     actgggtgaa attgaggtcg cgttgagcca gcatccggct ttgaaagagg ccgtcgttat    231060
     ggtgcgggag gatcgaccgg gtgataagcg tctggtggct tacggtgtac ccaatgcgga    231120
     atccgccgtt gagacgcttg aaacgctgga actacgccgt ttcctaaatg aaaaattacc    231180
     cgactacatg gtgccctcag ccttcgtgct gatcgagcgg ttgcccctga ctcccagcgg    231240
     caaggttgat cgcaaagctc tacctgctcc agaagggaat gccctggcct ctgcagaggc    231300
     cagtcgggct gcaacccctg tggaagacat tctgataggc atctgggcta cggtcttggg    231360
     gtgcaatcgg cctgggattc acgataattt tttcgagcta ggtggccact cgctgctggc    231420
     cacgctaatc atttctcagg tgcggcaggt gtttcagcta gagctaccgt tgcgtcggtt    231480
     gtttgaatat cccactattt cccagtttgc gatcgcaatt gaacgcgagt ctcaatcggg    231540
     tttagcagca ccgccgattg aacctcagag cgatactaac aatctagtgc tgtcctttgc    231600
     tcagcagcgg atgtggtttc tggctcagct tgaaccggat agcccttttt acaacctacc    231660
     tgtggccgtt cgcctccagg gtgagttgca tcagctggcg ctggaacaaa cgttcagcac    231720
     gattctgtat cgccatcggg tgctgcgaac tcagattgaa accgttgcgg gtcaacctgt    231780
     tgccaatctt tcagtggatt cagatgttgc gatcgcacag atagacttaa gcggactctc    231840
     tcaaccagag caggaggcgg aagtccaatg gtggatgacg gcagaagccc agcgtccctt    231900
     caatctcagt cgtgagccac tgatgcgggt tagcctactg cacctagagc aacacgacca    231960
     tattctgcta attaccctgc atcacattgc tgccgatggt tggtcgattg gcgtcctggt    232020
     caacgaggta gctactctct atccagtctt ttgtgctgga caaccatctc ctctgcccca    232080
     gttaccaatt cagtattcag acttcgccga ctggcagcgg cagtggttac agggtgaggt    232140
     attggaacaa cagctcacct actggcgcaa gcagcttgcc gatgctccag cactgttgga    232200
     gttacctact gataatcccc gaccagccgt acagcgtttt caaggagaca gctacagctt    232260
     tactttagat accaaactat caacggactt gcaacaactc agtcagagca caggctgcac    232320
     cctgtttatg acgctactgg cggggttcaa tcttctgctc agctactata gcaaccggga    232380
     tgatattgtt gtcggcacac cgattgccaa ccgcaaccgg gcagaaaccg agagactgat    232440
     tggcctgttc gtcaacaccc tggtgctgcg aacggatctg tcggataacc ccaacgttac    232500
     cgaactcttg agccgcgtcc gagaggtagc cctgggagcc tatgcccatc aggacttgcc    232560
     ctttgagcag ttggtggaag aactgcagcc agagcgatcg ctgagctatt cgccgctgtt    232620
     ccaggtgatg tttattctgc aaaatgctcc gttagatgag attgagctac caggtttgat    232680
     gctaacgtcg ctggagagcg acagcggcac gtctcagttt gacctcaccc tcatactgga    232740
     ggagctgccc aaaggactgg tggggacggt tgaatacagc actgacctat ttgaagagac    232800
     gacaattgcg cgactggtgg gtcactacca aacactgcta tccgccatcg ttgccaaccc    232860
     caaacagcgt ttgtcagagc taaccttgct aacggaggtg gagcagcgtc agttggtgca    232920
     gtggaatcag acgcaggtgg actttcccat agacctgtgc ctgcatcagc tcgttgaagc    232980
     ccaagtggaa cggacacccg aagcaacggc cctcatcttt gaagatcagc aactcaccta    233040
     cgctgaactc aacgccagag cgaatcaact ggcctactac ctgcgatcgc agggagtcaa    233100
     acccaatgat ttggtcggag tctgtggaga tcgatcaccg gaactggtga ttggactgct    233160
     tggcatcctt aaaacgggtg cagcatacgt cccccttgat ccctcttatc cccaagagcg    233220
     attgaattgg atggttactg atacccagat gccgattcta ttgactcagg agcactggcg    233280
     cgatcaactg cctcagcata agtcccaggt ggtgtgctgg gatcttgata gtgaggcaat    233340
     ttcccaacag ccagacccta atcccgagcg acgagtggga gcagatcatc tcgcctatgt    233400
     catttacacc tctggctcga caggcaaacc caaaggggtg cagattgagc accagagtct    233460
     ggttaacttc ctcttctcaa tgcaacgcca gccgggattg gaggctacag atattctctt    233520
     ggccgtcacc tcagtttcct ttgatatcgc tgccctagag ctatttctcc ccctaatcac    233580
     aggagctacc gtagctctag ttagccgaac agtggcaatg gatgggatac ttttaagtcg    233640
     ccaattagaa gctgtcggcg caacggtgat gcaggcgacc ccagctacct ggcggatgct    233700
     cctggccgct ggctggcgag gacaagttgg gctgaaaatt ctctgcggtg gtgaagccct    233760
     gagtagagac ctggctcagc agttagtaac aaccggaact tccgtgtgga atctctacgg    233820
     ccccaccgaa accaccatct ggtctacagt ttatccaatc aaggatccaa gttctgaaat    233880
     cccccttagt aagggagatt tagggggatc tctccccgcc accctgccga tcggtcaccc    233940
     cattgccaac acccaaatct atcttcttga tcgtcacgga cagcctgtgc ccatcggtgt    234000
     tcccggcgaa ctgcacatcg gtggcgatgg actcgcgcgc ggctatctca atcgacctga    234060
     tttgactgag gagaaattcg tcgttcattc tcagtggggt caactgtatc gaacaggcga    234120
     cctcgcccgc taccgtccgg atggctcgat cgagtatcta ggtcgcctgg atcatcaggt    234180
     aaaaattcgc ggcttccgga ttgaactggg ggaaattgaa accgtcttgc gtcagcattc    234240
     agatgtccat gaggtggttg cgatctcccg tcccgactta ttcggagagc cgcagttagt    234300
     ggcctatttg gtctgccagc cagaacgtca ggtagacagt ggtgagctac gcgaattctt    234360
     acgggcgaaa ctgccagact acatggtgcc tgcgacctat atgacgctgg aggctctgcc    234420
     gttgaccccc aacgggaagg tcgatcgcaa ggcgctgcct gcgccagagt tgtccctaga    234480
     tacagtctct gagggtgaac tgccatcaac accgatggaa atgcgcctgg agcagatttg    234540
     gatagaagtg cttggagtcg aggccagtca acaccttggt ctgcacagta acttttttga    234600
     gctgggcggc cactcgctac tggccactca ggtgatttct cagatccggc aggtgtttca    234660
     ggtagagctg ccgctacgtc gtttgtttga atgtccgagc atcgcccagc ttacccaggc    234720
     catcgcagcg gcaattcagg gaggagaagt gccagatttg cctcccatcc agccatgctc    234780
     tccggcagaa ccaatccagc tttccttcgc tcagcagcga atgtggttct tggctcagct    234840
     tgaaccggac aatccttttt ataatctgcc agtggccgtc cgcctccagg gaacgctgaa    234900
     tatcaacgcc ctggagcaga ctatcaccga aattatccgt cgtcatcagg tactccgaac    234960
     ggcgatcgta acccagctgg gagaacccag tgccgttctt caaccatcgt catctgtctc    235020
     tctcactcaa gtcactttga gccaagggga acaggatgct gacgttcaag agtggatgga    235080
     cgcagaagcc cagcgcccct ttaatctgag tcgtgatccg ctgatgcgag tgagtctgct    235140
     gtgcctgagt cacaacgaac agattctact gattaccctg catcatattg ctacggatgg    235200
     ctggtcgttc ggggtgctag tgaatgaggt ggcaaccctt tatcccgcct tttgtgctgg    235260
     acagtcctct ccattatctc cattaccgat tcagtattca gatttcgccg cgtggcaacg    235320
     tcagtggttg cagggcgaag tattggcaaa acagctcgat tactggcgca agcaactaag    235380
     gggtgctcca gctctgttgg aattaccgac tgaccatcct cgtccagccg tacagcgttt    235440
     ccagggggcc agctatacct ttaacctaga gaccgaactg tcaagtcatc ttcaacagtt    235500
     gagccaggat acaggctgca ccctgtttat gacgctactg gcagggttca atcttctgct    235560
     cagccgctat agcaaccggg atgatattgt tgtcggcaca ccgattgcca accgcaaccg    235620
     ggctgaaacc gagagactga ttggcctgtt cgtcaacacc ctggtgctgc ggacggatct    235680
     gtcggataac cccaacgtta ccgaactctt gagccgcgtc cgagaggtag ccctgggagc    235740
     ctatgctcat caggatttac cctttgagca gttagtagaa gaattgcagc ctgagcgatc    235800
     gctgagctat tctcccctct ttcaagtaat gttcgtgttg caaaacgctc cattctcaca    235860
     ggttgatctg ccagaattga ccctgacccc gctggagagc gatagcggca caacgcagtt    235920
     tgacctcatc ctctcactga cagaaacgga tgcaggtctg atgggcacgg tggaatatga    235980
     cacggatcta tttggggtag ggacgatcgc ccgtctagtc ggccattacc agaaactact    236040
     ggagatgatg gtagctaatc aagcccagca cattgcagat ctgtccctcc tgactgaatc    236100
     tgagttccac cagttgatgc aatggaatca gacacaggct gactatcccc aagatcggtg    236160
     tttatctgag ctgttcgcca cccaggttga acaaacgcca gatgcgattg cactcatctt    236220
     cgaagaccaa cacttgacct atgccgaact caatgcccga gctaatcaac tcgctcacta    236280
     tctgcaaacc ctaggggtga agccagatga tttggtggga atttgttgcg atcgcagcct    236340
     cgacatgatg attggactgc tgggcatcct caaatcggga ggagcctatg tgccgattga    236400
     tccggactac ccgagcgatc gcttggcctg gatgatgagt gatgcccacc tagcgattct    236460
     gctcacccaa cgctctctaa cggatcagct acctccccat caggctcagg tcgttgaact    236520
     ggatggggat tggcagacaa ttgcccagca accccgacac aatctcgcta atctggctac    236580
     ggcagaccac ctcgcctacg tcatctacac ctccggttca acaggcaagc ctaagggggt    236640
     gcagattact caccgcagtc tggttaattt cctctgctcg atgcacaaac agcccggttt    236700
     aactgcggat gacacattac tggctatcac ctcgatttcc tttgatatcg cggcactgga    236760
     actgtatctt cccctgatta ccggggcaaa ggtcgtcgtc gctagtcgta cagtagccgc    236820
     cgatggcgaa caactcagtg aactgcttag ccgcacaggc gcaaccatta tgcaggccac    236880
     ccccgccacc tggcggatgc tgctgaccgc aggctggtct ggacaagccg gactaaaaat    236940
     gctctgtggc ggtgaagccc tgagtggcga tctggctcag cagttaatga acatgggaac    237000
     ttccgtctgg aatctctatg gccccaccga aaccaccatc tggtctacga tttatccagt    237060
     aaagaaccag ccacacaatc acaccgactc cgaagtcccc tttaccaagg gggatttagg    237120
     gggatcaatc cctatcggcc accccatcgc caacacccaa atctatctcc tcgatcgcca    237180
     cggacagcct gtgcctgtcg gcgttcccgg tgaactgcac atcggcggcg acggactcgc    237240
     acggggctac ctgaatcgac ctgagctaac ggcagaacga tttattgatt ttggattgcc    237300
     aattgccgat tttggattag agccagactc acaaatccct ccaaaatccg aaatcgttcg    237360
     actgagcgct cacgacgaag tccaaaatcc aaaatccgtt cgtttataca aaactggcga    237420
     cctcgcccgc taccgtccgg atggctcaat cgagtatcta ggtcgcctgg atcatcaggt    237480
     gaaaattcgc ggcttccgga ttgaactggg ggaaattgaa gccgtcttgc gtcagcattc    237540
     agatgtccat gaggtggtcg cgatctcccg tcccgactta ttcggagagt cgcagttagt    237600
     ggcctatttg gtctgccagc cagaacgaca ggtagacagt ggtgagctac gcaaattctt    237660
     acgggcgaaa ctgccagact acatggtgcc tgcgacctat atgacgctgg aggctctgcc    237720
     cctgacaccc aatggcaagg tcgatcgcaa ggcgctacct gctcccgacc tatcccggac    237780
     gcaggatgaa atcgtcccac cccgcagcca caccgaagcg acattggcta ccctctatac    237840
     cgaaattctt ggggtagaga taatcagtgt ccatgacaac ttttttgaac tggggggaca    237900
     ttcgttactt gctacccgcc tcacctcccg tctgcgcgaa acctttgaac tggagctctc    237960
     tctgcgtagc ctgtttgaaa aaccgaccat tgctgaactg gcagaacaca tcgacgttct    238020
     ccggttggcg attgcccaag cccccatccc tgctactaca accgaaccgg gtcgaaagga    238080
     aattgaacta tgaaaccgat tgaatcattc ttatccgatc tgtatcgcct agatgtcaaa    238140
     ctgtgggtcg aagggaccga tgacaaacgt caggacggct cagaacagac tcgactgcgc    238200
     tgcaatgctc cagaggacat tctgactgcc gacctcagcg cccagatctc ggctcgtaaa    238260
     gctgaaatca ttgcctttct caatcaggct catgccgcct cccatttgtc ccttcccgag    238320
     atacaagcga tcgcccgtcc agagcatgta tcgttatcgt ttgcgcagca gcggctgtgg    238380
     tttctcgatc agatggaacc caatagtccg ctctacaaca ttccagcagc ggctcgttta    238440
     acgggtaccc tggatgcgat cgcactcgat caaagcttca atgccatcgt gcagcgacat    238500
     gagagtttac gaacggcctt tcaagccgta gatggtcagc ccgttcagat gattgtgccc    238560
     gaattaaccg tgcctctaca gcgtgttgac ctcagtaccc ttgacaaagc ggagcaggaa    238620
     gttcgagtgc tgcaacttgc ccagcaagag gctcagcagc cgtttgacct cacccaggca    238680
     ccactgctgc gagtcactct gatccggcta acggatactg agcatgtggt gctgttgacg    238740
     atgcaccata tcatctcgga tgcctggtca atggatattt tgctgcagga gttaaccgct    238800
     ctgtatgggg cgttttcagc tggacagccg tctcctttat cagagctgtc gattcagtat    238860
     gctgaccttg cggtctggca gcgccaatgg ttgcaggggg aggtgctaga gcggcatcta    238920
     tcctattggc accagcagtt gggtggaaac ctgccgattt tgcaactgcc cagcgatcgc    238980
     ccccgtcctc gcgttcaaag cttccgggga gccaagcaca cctttacact ttcggctgag    239040
     ctgacggcag ccctcaaagc cttgagccag caagcaggtg tcaccctatt catgactctg    239100
     ctggcctcgt tcaaggtact gctccatcgc tacaccgggc aggcagattt gttggtcggt    239160
     tcccccatcg ccaaccgcaa tcgctctgaa attgaggggc tgatcggatt ctttgtgaat    239220
     accctggtgc tgcggagtaa cctggccgac aacccgacct ttcgtgagct gttgcagcaa    239280
     gtgcagcaga cgactctagc ggcctatgaa catcaagatc tgccgtttga aaaactagtg    239340
     gaagagttgc aaccggagcg agacctcagt tacagtccac tatttcaggt caagtttgcg    239400
     cttgaaaatg cacctacaag cgatctcaat cttgctgact tgacaatgag ctttcttcag    239460
     ttcgaaagtt cgacggccaa gctcgatttg agtttggaca tgagcgaaga ggtgtctgac    239520
     actggggcgg ctcgtttagg aggtaccttc gagtacagta ccgatttatt tgacaaagca    239580
     acgattcagg caatggccga acatttccag tgcttactga ctggcatcgt tgcccatccc    239640
     gatcagtgca tctctgacct gccgttgcta acagaagccg agcggtatca gcagttcgtg    239700
     acctggaacg atactcaggt tgagtatgct caggacgaat gctttcatca gcgatttgaa    239760
     gctcaggttg aacaaacacc caatgcgatc gcactcgttt ttcaagatga gcagctcacc    239820
     tatgctgaac tgaatcggca gtccaaccag cttgcctact atctgcaaaa ccaaggcgtg    239880
     aaacctgagg ttgtagtagg gctgtgcgta gagcgatcac ctgccatgat cttgggactg    239940
     ctcggcattc tcaaagccgg aggtgcctat ctgccgcttg accccaccta tccgcctgag    240000
     cggctggctt ttatgctggc ggatgcgcaa gtgccgctgc tggtgacgac ctccacctca    240060
     gcgacccatc tgcctaaccc taccgcccag gtgatcaagt tggatgccga ttggccgacc    240120
     atttctcagg aaccggaaca caatcccagc agtgcggtta cggtcgaaaa cctagcctac    240180
     ttgatctata cctccggctc aactggcaca ccgaagggcg ttttggtgcc ccatgccgga    240240
     ttggtcaatc taaccgacga caagattcgc acctgccagg tgcgccccga tagtcgcgtc    240300
     ctgcaatttt tctcgctcag cttcgatgca tccgttcccg aaattgtcat gagtttgggt    240360
     tgtggtgctg ccctccatct agctccccca gaggatttgc taccagggcc gggactccta    240420
     aagctactgc gagaacaggc catcacccac atcaccgcac caccctctgc cctgaccgca    240480
     ttaccaccag cagacttacc cgcgctgcag atggtgttgg tgggcggcga agcgccatcg    240540
     ccggaactga ttgcccagtg gtcaaaagga cgactgttca tcaacgccta tggccccact    240600
     gaaaccaccg tcaacgccag catggtgcct tgtgaggctg gagcagaacc aaccctgcga    240660
     ccagcggcca acaagcagct ctatatcctt gatcgccatc tccaactctt gcccattggc    240720
     gtaccgggcg aattgtatat cggtggcatc ggcctagcac gaggctatct caatcggcct    240780
     gaaaaaacgg cagcagcctt tgtggatttt ggattgccgc ttttcgatgc tggattagat    240840
     acgggtcagt tattatctcc aaactccaaa atccctagcg cagcgcagca gagccatgcc    240900
     tttgaggcta taaatccaga atcaactcgt ttatacaaaa ccggcgacct agcctgctac    240960
     cgccgtgacg gtcatatcaa gctgctgggg cggctagatc atcaggtgaa gattcgaggc    241020
     tttcggattg aattgggcga aattgaagcc cgcctggctc aacatccggc ggttcaggag    241080
     agtgtggtga ttgtacgcga agatcaaccg ggcgaacgcc gcttggtggc ctatgttgca    241140
     accagctcag acccagcacc caccaccagt gagctacacc gttttgtcgc taaaaccctg    241200
     cccaaataca tggtgcctgc ggtcttcgtg cgactagagg ctctcccgct caatccaaat    241260
     ggcaaagtcg atcggcaggc gctacccgca ccggatacgt tgcggcctgc cctggccgag    241320
     acctttgtgg ctccccgtaa ttcgactgag acttgcctgg ttcaggtgtt tgctgacgtg    241380
     cttgaggtca agcaagtggg agttcacgat gacttctttg agttgggggg gcactctctg    241440
     ctagccacta agctgattgc tcggttgttg aaagattttc aaatcgagtt ggcgatcgca    241500
     gatttgttcg agtcccccac ggttgccggt ttggctgaac gcattgagtc gctgcggcag    241560
     gcatctggtt ctcaatcagc ctcccaggag gctacccatc aaactatcgc agcgttcctc    241620
     aaagctgaag ccgtcctcga ccccaccatt cgcccagcac ccggatcgag tcgggcgatc    241680
     gctccagcct gtggcatctt cttaactgga gccaccggat ttcttggcgc ttttctactc    241740
     gcggaactgc tgcaacaaac cactgccaaa atctattgtt tggttcgctc acactcgcaa    241800
     gcatcagccc aacacaagct gcaagctagc ctgacatcct atcagctctg gcatgatgcc    241860
     tggcaatctc gcattattcc catcgttggc gatttagctc aaccccgttt aggcctcact    241920
     gaatcgcagt ttcaggctct ggctcgtgat gctgacatga tttaccacag tggcgcatgg    241980
     gtacaccatg cctcgcccta ctccttgctc aaagccagca atgttttggg cactgaagaa    242040
     gtcctgcgat tggcctgtca taccaaggtc aagcccgtgc attttatgtc ggcaaccagc    242100
     gtttttgccc ccgctgacgt tgccaacccc caggtgatcc gagaacagga ggatattaca    242160
     aatcacgcac cgttgggcgg ctacaaccaa agcaaatggg tggccgagca tctggtagta    242220
     atggcgggcg atcgcggcct accagttgcg atttatcggt tgggccggat ctcgggtcac    242280
     agtcaaaccg gggtatttaa ccccaatgac tttttgtatc gtctgatcat cggctgtgtt    242340
     gagctgggct atgtcccgaa agacgcagag atgctgctcg acatgattcc agtggattac    242400
     gctagtcgtg ccattgctta cctctctcag cagcccagct ctcagacgca accgttccac    242460
     ctagttcatc cccagccggt ttcgtccagc attctattcg aggccctgag atcgcagggc    242520
     tacaccgttc agcagatttc cgaacagcac tggcggagca aactgctgca catcgccgaa    242580
     acctcgccca atcacccatt gtatccgctg attcccctac tgactgctcc cagtcaaccg    242640
     tctagtgaac cgtccctgga agctgtcctc cgattcgact gtcaaaacac cttgaatgga    242700
     ctagctaaaa gtgagatcgc atgtccaccc ctcgatcaat cgctcttaca cacttacttc    242760
     acctatctca gccagaacgg ctggctcaag caatctgaac ctcaaaccta acttattcct    242820
     tattcacaac caatttgcca aaaactatga cctcttctac ctcccgctac tccgactacg    242880
     atccctgggc ctggttatac aatcgctctg aggctcatct ggcccttcaa ggtctcatgc    242940
     cccttttgga caaattacta tttccccacc tgcctgaaaa cggccagatt ctagatgtgt    243000
     gctgcggcac ggggcaggtc tccaaacagc tgatccagca gggctatcag gttacagggc    243060
     tggatggttc ggagaagatg ctgcactacg cgcgtgagaa tgcaccccag ggtaaatttt    243120
     tgctggacga tgcccgctcc tttaccctgc catctacctt tgatgcggcg atttcaactg    243180
     actcctctct caaccacatt atgagtctag acgagctaca gcaggtattt caaaacgtgt    243240
     acgccgccct gaagcagggc ggacgtttcc tattcgactt gggtctggaa aatcgatatc    243300
     gcaatatcga ggtgaatgat ggggaactgc aagctgatta cgcctggacg gtgggagaaa    243360
     cttatgatgc agacaacaaa acgggcacgt ttacgatcac gctgtttcag cctgccgatt    243420
     ccgacgcatc ccccagcctg acaaactcgg acaagagatc gcattccatc ccccaacggc    243480
     tcaagcgctt tgtttacaat cgagtcctgc gcgtcctgcg tcccggcctt ttaccccagc    243540
     taattgataa gtattggcaa tctttaccca tgacctttac ggctaagccc tattctcaag    243600
     ctgaggtacg agctgctctg gaagtggtgg gattcaccca ggtcgaagtc tatgattttc    243660
     gggctaggag agccactcct caacggaaag attacgccta cttcctagcc caaaaaccca    243720
     gtggtcaagc ttaaatcatt gatattaggt aggggcaata gccattcatc cctactaggt    243780
     gatttcttga aaagaagccc cgtactaaat tggatgaatt aggatgtccc acttgggtaa    243840
     ctgaggatgt ctctccaatc gtttctcaat gcctttcatt gcttgtttag taagcgaaat    243900
     tcctgtttca taagtcttct gtgtcacagt tacaacgggg tgattcccct tccaagtcat    243960
     ggtgctagcc catcccaaca gggtatcaac atcggttaat aaggttccgt tccagtgttg    244020
     ctccaaaatc ccccaacatc gctcaatggg gttgtacttg ctgtgataag gcggatagta    244080
     caggagttga atagcggtgc cgatgtgatc gctaaatgcc accagtcgat tgaggaactg    244140
     agtgcgtacc ccactattct caggaccgtt atccaacttg atctggatga gctgcagggt    244200
     ttgctgttcg gtgggggcca gggtgttcca ccaatcctgg agattatcga ccataaaatc    244260
     gctcgttttg tgagaatggc caaaaatgat gtgtaatgta tcggtatcct cctctaggat    244320
     gccgcaggga atatattttg gcccactacc catatcgtga tcacaggctt tcgtttgggt    244380
     tcgagtcttg ccccgacgag aggactcccc tagttcaacg gtggctttgc aatcgatgct    244440
     caatcgtttg acggtaccgt catggtcttt caggtctttg tgtttgaggt tggcaaagac    244500
     ggcatcggtt tccggcagtt tttttggggt ttagctttga ggacacgacg gagtcgatag    244560
     cctaaccgat tcaagacgac ggccatggta ctctttgccg gtacagactt ggggggaaat    244620
     ccttgcgctc tcaagtgggt gatagcggca gccgctgtta agcgggtata ggcagttgag    244680
     ctggaaaagg tggggtcttg ttggcaatgg gcttctgcaa gctcccgtaa ggcggttgcg    244740
     acctctgggt gaaggtcttc ccaacgtttc ctgccacaga aacccgactg agcacccaca    244800
     caaatcatgc ctgttcgctt ctcacctaaa cctgttgcca ccgtatttcg accccagcca    244860
     aagataattt ctgtgagatt ggggttcccg tcacagtatt tgagggcgat gtctgcctgg    244920
     aaagcccggc ggcgggctcc tgtcattttc gaggaggcaa atttcagatc ttcaagttga    244980
     ttccaggtta attggtcacg catgctcaga gttagattca atgcatcact attacattct    245040
     gtgctcagaa gtatgtgagg tctttcctag aaatcgccct agatatccag aaagtacgtt    245100
     tcgcaaagaa aaaagtacgt tttacgaaga aaagctaggc tacatcctcc tatgatagtc    245160
     tcagatttac ttgagaataa ttctcgattg ctattagggt gatgtcatga cccagtctct    245220
     tttagactcc caatctaatc ctcagcaaag tcctcaattg gatcctcagc gtgcctattt    245280
     ggacaggttc attgtgcgtt acacccaacg aactcaaacc tccaaggcga ttgcccaatt    245340
     ctctcgttcc gtcctggccg atccgaggca atcggaatgg tttagtccaa ccaccaaaga    245400
     gctgtgctac ctggttgtgg gcgagcgatc gcagggatcg cgggtctggg atgtcaacgg    245460
     gaacgagtac attgacctaa ttatggggtt tggagccaac ctgctgggtc acaatccacc    245520
     attgattaaa gaggcattgc aggcacaact ggaaaaaggc atccagctcg gcccccaggc    245580
     cgaatatgcg ggtgaggtgg cggccttgat tagtgagctg acaggtttag agcgggtcgc    245640
     gtttagcaat acgggtacgg aagcggtgat gaccgcggtg cggctggcgc gagcggcaac    245700
     gcagcggact aaaattgccg tctttaccaa ttcctatcac ggtcacgccg atggggtctt    245760
     ggtagagcct ggatttcccc tgcccagcat tctacagcga ttgctggggg ggctcgtctc    245820
     ccgcttaaat gcccgcgctg tgccaatggc tccaggcatt cccaaggtga tcgctaaaaa    245880
     tgttttagtt ctagactacg gcaatccgga atcgctccaa gtgattaaag ctcatcgcca    245940
     tcagctagcc gccgtcttgg tggagcctgt tcagagtcag cagcccgact tacagcctaa    246000
     agcgtttctg catgacttgc ggtcaatcac ccaggattcc ggcattgcgc tgatctttga    246060
     cgaaatggtg acgggatttc gcctccactt aggaggagca caggcatggt ttggcgttga    246120
     agctgacatc gctacctatg gcaaggtggt aggtggtggc ctccccatcg gcgtgattgg    246180
     gggtaaagcc gcttatctcg acaagattga cggcggtcag tgggcctatg gcgatgactc    246240
     ctacccctca gtagagaaga ccttttttgc cggtacccac tgcaagcacc ccttatcaat    246300
     ggcagcggca cgggctttac tccaccatct caagcagcaa gggccgaccc tgcaagagca    246360
     attgaatcag cgcaccgctt gttttgtgga acagttcaat gcttttttag ccgtcaattc    246420
     tttgcctata caaatggctc attttggctc tttctttagt cccgtttttc gtcaagatgc    246480
     cagtccatgt acaatttccg cgctgatgcc ggggttcgaa ctgttgcgct accacctgct    246540
     tgatcggggc attttgctgc gcggtgaagg tggcggcttt ctatcaactg cccatacaga    246600
     tgacgacatc aatgctatca ctcaggcgat gaaagatagc atcgctgagc tacagtcagc    246660
     aggctttttt ccgacctcat gacgttccct gctttgcctc ccaggctcta tttagtcgtt    246720
     ccctgggatt taccgattca acacccacta gatgatgttt ataaagacaa actggagcga    246780
     tcgcttaaac agttcttgat tgccctagat caagattctg atcaagtggc tcaagcaatt    246840
     atcaatcggg aactttctcg tcttgatctc agctctgtct cccccattgc attaacctca    246900
     actcaaactg ctcttaagcc ctgcgaagtc gaagattttg atgcttactt tgaagtcaac    246960
     cacgtacaaa ctaacgaacc tgctacctgt atgatttgga gtctgctagt ttcctaccaa    247020
     gcatttttaa cactatgtca gcaaaaacat gacttttatc tggagcatat cacccagcaa    247080
     aaacagggat ttaggagcta tacaaactta ctatctagag tttttgatct caatttggag    247140
     tgaataataa ttcaattccc atgatcacga atgctactat cacgaatgct gatccccagc    247200
     aaatatggaa aaaatgccat tggctattct tcatcaacat tcagggacta attctttccc    247260
     tgcgtcgctt tgagcgaagt ctggctgcaa acaacttatc ccaagcccgt gtagagttgg    247320
     aaacggcgac tgatctgatg ctggcctctg gctcagcaat ggaattggca gggtgcctta    247380
     gtcaccaaga gtatgagcac caagttcggc caacaatggc tccacctcat gtcacgaccc    247440
     ctgactttag tggtctgatg tcgtgggaac atgccgccct tatcgagatt tggaagaagc    247500
     tgcgcccaac ctttgcaaac ctacctgact ctttttcagc tcagcatcag cagtttgttt    247560
     ccgcctattt cagcttatcc aatgcccaca gagcagtttg ccaaaagttt ggtggagatc    247620
     agatgggcag tttacgctgt gatcatataa ccgccgttca ggtcttggac aaatttacga    247680
     aaaatcgctg gaagttaatt gaccccaagc gcaaaaccgc tccaggttgc ccatttcgct    247740
     aggtaagggg agtttgctac atgaaagatg tgggtttgat gaacacgcta atcgcaatcc    247800
     tgactgattt gggagttcct aaagattgtc tgcattctga agcacgatta cataaggatc    247860
     tgcaactgga ttcgactgaa atcgttgaaa tttctttggc gctcaagcgc cgattagatg    247920
     tgcgagtcaa gctagaaggt cggcaagata tgactttggc tcaggtctgt gatcggatcg    247980
     aagtggctca gcttactaat tcaaattcag ctcatggttc ttgacgtgca gggaaaattg    248040
     gagtgcttag cacggaatgt tgatgttcag tatggagaca tcaaaggtgt gggtatagat    248100
     attgtgtcag ttgcccaaat tgcaaactta gttgagcaat ttgactgcca atctttggct    248160
     ctgcttttca ctccaaatga gttggattgg tgccaatcgg cagggattga aaaagaagag    248220
     cgaaaccgcg ctttcgctct ctgttttgcc accaaagaag ctgtttccaa agcgctcaca    248280
     actggtttag ttggcatcga atggactgac attgaagctt actttgaagc cgataaaatt    248340
     cataacccga tcaccgtgat gctatctggt gcagctaggg tccacgctcg gaatcatcat    248400
     atccagtgct ggcaggtgaa ctggtgggaa tgggatgggc acgtcatggt tcatgtcttg    248460
     agtttcctaa gggaataagg aaaatcatat gggatgcatt tctgcacaat taccggatat    248520
     ttttaatgtg gcggcctatt tcctcgatgg cgaggtcgcc caggaaaata gtgagcgaat    248580
     tgccctgttt tatcaagaag aaacctacac ctacggccag ctccagcagt gggtacagcg    248640
     ggcagcgaga tcgctgctta tggcgggtat tgaacgagaa aaccggattg ctctgctcct    248700
     gccggattcc cctgaactcg tgtttgcctt ttggggagcc atctggatgg gggcggttcc    248760
     tgtgccaatc aatactgcct gtagtgtcga tgaagttcga tatatcttac aggactcgcg    248820
     agccaaactg ttggtgacaa ccgaagactg gcaggctaag ttatccccca ttacatcgcc    248880
     ctttttgcag catacgtggt taaacactgg agaaactccc ttgttatccc aattagagca    248940
     gttgccggca actgcgatca cagccgctac gtctcgcgat gaacctgcct tctggcttta    249000
     tacctccggc agcaccggca agcccaaagg cgtgattcat ctgcatcaaa gtatggtggt    249060
     ctgtgtagaa cactatgcca aaacgacctt aggactccgc cgcgacgaca ttacctattc    249120
     agtggcgaac attccctttg cttatggatt aggcaacaca ctttatatgc cgctggctgt    249180
     gggggcagca acggtgctat ccgacgccat caatgccttc gacatcgtgg ccgacattca    249240
     gcgctaccaa cccaccgtat tcttcggcat tcccagcgta tacgccaacc tcctcgccat    249300
     ccatgagatc gaaccgctta acccggctgg tttgcgtctc tgtgtctcgg cagcagagca    249360
     actgcctgaa agtctctggt atcaatggcg ggcaacgcat aaccaagaga tttacgaagg    249420
     gattggcacc acagagtttt tgcatatctt cctttccaat caacccggag cttgcaaacc    249480
     agggacctcg ggacggcccg ttgctggcta tgatgtgcgg gtggtggacg atgagggaca    249540
     ctcttgtgca gtggcggaaa tcggcaacct agtggtcgga ggagagagcc tgatgggggg    249600
     ctactggaat catctgcaag caacccgaca ggcgattcat gggagcacaa tgcacacagg    249660
     agataaatat cagtgcgatg ccgagggcta tttcaaattt atgggacgta aggacgacct    249720
     gtttaaggtg aatggccagt gggtttcgcc gatggaaatt gaggatgtgt tgcaccagca    249780
     tccccaggta ctagaggtag ctgtgttgcc tgaatcccag gcggaggaac ggcttaccca    249840
     ggtgatcgcc tacattactc tcaaagccgg aaaccctcca tccccagaat tagaaaccca    249900
     aatctgtcgg tttgctaaac agcatctgcc ccattttaag gcgcctaaaa ctgttcagtt    249960
     tgtggatgcc ttaccgcgca cgccaaccgg aaaaattcat cgcaaatcgc tgggtgttgt    250020
     gcattcgtaa cgtcagcacc tcgaaacatt taaacctatt gcaaggagat attgatggtt    250080
     acagaattgc acccaacaat cacctatcag gaaacatttg ttccaggaaa aagaagcgag    250140
     atcgcaactc taaaatcctg tttggatgca ggactctttt ccaattacat gctatacaag    250200
     aaagatggcg acgttcgcat tgcagggaat gaactggcga ctatatcagt cagtccagat    250260
     gtcattcagc tccagagtca ggggcagtcg catactgaac ccgccaccga tccttttcag    250320
     caagttggcg cattactaaa gacattagca attaaaaatt ggacagccta tggctatgtt    250380
     gctttcgata tggccagatt ctattcctcc tattccaaat cgatacagca gccgctgctt    250440
     cactttctag taccagaaac cgaactgcaa tttacccatg caggggttca tgttaagcgg    250500
     gtaggcttac tcgatccact gctaaagatt ttggaaagcg atcgctccct cgctgattac    250560
     cagccaattc cgctggagca agatgctgct gattgcgagc cctattccca caaaatcaag    250620
     actctaatcg cggccatcca acagaatgaa ttgcacaaag ccattatctc tcgttcaaaa    250680
     aagctgactg gtgatttaga tttaatcggc acctatgctg tgggagtaaa gaacaataat    250740
     tcggctcgtt cctattgctt taagctggca gatgtaggtg ctgtaggctt tagccctgag    250800
     attttgatgg aggtcaatca ggcgggaatg ctagtgacca atcccctggc tgctactcgc    250860
     cctcgtggaa aagatcatga ggcagatcag cagttagaga acgagctatt tactgatgca    250920
     aaagaggtca aagaacatgc gctttctatt tggcttgctc aaagtgaatt agactctgtc    250980
     tgcatacctc agacggtgaa agtgtttaac tttatggaag tcaaaaagta tcggtgtgta    251040
     cagcacttgt cctcgcgagt aggcggacaa ctgcaaacag gtaaaacgct ttgggatgcc    251100
     ttgaaagtta tatttccggg ggtcactgtg acgggcatta ataaatctca ggcactcgat    251160
     tggatcgacc agctagagag tgagccacgc ggtatttatg caggtggtat tggttgggtg    251220
     gacagcaagg gaatggcgga tttagcgata gcaattcgct cggtctatca gtattgcaac    251280
     accatctgcc ttaacgctgg agccggaatc gtggctgaat ccaatacgca aaacgagtat    251340
     gtggaatcag tcaacaaaat gaacacaatg ctgaccagtt tagtcttgaa atgactgact    251400
     gaaatgaacc agccaactca tcagcatgaa gctccctatc gacagggctt acatattgtc    251460
     aaaactgctt ggattgaagc ttgcttagct caatcaggtg agcagtttga acagcagtac    251520
     ttttccatcg cagaacggca tcggacccag atccgagcgc cctatgctca atatctggcg    251580
     ggccgttttg ctgccaaagc cacaatccta caaattctcc acattcaact tgagaccttt    251640
     gatcgatggc acgacattga gattaaaaat tggcctcatg gtgaaccctt tgtgacgctt    251700
     gatggctact gtcaaaaatt ggccgccgat cttcacctta acaactggct actgagcatc    251760
     agccatatat caacctatgc agcagccagt gtgatcgcac ggctaaaaag tccgtttcac    251820
     aaagaaaaaa gtccgtttcg ctaagaaatt ggcagagtgt aatgattaca cttgatagat    251880
     cgctttgata aatctttcgc ctatagtctc cctgtgaatt tcatccgccc tcaactcttt    251940
     aatgactgtc aaatttgttc agtcatttct aaatccaatg gtgaagatcc tattgggagt    252000
     gctcatccct gtgatatctg gataatggtc gagatttcat tgccttggac agaagaacgg    252060
     ttgatgacgg aaccgattct aagacaactt taccagttgt ttcatgacta ctacgatgcc    252120
     gatgaacaac catttcagat gatgccaatg gttattgcgc ctgaccataa ctattctgtt    252180
     cccgagtaca cgcgtgtctt gcttttccag cgcccagctc cattctttgc ccagttcaac    252240
     aaacaggaat tcctccttcc ttttgagcag cttccccatt tgatgcaaac cgctctcacc    252300
     cagcccagca atctcaaaac ttttgactgc tataaacagc cgacttcgtt gacccgcgat    252360
     ctctttgttt gtacccacgg aaatgtcgat gtggcctgcg cccgctttgg tactccagtc    252420
     tattttgaac ttcgaaaata ttgtgggaaa accgaaggcg atggaaaatt ttctctaaaa    252480
     tccaaaatcc aaaatccaaa atctttctac tccccacctt cctctaactc ctccaccctc    252540
     cgtgtctggc gctgttctca ttttggtggc catcagtttg cgccaaccct ggtggacttg    252600
     cctactggcc aagtctgggg acatctggag atggagatgc tcgacacgct aatacagcgg    252660
     catcgtcccg ttacggaatt gcggcgattt tatcggggct ggtcaggtct gcctcagtat    252720
     gcccaaattt tggaacgtga agtctggatg cagcagggat gggactggct ggcttacaac    252780
     aaattggggc acatcatggc tcaagatact gatcatgaaa aatgggacgc ggactgggcc    252840
     gacgtgcgcc tagagtttgc ctcgccggat ggtctcgtta aaggagcgta tgaggcaagg    252900
     gtggaagtga ctggttcagt attgacagtc tggaattccg gtgagaagcc ggaagcggtg    252960
     aagcagtaca gcatcaacca gttaatctgt gttgcgtagc aatgggttaa ttctagcgtg    253020
     cgtactttca tctttctctg gctaggacaa ctgtcttctt cggttggcag cagcatgacc    253080
     tattttgcgc tcaacctttg gatatggcag caaactcagt cggcaacatc gattgctctc    253140
     atcttagtct tttatcaatt gcctcaaatt gtgatcgctc ccctttctgg tctgctggca    253200
     gatcgtgttt ctcgtaaacg cctgctgatt tttagcgata cggcatccgc ttactgcacc    253260
     cttgccgtgg gcatactggc cgctttccaa attctgaagc tttggcatgt ctacctgatt    253320
     gcggcagcga ttggctgctt tgggaacatt caagcactca cctattcaac tctgattccc    253380
     ctgattgtcc acaaacagca tcatacgcgg gctagtagca tgggagccat ggtgggttat    253440
     ggagccgata ttttttcccc tgccctcgct ggactcctgt atccactcat tggactccta    253500
     ggaattacct tgattgacat gagtacattt gcgatcgcga tttttaccct agtgttagtg    253560
     ccaattccag caatcgagaa agttaacaaa cataacgacg aacaacgatt ggctttccca    253620
     agtgttgagg gagcaaaacg gaaaatttgg cgtgaagtga cgtttgggtt tcgctacatt    253680
     gcctcacaac caagcttatt aacaatggtt atcaccattt ccatcttcgc ttttctccat    253740
     cagcttggtg aaacgctcta tcaaccgatg attttagccc gcacgggtgg caacactcag    253800
     gtcttaggct tgatcgtcgc tgcctccgga ctcggaggag tgttcggggc aattatcttg    253860
     agtatttggg gtgggttccg gcggcgaata tctggcatat tggtcggatt tattggaaca    253920
     ggcgtgagca atctcattct gggacttgga catttccctg gactctgggc ggtggctcgg    253980
     tttgggtcat cactccataa tccactcgtt atgagttctt acatggctgt ctggtatgcc    254040
     aaaattgccc cagaacacca aggacgtatc ttcgctgctg actatctggt gggaattgtg    254100
     attgaatcta ctgcgggttt gagtgcgggg ttattagctg atcgcttact cgaacctgcc    254160
     ctgcagtctg gtgaatggat ggctttacat ttagggggat ggattggaac aggccccgga    254220
     agtggtatgg cattgttaat cacgatgagc gggatgggta cggtactgat tggcattata    254280
     ggattcaaga ttccacagtt gcgagatgtc gaaacactct tagccgacca tgactctatt    254340
     ggggataaac acactgctac taattaattc ctggtatatg gggtcgctct tcatggatta    254400
     cagggattaa cttgagaaat attctaaaag agctggaagt agccctttcc cccccctgat    254460
     agaggacttg gttgggacgt aatcgtaaga gttggttaaa aggtgtctct gacccctatt    254520
     tgagaaagtg ggcatagcta tactatctgc caaaaagtaa atcggacccg ccagatggac    254580
     gcatacttgc tgctgttgag tagcagtttt ctctagtgga gtctcaaaac tggtgatgcg    254640
     ttcacagcta agggcaatgc ccaactctct tgggctttag gaatccaggt aatgctgctg    254700
     tacccttacc caaagcgaca gtgtactaac aagccgattt agactctgtt cgaaaacttg    254760
     aaagcattat atagaaagtc tttcaaactt catctaagct ccaattccag attttgagga    254820
     tgaaatctgg aattaaaatc gccaatcgaa tttagtcacc tgcctgtatg atttggtgat    254880
     atgtgtcagc acgagatcca gttaggaaaa aggttatcga gcgaacctgg aacaacctaa    254940
     ccagcgtgtc tggctggtaa gcgggcttgt tgctcattcc tactattctc taacttatgg    255000
     atctatttgg gataacaatt attatccgtt ttgcttgcaa aatttactaa tgcaagtaca    255060
     attggctgag ttgaaccaca acgatgtggt tcataagaag actttcagaa ccagcaatct    255120
     agttcagtga caaaattagt taattgagat tcagatggca aaaatacttg cgttttttaa    255180
     ccacgcagga ggggtgggta aaactacctt agtacaacag gttggttatc atctttctca    255240
     atgcaagaga agagtaaagg gtaaacgaag tagaaaaaag ggtgactact atcgaatact    255300
     gcttgttgat atggaccctc aagcttcatt aacaacattt atggggattg aaccctacga    255360
     tcaagagaaa actatatata atgccattct caaagacgaa gaattaccta ttctaaatgc    255420
     tttgtatgca ggtcagggaa tggaggatag caatggattg gatctggtgg catcaaattt    255480
     gggcttagct atagctgagc aagaactaat gacagcagtt atgaaagact ttaggctgag    255540
     ggactcatta gaaccaatta aagaagaata tgattttata ttgattgact gcccgccaag    255600
     tcttggcaac ctaacttata tctctcttgt agctgctact cacttacttg tacccattca    255660
     atctcagtac aaggcattta agggtgtcca gcccctcttt gacactgtta gattggtctc    255720
     tgcccgtcct aataagtcac tcaaaattgc tggttttatt cctacgatgt atgaccaaag    255780
     aaattctcat gatgaaagaa cattagctgc aattcagcaa caactaacac ctgtagccaa    255840
     agttttttct ccgattccaa gaactactac atttgctgat gcatccgaag aaaatcttcc    255900
     acttgcattg tttgataaca agcatcctgc cttggaaccc atcaaagtac ttgcagaaca    255960
     gttagagagt ttagcgctat gactagtaaa cgtgataaag cgtatggtgc aactattgat    256020
     cttagccgtt tgtatggaag ttctttagag tcactcgata atgatgtaga tcaagaaagc    256080
     gacaagatag ctgtaattcc aatagataag attaagcgta ctccagatca agtaagaaga    256140
     tactttgatc ccatgaaaat gaatcaattg gtttcttctg tcagaattga tggaatactt    256200
     gagaatctca tcgtttcatc attaaatgat ggtaaatttc aacttatttc tggagaacgc    256260
     agacttcggg ctgcgaaaga agttgggcta actgaagttc ctgtaaaaat tctgaacctt    256320
     gatgagtttg atgcatttag aattagccta attgaaaatc ttcagagaga agatcttaat    256380
     ccagttgaag agacggatgg aattattaaa ctactagctg gagagctgca cttaagggag    256440
     gatgaagttg tttcgctcct ttatcaaatg cagaatagcc tcactagaca agttgtgaac    256500
     cacaacgttg tggttcagga gaatcaagag actgtagaaa aaatattcaa ctacttgggg    256560
     cggttgagtt ggcaatcttt cgtcaagcat cggttaccac tgagaaaact tcctgtagat    256620
     atcttggaat tcttacgaca agggaagttg gcatatacga aagctcagtt aattgcacga    256680
     atcaaagacc aagaattccg aaaagaaatg ttaaatgtag ctgtcacaga agaattatcc    256740
     ttaagtgaga taaggacaag aatctcggag tttgcacaaa aagagatttc aaacaatcct    256800
     gatattgaca ctgaattgag aaagaaaact gctgggtgtc tcaaggcatt gaaaaagtca    256860
     aaggctataa attcacctac caagcagaag aagttaagga aaatactaga gcagttagag    256920
     aagctattgg agtcatagta cttatttttt tactgataaa ggagtctcta ttggagcaac    256980
     cgattacctt gccctcatac ccatagcaac gatgtagatg aggaaaatgt taatctatga    257040
     attttaatga ccctccagta caagcagcga ttattggtgg cggttgtaca ataattagct    257100
     ctctaattgc tgcgatcgca gccagtatca tcgggaagaa aattgctgat ggaggtaaac    257160
     tttcaaaatt actaagtatg gcaattaaag atatcgaatt cttgttagaa gtcgaaaagt    257220
     tgcattgtgg ttgccctccc aaagggtggc gaggaaagtg agaatatgca ttgtgaaaga    257280
     aataaatcac gagaaggaaa gtatctgaag aaatttaccc gtgatgaagt taggttgcct    257340
     tcccaaaggg tggcgaagaa agtgagaata tgcagttaga aaaaatggat ataaattttc    257400
     tagtaaactc acaccaggaa gagctaaatc cttattaatg aagttgtaat ctctaactta    257460
     aactattcat tcttgtttac tgtttacccc gtctatattc ccacggcata actggattac    257520
     tctggctcca aaagttaagc cgctgcgttc tcgcctcttc ctcagcagca atatactgat    257580
     cctcactctc agaacaccca tccaagtatc ggtggtagac cacggcataa ccttcccgta    257640
     caagctgaag tcctaccgat gtccccccgg aatagatttc tgccactgtg cgctcatggc    257700
     ccaattgaag ggttgctgac accaggggca atcaaaccaa atcacccctc aaaacagggc    257760
     aaatttaccg ctaatcaata agttttgctt aagtattttt tgtcgctgta ctactcgata    257820
     ttggagcaaa ggttgccttg tggagatggg ccccaactca gcaacctcat tacagctact    257880
     ccctacgcag ccaagttttc aatcaccaga cgctcattca tgttgaggcg gaaacgtcca    257940
     taaggattga tatgaaggta aaacaacggc gttaacgccc tcaaatcttc ttcctgcata    258000
     cgattcatcc acgtgggttc agaaagtact ttttgaatca ttagaatatt gatgtaaacc    258060
     aggctgattt gcagtaggtg caggcaaagc atggacagct cttgcatcgc cgtttgatta    258120
     ctggcaaagt caccattctt gccatagaag atgaagtcat tggcactatt ccaattttca    258180
     atcacattca aaccttcatt gatctcttgc cgtaaggctt catcgtgcaa atactggcac    258240
     aggaaaatgg tcttgatagc tcggcctaat tcagccaaag caagataggt ggggtgctta    258300
     atgttgttgc gagtgaaccg actcagaatc gcttcaggtt cggcggtccc ttgcttcatt    258360
     gcggtggtga actggatcat tggctcatat tgctcccgca ccagatccca acgcatgggg    258420
     cgcttcacaa tcgccttgag atagacatac ttcttcttct gcccggacat cggtaaatag    258480
     agcttctgct tgttgatgcc cttgaagcgg ggcatcagct gaaagttcag caaatagcaa    258540
     aaggcaaacc ccacctcgct ttggccatgg gtatccacat agcttttatt cacggacatt    258600
     tgcgtacagt ggcgaagtac gcccttcacc ataaaggcca cctccgagga agaacacttc    258660
     ttcagttgcg agtagataca cacggatttt ttctcgacat ggttaaccta agccggagga    258720
     tcactcctcc gacttggctt caaaaccgtg cgtaaatctt tcgatttaca cggctcctca    258780
     gtggcttggt gcttgtcata cataccattt ggcctgagag gacttctcct tggccgtttt    258840
     aacataatga caatgtctgt gtagtagttg aagattcttg tatacgtcca atcctcccat    258900
     tgatgtaggg agaatgtgat ccacttcaag taaatcttct tctcggaaga acatgccgca    258960
     ctgagcgcat ttccccttct gcttcttcaa gagcatagat actctcttcg gagcttctgg    259020
     atgcttccca gtccttgaac tccagtaaac tagattgcca ttgtagggac ttgcatcccc    259080
     cttgactttg acatggcgga taattggagt ctgtcgatgt ttgagtaatt tttcggttct    259140
     agatttagtt actctagtcg cgaagaccca tttatctccc ccgacagttt gccaatattt    259200
     attcaccacc catttcctgg atttgccagg atggcggtgg ttagcccatg tttgaagctt    259260
     ttgatacagt aaatggtcta gacgggagaa ggtctcttta ctagccatgg tcgaataata    259320
     tctcgtccat cctctaatca cgggattgag gtggcggatt aatgccgctt gcggcgctgc    259380
     cttatgggcg ttgatgatac taacgagccg attgtaatgt actttttgct tctttcgact    259440
     gggggtaatg atggtcttaa atcccagcaa tgtcccgcat aatctccccg attgatgttg    259500
     accgaccggg aattgtctaa ctgagaatcc tagaaaatca aatccagggt tttcagcttc    259560
     ataccttttg agagtatggg atatatgcgt tttgctaggt tttagttcca accccatgtc    259620
     ttttagccac tcatgaacta agctctgaca tctttgaact acggataaat cctcgtgaag    259680
     aatcacgaag tcatcacagt atcgaatgac atcaggagta gcaattcttt ttcgcttatt    259740
     cccgtcggca atctttctga taggaaaggc ttgcttgatt cgatactcta ggccatggag    259800
     ggctacattt gccaacaaag gagagatagt ccccccttga ggtgctcctt cagatgtctg    259860
     taagaactga tgaccatcaa ttaccccagc ttttagccaa gtttttattt gtcggcgtag    259920
     agtgggaaag gtcttcagct ttttgagcag tgcttcgtgg tttattcggt caaaacattg    259980
     ggctatatca gcgtccaaca catattttgc tttctgttta atggctgcaa aaatttgttc    260040
     tatcgcgtca tgacatgaac ggcctggtct tgaaccatag gagtttggtt cgaaaaccgc    260100
     ttcccattca ggttccaggg ctagtttgac tagtgtcatt cttgcccttt catacagggt    260160
     cggtataccc aaaggacgtt gttcgtcttt tcctggttta ggaatccaca cccgtctggt    260220
     gggaggggcc tttgagccga gtttaagttg acccactagg ggcagacgag cttctgggga    260280
     cagagattta actccatcca cacctgccgt cttttttccc tggttgtctt gtgtgacccg    260340
     tctaactgaa aggcatttgg ctgaccagga cctcatcaga gttttctgga gtctatgtac    260400
     tactttgaca tcgccacgtt gtctggctct gaatatgcgc ttttgcaact taaacacttt    260460
     ccgctctagt tttggccagg ggattgcgct ccattccatc atcggtttga cccgtgcttt    260520
     agacatattt attgctactt gttcctattc attccaagtc accgtgagtc tgtctgctta    260580
     tcctcaccat tacagtgggg cttttgcttt tgacccaatc cttcccaccg cctaacttct    260640
     ggttagcacc tactcttagc caatcgacct ccaagagaga taggcggggg ttacttcgtt    260700
     cctaatagcc attgattgaa ctgttagagt gatgcgctcc accgggttta ttggaagtgc    260760
     taactggtcg ctactggaca cgccagctcc gtatatcctt gcccttttgg gactcccagc    260820
     gttatcaacc taatttcgct ggttaatgat tacggtgggt taaccacatc ttcgctttcg    260880
     ctactcataa gttcttgctc gaaggggttc agagctaggc tccctgttac ctcctttttt    260940
     ccccgcttca ggcgttgatg gctagtcgcg aacctggggg aaatgctgtc accgctgcac    261000
     ctgcgggata ggactagagc ggtctaggat actgactctc acctatatgg ctattaagtt    261060
     gtcaaggtac agttgggata ttttcccctt ctttacgctt gcggctaatc ccctcaaacc    261120
     ctattcaggt ctagtttcta gccaacgaat cgcacccagt agatcatcac accccggccg    261180
     ccatagcgaa catgccattc cgtcatcaaa ttctggtccc aagattcaaa gtgccgagaa    261240
     tcagacgcac aagccgtggt ggcttccccc cagatatgag aaaggcgaat ccggaaaatc    261300
     gcattggcca catccgtaat cgcacagctg agagctgtct tgcttaaaaa cttgcgtcgg    261360
     acataatgca attcaaagta tcctgcatcg gcttctgaat gagcgatgcg cttaattcct    261420
     aaattggtgc ccagtccgta aatacacaac agtaggcgct tgcgcaggga ctgggggctc    261480
     aatatttcac gactagccgc actcttgaaa tgctgggtga aatcaatccg aaagtctgcc    261540
     tctttgagga cgtccaacaa atgcgttaat gaccaccgct ggttgatctc ttccttgagc    261600
     ttgtgaatgt tcatgggttc cggttgagcc tcaagcgggg ataccttaat tcgtcctcca    261660
     cgcttactca agatctcaac tttggagttg tgaggcatcc cctgatttaa acgggtcaag    261720
     gcgttttcca tatcagcctg gatttgagcg atgaaggttt ccacctctag gggctgttgt    261780
     agatcctggt aatattcctc tcgccgctcg tcaaagtctt ggggtaaatc caggtcgggg    261840
     tttcgatagc gattggcacc ggcgacccaa atttccttac accgtagttt ctctcgcagg    261900
     gccctgagga cgcacatctc ataggcgatg cgatctactt tgtctggctg gtcttcatcc    261960
     tgacccaata ccgtctcttg ccagtctgca ctaacgaccc cttcgatggg aacgtcgtct    262020
     gctgaggcat aaggttttcg gggggtgtcc acataggctt tgagtaaatc cacagcctgg    262080
     aggatgggct ggtattgctt gttattgcac cgaaagtcaa tcacttccag taccgcagga    262140
     agcatttgcc gataatgatg accgtaggaa gaacggatcc tcgagtgtag aagttgtcgg    262200
     taagtctgac cgccatcatt gtaggagtca acaaatgctt ccagagtttg ctcactagca    262260
     acggggtaga taacatttct gaccaagcca tctggtgtgg ccagggctgc ggtggccacc    262320
     tgataaaaca gctgggtatg agagtcggtt tttttgactt tagcgatcac ctctgacgtc    262380
     actttattct tgctgcgtgt atcaatgcga tgaacgatct gaatcaataa atccatgatg    262440
     ttgtcgataa tctcttggca ccgctgccaa cagaaactcg cgagtaaggt gagtcggatg    262500
     gttttggggt gatgcctcaa ctctgataag gtttctgtct ccactcggag ccgataacac    262560
     tccagaactc gtggggtcag atgagaaaac aaggtatctg gcaaagccac ttggcggagg    262620
     cgttggagct tgatgatttc tgaaagcagg ctattgagac ccacgggtcc aggatctttt    262680
     tttaaggcac tcaggggcgg atctggtatc tctttacccg gcgtcacttt gggttcttgg    262740
     atcaattcat caagctcagt ctgagtttgc ttggacagct gcttgagggt tgaggaaaaa    262800
     agctgacgct caaaccgacg ctgagcggac cggattaaac gctcaattct agcaggggtg    262860
     ggtggttcaa tctgaagagt acgcagttga gcatagactt tcaatttcag atgatggtaa    262920
     tcctgctctt gactcaggac tgtatcgact aaccaagtac gtagctgatt ttgatctgaa    262980
     agagtggctt gtcgaaatcc agtaaattgg cgaatctggg cccggtgata tttaacgact    263040
     ctccctcgcc acttatagtc ttgaaactgc tctggcggca agtctaactg ctctgccaca    263100
     aaagttatcg ccatgcgagg aatctcatac ttctgttcgg ggaaacgtcc ttcatattgg    263160
     aaaaatttaa gcagcaggac aaatcctaaa agagtaacgc ctttacgcct agccaataga    263220
     tgtgcttcat cgggctggat ggaccaatgc tcaatcagct cttctggatg ccatttccgt    263280
     ttcatgcgat tacgctccta ttaaaagtga attcactaga gcgtaaggca agctaatgta    263340
     ctataaataa aacttatgat ttaagagtag tgtaagtcga tggtatttac acttcttaat    263400
     gcctgtaact attactgaga aagggttgta gctttcgttg ccccaggtgt cagcaaccct    263460
     tcaattgggc cttgatgtcg atttgcttag agcaatcttg gtggagaaaa ccaaaccctc    263520
     cacgcgggaa gggtatacca aggatctggt ggacttcttt ttattcgtga cccaagggga    263580
     aatggtctat ggagttgagg gaccgaagcg aaaaagtgag ataaaggcgc aggtgaagag    263640
     ggaattatct aggctgagtc aatcctttgt ggggattggc agactgaagg ctttagaatt    263700
     agccgctcgg tatcgagaat gcatgatgca gcgagggtta caagcgaata ctatcaatcg    263760
     gcggttgtcc gcagtgaagt ccatggtgcg gatggcccgt cgtttagaga tgtgtgattg    263820
     gactttggcg gaagttgatg gtttaacggt gaaaccttat cgagatacca gagggattac    263880
     agcctctaaa tttcgactga tgatggttat tggatgtcaa ccccataggc gatgtcgcga    263940
     caaccacaag gcggatcaac ccccaaattt gaaccgtatt atttggcgta cactcccttt    264000
     gcgttagctc tttttcagac ctcatacgat accttcagaa caaaacgaca acccgtgatc    264060
     gaaatgacaa ccagtgatcg ctcgattatt tggactggga tttttgaggt ggagactgag    264120
     tttgagccgt tctctgagtc gctgatttgc gccgataact atcggcttga atttcgataa    264180
     tcaagccatg atgaattaag cgatcaatgg cagccaccgc catcatcgaa tcagtgaaaa    264240
     tgtcatccca ttggctgaag ggttgattcg ctgtaatcaa caaacttttt cgttcatagc    264300
     gatgcgcaat taattcaaac agaacggacg tttccgcttc cgactttttg caatagccca    264360
     agtcatccaa gatcaacaga tcatagcggt ccagtttttt gagcattgga tgcagctgca    264420
     gttggagctt cgcctgttgc agttgctgga ccaatgcgtt ggctgcaaag aacttcaccc    264480
     gcttaccgaa ttccagcatc tttttggaca ccccagtggc cagatgtgtt tttccaacac    264540
     ccgagggccc cagaataagg caattctcgg cgcgctccaa ccaacccgga tctgcggcta    264600
     attgcatcaa gggagctgga ttgagctggg gacaatggct aaagtcaaag ttggtaaaac    264660
     tttttgcgtt tgggagcctg gcttcggtga gggcacgttt tagacgagct tgttctcttc    264720
     gttgggcctc cgtttcgcac aaggctagta agaattccgc ataagaccag ttttcctgca    264780
     tggcttggga ttcgatagat tcccaatggg tcaacatgtg ggagagcctg agctttttta    264840
     aatagaggct caggtgctgg taggggctca gcggggactg agcaggaggg gaggagtttg    264900
     tcataaagtt caagtgaatg ttgttcaatg ctgaggtcag gaacctgctt catctgaggc    264960
     ggctcaaact gttttttcag gcgattgagg gtaaggctgg atgagcgaag ctgctgctgt    265020
     aagtacactg ctacggcctg ttctttatct tgaaccgcag caatatacag ggcttccacg    265080
     atgatcttgg cagcctgctc taggtcaaat tgggctttga gctgttccca gatttggcgg    265140
     tattcaggat tgggaagtag gtctgattgc caggtgcaat agataaaagc acgaggcttc    265200
     aatcgcattg aaccaataac atggcgatag ttgatgcaac ggtcgcgacg tttgcctttg    265260
     ccactgacgc gcttcctcgg caattccacc accgggtgtc gctccagata gccgacaatc    265320
     cggtcatggt atagatgcag ttccaattga cgaccaatca gtcgagaagg gacggtgtat    265380
     agaatgcagc gaacatcgat ggtgctgcgt ttgctgactt tagccgtgag cacttcatag    265440
     tcaggggttc gatatttggg cagtggttgt agatggtctt tctcttgctc atacttggtt    265500
     tggcactgct gattcaactt ggcaacctgt gcatcaatta aggcttgata ctcagcaacg    265560
     ctcgtaaaat ctgcactgcc gcgcagatag atcgcctgct taattcggtt cttcagatga    265620
     ccatggggag attcaatgga gccattctca tgggctacac ctttgttgtt acgagtgggt    265680
     tctagccgat agtggtcaca cagttcgtcg tacagacgag tgaggttttt ggaccggcgg    265740
     ccgcccatgt tgcgataggc tgcactcaaa ctatcagtac gatgctgtgt aggaacacct    265800
     ccacaggctg caaaggcatt ttgcaatcct tctgagaggg cgacaaagct ttcgcctcct    265860
     tcgatgatct gggcatatcg ccagccgctg tatcccagac ggtaatggta aatcaggtgc    265920
     tcaaagggtt tgccggcaat ggtaatcgtg atgcccttga gttctgtaaa gtcggaaaac    265980
     ccttgtaccc cgggttcatg acgcaattca aacatcactt cagggcttgg tccatgtaag    266040
     gctttccacg ttctcacccg acgttgtagg gtccgcagga cttggggata ctggcctgga    266100
     tacttatcct gcaggtactc atacagggtc atgggtttga ggcgtgggtc tcgacgcagc    266160
     attggttcta gctcgtcttc ccacacatca gctaaggggt cgggaacggt gcgttggtcc    266220
     tgaaggcggc cgcgattagg ttgatgggtg ccggcctcaa ttcgttgtcc ggttcttgta    266280
     gatatttcgg caatgtaagc tgcttcagct tgtttcaagc cgaggtctct tccgttcata    266340
     taaacacgag tatgatagga atcaattctt ttgttaggca cttgtacagc cctctattga    266400
     ttagggatgt aaaaagtgtc ttttttcttg agattgaatt ctagaaacgc gatctcacac    266460
     atcatttcta gggaattgag atctagtttt atccttctca ggggatgcct ggtttcttca    266520
     tagctatagc cgacgtgaca tcgtcattaa tccgtcagct cgattgtcgt ctaatagatg    266580
     gtattcatca atcggttttc cctagctggg gctcgggatt tcgccatgat gacgctactc    266640
     tgggaggcgg gattgcgacg gtctgagcta gtgggctgtg atgtccgtca ttttgactcg    266700
     gagcaaaaac gtttgtcgat tttagggaaa ggaaggaatg aaagggagtg gattgatttg    266760
     acggaaagtg gggtacgagc catatcagag tggctggaac tgcgagaagt ttatggcctc    266820
     acggagccgt tgtttatctc gttggatcgg gcgaattggg ggtcgcggtt gtcggggaca    266880
     tcggtgtatc ggattgtccg ggctctagca aagaaggctg gggtgagcga gaactttggg    266940
     cctcataaga tacgtcacag cggcacaaca acttatttgg aaatgacggg tggagatttg    267000
     cggggggcac aagcctattc ccgacatgcc aatctcaata cactcaagtt ctatgatgac    267060
     aatcgcaagc agcttcagaa gaaggcttct gcaaaattgg ctgagaagat tacttggaat    267120
     caaacctcag attaatatta ctgcaaccag tttagttatg aagatgctaa gtctatagaa    267180
     aaatcatctg gcctgaaatc cctacaccaa gcttgctttg agaagcagtc ccttgctact    267240
     cagttcaatg atcctgcaac tatttcacct aatcactaga tttcgaaaag tcgagcaatg    267300
     cctcacagag gacttcgagt tgttcgagaa agagggctga gataatctca cctgactact    267360
     gatgctaggg tagttaggtg agataatctc acccccctaa tttttggagg ctatataaac    267420
     aggtgttctg agaatctgag cttcggtcca aatgtgttca gtcaatccaa ctgccatggc    267480
     aggagttctc tgttgaaagc gcttgttacc ctcaggtact tcaagaggag aacgtaaact    267540
     gcgatgctct ctcacccagt tgtagactgt tgcactccac caggcaacgg cttgacgagt    267600
     gtcactgcgg tgagcgaaag caagtgagcg tctgacttga tgagcattca tccgtcgtgc    267660
     agtaccattg aaacgctcca cagttgaagt attgggagtg ttgtaaccca ttttgtctaa    267720
     tgcttgattg atgcgttgcc agctcccatg ggctttgctc acctctacag tttttaactt    267780
     ttgcccctga cgatgtttga tgatttggac gtgggcaagg ggtcgaggaa tccggtattt    267840
     tgagttgggc gggcgcccca tgttgctctg acggggggga ggtaggatac cccgaagatg    267900
     atggggaaca gggtacgata actcgcgtct ccatcggtca tcagcaccag gtctcgggga    267960
     tgggccagtc gtttgtgagt ggctcgcatc agcctatcta ttaggtttgt gttacggggg    268020
     ccaacttcga cttggatgat gaatttgctc gcagcatcaa tggcaacggc atcccaacat    268080
     tgctgctgct tgattgcgac gtatccatga cgctcatcca tctctaatac gtcgatgtcc    268140
     aattgctgag cttcctgctc atgaaagtct tgggcatgtt gaccaaattt gaggcttaga    268200
     cgtttcactg ttgctcggtg agtgtaggtc aagcgtgaag ttcctttgat agaggtccct    268260
     tctgcaattt gacgacctac ttctattgca cgagattcag gaatttttgt attccaaaag    268320
     gcagtgttct tgcgttcact gaacgctgct ccacagcaac gacagcgtag ataccgaatc    268380
     tgatcttgtc catagacttt gcgcacgatt aaattctcaa ggcccgcttg accatagctc    268440
     tcacattttg agttcacgca agctagcact gagagtaaag gccgttttct ctctttcatg    268500
     ggagtatctt ggctaatgac tcccttcagt agaacctttt tcaggcctct cttagctaga    268560
     ggggctgaga taatctcacc tgactaccaa gtgggttttc tttgcattta gtcgtaagcc    268620
     atatttctcc agccgtcgcg gcagtacccg cataaatcta atggcatctt cttcatgttc    268680
     aaacacagcc gcaacatcgt ctgcgtatcg aatcattgtg ccgcaaccaa ccgcagacaa    268740
     ctaccaacat ctgaaggtgt actctattgt tttcaaaaag tcgtttgctt aaggctcata    268800
     gttccattcg ggtttaggca ggtttttcac gatgtcgcgt agactgtaat ccgataactc    268860
     cgtaagtcgg cgaaacgcac gtccagatac atgacattcg gctcccggaa aacatcgggc    268920
     gcagcgttga tagagtcgtc ggacactggg gttctcaaca gattgtccag tgatatacac    268980
     accgccctgc tgttgaattt gaagggtgat ctctgtaatc aaacggactg ctatgcctcg    269040
     ccctcgatgg gcaggttcaa caaacaagtc aataacctgg ccacctttca tgcagtagtg    269100
     caaatcatag gatgatatcc aagctgcaaa cgcaaccaat tgataatttt cagcttctgc    269160
     aatcaccatt tgaaattcag cacctagacc atcttgttct aacttttggg gcgttccccc    269220
     ccaagggcgc tgaaacgttt cttgcataaa cgccatcagc aacttttgca gattgggtgt    269280
     gtcctctaga gtggcattac gaatgtggta gatcgtcgcg ctagatacag tcatggttat    269340
     attctcagcc caatgattta agtctgatca gtcatggcct agctttcaaa ggagatgcgc    269400
     tatcgtgaaa gcatcggtct attttgccgg aggcatcgag atggtacgtc cctacctaac    269460
     aggcctgagt gcttcgctac taatggtgat gagtccactg gtgagtcaag catcggagct    269520
     gccgattgta gaatctgctg cattagggat tggtaaaaat ccaccctggt ctgagcctgt    269580
     tcaggttgaa gatccctttg aaggtcaatt tatcgccgtt tttgatcggc atcgttttag    269640
     cgatcgcttc ttaaataccc atatgcggat cgaagtccaa agcctatgga ctcaagatta    269700
     tgttcgccta ctgttcacag ccaaggatcg cgattgctat ggccatcacg gctttttatc    269760
     atcatcctat tgcagtgaag taatcgacac caaaaaaatc agcaaattgt tcctcaagat    269820
     cgatgagcaa atctatcaag tatcaggcca gcaaaacacc ttccccgtga gtacagaatt    269880
     agccaatgcc cttcgtagtg ccccggaaca ggagatacaa attcgcttgg tcacggaaag    269940
     tggggcttcg gtggatagca aaattggtca aaaaaccgtt aaggcttggc agagcatcta    270000
     tacacctacc gtctctcgcg gcttagactg aaaggcacat caaagaccct ctcactgttt    270060
     gatgtcattg gtttgagatc aggtcaatcc attcgaaatt acaaagtaat acctgctggc    270120
     aatgaaccgt ggaaccagcc catatctaag ggagctaatt aaaaagctat tgagaataaa    270180
     tctaaactgt taactcaata atcgattggg gttgcttcac ccgtttctcg gggaatcgaa    270240
     gggctccatt gagctgaatc ctagtcatgg attgatatta atgctataaa catcgatatc    270300
     gtcataacaa aatacgggag tgaaatcgtc aaagaccact gctagacaat tgattattga    270360
     gaacgtattc tgattgtagt tatccataca ctcattgctt gatgataatg acgaccaagg    270420
     atgaactggg ctactgatgt attcggctaa cacgcttaaa gctgaactga atgcgctagg    270480
     tgggcggatc tcttcgcaac gtgagatgat tctgaatgct ttccaagctt tacccgaggg    270540
     gcaacacata agtgctgcga agctacacca attactcgtt aaacaagact attccatcgg    270600
     tctgccgacg atttatcgca accttaagct gatgtcgcag atgggagtat tgcgtgagct    270660
     agagcttccc ccagaccgaa aactctatga gctaaatcca ccctatcatc atcgtcatca    270720
     ccacctcatc tgtgtcaagt gcaatcagac cattgaattc aaaaatagtt cgatcctcag    270780
     aataggcaaa cgtcaagcca aggaagccgg atttcacctc ctagattgtc agctcaccat    270840
     tcatgcactt tgtccaagct gtcaacggtc agttacacaa agttgattag accagtatgc    270900
     gtttagaagc ttgccttgct tttgtcagat cttcatctta gaaataacac aacgaaactt    270960
     ccaatttatt aactcagaat atcgagtttt cagttctgct ggcttagaac attttgctag    271020
     ttccaacgaa tgagttgaat ggcacggaaa ttgtttgaag cgaggaaagg aagtcatcac    271080
     catcatgaga attttccgat gatctaggct catgtttctg tgatggattg taattaataa    271140
     gtcagatgga ttagaagaat cttaattaaa aagtgaatta aaaatgaaaa tctgttgatt    271200
     ataaaaatga gatgattatg aaaatactga attattatta atactattta ttgatttttt    271260
     gatgatctta attcatcaaa ataatgctac tatcgtcctg aacgaagggg agtagcttta    271320
     gccgcacaag gcccatcgtc tgagtcaaca tactggtgtt taacctggtt cagacggcaa    271380
     tttagaattt tctagcttgc aagcgagacc ttcattaagt ccacaacaag agtgggcttg    271440
     atggggtctt tggaaatgcc tgtcatgcct gctcatgcaa tacagtactg gagcagcaaa    271500
     tgaacctctt gcctggattt acagccggat tgttactaat tacgctttca gaattgggtg    271560
     acaaaacttt ttttataggt gccattctag cgatgcgtca tccgcgtcgc tgggtttatg    271620
     ggggagtaac cgtcgctcta gctacaatga cggccttgtc ggtctggatt gggcaggtag    271680
     caacagtctt tcctcagcag tatgtcaaag gggtaacggt ggtcttgttt atcggctttg    271740
     gtctcaaact gctcaacgat gcgatgcgaa tgtcaggtaa tgaggggatg gttcatgagc    271800
     aagctgatgc attagaggct gtcgaatgtc gagagaaggg tgttaccgct tggtcaggca    271860
     gagcgatatg gatggaagct tttactttga cttttatggc ggagtggggg gaccggaccc    271920
     aggtcgcgac gattactcta gcaactgctc aaaatcccta tggagttttt ctaggagcta    271980
     ttttgggtca tgctatttgt gccgcaattg cagtcgtctg tggtaaattg attgccggac    272040
     ggatttcaga gcgtttactc actgccatag gtggtgtttt atttctgata ttcggcatcg    272100
     tcgtaatcag cagatgactt gatgcgcaat gctgaggaat actgaaagtg aggatgcctt    272160
     aaatccaaaa ccgtaactta ttgggcgaat gcccctgccg gtcctacttg taaaacgcgg    272220
     cattagtgga gaataagtct taaagcaacc ccgatcgctg ccaaaatccc taacaatacc    272280
     aggatccagc gttgttggaa gatcaatcgg ctgatggcta gagatggggg agcagctgtc    272340
     tctatctgca caggcacacc caactgtttg gtcgcccaaa gattggcttc tcctagagag    272400
     ctaaagactc taccagggca gccatacaaa ttttgagtga ccttggccac cattggcccc    272460
     cacagggcaa tgagcttagc ggaatcgggg accatagcca caccagcaca atattcagaa    272520
     atcaagggct tatgtttttt ggtccaagca atgccctctt tgcggagttg cttggcctca    272580
     ggtgatttcc cttgtttctc tgccgcttca gcattatccc gctgtagcac taaggcaaac    272640
     ggttcttcct tcgccaacca ttcctcgaag caggcataga attgtgccat ctcttcaggt    272700
     gtaccaagtc cttgaaaacg agttgagaca aggggccagc ggctatcatc aatagttagc    272760
     atgatccatc acaaagttag ggcgggctat ggctaaacgg ttgtttctag aatcaaacaa    272820
     gcattgcgta agggcggtaa ttgactcagc caagggaccc agcgaaaaaa gccgatgcga    272880
     tgcggatatc ggcagtttgc ttgaatcaag gattgtacac ttgtgaggga caatcccatc    272940
     gctgcgatgt cctgttcatt tttgataaac cagttcaagg gggcaccgag ttgagccaac    273000
     tgtttggctc ctttgctatt tgaagaacca cccaatgcat caaagactag cgttgctcct    273060
     ggaagccggt ggtgcaattg gtcaatgagt tgctgtactt gggtttcttt gaaatacatc    273120
     agtaatcctt ctgcgatgat cagaagattt tcaggatttc cgggtaattc gtccatccaa    273180
     gtgaagtcaa gtgcagattg agcgaggaat cgatgatggt ccgtttctgt atctagctga    273240
     cgccggagag tggttatttc cggtaaatct aactctagcc aatagcgata gccttgtccc    273300
     acgcggtagt agcgggttga catccctgct cccaattcaa tggcgatcgc ttcctgatga    273360
     ctggctagat accgttgtgt aatctggtca aatagatggg cacgtaccgc ccaagtgagt    273420
     tgcgcaagtg aaccgctata gaagatatct aattcaggat cccattggag cgaagaccac    273480
     cattccatta cttttgggtc atacaagatg gcatcagggc gttgatgctc ttcaacacgg    273540
     gcacgagtgg tcatcagcat cgtgcgggga acacccgcca gtttagactc agaagggctg    273600
     atcattcttc ctctcctaca gcatagaggt ttggctatcg aaaaatagat ggactacccc    273660
     gttgagttca aggatataaa ttaatgaaaa attttctcaa ctgtatatgc tcaattataa    273720
     atgacctaca gtgaatctgt tggacgccaa acggatcttc tcttttctga taggaactga    273780
     aaatcgacgc aatagatcca ggatctattg cggatagtag aaaggcgatg ggcaatcaca    273840
     atagttgttc gattttgcgt aatcttagct agtgattctt gaatagctag atcgattgca    273900
     tttatcccag taggaataga gttcttcagc gcaagactgc acctgcttga gttaataagg    273960
     ttcacaataa tgcatcagga atactcaagt tttaagcgat agctgctgct gtatccattg    274020
     tctagcctct tccgagtgca aaaagatctg accaggacaa ccaaacaccg ttttgatcag    274080
     ttgtggggtt ttagtctggc gggctattcg ttcctgcacc gtctccactc ctatcgcaat    274140
     accttggcag tgagccgtaa ttagagattg atattgcttg gcccactgtg ctgtaagcag    274200
     gtgaatactc tgcatctgtt taggatctac ttcttcgctt tgggtttggc tcaaaataat    274260
     cccaaaaggc tgtaatctca ttagccaatc ttcaaattgt gtaaggtagg atttcgttgc    274320
     tgacattatc gtcgctccct cgaaatacac tgagataatg ggataagaag attggtcaat    274380
     ggtgagcata gtcgtaagtc tcagaatttt ttgaggaggt gatattgaga tctaaatgtt    274440
     gaacaattaa ccaattgcag ttcaggagaa ttcccgtact aaggataaat attcctcgat    274500
     aacctacgat actagcaatg acacccccta aagctgccga aagaatacta cagagagcaa    274560
     tcacagaagt ttgcaacgtg taatctgttc cagctaactc tattcgactt ttatccatca    274620
     taattgtgaa tgcggtagtt cccagtattc cgaaagcgaa gaaggtgaca ccaatgatgg    274680
     tgttcaacac aggtagctga gtaaatccgt aggttagtag cacattgctg aaggtgccta    274740
     ctgctaatgt gtttgctgca attaatagcg ctcgctgacg gcctaactta gccattagca    274800
     aacccgccgc tgctgaaccc agcatcgtca tggcaatgcc aaaaatacca atcatgcggc    274860
     caatatctgc gatggaaaaa ccgagatcga ctaatagtgg acgaaacatt gccgctgaaa    274920
     aattgtagcc agccgtgatc actgccagtg tcaagagcca tattctgatt cctggacgct    274980
     gacaagactc gataaaaatt ttgcaatagg caatgagcgg gtccaaggca gggttgattg    275040
     atttgcctgt cactcggccc ataggtctaa ttgtctctct atgccataag agcggcatca    275100
     acgccagcag catcaaagca gcaagagtca ataaactttt tgaccatccc cacttgttga    275160
     gcaagattaa catgccacct ccgccaatca ttttgcctag agagccgcca atcccctgga    275220
     ctgcgttgcc cactccccgt tctctcggag ataaaaggcc caatgccagg gcatccgtag    275280
     caatatcctg gctgctgcac agtaatgcca tcaaggctag tcccaccaag aggacaggta    275340
     agttgtgctc aacactcaaa aagctacaga aaacggtcac accaataacc ccagattgaa    275400
     agcaaataat ccagaaacga tagtgtcccc accgcgtaaa tccgtaaaag tcgatcacgg    275460
     gagaccagag aaacttgaag gcaatgggca gcagtagcat tggcaataag ccaatagctg    275520
     ctaaggataa ccctctttgc ctgagaatga ctggcaatgc ttcaaataga aaccaaaacg    275580
     gtaggaattg ggagacatac aaactcgcca aaaggctcaa tttctgaatt ctttgagctg    275640
     aaatcatgtt catttgtctt tgctcagtca aaattgatag gtaatcgagc caatcacagt    275700
     gaaaggttca cctggttcaa tgcctctaat tcttgaaata ggggtgccct gaatgtaatt    275760
     cacgttaaaa atatttttga agttcacggc gagtctgagg cgctgacgct gatagaagat    275820
     agcagcattg gtaatgaagt aatcattgag gacaaaggta ttgctcaaat caccttggcg    275880
     atcgctggca taggtaaaac caatcccaaa tcctaaccct tggagatcac cctgttggag    275940
     ggtgtaggtt gtccataaat tagcgctgtg cttgggaatc ccagtcagtt gattgccaat    276000
     aggaatgaca ttatcctgag tgatttcagc atctgtatag gcataggagg cgatcacatt    276060
     ccagcccggt agaatttcgc cggataggtc caattcaatt ccttgacttt gctgttcccc    276120
     tgtcgctaca aaagcattga aaacaccgag agcattggga tcaggcgtcg caacattttg    276180
     tttcgtgata ttaaaataag ctagggtggc aaacagttta tccggcacca cctcagcctt    276240
     gaaccctact tcaaaacctt cacccgtttc ggggattaaa aaatctcctg ctgctgtcgt    276300
     tgaggcacta ggggtaaagg attgagcaaa actggaatat aaggatagtt caggaatcag    276360
     ctggtagact accccaacgc gaggggtaaa ggcatccacg gtctgttctc cctgacgacc    276420
     tgctggatca aataaagaag gagaatttgt gacttgctgg tcaacggtat cgtagcgacc    276480
     accgaccaca aactgcagat tatctagcac cttaatctga tcctgtaata gaattcctaa    276540
     cctgcgggtg gtgacatctt gtgctcgggc taccgtagca aaatcattga agcttaagcg    276600
     cgtgggtgta ccgtaaacag gattaaaaat atcaagcagt gaaggggcaa aattgactcg    276660
     tgcgtcaata ccactgcggt cttggctaag gtcaacgcca aatagcagcg tgtgctgaat    276720
     agggccagtc ttaaacttac ctgttacctc tgtttgcaag ccgagataat cttgaaacca    276780
     gtctgtactt ccgttaatgc gagccactag accagtggct tcattaaagt ttaggggtaa    276840
     aaagaagttg gataaataat cctgtttgct atagcgaaag gcactgcgaa cggaccaatt    276900
     ctcgttgaac tggtgcttga aggtataacc agtcgtgatg aaatctcgat ctatgacatc    276960
     atccggttca cctacaatcc gctcccgtgg cacatccaca acccctcgtc caaaggctag    277020
     caaaccacta tcatttgggc gttgatcatg gagatattca aaatcgaggg ttagattggt    277080
     ctcttctccg atatcccagc tcagaacagg agcgacaaac tctcgctgaa tattttggtc    277140
     atagtctcgg aacccttcat cacgctgaat cagagcatta agacgatagc ggagttgacc    277200
     atcttgagtt aatgtatctg aaaaatcgat ccgaggtcga aaaaaggtac gactgccgac    277260
     ctgaacttca gcttcgtata aaggctggga ggtgggtgtt ttggtgacta aattaatcac    277320
     accgcctgga ttaatttctc catacaggat ggaagaagga cccttgagaa cttcaatctg    277380
     ctctaggttg gcagtttcgg gcaaggtcaa taggccagtg ttcgagaggg catctgatcc    277440
     cgataggcta aatccatttc gtaatacttt ggcagccgaa aacccacgca aactaaactg    277500
     aaagcccgct ccttccgtgg tatctccagt aatgccgctg acattgcgaa gggcctcatc    277560
     caaacgcgtg acttgctgat ctttcagcac ttctttaggc agtacttgaa tcgactgtgg    277620
     tacattgcgt atggcggtgt ctgttcgcgt tccagtggtc gctttaggga taaaataacc    277680
     tgtttgagat cgttctgccg ttacagtaat ctctgtttca gcatcatcgg ttattggagt    277740
     aacgactaaa gctaaccctt ctgtccccac tgtcacttga gcaatagggg ccaactctac    277800
     accggtcact agcactcgaa tttgagtagg agtagcttga atcacggtca gttcagtaat    277860
     atcagatgca ggatcaattg attggaagcc ctggggatct tcgagaatcg cattatcaat    277920
     taccgctatc agccgattgc cgatactctg aatctgaggt gttgctagct gtcccgctga    277980
     agtgttcaat tgcacggata atcctgtttc tgtcgtctca atctgcacgt tcgtgacctt    278040
     aacgaggtct ccttctatct gggtaagcca atctgtcaca gtagtagctg gatgagcttg    278100
     gggttggtct aaagttggat gctgttctgg cgctgctaaa acgtgctgag gttgaactat    278160
     cgatacacta cagagaagta tcagggtaat ctcatgccca gatacttcga tagcactata    278220
     agcttttgac accccattac ctacaaagac aatacagttg ataactatac tcaataagta    278280
     ataacgatct tgtgtcgaga cggattattt tcgtctctaa acggattatt ttgattatct    278340
     acacttagaa agaatgattg gatcggaatt acagtgctcg gtagctacta ggagaatagc    278400
     caaatgtttt tttaaaggct gctgaaaatt gactcggact agcatagcca actgcctgag    278460
     agatttggga aatcgaaagg tcataggact ctaacagtcg ctgtgcctgc tccatcctat    278520
     gttgacgcag acaaccgaaa accgtagttc caaaaatctg gcgaaaccca cgctttagtt    278580
     tgaaatcgtt tatccctgct tgcttggcta acgcgactag cgagagagga ttatccatat    278640
     tgtctagcaa aatttctttt gccaaataga ttcgctcaat gtcatctgtt tttaagttaa    278700
     tgtcttcagg gtagaaacgt gattcgctga cctgatttag ttttaaagca atgagttcta    278760
     gggctttgct ctctagataa gttcttttga tagcaccttg gtaaggacag tggagtattt    278820
     gctgaagcgg ggtgagcata ctggcagagg tatgacccac aagattgaaa tcgcttgaga    278880
     agggtctagc tatattatga ccaatgctac ctagaggaca atcttcaggg ataaacgtgg    278940
     caaagagttg tgggtgtatc accagggtta gcatctcaac acattgatgg gctggatagg    279000
     tggtgttaac ctgcatctct ccagacataa agcccagcat attagtatgg gggcgggtca    279060
     aaatctcagc ttgattggag tgaagttgta gtcgagaatg gccagctaag tggaatcgaa    279120
     gtccccatat ggatagcttt tcaaagcttt cagtgaaatg cagattctct cgtaagtttg    279180
     ctcgggtaaa caccagatct aatccttctc gcagttggaa actatggttt agccagtctc    279240
     cgaaggactg ctgaagtgac caagtaacgg gatcggcttg gatttgatag tcagcatcga    279300
     tctgctgctg ggattctgcc agcatttcat agaggttgct agaagagagc gtcagttgca    279360
     gagttgccat caggaaagaa ttagcacggt ttgataatga taattgtttt taattatatt    279420
     gttgtaccat cttgagcatt tttgctgaga taggcatcaa ggaatgttaa aaataagaat    279480
     acatggtgca tctctattgg gattagcagt atgaaaactg tgagaccgaa aacaagtgtg    279540
     ggaaagcctg gaaactcctt gatcaagcgt tcaagccgct ggagcagcca gttctggata    279600
     ccaccgttca aaggtttcac gccagtcgcc atccaatacc ttcgtcctga cctgcaatag    279660
     gagatacgct ttcttgctcc atcgcatttg ctgctttttc tccaaacgct tagccaccac    279720
     ctgatccaaa tttgatttgc agtatgtata cccaagagta cggaaacagc cgttgataaa    279780
     cactagattt ttggtgtagt cgattgtaac cttctctaat ttgttgttga tggagtttat    279840
     tccagttgcc taagccattt agggatttgt tctgaaaatt gatgatgata attatttgct    279900
     tcattagcgc tcatcccttc atgttgggca tcttcaagga gcttactcat agaccgcatc    279960
     gagtcgtcaa catccgtcca tgaatcaggt gatgccttta ataaggcatt taattgagat    280020
     cgaatgcgat ccgtggcagt ggaaccgttg acgggtgaag tcgatggaat cgaagacgca    280080
     gactgtagtc gcggaacagg caattcacaa gcaacaggag gtgcatgggt gctaatcaga    280140
     tattgctcta gacgagaggg caagctgggt ggcttttcta taagctggct ttgcggcgga    280200
     atgtaggtat gggtcttttc atcataggca aggacttcac ccgtctcgat atggtaaatc    280260
     cagccgtaaa tttgcagttt gccctgcagc atccgtgatc gcacaatcgg ataagtcttc    280320
     aaattatcaa tctgcactaa gacattttca gcgactaaaa tttcaacccg ctcttcccct    280380
     tgagattctg ggtagttttc tgaaactact cgccgggtcg tttcagcatg ttgcaaccag    280440
     tcatacacca acggcatatc tgcttgcagc ttgttcagct tcatcagacc tgtcattgct    280500
     ccacaatggg aatggccgca gatgacaact tgctcaatct ctagagcagc aatggcatat    280560
     tcaatcgtgc cgccctcacc accatttgct gccccatagg ggggcacgat attcccagca    280620
     ttacggatga caaacaattc ccccacatct gtctgggtaa tgaggttggg gtcaacccgc    280680
     gaatcagagc aggtgatgaa taatacacga ggtttttgac cgtgagagag ttcttttaag    280740
     agttcttgat gttgagcaac atatttttgc ttaaactctt gcagaccacg aacgagcttt    280800
     ttcacgactg cacttccttg acatgactct gcgcgaacaa tgtcatcggg ccaagttcac    280860
     gcgagttctc ggatagtaat ctttccaaaa ctgctgttta aattatattc caacagtcaa    280920
     ttagcccagt tgtatggccg ctcccccgca gagcgtcaac cgatttgatt ttgagaaaga    280980
     cgtttaagcg agtgctattt gctcctcggc ctgccctcta agcagcaagc agatattaca    281040
     ctaaatcatc aaaatcttca gaccttgaga ttcgtgcaaa acaatacaca gcaagaattt    281100
     gatattcaaa tagcatttta attccgattt ttggccacaa atctggaatt aaaatcaccg    281160
     atcttataga gtaatctgca agttcatgct ctgtggtgca atttatgtcg cgtttggctc    281220
     aacatgccga cttgccgcct atgctcgatt tttctggagc cagttcacta gatcagcaga    281280
     ttccgtaaag tcgagtagtg cctcgcccaa agtttcgagt tgatcgaggg agagggcttg    281340
     gatttgcgat ctcaattcta gagcaacgtc accaatgcgt cgattgagta gacgaaggat    281400
     gagcgattgt tcaccttcaa gcttgccttc ttgccttcct tcctggcggc cttcatccaa    281460
     ggcttcctgg tagactttcg tttgcttgag ttcgcttacg cccaacatac tctctatctc    281520
     ttcccgactc agttgtggaa atttgtagac cacaattgtc tcaattaatt ctattatcgt    281580
     ggcaaatctt ggatttgtct gttcttgagg ctgaaccctt gaaatcaaag cttgggcctg    281640
     ggtgacggtc tttgctgagt cagccacaat caactgcatt agacccacac caacagagtc    281700
     aacggcttca ttcaagtctt ccaagtaaat acgatgtact tggtcgctat tcaggttggc    281760
     ccggaataca tggtgatagt ctggttcaat gctgcgtttg gggtagataa caacggcttg    281820
     ccagtccacc gtgtcagggt gaagattgag atacagataa atctcagaga agaaccgttg    281880
     atagaacgcc gggtctcgtt gaaactgaac ttccacaaac cagactgttt ggtctgcagc    281940
     ctctggagta ggcaagaaaa cgccatcaat gcggaaggca acctgcttga tttcaacaga    282000
     cttaaattca tagccttgag ctctatgtga ggattgtccc agcagctcga acaagatgcc    282060
     gggatctgcc tggaagatgc gatagaagat tgaatctgtt ttcaaagggc gagattactc    282120
     tgcgtcgttc cagttattct actgaatgaa agtagctcca gaagagtggc ggtttatagt    282180
     ggatattgaa tagcaccatt gatagctaac gatgttagtt aaattgttat gcagcccgac    282240
     aatgacaaaa tcgatgatgt cgttctcgca ttactagccc tcaatattca tgatgaaact    282300
     gagcagggtg cacgcagttg gaaaggttac gattgggagg ctcttaatcg gttgcatcaa    282360
     aaaggatgga tcagtaaccc tgtcaccaag gcaaaatctg taattctgac acctgaagga    282420
     ctagcgagaa gccgagaact attcaaacag ctatttacaa aagagacctg atcataaagc    282480
     ccatccttta gctgactttc ccgttatctc ctacaaccct ttaacatcaa tacttctaac    282540
     tcaacgatca cagttttggg gtgagcatat attcgaatag tacagttcac taccgtaaat    282600
     gtttgatgcc gtcagcttct ctcgaaaagc gatccgtgat caagctgatg acaggtcgct    282660
     tgcgcacctt gatattgaca ttgaccgaca tccctgattg caaggctaat tgccgctcct    282720
     tcgtcttcaa ggtttgtgag tctaatttga cgacggcggg gaagctgtaa aattgccgca    282780
     cttcggttgg gggtagggca tctgaaccaa tggactcaac cgttccttta atatcaccaa    282840
     attcactgaa attaaacgaa tcaatcctca catcagcggc catgccagtc tggataaaac    282900
     caatatcttt gttggtgata tagacttttg ccttcaggtt atcagcaggc acaattttta    282960
     agacgggttc actcgcattc gcaacaaacc ccggtgtgct cggcttcaaa tcaaacacca    283020
     taccatctac gggggctttt aactcttgat aatctagggt tagtttcgcc tgttgtaacc    283080
     gattctctaa gtcagcaatc gttctttgat tatccacgat ggctttggtg agctgactgt    283140
     cgatttccga aatccgcttt ttattggcag caatccgatc cagtaattct cgctggttcg    283200
     tggcaacagt gttcagggct tgggcttggg cttgttgttt ttcctggccg acttgctcca    283260
     attgccgtaa caatcgaatc tgctcttgct ggaggcgtga gacttctgcc gtgccagttt    283320
     gcacttcatt ctgttgctgt ttgaattgca cccgagcaat cgcgcctttt ctataagcct    283380
     cttcaatatc ttggacaatt tcttgattga gggccaaggt ctgttgagcg ctcgctaatt    283440
     gaatcttggt ctgctccagc tggacttcta tttgacgaag ctgtttatca gcttggttta    283500
     tccgcgcttg cgctgcagcc acactgctgg aaccttgagt gaggccagat tgaagtcgct    283560
     gccgttcttc ggctgagaaa tgcctccatt cctgtgcacc attgagctga gcccgataaa    283620
     gtttattctc agcgacgagg gactgacgat cccgagtgga attgatcaat gctgaatcaa    283680
     tcacatccgg taagggggca ttagattgcc cctgcagctg ctgacgataa tagtcattga    283740
     cttgtactag attgcggcgt tggtgttcaa gggattgaat ctcagaccgc gtcccttggc    283800
     gattcaggac gaggagaacc tctccttttt tgacgagctg cccttcttca accttgatct    283860
     ccttgaccac gccagcgacg ggagattgaa tctccttgac ggcccctttg ggttcgagct    283920
     gtcccgttgc cggaatagct tcttcgattt ggaataaaca ggcccaggcc agtgcagcgg    283980
     atgcagcccc cacaattccc cagataatcg ctcttgacca gaccggggac tgctgcagaa    284040
     tcacaggccg atcaaagggt ttttctttct tgggatgagc tttcgtgagg ggtagtacgt    284100
     tttgatctga ttcgggggtg agggtcgaat tcagttgttt ggggtcgcct cccgcgaagg    284160
     tttgaatact ggtcatgatt gagtctcctg ttgctggtat agccagtaat aacggccttt    284220
     ttgctgcatc aattcggcat gggtgccttg ttcaaccagg tggccctggt ccatcatcaa    284280
     aatcatgtct gccgactcta aggtcttgag gcgatgggtg acaaagaaga cagtgcggtc    284340
     gccaaaggct tctgccaggt tttgacagac ttggcgttca gcgttgtagt cgagggcgct    284400
     ggtcgcctcg tccagaataa tcagttgggg attctgcaag accatgcggg cgatcgcaat    284460
     ccgctgccgt tgtccccccg acagggccga accccgctca cccacacggg tgttataccc    284520
     ttggggcaat tccataatga aatcatgggc ataggccact ttcgccgcgg ccacaatttc    284580
     ctccgccgtt gcatctgggg cagaaagggc aatgttttcc tgtaccgtgc catcaaacag    284640
     taaactgtcc tgtaacacca tgccgatttg acgacggagg gagtacagtt ccaccttgct    284700
     aatgtcgtac tgatccacca agattcgacc gctgttggcg ttgtagaggc gcatcaacag    284760
     cttcatcaag gtactcttac ccgaaccgct ctggccgaca atccccacaa acgtcttagc    284820
     gggcacttcc agagacacct gctggagctg catcggtcca ctgtctttga atcggaagga    284880
     cagatcttca aacttgaccg ccccttgcat caacggcatg ggaatcaaat cgcgatccgc    284940
     ttcagtcacc tcttggggat agtccagaat atcgctcaag cgctctaggg atagggctgt    285000
     ttcctggaag ttctgccaca gctgcaccaa tcggagcaaa ggaccagtgg tatagcccgc    285060
     aatgatgcga aaggcaatca gttcacccac ggtcaattgc ccttgaataa atagataggc    285120
     cccgacccac agtaagagta agctggatag cttattcaag aagccactga tagaacctgc    285180
     cgtggtggag gccaccaccg ccttaaaccc agagctgaca taccgggcat agcgatcttg    285240
     ccattgccag cgggatttca actcaatgtt ttgagccttg accgtttgaa ttcccgatac    285300
     cacctccacc aagtaagact gggttttggc attctcttcc gctttagtcc gggtcagacg    285360
     gcgaataatt ggagcgaaaa taaaggtgag taaggcaaac aacggcactg tgcctagggc    285420
     gataatcgtc agcagccaac tgtaaaacac catgacgacg atgtacacga ccgagaacac    285480
     cgcatctaaa actaccgtca aggccgttcc cgttagaaac ttacggatgt tttctagctc    285540
     attaactcgg gttgccagtt ctcccacagg acgtttatca aaatagcgca ggggtaaccg    285600
     cacgaggtga tcaatcacct ccgcacccag cgacatatca attcgattgg tggtatctac    285660
     aaataaatag gtacgaaaac tggtgagcag ggcttcaaat atagctaccc ccactaacaa    285720
     caaccccagg acattcagag taccgagtgc cccttgcgat aggactttat caatgatgac    285780
     ctgggtaatc aggggattcg ccaggccaaa cagttgcaca aagaaggaag caattaacac    285840
     ctcagtcaaa accttgcggt gcttcttaat ggacggccaa aaccagctca ggttaaaccg    285900
     actttgaggc gtttcatggg tgcgctctag cagcagcacc tgtaccttgt cttcaaaggc    285960
     gtccaagaaa tcatcgggat gtttgcgaag taaggtctgc tctggcactg caaatacaat    286020
     ttctttggtg ctggtttcat acaccagggc aatccggtcc tgccagttaa cgagtgctgg    286080
     agtcggcaga cgagaaaacg cagaggcggg ggtttccact aactgggctc gtaatcccat    286140
     cgattctgag attgcaccat agacgggcag cgataccccc ggaccattgc gctctgagtg    286200
     attcttgaga atccgccgaa gcacatcctt gcgaaagggc aaattcagat gcagcgccaa    286260
     catctggaaa caagctaagg gagcatctac aggacctcga ccggacttga acggatattt    286320
     gccatgttta acaggggcat catccactgc aggcagcagt gtaggcgctt ctgggatttc    286380
     atcccaaacc tctgattgag gacttgcagc gactggctca atcgaggatt gaaacgcctt    286440
     gatcggggtt aatccaatca gccgtaatgt ttcagaccgg gagacggtgc cgttgacttg    286500
     ttctaggcac gcttccaaag gttgacctat ctctaaatca ggaatggacc ccccactgac    286560
     aaaccattcc aaatggggtt gtaactggtc aatggagata tctcgtaggg gacgagtttg    286620
     aacgaggctc tctggcaacg ctcgttctgc caaatttttg aggtccgtag agccatccgc    286680
     acggcgcaat aactgttggc cgaggacatc aaagacttct aggatactcg gctgctgctc    286740
     atacacttga gccatactgg gttcatggct caacagctct aggaagttcg cagcaggcaa    286800
     cttcaaacca acggtttcta ctgaagcaat ggctgtctcg caagggattt ggcgcacgag    286860
     actgatccac ccgactgcag cccccggtcc caatagtttg agtgtcactg gcgtgtcggt    286920
     gcgaggatca tagcccaata gccgcacctg tccttgatag atgaggatca agtcttgggg    286980
     catggcccgg ttggatacga ggggacgacc catgggatag cgcagcggtt ggaactctgt    287040
     cgctaccgaa gatagaaccg cttctgaaag ttgatcaaag ccagggagat ccttgaggaa    287100
     ggattccagg gataagtggg ttaaagtcat ggtgtttgca cagaaacagc aatagaagtg    287160
     tcagatactg caaccgattc catctgtgtt tggagccact cattaaaacg ctgttccaac    287220
     agctgttgtc gcagcggggc atccagttgg gctgagataa aggtttgcag acggacaatc    287280
     acaaaccatt caccgaggcg aatgggaggg cgaacttgcc caggttgagc attggtgagg    287340
     agttgcacca aggtcgggtg catatgggtc gccgtcacag ggccaatcag tccccccgtt    287400
     tgggcttcgg gaccttgaga atattgggtg gcgagatccg aaaatgcttg ttcatcccct    287460
     tgcaggcgaa agtacaattc ctgagcgact tcagcactcg ccactcggat cagcgaataa    287520
     acatattgat caaactgtcc tttgtgttgg agaaaatcag actccacctg gttattccag    287580
     gtttggagct tgaacttttg caatttgaac tgccgttggg cttgtgctgc catctgttga    287640
     agcgtcatgc agtaatgctt taaccaagct tcgcgctggg tatcatcccc gatttgatat    287700
     tggtggtaga actgctcgac tgcctgcacc ctttcctctg agcttaatgg cacctcttga    287760
     atggcttggt cagtgatcag ttctttcagc aactgaggga gaagctgata ctgcccaagt    287820
     aaaggaatta attcagcgga ttgaacagtg ttatccatga tcggctgagc gggtttcata    287880
     ttaaaatact tttaatagag agggtgactt gaatgacctc gccctaagag aaatggggtt    287940
     tccatcctgc ttagcttgag gtgttgcacg cttttctgcc ccaagttgca tcatgcttgc    288000
     gctatcagca gttatttgag agatgtagat tgcacggttt catagtctgg gggttcaggg    288060
     gctgctgtat ggctcacggg aactaagagt tctatttcag atgcttctaa gatttgcttt    288120
     agagcgattt cgcggagagt tgttgtcatg attgatttcc tgtgtgaatc aggttgaaga    288180
     gttaagtgct tagaagctgc gaatatcggt cgtcgcttcg ttgatgtctc tactatcggc    288240
     aaatccatca gcagataaaa tctcgttata ttcaggttta ttcaggtctt tatcgaattt    288300
     tttgtttgaa atgttcaata aatgcagata tagaaaaaga ccatctgtaa atttattcct    288360
     gatatcttta ccctgcattg ctttcaaggc aggataaaga tatcaggaat aaattacagg    288420
     ttgaatcttt caaatctttg atgcaaaaaa gagaggaaag tggccttcct ctctttcagt    288480
     ttgactaact aagcattatc tagaccgccc aggattgctt aagcgttgaa tctaactgag    288540
     tcttagccgc taaagtagac ccggcagcct caaaaatgtc ccaagcctta accatgtcat    288600
     tgacttgaga actctgcaaa gaagctccat tactaatttg gatggtgtca acctgttggg    288660
     atagaggcgt tgtataccag tccttgagga taaccacctc attagtgtct gaaacattga    288720
     gtttgacatc attgccgctt ctggagaagt caatgttgtg gtaatcaacg ttagctccta    288780
     atagtagctt gtccgtagtg ctggcatcac ctctgttgtc gatggtagta gtgcgggtgc    288840
     ccccaggatt ggctcctaaa gaagctccaa atgcatcctt accaccaatt tggtaagtgt    288900
     cattacctgc accacctgtc agagtgatgt tgttgccgta agaaatcagc gtgtcatcac    288960
     cagcacccgc atcataagtg ttggactcac cgcctgcatg gatggtgtcc ttgtcttgtc    289020
     caccctggat ggtgttgttc ttacccgcac cgtagatgcg gttcaaccca cccaagctca    289080
     caaaactatt cttggctcct ttgactagga caatgtcatt accggaaccg gacttgattt    289140
     tattttcctg accgaggcca aggataatat catcaccttt gccgccgtca aaggtgttct    289200
     tcttaccaat ggccaggata aagtcattgc ccttgccacc gataagcttg ttttccttac    289260
     cgccaccgat gaggatgtca tcgcctgcac cacccttgag cacattcttt gtgccaccgc    289320
     caatcaggat atccttacca gcgtcgcctt tgaagctatt ggtcttacca ccaccaagga    289380
     tgatgtcatt accttcgccc cccttaagca cattcttctt accagcacca aggatgatat    289440
     cgtctccctg accgcccttg aagatgttgg ttttcccagc accaaggata aggtcattgc    289500
     catctcctcc gaagaggaga ttcattttac cgccaccgac gatgatgtca gcacctgcac    289560
     cccctttcat tgtgttggtc tttcctccac ctaagaggat gtcgttgcct tcaccaccta    289620
     gcatagtgtt gaatttacca gcaccgacca tgatgtcgtt gcctttgcca ccggataaag    289680
     agttcacttt accgccgcca atcacaaggt catcaccaat cccggcaagc attttattaa    289740
     gcttaccgcc gcccaccatg atgtcattgc cagctccgcc catcatggtg ttgagcatac    289800
     cgccaccaat catgatgtcg ttgccatctt ggcccatcat catgttgaac ttaccgccag    289860
     ccagcatcag gtcgtcgcct tggccacctt ttaagaaatt gaacttaccg atggaagctt    289920
     ggatgtcatt tcccagtcca ccatccacca cgttgacctt cccgccagcg acctggatgt    289980
     catcgccttg gccacccgat aggaagttca cggcccccag tgtgacttgt acatcagcac    290040
     cattgccgcc aaagagcgcg ttggctaaac catgagaaaa ttgaatatcg ttgcctttgc    290100
     cgccaagaag gaagtttgct tctcccagtg caaccatggt gtcactgttg gcaccgtggc    290160
     tatagagatt gaagtttgga agggttagat tggggagttt aacggattga gcgacactat    290220
     tggctttatc cttcagggtt cgtaagggat ctggaagagt aacagaaggg atagagggta    290280
     gtgacggtaa cgacggcaaa ctcagggctg gaatattgag cgttggtagc gttacctgag    290340
     gcacaggaat ggaaggaagg cttaccgtgg ggatgttgat agtcgggagg ctcaagctgg    290400
     gaatggtcaa ctgaggtaaa ccaatgttgg atgtgggcag tctcaagctg ggaattaagt    290460
     gaccaggtag gtttatggac ggcatctgaa tggaaggtag ttgcacattc ttgaagccag    290520
     taaccttaaa gtcaaaccca gggaagttca accccccttc aggagcatcg atagataaat    290580
     caggtaaacc aggtaacttg atgtcaggag cattcaagga gattttcaaa ttgctcaagt    290640
     tgggcagttg accaatattg aagttagggg ccttaaagtt tggaatgaca tcacctagct    290700
     cactaaagtc agcggcaaat tctttgaaat ttgggagact gaagtctgaa aaatttaatt    290760
     ttggtaggct ggcatcagag agcttaagcg aacccaggtc tagatcttca gccattttct    290820
     tgagggtgtc tttgccgacg gtatcgcccg ccatggcgtt tgccttaccc aatgcaacca    290880
     ttacatcttg gccttcgcca ccgacttgca cattgagggc agcagcgcta acgaggatgt    290940
     catttcctgc tccaccgttt aagtagttgg ccgcaccgag accgatcatg atgtcgttac    291000
     caccagcgga tgtgagccag ttcccagctg caacaccgac cataatgtca cgaccattgc    291060
     cgctatggag tttgttgagt ccgccgaaac cgatgacgac gttgttgcca tcaccagcat    291120
     taacaacgtt ggcacctccg acaccgatga tggtgtcatt gccagtacca gaattgatga    291180
     cgttcgctcc gcctaggccg atgacggtgt tgcgaccatg accagcattg attttgttag    291240
     ccccaccaaa tccgaagata aagtcgttgc catagccagc gttcatgttg ttgtagccac    291300
     ccacccctac taaggtgttg tgaccgtggc cagcatccat attgttgtag ccacctacag    291360
     caatcagggt gtcgttaccc caaccggctg tcaaacggtt gtatccaccc gctgctataa    291420
     gggtgttatg accttcattg ccatgaatgg tgttcttccc accgactgct acgactttgt    291480
     cattgccaga gcccgcatgg atggtgttgg aagcggcagc agttgtgatg tggtcatctc    291540
     ctgaaccgcc gtaaacagta ttaccaatac cgaaaatttc gatgcggtcg ttcccagaac    291600
     ctccatcaac aaagttagag ccaccaaagg ctttgatatg atcatggccc cactcaccat    291660
     aaagccggtt tccagcagca acggcctcaa tgtagtcatt gtgaccaccg ccgtatacgg    291720
     tattgtgagc tccccagact ttgatgttgt catagccatc tcctccgtgt acatagttgg    291780
     aaccaccccc tgcacggata gtgtcattgc cccactcgcc ccggatggtg ttgcgaccgc    291840
     cccaggcttc gatatggtcg ttgtgcccac cgccataaac ggtattgcta atgccaccaa    291900
     ctacgatgtt gtcgtggccg tcaccaccgt ggacccaatt ggaaccaccc caggcacgga    291960
     tcgtgtcatc accccattca cctcggatgg tgttgcggcc accccaggac tcgatgtagt    292020
     cgttgtggcc gccaccatag acagtgttgt gagctcccca gactttgatg ttgtcgaagc    292080
     catcgccacc atgaacccag ttggagccac cccctgcgcg gatagtgtca ttgccccact    292140
     caccgtgaag ggagttgcga ccgccccagg caacgatgta gtcatcgtga ccaccaccgt    292200
     agacagtatt gctgatgcca ccgacctcaa tgttatcgtt gtggtcgcca ccgtggaccc    292260
     aattggaacc accccaggca cggatgtagt catggccgct atctccacgg acgttgtttc    292320
     gaccgccaat ggcatgaatc tcatcgttgc ctgtgccgcc acgcatggtg ttctggccac    292380
     cgatggcatg gaggtaatca ttcccactac caccatctaa ggtatttttc caacccacag    292440
     ctcggagggt gtcgttgccg ccatgaccat aaagatagtt gacgggcata tatccgatca    292500
     gggtgtcatt gccccaacca ccgtgcttgg tgggtgaagg tgcaattttc ttaacgactt    292560
     ttacaattgc cttaatggga ttcttgggct tacccatgat tcttgctcct tagtgattgt    292620
     tggttgtgcg gtggcttttg ccctcgctgt gttgaaccca ctatcgcgga acccattagc    292680
     agaaaaaatc cagaagaatt cagggttatt caggtaaaaa ttcaggtgtt tgttggacga    292740
     taatttgccc ccaacaaaaa attcacatga aaaagagacc tccgcagctg ggaggtctca    292800
     tgtcagactg cctgaaaaat agagcgactg ttcagagggt atacttagcg atcgagcgca    292860
     aattgccttc agcatcaacc cgtagggctt tagcgggggt acccttacga aagatgttct    292920
     gccggatatc cttgactata tagcgggcat ggccaaaggg agcaatgaat tcggggtacc    292980
     aaagccggtc accgcatttc cattcaggaa ataacagctg atactccccc gtttgatact    293040
     gggcttcaat ctcttcagaa agccacgccc aattcagaaa tcccacaggt tgcccaccac    293100
     tttggtagta gcgaaattga tcgtgcatca agctaggcaa tatgcgggtc tccaagtctt    293160
     cgagagtgta ggaccgatgg aggggagact gcatcatcaa ccaggtgatc gatccaagca    293220
     gctgtagtcg ttgctgtact tcttctgtgg tgacttgaga tagaatagtc ggtgcttggg    293280
     ctataggaga atcattcgct gccgaaactt caatctggtt tagagttgtc tttacagctt    293340
     ttggaatatc ttgagtcatc atgatcatta cttctagtta tgggggtaag cgaaaaagga    293400
     tagacgggag actgaaattt ttgagtggcc tgtacgtcga tgcttctact atcaccaaat    293460
     ctctgagtag attaaatccc gatttattca gataagttca ggtgtttttc caactcacaa    293520
     acccaaggaa atcccgcaga atggtctttg agtgcaagtc aagccatgcc acgggagtga    293580
     ggtgattaca gatgtcacaa atagcgaagt ctttctgggg taggaggctt agattaccac    293640
     ccgttactga gaattaattc tttgcattga ccattattct tctgctccca gctgatattc    293700
     aacgattgag cgagaaccat cttcttgagt tcggatcatt ttggcggttg tgccctgggg    293760
     aaagatattt tgacgtaaat catcaaacat actttggtca tgaccaaagg gcgaaataaa    293820
     atcggtacac cagagttgct caccactttg ccactcttgc ggcaacagtt tgtagctgcc    293880
     tgtttggtat ttctcttctg cttcttcgga taggtaggcc cagctcacaa atccaatggg    293940
     ttgaccgttt gcttcgtagt agcgaaattg gttaagggta aggctgggta aaattctggc    294000
     ttctacttct tcgatggtgc agtgccagtg ctggggagat tggagcatca gccaggtgat    294060
     accgcctaaa agctgcagcc gctgacgcat tgtttctggt gaggcttgag tggcctctgg    294120
     agtatcttcc ctttgctcta aggtagagtt ttaatcctct gttgactctg cagaagatgc    294180
     aatattatct gggggctcag gtattgtttc ggtaggtgct gagactactg cgtcctcaac    294240
     aggaattacc agtgttgctt caggcgcttc ttggatttgc tctaaagcga gttcagtttt    294300
     ttcgggggta attgtagtca tgattgttat ctgtattgat tgggttgaag agtttagttc    294360
     tttgaagcta tgcttatcgg cctttgcttc gttgtcccta ctatctctaa atcaatcagt    294420
     agataaaatc cccttttatt caggaattta catcaggtta tgcaatgaaa ttcttttagg    294480
     tgtgaaatta agattgagcg aaaacaaatc caacttaagc tggtggctca gggcgatcgc    294540
     aaataagaaa acccctagtc caagaagacc aactaggggt tggtgctggg gggcagcact    294600
     tagcttcata atcgaagatc cgagccgcag ataaaatccc aatttattca tatatattca    294660
     ggtctttgtt cagtcctgtc caacccaagg tcatagccaa ttacccacca agacaaatgg    294720
     actccaaaaa tagggggctc taaacttcgg gttcttcatt aacgccaact gggcctgacg    294780
     gaacgccgat gctttggttg tattcggttg ggccaacgcc tgataaaaat ggcccataaa    294840
     ggccgctgct gcttggtcgt ccaacgacca taatccagcc aaagtgctgc gtacgcccga    294900
     gcggatcgcc atacctgcaa tgcccaggac agcccgacta ttgccagtcg ctgtttcaca    294960
     ggcacttaag accagtaaat caatgggcac ttcagacatc agactccgac ttcgaagtaa    295020
     agaagccatc gcctgaatcg acagttttcc ttcccaagtc aggataaatg tatcttcagg    295080
     actggccccg aactcggcat gagtggctag atgaaccact tccgaagaca cctctgtcag    295140
     gtaatcattc agattatctc gcgtcaaatc ctgatttaac aacacatcat tgtcttgaat    295200
     ctgagcagta atctgctcaa cttctttggc cacaaagggt aaggcaggga acccagaccg    295260
     agcctcactc acacccccta ctagcaattt cactcgctcc ctatcttgtg agcgaggtgc    295320
     taatagttct aaaccagggg aaagggcaac gttatacttt tcgattaagt actgttcgcc    295380
     atcatagagg gtggtcaagg gtaaggtgcg caaggctcca tccgcgacaa acaccaacgt    295440
     ctcgatatcc tgttgggcta aatctgccga agccgggtcg atgacccagt cataaattag    295500
     tttgagtttg gtcaggttgt tcttttggac agaccccaag ggagtggtga gcgatctcag    295560
     cagttgattc accgtggtat ctacctgacc aggctcgatt ggggtgctgt agtgacgcaa    295620
     cggctgattg ccgatactga ctattacatc gacccgatcc tttaagacaa ttgggtaaat    295680
     caccgcagct ttcggatcca cctgatccgc tgctaagggc tgtgcttgaa cacaggcatc    295740
     ctggaagtaa tcctgaattt cattgagctg caagtcttcg ataagcttac gggcctgcgt    295800
     cagattgctc gatgcctctg tctggttcat atctccttct agcagcagtg caaccaactc    295860
     ccgataaacg ggttccaccc catccctgaa ggtaaagcga acatcatcac tggccgtgct    295920
     cagatctccc cgcagagaac gtagggcagc aacggcatcg agataggctg aaatcgcccc    295980
     ttgacgattg ccgagttggc gacgatagcg gcctagttgc caagccagtt gatacaacac    296040
     ttccggggcc tgctgtcttt gcactcgctg cagggcttgt tccgtcaacg acaaagcttg    296100
     agaccattgt tgggcttgac cataaattcg tccctgatat cccaggatgt aggattgagc    296160
     attgggatcg tccaactctt gagcttgggc ctgaattcga gacagaaggt tcaatagcgc    296220
     ctgggattca tccagcttcg agtccaacac tgtttcgatc agatggagtt gagcataaat    296280
     cccctctcgg ctactgggaa gctgctgggc ttgaacctgc aattcttgaa atatcgtcga    296340
     tgccgcagga tctttttgca caacgagtag atcatatcga ctcacttgca cctgaaattg    296400
     aatcagggat gtgggggcaa tctcacgggc ctgctgatag tagcccaatg ccttttgagt    296460
     gtttccctgg ccccgaaagg tatgtcctaa attcagaaga atcgtactgg ttagggctag    296520
     ctggttcagg gattgggctg ttgttagggc tgcttcgagt tggcgctgtg accgtaacaa    296580
     attaccttca gcccgcgaca ccttccccag attcaactga cctatggcct tgacgggaga    296640
     cgggggctgt tgttcaaggg gctgcatgag ttgcactagc cgttgttgag tttggcgcag    296700
     ataacccaga tcctgaagaa cttggatttg attcaactgg gcctgcaggt ttcccaaatc    296760
     gtctccagcc cgttgataga ctgcagccgc ttgttgccaa tcctcaaggg ctgcttgtat    296820
     attgccgcga gtaagaaaca aactcgccct tgtattcagc acttgggcat gaagagcggg    296880
     ctgctgggca atcagttcgg gggtcaggac cgcttggctg gcagccatag cctctctcgc    296940
     tttatcccaa tctccaagat gatggtaggc cagcgctaaa tgactctgaa cggaagcata    297000
     agcaccagga tgcttagact ttgatagttg gttaacggct tgcgtccagt aggtgatggc    297060
     ttcaggatat tttgcctgtt ggtattcttg acgagccgct tccagtaatt gggggagtga    297120
     acgagacgac tctccctgca aatagtagtc acccctagca gtaaccacta gttgcttcgc    297180
     ttcttgcaaa acctgttttc catcttgagg agcttgagtt cttaaatccg ataagagata    297240
     acgtcccaca gggcgacttg atggcatcag aggtaatccc ccccggcccg ttacgatgaa    297300
     ttgagactgc ccagaccgag gaacagcaca ggcatctgct acttgtgtac tgttatccaa    297360
     cacattctcg ggtagctggg tcagggaatt ggtcggatcc gtctcaatgg tttcaataat    297420
     agtatcgcca tttactccca atttcgaaga agcagaaata ttgagaaact gtcggccaaa    297480
     aatcgcattc gtgaatatat taatttcacc cccatccccc tcaacggcat tggcaataat    297540
     ttgattgagt tcaccaggga acgccaagat aaactgagcc gcgatatcaa tatcgccccc    297600
     attaccaaag cgtcctgaat tttccgtaga gatcgtcgat ccacccttga agatcaaaaa    297660
     ccgcagtaac tgtgtatccg tcccactaat aatgatattg ctgccatcag catcccccct    297720
     agccacggtt gagatgcgac tcccgttgag gagttgcaat gaatctcgaa ctgacagctc    297780
     aatattggct agattgcctt ccacagcctc agccaacaag gctgcattat ccagcacaac    297840
     gttattgccc cgaataaata agctccccgc agcccctgca ttcgtactgc tcacagaaat    297900
     ttgagcccca ttactcactg tgatatttgg tgaaaaaata tccacattac ctgcattgcc    297960
     ctctcccggt gaactggcaa agatgccact tgggaatcgc gtacccgtgg gatctaggac    298020
     aaagggagag tcagcattgc ctggaggcag ctcaatccga ggtgaagatc cagtgataaa    298080
     aatcccttga ttagcaataa tcgaaacatc cctgccattc ccttctgact ctgcaatggt    298140
     ggaagccgaa atttgtcccc catcctgtag ggttagccgt ccagttacca agtcaatatt    298200
     cccaccatca aatggcccag agttctgtaa ttgggtaata atccgactag gctgcccatt    298260
     caacgtccct tggagcgtta cagattcagt tgtgttgatc aaaatatcgc cactatttcc    298320
     aaacccaaac gctccggcat caatagtgga gccattggca aggatcaaat ggcgggcatc    298380
     aatgcggaga tcgccactca ctccttcaag ggttgcatct cgaatggccg tagacacatc    298440
     tgcaatccca gcgaaattgt cacgagccgc tgcgggatct ccaactaacc gaacggtatc    298500
     acgagcccga atcgtcaggt ttcccccctg agcgttacca aacaccgttg aaccaatcag    298560
     cccaccaatc aatgttagat tctgagtatc aatctcgata ttcccacccg tcccgcctat    298620
     catctctggc ggtagaccca gatcttgagg gatgaaactt acatctgcag taatcccaat    298680
     gggaggtcgg ttgcgatctc cccctcgatc atctatcaga atattgttgg cacgaatccg    298740
     aatattgccg tctgaggtat tgggaccaaa tttagtagta gcgatatcac tattttggcg    298800
     aaccaataat gaatgagtag tgagattgat gtccccacca gacgcttggg tgacagaagc    298860
     tattcgggaa cccgaattca gacgaatgtc aggggtgttg ataaatatgg ctccagcgtc    298920
     actctcaaac ccttcagcta gactggatat ttcggattct ccactcaaaa ataggcgatt    298980
     ggtggcattc atatggatgt cacccccttg accgttttcc tcaacaaaag tctggatgat    299040
     actgccactc aattgaatat cccccgtccc cttgaccagg atgctcccac cttgagtatc    299100
     aaacgaatcg acatcctcgt ttaaacctgc caagagcgtc gtttcgataa atgagatatt    299160
     ctgagcctga aggacaatat ctccactacc ctcactcaca gtattaatgt ttgagttatt    299220
     gagggagaga ttggtttgtc ctaacggtgg aacagttaaa aaggattgtg gcgacgttgc    299280
     atccagatta aaagaaatgg tgccgggttg tgaaagtcca gagagtccaa catgccctcc    299340
     aggagccagt atattggcat cattcagggc cacatcgcct cccaataaaa ctaagggctc    299400
     tcctacccca gccctcagag ttgcgccatt gaccgagatg ggctgaggat tagcgccaaa    299460
     cttaactccg aggggcaccg aaattgtgag taagggtggg gcattaggat tcactgcatt    299520
     aaaggaagta ccattggcaa acaagaattg atccgcagtg gtggccataa acgctccagc    299580
     cacatccaac tgtgcgtttg ggccaaaaat aatcccgctt ggattagcca aaaacaagtt    299640
     agcaggacca tcaacgccta gtaggccatc aatgttggat gggagtccgc ccgttacccg    299700
     agtaatgata ttatccacag aagctggatt ctcaaagaaa acggtctggt ttgaattgat    299760
     actaaattgt ttaaagctat gaaacagggc ggtatttcgc tgagccccgc catcaatcac    299820
     gaaatcgttg gccgttgccc cagtcgaaac cgccgactgt tccattccca aggtgtcgtc    299880
     tgggacaatc acttgagcca gtgctatgtc tgagaacaaa aagggggtca atgtagcacc    299940
     caaccagaag ccagaagtca tgattggtct caaacaacat tttttgagcg tcaaatcgca    300000
     cctcgacctg ttcatgatca gattagatct ccagaatgtt tactgaacaa gagagaacac    300060
     aactttcaat tcaagggttt aggaaatgga gggttcgaat ttaaggactt tacgggagca    300120
     cgctgggtcg aatccttcag cagatttgca attttgacta atgcctggcg atgttctgcc    300180
     tccacctcta accgtgcgag ttctttcagt aagtctggaa gttgatggta agagtctgaa    300240
     gggctggcat ccaccaacag ttctctcacc gtatcaaacc aatagccagc ctttgcgaat    300300
     accgcagcct tttgttgtgg cgtgcgggcc tgggataagg cttgtttcaa agcgggagaa    300360
     ggtgccttga catcaatttc agcgataaaa aactgattaa acctgtcact gctgggattg    300420
     caggccatac tcagctgaac aaaataccgt tgacccgttt gaagcactga cttatcttcc    300480
     ggcaacgtgt attgaattag tcctgaagcc gtctctacat attccaattg atacagaagt    300540
     tcagagcttt ggtcagaagg gtcggtaaac aaggaaatct gaatgcgata gggatgtgat    300600
     gcgcttataa accaagcaaa cgttggggtc acagaacttg ttctgcccac atgctgaagt    300660
     ggggctaaca atgtgatggg taaagtcttg ggctggtcgg atgccggcgg gcgaagtaat    300720
     ggcttcggtc ccatgtgact tgatgcttga acaggttgtg agtgctcaaa agtcagatcg    300780
     caacttcggg agccattaga gccaaaaact ccctttggag gatctcccgt tggcggttga    300840
     tatcgtctgg cccaggctgt actgggaaac actaaaaaaa atgcaaagat aatccctgca    300900
     atcgggtggg agtggatgag tttactcctc attcctagtc cattaaatgg atgagacagt    300960
     tgttgttcca tgacaaatga gtaagtgaga tgaataatat tttgtgattt tggctgcggc    301020
     ttttctactg actgcataag ctatacagcc caatttgcct agccttgaag agtacggagg    301080
     tattgttttt ttagaaactg aattttattt gcctaattta gatagattag ggatgattag    301140
     tctctagaac ttagttctcc acattttcat aaagcacaaa agaaactatt gctttttaca    301200
     tttcaatctt ttaacaagta cttcaaaaaa catcattcta ctgaatggtg aagttggact    301260
     atccatgctt agttcatctc ggcttagtgt cctgtgcaaa atgccagtcg tttgaaaagc    301320
     tgagtttttc agttgtttcc atatctttgg gctagcaaaa tatatttgct taactttttc    301380
     ctctgaaaag atgttgatgt ttcagtggga attatctgga tttatataca tcgttgatgt    301440
     tccaattatc gccaaatcaa tcagcagata aaatccctat ttattcagat ttattcaggg    301500
     aaaagttcag gttgtaccat gaatgccttt ctggcttgaa tctcgttaga gtgaaaccca    301560
     ctagcgacag tatcggctaa tatcttcacc acactggtcc gcaagatagg atagggctcg    301620
     aaatcttaag gcaactactt cttcataagc tgggttgagc ttgcagagtg gaggaatgtg    301680
     gaatagcgta tgccccaaaa agcgaatatc tcgttcaaac gggcactgag ttggcacgag    301740
     ctggcaaatg agattagcgg ttgagcgatg ttcgacattt atggaaacaa atactgagtg    301800
     gacgcgtttc aaaaaaaatt gtttgagact ttgttttgta gatgaatgga gcctgagacc    301860
     gttgatgtga aacataagat ttcctcgact ggaattggaa tgaaatagag ttagtatgat    301920
     gaggctaaac tgagttcact gcttccaagg agaagtagaa accaaacata aaaaaaatga    301980
     cccaagtgct aatgatgttt gtaaatagaa ctgtcgatat gattggtgat tctccactgg    302040
     ggacgtgagt gatagtttga ggttgcactt ctgttcatcg ttgatttcac tatcaatgaa    302100
     atactcagca gaaaaaatct aggaaagttc agtttcattc aggtcttagt tcaggtactg    302160
     aaaaaatggg ttacatcatc tgtactaaac tactgaaacc aaagcctagg aacctttatc    302220
     taagcaggag aaagaagctt acaagaaaca ttgtccttaa cctgttgtcg atgaacggcc    302280
     aaatggagag gtgtttcaga aggactaatt ttgtagataa agttgtgacg agcagtattg    302340
     taagcgttgc tggtgaagtc aagcttcatc tgttctagtt cttcttgccg ataaattgct    302400
     ataggcttgt attgttcatc caaaaatcgt tgtttattct tgagccatag aatgtcctga    302460
     aaatcctctc cctgagctaa gctctcagcc tctttgataa cctgtgtctt gaagtcagat    302520
     actgtattgc caaaatagtc atcaataagg ccaatggact ttgcagcccg tgtacccatc    302580
     ggcatacaca cactggtcag cttctgggcc atctctggac ccactcgtcg aggcaaggaa    302640
     taggtccaat actctgagcc atagagcccc attcgcttat agtgagggtt cagcacaatg    302700
     ccttcgcgag catacactct gtccacagct aaagccatca tcaccccacc cgcagcggca    302760
     ttaccttgca tcgcagaaat aacgagatga gtatcagttc gtaatacctc atatacaaag    302820
     tcattgatgg cattgatgtt ttgccacgac tctgcagcag gatcagccga tgcttctacc    302880
     acattcaggt gaataccatt ggaccaaaaa ccttctcctc ccatgagcaa aattactttt    302940
     gtgtctttgg ttcgagcata gagataggca ttccgcaaac gttggcattg ctctgtgctc    303000
     atggcaccgt tatagaaagg aaaatgcaaa tagccgacct ggttcttttc ctcgtaccaa    303060
     atatcccgaa aagtaagttc atgaggagat aactccaaag acacaggaac ctctggcaga    303120
     gcgtgtatgt attccctcaa tacttgagca gcaggtagct taaagaacac ttgctcctct    303180
     tttttcttgc gctttagatg ggtaatccaa acagcgccat caatcgtcgc tcgacatata    303240
     gccccatacc tttgggcaat caattctcct ggcttacccg ttaaggtatt ttctggatgc    303300
     gcaccataga gatagaattg ctccccaaag agtacatcaa gcaaacccgg ttggctatct    303360
     gcgctgcgaa tcttacggac aatctcagca gtggtatcac tctcccagga gattgcccta    303420
     tgagactgtt tgaggggatt acgccaagta cctttgacat ctggattacc gtaatcaaga    303480
     ggttcaggct gatatttagg atcaataaag ttggctaagg tttgcttgat acatgtgatc    303540
     gccgcttgag cgcccttccc tcgatacaaa tcacttttag tttctccttc taaggggaaa    303600
     ttaatagatg cccaaatgtc acccgcatcc atttctgcat ccgcttgtaa agctgtcacg    303660
     ccccattcag attcatcttc gagaatcgcc cagtcaatgg acgaagggcc gcgatcacct    303720
     ttgatacctg ggtgaataat gatgcatagg tgttgtttcc aaatatcttc tgggatagca    303780
     gttttcaaga agggggcaac gatgacatcc ggttgaaaca aatcaactgc ttggcgcatt    303840
     cgttcatgat ccaaagccag ttctatggaa acttcgtggc ctaaatcgac taactcgaca    303900
     tggaagcgct gagtcatact gttgtaggct gaggcaaaca ataaaatttt cacgagatgt    303960
     tctctccgtt ttagttaggt tcaactacgt gagaaaaggt gacccttgtt gataggtcat    304020
     gaaacaactg gagctaggat gctgagttgg cgatcattca gcctcttctg atgcagaatg    304080
     atttatccgg ccagcagctt cataacaatc cagcacaata tttgccccct cttaaattga    304140
     gatggcttga acaatatcca tgttcttagc cgctattagg cggaattttt tcccatcact    304200
     atcagtgagt tcgtagcttt aagctgaagc cgcaggggta tcagcagcaa gatagttact    304260
     taagtttctg gcaataacgc catttgttta gctaggtgag tcatttggat gctcctttaa    304320
     agattaaaga tcaagcgaag atcttctggg catactgtgc aataaaaaaa gttgttggta    304380
     gttcagcgta ggtaaaatgc ctagactgtg atgcttcgtt gttgaactca atatcccaaa    304440
     accgaatagc agataaaatc ctgatttatt caggaaaatt caggtatcgc tcagattgtt    304500
     gtaccaacag aaaacgcttg ccactcacta ggcatattcc ggggactggt gttgaagcga    304560
     agattgactt gaaatgattt ggaagtgggc accccacaga atagaaattc ttttttgagt    304620
     gtggtgagcg tttacggaat cgatgtgata actgcaatga gctaattaca tctctaaaac    304680
     atcggttctg ccccttctgt ggccaggcgt ataagctcac aaaaacctaa tttttgaagt    304740
     ctgaaaagta ctgataaatg tagtttacag cgatcctgtg agaaaaattt ggtctatccc    304800
     ggcatgaggt gaatttaaac cctgtggtgc aaactatttc gcgtttgact caacaagctg    304860
     atgtactgcc cttacatcga aattgccaca atgtactcat aaggctatgt caaaagctcc    304920
     taacgcttgc aaagaacact tttgagaatc gctcaacccc gctacccctg taatgttcat    304980
     tccttcataa gggcgatcgc tcctgaaggt tttaatcagc tcacccgttg ttgcattcca    305040
     cagcttggca gtttcatccc aagaacccgt aacaaaggtt gtaccatcag ggctaaatgc    305100
     taaatccata atcatgcgct gatgagcaaa tagttggggc tggtgggttc ccttgttggg    305160
     gtgccaaatc gtcaatcgtt ggtcgccgcc accaatggca atcatgagtt catctctagc    305220
     actggaattg gaagatgtcg gagaaaaagc cactgccatg gctatctgct ggggtaaaac    305280
     ctgcaagcat tcacccgtgg ccgtagacca taatcggaca gtctggtcaa acatactgcc    305340
     gcttacaagc tgtgttccat cgccactaaa ggcaatactc tgaacagccc cttcgtgatc    305400
     ttctaaggtg ttaaaacatt tgccttcctc aatgtcccac agcttgaggg tttggtcata    305460
     gctggcgctg gctaacaatg tagcgtctgt cggactaaaa tctaacgacc aaacacaact    305520
     atcgtgaccc tccaaaactt ttaggcactg gcccgtttgc acatcccaca gacgaatcgt    305580
     ttgatcgcca ccgccacttg ccaagaggct accatcggca ttgaataccg tagtccagag    305640
     ctgtttggtg tggcctttca gaattttcag acattgtccc ttttgcgcat cccatagacg    305700
     gatggtttga tcttcaccac aactcgctag cagcttgcca tccggactaa agacgacaga    305760
     cgtcacccgg cgaggatgcc ccttgagggt tttgtagcaa gttcctgttg ctacatccca    305820
     aaatcgtaag aactgttcgt caccgctgct cacaatggtt ttaccatcgg ggctaaaggc    305880
     gacggtccaa acctgctgag tatggccctg caaggtttgc agacactgac tggtcaagac    305940
     atggactgat tgaggttttg atgtggcttc agatgtgcct gactccagcc acgaaacatc    306000
     ccataaacga acagtctgat cttcactacc gctggccaat aatgcctgtt ggcgagacag    306060
     tttttcagat gaaagcatgg acattagggg ctggggtgaa aacgttaccg accagattcg    306120
     gtggtcatgg ccatccaaaa tcttcaagca gtgcccggaa taaacatccc acaatctcac    306180
     cgtttggtct tcgctaccgc tagcaatgat attaccctgg gggttaaaag ctactgacca    306240
     gatccagttg gtgtgccccc ttaaggtgtg aatacagcta ccgctgctga cattccacac    306300
     cttaacagtg ttgtcatggc tcccactggc taccctttga ccatcaggac tataagccac    306360
     agaccagatc cagttgtgat gaccaattag ggttttgagg cactttccag ttgcaacgtc    306420
     ccacagcttc aacacattat cttcaccacc actgataagg tgctgaccat ccatagagaa    306480
     ttgaacggac caaattggct gagtatgtcc ctcgaaaatc cgcaagcact cgcccgtgta    306540
     gacatcccac agccgtaggg ttaagtcttg gctactgcta attaaagtgt gaccatcagg    306600
     actaaacatg acggtacaca cttggccctg atgagcactc aaggttctta agtgttggcc    306660
     ctgtttaagg tcccacaaca tgatcgtgta ttcgtcagat ccacttgcca gcaaagtgct    306720
     ttcagagtta aaggctacag tacgcaccca gtcagaatgg ccttgcaatg tgtgaagcgg    306780
     ttggccatta gcaacactcc agacccccac atcacagtta gtatcacctg ttgcaagcag    306840
     ctctccatca gaactaaact ctgtggcgag aatgccacta aacgtttgca taaaaacagt    306900
     tttatgaaat ttagcttgag tgaagtcaac ctggtgcaga gtcatatctt gcagataggc    306960
     ctgccagatt gccaggtttg agaaattata gccttgggca tctaactgaa gctgacgaca    307020
     gagattgagt acatttccgc caccatagct gacacgatag acttcgtcac tgcgcagtgt    307080
     atctagggtc gcttgcaagt gcttggccat accagttagg gaaccgaatt cttggttcag    307140
     ggcatgtata acagggtcta aaattaagcg gcattggctg atgcgaatga aatctttgat    307200
     gttggttttg atcagggcgt ggtgggtaaa taaatcaaag gtttggtgaa ttaactcagt    307260
     ggtgatttgc tcaataaagt gctcggtgac gtactccatc actacaggct gctgggtata    307320
     gctgccgatc tgacgttcaa tcagatttcg gcgacagagg gcctccaaag cttctagcaa    307380
     acgatagcgt ggcactgggg gaacgatatc ttcttgcaaa gcgtctacgg ttgtccaatc    307440
     tcgattgatg gccaaccaat acatcagcgt ctgctccaat cgcgagaggc gctcgaattg    307500
     ctgatcgagg agttggcgaa tcccgttaaa caatactgtt ccctgggcaa gaaaggtggc    307560
     aatgtctccc tcaaacaagt cttgaacaga ggtagccaca atcttgagcg ccagtggatt    307620
     tccaccgcag gtctcaatta gctgggagcg tgagattgca gaaccggaca acccttttgc    307680
     cgtaaggatg gggtcagcat cggcatgcaa ccccccgagg actaatgatc gcacagctaa    307740
     agctagacct tcttgagcag caatggcttc gggtttttcg cgactggtga ttaccagaca    307800
     actcgtatga gctatatcac ccactagctg tagcagttga ccatactctt cataacctga    307860
     acgaaagagt cctagagatt ctggctgcag aatagcttct aggttatcca gaaccagcaa    307920
     acacttcctg gcgcgcaacg tcggcagcag ggcactgagt tcaggacgag aatcagtttg    307980
     tcccgagagc aagggtacca gttcggtcag cagcgtctcc aacggtggag cattccggag    308040
     actacgccat acaatctgat caaatttgga ctgaagctgc tgggccagtt tgacggctaa    308100
     ggtcgttttg ccaatgccac cgatgcccag caaggcgact aggcggcaag cgtcacccac    308160
     aatccactgc tggagagtgc tcagttcggt agaccgacct aggaagaagg agacatctgg    308220
     agcggcgccc caatcacagt ggacggtctg cgggagggga ggaggctgag tttgtgcctc    308280
     cactagatag cggctcagag caacctgaaa gcttgttttg gtgatctttt cgcccagagc    308340
     cttggagagc agccgccaga gtttagggcc aatgtctcgc ttaagatagt tgatggaata    308400
     gtgggaggtg gcagcaattt gctcgtaggt ttgatctgca atcgcaccca aaagaatcgt    308460
     agtctctaca tctgagagat agcgattggc ctgtttaaag acggctgcat tagcggcagc    308520
     aacaatgcgc tctgattccg tcatggcatc taatggagaa cctgactgcc attagcctaa    308580
     cttacctttc cataacttga gcggcatact accatccaga aatctcgccc agatgatcct    308640
     gatgactcct tatccaaatt tgtcggcact aacgtctttc ccatttaaca ggctcgtttt    308700
     gaatagggat ggagatcgtg gatcaaatta gcattgaggg gattgcgtga atatgttgcc    308760
     atcctccatc gattagaggt gttgtacgac acttgacctg taattccctg ctagaaggtc    308820
     ttcggtggca tggatcttct aatcacctgt atagggagtt tagacgacaa aatgacgcat    308880
     aagtaatact tagctgtcga gtaacagtgg caaaggtata tgagcaggaa atgaaccaac    308940
     ctattgtttc agagaaacta cgaattcgac gatttgagcg agatgatgtc gaagactttg    309000
     tcagctttat gacagactct gactctacca aattcctgac tttcggtgaa gagcagaaaa    309060
     gccaggaagg agccacaggg ctgcttaaag caaccatgga atcctatgat tccgatgcac    309120
     cgctgatggc tttcgcagtc gaaaatcaac aaacaacgga atttgttgga ttctgcggat    309180
     tgactccacg tgaggaaggt actgtggaaa tcatgtacgc agtgatgcca aacgaacgag    309240
     gtcaaggata tgcaactgaa atcgcggcaa cattggcgca gtatgccatt agccaacttg    309300
     gctatcgcag agtgatagct cccatctctc ctgaacacaa aatttcaaag gccgtagcgg    309360
     tgagggcagg ttttaaggat catggtatca gtcagaaccc agattctctg gtgaaggtgc    309420
     acctattcgt atttgagtag atatagctct cgcccctcta ttgatctaga tttcgtagca    309480
     gtaccaagat gtctttcttg tagttgcccc cgagatcgct tgacgtttag gtgcagttcc    309540
     ccaatataca tccataacta ttcctgaact tttctgtaac gacagcccag agaacctgtc    309600
     atatagtaag cgacgtggat gagtgagata tttctaaaca ctcgcatcca ttcagatcgg    309660
     acagtcgtat agacaataga tggtaaacgt ccagacttct cttaatcgtc tgcacactta    309720
     tgtagtaaga cagtgtcgcc tatttagagg ttggcacaga attctgattg ggaggggttg    309780
     atttgcaaac caatagctta tcgaaggaga ctaactatga ctcttcaact aggtgataca    309840
     gtcccaaatt ttactcaaaa aacaaccgag ggtgacctta acttttatga ctgggcaggc    309900
     gattcctggg ttgtcctgtt ttctcaccct gcagattaca cgcccgtatg taccactgaa    309960
     ctcggcagcg ttgccaaact caagtctgag tttgccagtc ggaatgccaa ggtgattgcc    310020
     ctgagtgtcg atgatgttaa ctcccataag ggctggatta acgatatcaa cgagacccaa    310080
     aataccgttg tcaactatcc catcattgcc gatgcggatc aaaccgtggc caatctctac    310140
     ggcatgattc atcccaatgc caatgccaag gtgacagtgc gaacggtttt tgtgatcgac    310200
     cccgacaaaa agttgcgtct gacccttacc tatccaccga gtacggggcg aaactttaat    310260
     gaaattttgc gggttcttga ctctttacag ctaaccgata actacagtgt ggccacgcct    310320
     gtggactgga cagatgggga tgatgttgtg gttgcaccca gcatttcaac agcagatgct    310380
     aagcagaaat tccccaaggg tgttaacgaa attaagccct atctgcggat gacgccccaa    310440
     cccaatcgat agcgcaaatc gggtgtgttc cccattagtc aacacaccga tggagattca    310500
     tcttatgaga acccaatctt gtagttctcc caataccgat acagagtcta taccgtctgc    310560
     tcccatgttg agcgcaacgg tcaaagatta tcgagcgatc gcaaatcaag tatccgccca    310620
     actagctgcc catggagttg agcaggatac taaagctggc agtccggttg aggaagtgaa    310680
     cgctttaaag caatctgggc tgatactcct tcctgtccct caggaattcg ggggtgcggg    310740
     agccacctgg cctcagattt ataacgtcgt acagatatta tccaaagctc aggggtcagt    310800
     gggtcaactc tatgctaacc acgcaacgtt agtctctatg ggcaggctgg tgggtgggcc    310860
     gggtcaggca gagcgatatt accgtctgac ctcccagcag aatcttttct gggctaatgc    310920
     cctcaatagc cgagatcaac gtttaaaact gatgagcgtc aatggtgcgt ttcgtctcaa    310980
     tggcgttaag agcttctgta cgggtatggt cgctgctgat atcagcatcg ttctctccat    311040
     ggaggagaaa agtaaccatc ctgtcctgtg tgttgtcccg atggaccgag agggcattac    311100
     ctataacgac gactgggaca cgatgggaca acgtcgcaca gccagtggca gctatacgtt    311160
     ccatgatgtt ctggtgaaac cagacgaggt tttgggaccg cctctgtcta gcggtgcatc    311220
     caccacactc aagtcgctga ttgctttatt ggggcagacc ttcgtttatc tcggcattgc    311280
     tgagggagcg ctggaggccg ccaaggggta cacaaccacc tcagccctag cctggatggc    311340
     atccgatgcg gaaacagcaa cacagaatcc gtttattctg caacgctatg gtcagatgtg    311400
     ggctgagtta caggctgcga tcgccctcgc ccatcaagcg tctgaagccc tacaagcggg    311460
     ctgggaaaag ggaacagctc taacgacaga agaacgaggc gagattgcga tcgtaatggc    311520
     ctctgcccga gcaattgcca tccaggcagg catcaaaatc accacccaca tctttgatgg    311580
     gatgggacct agagccactg ctgctaacta tggctttgac cgctactggc gcgacctccg    311640
     cacctttagc ctgcacgacc cgattgatta taaattcaaa gacatcggta attggatgtt    311700
     gaatcagcag tatcccaccc cgagtcaata ttcttaacct caatggtgaa acggcagcag    311760
     aaccctcaat acggcaggcg aaacgctctg cagactgttg gagcagggtg agataaaaaa    311820
     aggagcgaaa cgatgttatt caggcaactc tatgacccgg agtcgagtac ctatacctac    311880
     ttgattgcgg attccaagag tcgtatggct ctgctagtgg atccagtgct ggaacaagtg    311940
     gagcgcgatc tcaaactact acaggagctg aagctaacac tcagttcctg tgttgagact    312000
     cacattcatg ccgaccatat cacgggaacc tatcagctcc agtcccagac gggctgcttg    312060
     agtactgtcc ctgcacatgg ccctgctgtc tgtgccgatc gccagctaca ggatggggaa    312120
     attctaaccc tgggtgatat ttcactgaag gcgatcgcta cccctggcca cactgacagc    312180
     cataatgcct atctggtcaa tggccatcgc gtcctcacgg gtgatgcact gttgattcgg    312240
     gggtgtggtc gtaccgactt ccaaagtggt gatgcaggaa ccttatatga ctccgtcact    312300
     caaaagttgt ttacgttgcc agatgcaact cttgtctatc ctgggcatga ttatcacggt    312360
     ctaaccgtct ccacgattgc ggaagaacgg cagtggaatc ctcgatttat gggacgagac    312420
     cgcaatacct tcatcgaatt catgaacgcg ctcgatctcc ctgaccctca aaagatgatg    312480
     gaagcagttc cggccaatga gcactgcggt ctagtcgttt caacaactgc aaggtaggtg    312540
     aacactatgc gtattgccca tgatattact caactagttg gtcacactcc attggtgcaa    312600
     cttaatcgga ttcctgctgc agaaggatgt gttggacgta ttcttttcaa gctagaaagc    312660
     atgaacccct ctggctccgt caaagctagg attggggtca gtatgattca agctgcggaa    312720
     gaagcaggtc agattcaccc agacaagacg gtcttggtgg agcccacggc aggcaacaca    312780
     ggtattgcac tagcaatggt agcagcggtg aaaggctatc gtctcatcct cactatgccg    312840
     gagaccatga gtcaggagcg gcgcaagctt ctaagagctt acggggcaga acttgttttg    312900
     acaccgagtt cagaagggat gaaaggagcc atccaacaag ccatggactt agtagaaact    312960
     gtgccccacg catttcttct gcaacagttt gagaaccctg ctaatcctga gatacatttc    313020
     caaacaacgg cggaggaaat ctgggcggat actgaaggac aggtggatat cttagtggct    313080
     ggtgcgggaa ctggtggcac aatcacaggt gttgctaaag ccatcaagcg caggaagccc    313140
     tcgtttcagg caatcgctgt agaacctcaa tctagccctg ttttatctgg gggaaaccct    313200
     ggtttgcatc aaatccaggg tattggaccc ggatttgtac cgtccgttct gcaagtcaac    313260
     ctattggatg aggtaattcg ggtcgcagat gaagatgcaa tcgccactag tcgtcgttta    313320
     gcttgtgaag aaggattgct atctggcatc tcatctggcg ctgcgctttg ggccgctctg    313380
     caagtagctc ggcgaattga aaatgcagag aagttaattg ttgtcattca acccagcggt    313440
     ggtgaaaggt acctaagtac ggggctattc aacaatttga tgccaggact cagaacagat    313500
     gttctcaacc aagacaaact accccataag attctgattg gcagatgtgc aaactgaaga    313560
     atagaaggag agcgattaaa accgggggaa acgttgatat agcagtacac tgaggaaatg    313620
     aatgcccccc cagctctggt tatattccag ctgaaagctg tgatggctga ggccgatcag    313680
     agaccatcgc tggcatcaga ttgatcatag gttgatagca tcggagatcc acatgttgaa    313740
     cgtcggggac tatgacgggc agcgtatcac catccgagtc gcaaagcaga cagtgtggta    313800
     cggtgctgaa ggtctccaag aacttctgtt catggcttct gaaagtggtt ataaagtagg    313860
     ctcactacct aagctatatt gctgattgac tgagagttct ggaaccaact ttcagggttg    313920
     taggtcgcag acacattcac taatcggtca agattcttac caaaatatag actcaatgcc    313980
     tgctgtatcg gtggtgtacc agccttcgta cttcctatat aaatatcagg atagttatag    314040
     tagcaacctt cagttccaat accatttggg atacctcctg aatcactata aatattctga    314100
     tatatttgat tgagccagct cacatgcgcc gttttaagtg tctcatcgtc ataccctggg    314160
     ggcaaactag tgacccaata gctctggtat tgcagtttca taattgagct tcgttgagtt    314220
     atggctgttg catttgaagg gactgtattg atctttcctc cataggcatc aaactggatc    314280
     agtgaatttt tcatattcac tgatttccca ttcggatcta taactttttg tgtcagccca    314340
     ctataggctg ctttcatcat agaatctgta aacttttgag tatgatacgc agacttatat    314400
     ttaccgtatc tgttaggccc agaggcattc aactgctgca taccttctag gaaggtatag    314460
     ccccgagatg aggattccgg atttaaacct agagctttag tacttgggat atatggatgc    314520
     ccatttatca ctaaatcatc cattgaaagc ggtgataata actctgcttc ttttagcctg    314580
     ttttcgtggc ggctgagaag ttcagtctcg aaattagtat gtataccatg tagtgattca    314640
     ttgtatatat caacagatga gaagccaagg ctcccagcat ccatatgatt tccatgaaag    314700
     atcccaaaag tattccaaga agactcactt tgattcgtat acacatcttg aaaatagttc    314760
     aaaatcgaac tgaatgtctc aaaagatatg ggattattgc tattcgatag catccaattc    314820
     cagtttaaag actgaatgta aatgtagtcg ggagaatcag gtagattttg gagatcgaag    314880
     tagtatcgag taataatccc aaactgccct cctcccccac cgcgaatggc ccaaaatagc    314940
     tcaggttggt ttgttgctga gcattgagag atcattctgg ccccattttt tcgatcaccg    315000
     atgactatat caatagctat caagtaatcg attgatagtc catagagccg agataagact    315060
     ccatatccac cacccgtaat atgtccgcca agaccaacag agtagcaagc ccctgctggt    315120
     acagtctttt gatagacatt gttgagtaac cgatacatat cccagttgcc caaaccaacg    315180
     tctaaataga tgctgggaat actaccaacg gtggcttcac cataggattt cagaccagtt    315240
     aaatcgataa cggccttcgt acttggattg taaacaaaac cttcataaca atggcgacca    315300
     caggtaatct gacactgccc tggttcaata gttttgtccc taagaacagt attaaaagca    315360
     tctacaacgt caattcccgc tgttggtcga tagatctgta gttgatcatt gctagcatac    315420
     cagcgcttat taaatccttg tcggtcactc actgatgccg gaataatagg agcatcacca    315480
     gaattactca catttatcat caattccccc ttaaataaat tgattgaaat ttaactcgtt    315540
     tcgtatttcg aaatttagaa cgagtagatt cttagttcta tttaataggt atgccacttc    315600
     agagaaatca ttccttggaa ttaaaggaaa cttagggaat agaggtttca ggcttgccaa    315660
     tgttgaagtt agagccttgg attgggggat tgagctaaat gctaagcacc agctctatga    315720
     ggtgaataga gaagcaccag agagcgagga tggggtgact gttgatcagt ctaaaggcat    315780
     tgaactgaag actgttatgt gggggcatgg acaataaaga taagcgtttt taatatggga    315840
     acgtttatcg agaatggaca acacggatcc caaatttgcg ccgaatttca ttgaggggca    315900
     tttcaaggta tcggtcatag ttactccaag gccaacgctt tcgcatttgg acacaatgcc    315960
     aaatcgttat tggcaccaag acgatcgatt ttattgtcgt taagacaatg tcaaagaggc    316020
     ccaactttcg gtatatctct tttgattcct tagacccata tcctcgtaat acttgcagac    316080
     caattgacgt tccaaatata gtgctgatct taacaactgc ttcatcggac agcgtcgtgt    316140
     cacacccaaa gacaacatgg acaacatcat gacagcgaaa gaatctcttc tcagccgttg    316200
     aaacattcct tctctcaact aaccctgaat tacaggagtg atactcttca agcccttcga    316260
     tcagagtctg ggtagaattc tgttgctgat atctatacat tttgtctcct catagaagaa    316320
     gagttatgaa gaatagttgt tcatctcatg tatagtaatt tttcagtaac tactgctgtg    316380
     atcgctggca gatggtgggc gtaatgctaa tctcaacact gtgctctcac acctctccaa    316440
     gataaccatg agtcaagccc taccctccct catcgtcaat cgttccttca tggcagagtt    316500
     cattgaagcg gagaaaccct gctgtgcctt ggggatggtg gaagttgagg atcaaccatg    316560
     tgggtttgta accctgagac cagagccaat gattccccca ggcgcaacgg atctgggttt    316620
     caattttgga catacaattt tcggaaccag cacctatgaa gtgatccact ttgcctttga    316680
     attctatggg ttccagactt ttaacgtgct catcaatccc aataatccaa ttgcccaagt    316740
     ggtcttgaaa cagatgatca agtctgggga ctactttttc tttgccattg atgaagaaag    316800
     tggcagtgct actgcttttc ggagtgagat tggggatgac accttgctca gcctgcaaga    316860
     aaattgggaa cgaattcagc attccaatac gacagaggac caatatcatc atgtgatgtt    316920
     gaagttcgcg gccaaccctc atccaccagg aattctcctc aagtgggtgt gcggggataa    316980
     tatcgagtat ttggatttga ccaaggatag gatgaacttg acgcctgcat agttgattgt    317040
     tccggtgatt atgcactccc ttcttcattc aagacaatcg atgagggcag actaattaat    317100
     atggtcacca ttgagttgtc cattcagcct aattgctttt tcgattatca ggagtctatt    317160
     ggtgagtgca agtcagattt ctcaagccct tctgagaagg tatgagccaa cctgtggcgt    317220
     gagtatcgaa gcagtagagc tgctacttct tctagtcaag cagaaagaca aggttgattt    317280
     tgaattcatt tggcaacaac ggggccgacg caatcctaaa gaattagctg caatgcttga    317340
     tgaactcatc acagcaggtt tgatcagaga ggttccaggt aagagcgcag agattgcaga    317400
     tgggtggaat agaacagaat ccctacaaca acctactggg ctgagtgatg atgattttgg    317460
     cgcctcttaa ataagaagga atatcgttcc aggagaatga agtctctgac taatctttcc    317520
     ctctcattaa acttcgttct ctacttctac tcaatcagga caacataaag gagtcatcat    317580
     aaatgcagca tcaattcatt cttttatgtg ttttaggtcc ggtgtttatt gcactgagcg    317640
     cttgtagcaa tccggccaat gaactttatc agaaacccgt tgatcaaggg caaaaagcta    317700
     tcgataaagc tggaaatgta cagctagaaa ttgacaaggc gcaatcaact cttgagcagc    317760
     aggaaaaatc tctagcggga gagcaaaaca gtcagtaatc gtgatttcaa aatcaaagaa    317820
     gcgtgcagaa gctcaaatta agtaggatgg gaaccctatt cgtcttagat tgggattgtc    317880
     tcctcaacaa cttgccactt cgactgtatc cgctaagtct gctgcctcac cgattcctca    317940
     atctcaatct tccctcgccc gaatcgtcca tcgacctcat cgatgatcga catcaggtgc    318000
     ttgcggtaat acctcagatc aggaaaaaat gaactcgcag ccagtagggg ataatataat    318060
     tgcaagaatg attctagtca tagagagcat agaaaaacta tggcgatttc gatgtataaa    318120
     gcttcggtac ctcctttaat tcgttgcctc aataacttat ctgggattct ggagaaggga    318180
     gctgcccatg ctgagaataa aggaatcgat cccagtgtcc ttatccattc ccggctcttt    318240
     cctgacatgt tgccacttgc caagcaagtt cagattgcgt ctgatgtagc gagaaaagga    318300
     gcagcaagac ttgcaggtat agaagcacct tctattgaag acaatgaagc atcatttcca    318360
     gaactaatca cccggtcaag tacaacagta gattacctaa atactttcac accggatcaa    318420
     attgatggta cagaggataa aatcatatcc ctccccatca gaggtgaaat ctacaaattc    318480
     cctggcttac cctacctact cacttttgtt aaacccaatg tgtacttcca tgtgacaact    318540
     gcttacaaca tcctcaggca ctctggggtt gaattaggta agttcgacta tctagggaaa    318600
     ccagagcatt agaaaatgcc atcaaaacga caggttttaa cccaccagac cgcagccgat    318660
     gcagataatc gattatcaga tctgtctcca cgacttctga gaggatgctc taaaggtaag    318720
     tgcttgagaa ttagctctct ataaacttta cttattctga caaaagcttt tctagctcat    318780
     ccaataattt cggctctctg ggaattagcg tgtagcagtc ctacatttag tgtgtttcct    318840
     ttttcatccc tatggaatga tctgaggtag tacttcagag caatggcgta atggataact    318900
     caattcgcat cccgctcaac cttcctgata ttcgagttct agagctatcg aagactgaga    318960
     gaggggattg gctcatcaag attgagagta cgcttcaagg aacaacctgt catcaatgcg    319020
     gacgtgagat tactgacctc cattgtcatg atcagccttt tcggattcgt cacctgccat    319080
     tatttgaagt ccccgtttac ttagaaattc ggcccaagcg ttatcgatgc aagtattgcg    319140
     atgaccatcc cacaacaact caacatttag aatggcacga acctcgcagt cccaatacaa    319200
     aagcatatga gcgttggctt ctgcgaatct tgatcaattc aacggtctca gatgttgcca    319260
     gaaaactagg cgttagtgag gatatcgtca gtggaatcat tgatcgttgg attgccgctc    319320
     aagttgactg gagcgaatat gcagacctca aagttatggg gatggatgag atttctctca    319380
     aacgaggcca tcgtgatttt gtggttttga tcacgattcc tacgacggat ggggtggata    319440
     tattggcagt tctagccgac cgtaaacagc agacagtggc aaatttcctt caatcgattc    319500
     ccattgattt acgccaaacc attgagcgcg tctgtacgga catgtaccaa ggatttgtca    319560
     gtgcagtccg agaacaattg ccgcaagcca aaattgtcat tgaccgcttt catgtgacca    319620
     aagcctatcg taattgtgct gatacggttc gtaaacgtga ggtcaaacgt ctacgacgag    319680
     agctctctaa gcaagagtat gacagcatca aaggcgcgat gtggcctttt agaaaacgac    319740
     cagagaatct gaaagagtca gagcaacaac tccttgagcg attgtttgct tattctccac    319800
     aactgaaaca ggcgtacaac ctccgagaga aactcacgca gatatttgag ggcaggtaca    319860
     ccaagcacgg agctaaatgt gccatccgtg cttggtgtaa acaagtactc aagagtgaca    319920
     tcaaggaatt cgattgtttt ctgaccacta tcaataattg gatggacgag atgaccaact    319980
     atttcctgga ggggtggacc agtggttttg tggaaggatt taataaccga gtcaaagtct    320040
     taaaaagacg atgctacggt attttcgata ttgaaagact cttccaaagg atttctcttg    320100
     acctcaatgg gtatcagaca ttcgctgtga cctaaacact atatctagcg gctaccacgc    320160
     taattcccgg agagccataa tttcttaatt ttacttcggt ttcttgagtt atctagtacc    320220
     ttgctttttt gcaatcttga accgatatct ttacagcgtt gggataaaag attttgaggg    320280
     gtttgtttat cttcagcttt cagagattga atttctagct ttatatcttt gagtgacaat    320340
     tgttccgtaa ttgcagtatt taagagattg gcccttactt ttttatcact gacacgagca    320400
     atagcttgac actttgtata ttcaagcaag ccttggcgga gtacctctaa aacatcttcg    320460
     ggtagcttca atagtggaag gcggctagat ctgaaactat caatagagaa acggcccact    320520
     tcctgcattg tttgttgaac agtatcgagt tgggacaaaa cgttttgtcc caactcctga    320580
     cctcgatgct tcgcgtgatg agcttgatag aaaagggcaa taacttgctc cttattaagt    320640
     tcaagaacta gccccaataa atcaaggatt gcatcagtct cttctatcgg atttaggtct    320700
     tctcgttgaa ggttctcgat tagagctaca tgtacagctt cacgattatt gagttgttta    320760
     gcgattatag ggacttcagt aagacctgcc tctttagcag ctcgtaagcg acgctctcca    320820
     gccactaatt catattcacc attcttaaga ggtcttacaa ggagtggttc caaaactcca    320880
     tgctctttaa ctgaagtaac caattgagca agtttttcgg cgttgaaata ctttcgaggt    320940
     tggtttgtag gtaaatgaat attcttgata ggtatagaca gtgaggagct tgattgccca    321000
     acagagtcgc gattgagtat tgctgctaca ttagtcaatt taggtttcgg tgttcttttt    321060
     cgtgacggca ctatagtgac tccaggtttt cagcaataga atgcaaaata gaattagcag    321120
     gatgcttacg gtcatatatc tctaaaggag tatgattcat agatgcatct gcaaaagcaa    321180
     ctgcttttgg tactggaggg aatacgggag caattccact gaactgctca atcactgctt    321240
     caagaatttc cttactctga gaagttcgat catgcaaatt tggaattaca cccgcaattt    321300
     gtaggtttga tgccactccc tctaccttta gttcgttgat cgtgcctaat aataaatcta    321360
     atccaacaaa acttttatac tgagtctgca ttggaatcag tatgtgggtt gaagcaacta    321420
     aggaaagtat gctgagtacg cctagagttg gaggacaatc aataaggatg taatcgtagt    321480
     ttgactcaat tgatgaaata gctcttttta gacgagtctc ttttgcaatt gcagtagcaa    321540
     gttgtacgtc agcagcactg agtgacaaat tacttggaac taagtccatt tcatgaatac    321600
     cacagagaat tggtaacgtt tttttgtcta aaatactttg ggacacagtt gttgctactt    321660
     cataggaaga gatacccata aaaattgtca acgaggattg aggatccata tcaacgagta    321720
     agacactatg ccctaactgc gacaaagcat atcccaggtt cattgcaagg gttgtttttc    321780
     ctgtaccacc agcttggtta aaaaaagaga agatctttgt cacagaatta aatgtcgcaa    321840
     cacagagaca gtttacattt agttttgaat atatgagaag ttcaaagtct actttaggtt    321900
     aatttctata aatattgatc gtggaaacgc tcgccacggg gtacgttcca gggactggta    321960
     ttggggcgag agttagctag aggtatagcc agagtggctg cccccgaaac cagcaagagt    322020
     atagcgcaat ccagatcggc aaggtcgccc tcccaaaaca atacttttgc tccgcgctct    322080
     gcctttgctt tgggatgttg cattattggg cgggcttagc caagtgtgga atcattttca    322140
     ccaaaagagc agcagattga ttctgcggat caagctgagt agccttggtt gctgattgca    322200
     aagctgcttg ataatccttg agcatcaatt ggcttttagc aagattgaga tgggcctcag    322260
     cactctttgg ctgtagtcgg gtgacttggg caaaatcctc agcggcttcc tgaaaattct    322320
     tttctcccat gaatagaacg ccccgaagtg cataggcttc agataaagat ggatcaatct    322380
     ggatggcttg attaagttct gccatcgctc cctgaagatc ttcttgttct aggcgagaaa    322440
     ttgcagcagt atagtgtggg ttcgactgcg gattgggggc tgcagttgct agcggtgatg    322500
     ggtggagaat agatatccct tgacccaggc tgagtagcat cgcagcgatc gcaaccgtga    322560
     aatagacccg aattggttta tgaagcattc tctatccccc gaaattggtg ctcttcattt    322620
     tacaactagc cttaactcgg ttgtactgcc cgaaatcgca tctcttcaac ccagacctcg    322680
     ctaaactccc caaatctttc tccaggtgtg aggacatggg ttgcaccctc ctgctctgaa    322740
     ataaactctt gtcgccatag ctcccaggct cggatggagg gcaggctcaa gtccgcacaa    322800
     tattcagccc aactgtcttg ctggaagcgg gaagtaccaa tgtgaacgtg cttgaaatag    322860
     acttcgatca gaccccagtc aaccaattct tgaacaaact gaggatgtgc tgacggtggc    322920
     ccctcatcct gctctattgg tgcttcaagg gaaagattga gcatttcacc agaacttagc    322980
     ttggcaactc taagaatttc tagctggatc tgcgaaagag aagggataaa agtcatttct    323040
     tatcctcacg ctgatgaaat cctaacaaac ccagccccta agtctcctca gaggctaggt    323100
     ctacggtctg cctaggattt agcagcttct tgcttcatca catcagcaag ggtcacccgc    323160
     ttggttccag tccgacgctt cccactacca ctagccacga caggagtcgg gtcttgaggt    323220
     acggccaact catcatccag tgggtcagga tcaacaggcg gatcaaggac cgggaccgga    323280
     gcctcatcaa ggatagtcat ggattcttca gccacgggtt cagcctgccc caggtcgtcc    323340
     gaaacatcag gagccagatc ttcagcctcg acctcagaag tatcctcgac cggattgtcg    323400
     gctaggaatg cctgagtctg taccttgaac caatcgatag ccttttcatg gagcttccag    323460
     tgagcatcaa tccgatccgt gagctgagtc ttgataagcg cttggacgaa caccgtctct    323520
     tgctgacagc ctttgcggta gacagccaca gttcgttcct tgacctcctc aaagatgggg    323580
     ccgtgcttct ggctcacttt ggaaaatccc caggagcaga gggcagtgaa gtttttccag    323640
     ccctggattt ccttgcgaat gacgaacaag aaggctttgt ttgcagctag gcccacttgg    323700
     gtagcggcgg tgtcgatgac ttcgttgtgg tcggcttgtt tgacggtgat gcttgtaatc    323760
     aatttcataa gtgttgtcct ttgaataacg aatagtggat agggcacgac tggcatgtgc    323820
     aactgagtcg gccatgtgga tattgagaaa atgcaagggg gtgtcttgac cctcgcgtga    323880
     gaatataccc tcagtaaaaa tcaggctcga tggggagctg tggtgaggtg gatttggaga    323940
     aaatactttg ggtgggggag tcccactgcc tatgtatcaa gatagcgtga aagccttgag    324000
     gatacaagga tttggggatt agcgtttctg atcggtggag ggagggagac taggcaaagc    324060
     taatgattag tgtgcaggtg ctaagaaatg aagtggtcga taattaagat tcactgacag    324120
     cagaatcgtg gatgacaaaa tggcttgtct gatcaacaga catccatcct tctttccgta    324180
     aactgcttag aatacgagat gccgtcacac gactagtgcc cgttagattg gcgatttgct    324240
     gatgggtaaa tcgaacacat atccttaccc cttcgggagt catttctcct acttctctcg    324300
     ctaaaagcaa caacaattgc tctatacgct ttcttatgag tcggtggtga acaatggata    324360
     ataacgcttc agtctgctga aaacgccgat tcagttgtat caatattctc tgagccaaca    324420
     atggtgaacg ctcaagctca gattgttcga tacgcatcaa cacgacatca gttagtgcga    324480
     tagcctcata cgctttgatt tgggtcaatg gaggtccaaa gggcatatct ggacaggcca    324540
     gtcccaggat cgactcctgt ccctccgagt ctaaagtgca gatttgaaca acgcctcgac    324600
     agacaatcca aatatcatgg atatgcagcg gcacgttgaa ccctttactg aaggcatagg    324660
     tttggcgacc ttgatattcg tcctcaagca tttgacgcca gttttggttt gaggatgctg    324720
     gtagttcctg tgtcttaaac atctatgcat aaccccgaat acttagctat caggtcgaat    324780
     aaggagtttg acgcaaactt ttccttttct gctcaatatt cggcctctaa atacgctcac    324840
     caaaatctat ctagtaacca gcattcaaag cttctagggt taccgaagtc aatgagacca    324900
     ttccccaata cgacaaactt caaacgcgat atttccaaac aagactaggg gtactaaaag    324960
     gccctcagta caatagccct gattgggaat ttgacgaaga gggtaacgct gatgccactc    325020
     cgctagatat tgcctaaatt ccataaagca aatcaaccaa acggagttgc gaggggggac    325080
     ataataggcc aacacatcgg cctcagatgc ataggcccag ccttgaaccg ctctgacatc    325140
     tacgctgatc gtttcgatga atgcattgcc cgtcctaccc gctgtcatat ctgctttata    325200
     ctcgaccgac atccatgacc cgtctggtgc ttgaaaccag cggtctatcc cctgtcgctg    325260
     ctcttgacga gaggcaggtt caatccagaa gtactgctga aaatacgcat cgagggtctg    325320
     ttcatgatgt gtcccgatca caaactgctg ctcaaaatca taggctggca tggggtgccc    325380
     cctcagcggt gtggaaggat gcgctgacct ggcatcaggt ctatattccc attgtgaacg    325440
     atgacctgga ttatggttag ttagctgagt agagatacca gaaatgccct ggatagggag    325500
     ttagaaatct gagctgaaat tcattcatgg atttaaagca ttgcccccaa catcactgag    325560
     accccaaaag acctgatagt gcaaccaaaa ccctgatacg gccagtataa tcacactcgc    325620
     caatgcacac agtaagaaca cattcagatc tgtgtctttt cctacaaaga cgtgagaatt    325680
     cctatcccat cgtcggagca aggcggggtc cagatggcac cgtagatagc attgcttctg    325740
     acgctgactc caaaagcgat ggtcaagggg ataccctaat tcttcggggt aaaagtgaac    325800
     taaggcatct tcaaaagtct ctcccacctc taagcccaca tacaaaaagt tttgttgcac    325860
     tcgcgtgact ttagtgggtc tattatccca atagcgcagc aatacccaat ctccctctat    325920
     aaaagcatca gagcccatga cttcgcccat aagcagggga tcaagttggg gagtgggaat    325980
     cagttttgca tagccattgc gttcattcat tgctatctcc tcagcgacta gaggggatgc    326040
     gctagcctga attaaggcgt atatttctat tgtgaacgaa tttctagatt ttgttgatgg    326100
     ggccaagcag cagaatcagg atgattattg tagaaagcca caaaccacac cagggactct    326160
     gatagggcta atgaactaac cttgctacac actacgactg gcatctccta gcaagaaaac    326220
     atggatgaac tgctctgcaa attgtcgtgg tatcacccaa taagcacagc ctacgatcag    326280
     ataagcctct ggttcgctag tgaaataata gtcgatgtaa acattgcact tgttcgccac    326340
     ttcataataa gagcaaccca atttgtaata gtctggtggc tccacttcta aattcacaaa    326400
     cccttcaatg gtgacctctg atagaacgaa gcactggatt tcaatcttca gattacccgg    326460
     cccagagatt ccatgccgac ttgagtctca ggcttcagat ctactcgcca ctcctcaatt    326520
     tcttcgctct tcatccactg ttacctccat catccaaaca ctggaaactc ccgcactcga    326580
     agatcctgcg gccattcctc ggcatcccca cccttcgcag aacggagctt gggaaccccc    326640
     acgggcttgc tgccaagctg cttgataaac acggggattt ctgctgattt gcattggtct    326700
     cgaatggagc gaatccaagt aacatcacaa ggccgagcgc ttgggccaga ctcacccccg    326760
     gtgatacacc aattcgcggg aagggcgctt agatccaagg gttcgagcaa gggttcacaa    326820
     cttaggaaaa tgccgccgac tttcttctgt agctttgcca gtttgggaat gacgacatcg    326880
     ctttctcgct gggtgcagat gctttggccc agccagactt gagaaggaac ttgtctgaac    326940
     tggagaaact tagccgcgac atccacccgc ttggtcagta gcaaccagat caggtttggg    327000
     gttttctcga tgacctcatc aaacagatct aaccgccaat taatcaggtc atcccggtcc    327060
     tcaaacacat cggccaagga cgcacagaag accgtttcag tgactcctcg ctctgcagct    327120
     ttgcggttcc atttatgagg ttgcttccag taggattctg atgtgcgaga tctggttcca    327180
     tctttgcccc acttcacgcg atgatatcgt ttgtccatca tcgcctcagc gtagcaattc    327240
     aaacagccag gactgttgtg tgcgcagccg atccaggaat tgaatgtgtg gtgggtccac    327300
     tcaattttgc tattctccat tggttaactc catcaaaatt ttcaatgttt caggtcggac    327360
     atctcggagt ccctgagacc cgcgataggg aatcggctca ggcagtggaa cgatgcttcc    327420
     taactgccaa gcaaagcgcc ccagttgcca gcaacccacg gccaactcca gctcagtctg    327480
     tctgctgatc agacttgaat ccatccgggg acaatccacc agatccgaaa tagccacgat    327540
     gcaaccgagc gggtaatcac atgggttgcg aggcaccttg ccatccgtca gattattgac    327600
     ctggcccact atcgcttgcc cgtctaaatt gataggtcgc ttggctgcat gaatcgccaa    327660
     cttaccccgg tagcgagtgc cccatgatcg agtctcaaat tccttgaagt tcagggcaat    327720
     gaaggtcgcc caaggttgcc agagggtgat gattttcatc gttccgcctc cattggcatt    327780
     cctatagctt catgcatttt ttctgcaatc ccccagcagt catcgcaaat ttcaaagtaa    327840
     tcgtcatcag cacccttgca atacggttga agatagccgc aggactgaca ttcgtaatat    327900
     tggcccgctt cgcagcccag gcaaagagac ttactgcgac tactcaggca tcccaagggt    327960
     tgcagttgca tgatgcctcg accttgctgc aaaagattcc acacctgctt tttcattgct    328020
     tcacctccaa atatgaattt tcaaaaagtc ttatgtcggg cctgcattct ccccaaattc    328080
     cccggcaggc agagtccagg caatcgggtt aacgaggatg ggcactgtat agtcttggct    328140
     cagggctaac cagaactggt ttacccttct tgcgctcgaa gttgcttttc ccgttcgatt    328200
     gcaggattca gcagtaaatc ttggagattt aaggtacaac cttcctcact cggcagcgga    328260
     caaacaccga aatagtgagg caaccgcacc agctctgact ggatgaaatc aaactgcaaa    328320
     ctgaagatgg agtacttttt ctgtgcccgt acctgcatcc gtcgaatgcg ttctcgatac    328380
     ttccgcgcca tcggccaagg tcgatagggg cgactgggct tgctggagat cgggccagag    328440
     cgaatggctt ggggaattac aataccgttt gccttgtggt acgccttcac cgcagctccc    328500
     atttgtgggg tgggcacttc ctgtaaacgc tgccaggttt gctggaacat ctggttggcg    328560
     attgccagta tctccgctgc ttccttgcgg agctgcgcta acatccgttc aaaggcttgg    328620
     cgttgtttag tggtcttgac tggaccagat ttagggagct ggagagggag agccgtttgg    328680
     acagcaatca tgatcaacct cattcaaata atgacaattg cggctgagga tctgaatcct    328740
     tacttttcct tttgggcttt ttcgctggac tcgtttgatg aatgccccca aatgcctctg    328800
     cttgctgatg caaggttttg cgaagtgcat catacgtgga aaagccccca tctgcgatta    328860
     cccggcaaaa ggcatcgatc acggggacac tttcaggggt caccatactg acaattcctg    328920
     gtacgttctc cataacaaaa gttttgggtc ggatctccaa aatcatgcgg gcgaattcaa    328980
     agatcagact atttcgcgga tcaagaactt gtcgcttacc tgcgattgaa aagccttggc    329040
     aaggtgggcc accaaagaca caatcgactt caccaactcc cacgccgatg gaatctagga    329100
     tctgctggcc cgtgagctga cgaacatccc ccagccagaa atgctccaca ccgggacgct    329160
     ctggggggcg atgctggccc gacaggaagc attgagcaat gccaccgtcc ttatccatct    329220
     gcatgatttt ctctagcagt ttcgtaaacc tggcctcatc ctcatctacg acaaaattca    329280
     tatccagggg ataagctccc agattagcga gataggttag tgctgcattg gcatcctttt    329340
     caacggcggc tacgacctga aacccaccct cgatcatccc cagactgaaa ccgccacagc    329400
     cacaaaacag gtcaatggcg attggaacgt catactctcg tttggggagc aatagcccag    329460
     actgtcgttg atgataggtg gattgctgag ggaggtagag gccatccccg ctttggacaa    329520
     acaaatcgtt catgtccgtc aacctcctaa caacacaact tgagacggac agcagggcgc    329580
     aaatccgtga ttttgaccgt ggtgaagttc ttgctccact tcccggattt gtccttggca    329640
     atcatcagaa cgtgctgtct ggagactgtg gagaacacct tgagacgggt gccgttttgt    329700
     ctcctgagcg ttccgaggaa gtacaccaga tgatgctgag gcgagtacac taacttgctc    329760
     atggaatttt cctccaatat tcaattaatt aatttggggt gtggctaccc ttcaatttcg    329820
     agataggtaa cggcaagcga accctcaata tctgcagtgc attttctaaa gcagatgcaa    329880
     tcaccgtctg gttctagaaa atattccatc cagtactcat ggcgaacctg atgcgattca    329940
     gcgggacagt ctggattgac ggcctgagca aacgaaactg gatctaaagt gccaatggtt    330000
     caaggcatgg catgatttat ctcctgtttg agtgatgcga ttttttgaga gcttcgatag    330060
     ttgttccaaa gtgagtcttg ggctgacatc ggcctagaca accacgtctt acgcccttga    330120
     tgagagagcg gcagtgcgag gagtaagagt tacaactttt actcgttgct cgaagcgttc    330180
     ctttccttcc agtcgccgca accttctgct caactctggt gtggggtata ttcctcgtga    330240
     ttgcccacag tcccggcaaa tccaccaagt atggcttcca ccagtacgat gcagaggaat    330300
     gatttggtag gcaattgcca ctttatactc gtgacaatcg cagcattgtt taacggacgg    330360
     ctgatagagc cgccgcacgt tacgagtaaa catggtacgt tgctcctagg atgtttattg    330420
     gttattagct gaggcggttc atgctcagaa agaatcgcct ctttattcgt ctaattgctt    330480
     ggaaacacaa gatttataaa caccagtcaa attattttgt ggtcgtggta aattctgagg    330540
     cgactgtgaa tacaaatcac tcttaagggc gacaccacac caactcctag tcgccctttc    330600
     tcataccaaa atctgttttg attggctcag gatagctcca actgctgggg ttccgggtgt    330660
     ttccatacaa ggtaggactt aataacatcg ccgtggcagg ccaggggagc gcaccaacag    330720
     agcaacttca cttctagcat ggcctctagt ttggctagct ctaccatcac ttgaggacga    330780
     ctgggacgct tccacatacc tgagacctgg acgttgtact tgtcagccag atctgggacc    330840
     acatcaatgg gattggcccc caggttggca acttcatgga ggtattcacg gaatgcagcg    330900
     atgactgcca tgcgctcgga ttcttggaac atgtgaaagg gattgccaag gacgctggca    330960
     cggtcgcaac ggtagccctc aacattgcga ttatggcgaa gattaacgac ggtgatgttc    331020
     atgatatatt tgccattgaa cgagataagc tttacggctt taggcagggc gtttttgaac    331080
     acgagaactg ccctttacta attcaattag gtcgatctag cacggcttca aacgcaaatt    331140
     ttaagactgt gctagatttc atgaagattc tgttttaggg cgaccctagt caactccagg    331200
     ccgccctttc tcgtcagcaa aattgttcag aagagtcact tttgggggtt ctttctcatc    331260
     acccctagaa aggaatattg tcatcaacaa atgaaccacc accagctttt gacgctactg    331320
     gtggcttcac ctgtctctgg ggctgaggcg gggtatgggt cggggctggt gcaacagtgt    331380
     tgctcgatgc ctgctcccct tgcttggaac ccagcagttc aacccgttgg cagcgaacca    331440
     ccacctttga gcgattgccg cctgagttcc tgtcaaccta gcgctcttgc aacagggaac    331500
     cactgacccc aatttgcgac cctttctggc agtactgccc aatcacctca gcggtctttt    331560
     cccaagcctc tatctcgaaa aagtcagtct cgtctttggt gcggttgatg gcaaggtgga    331620
     atttggcaat gactttgcca aactcgaaat agcgcatctg tggatctgca gtgagtcttc    331680
     caataagatt tacggtattc atatatagac tcctaatttt tcaatatttt taagtgctgt    331740
     gtgccaatta gggactgagt ttaatgccct ctcacatcac actttttctt tcaaagcaga    331800
     acgctggata agttcaaatt tccaactcca gcaagacgtg atgagttttt tcagattgtt    331860
     gtcatcactt atctcgattg gggcatcctc actaatggag tcatgagaac agagagcttc    331920
     tccaactcca ccacgtaaat agacctcgac agcttcggta acgagaagct gtcttttttt    331980
     gtctcaaact cccctcaaac caggccatcc aggatttcgt caactggcaa tcactgacat    332040
     catccggtag ctctgcccag aacaactcga acgcttgctg agcctgccag taataagcaa    332100
     atacccctcg cgcaccgacc agttgcacaa cagcaaattg cggaggaata gagcttggta    332160
     gggatgaagg cgaccggggt aaaccggaaa accctcatcc tcacagaagc ccttgatatc    332220
     ctcccggcaa tattccgtca ggttcttcag tgcttaccag tcgatggtcg gattcatcag    332280
     ccactctgca gttgagccac attggtcatc gcttttctgg cgacctctcg ccagttggtc    332340
     tgctcgtccc atgcctggaa aaccttctgg cccatcagcc acacggagca gaacagcact    332400
     ttctcctcat cagcgggaat cgcctcaatg gtgatgggat aatggagatg gtctggtgtt    332460
     agacttgcga tcgcactcag gaatcctttc gtgaacgtgg actctgaacc cgcctccagg    332520
     gtacagggac gatgagccat catcttgaat ctgagcttgc tcttgggttt ccctttgtat    332580
     tcacctttga tgaactcgat gctttggaga tagcccgtaa gcgctggata ggggagttct    332640
     acgggttggg aatcctgatt aagggtatac caagtattgg tattggcccg attacagaat    332700
     atcgctaagc cactgggact ttcaccaaat ccgaggggtc ggacatgggc ttgctgttgg    332760
     agtggggctt gggatctatc ttgagttttt atcataggtg gcctcgtggt gaagggacaa    332820
     ggtaatttct ttaggctggg ttggcaggct catagacacc gccagcaact cagatacacc    332880
     ccgaatcagg gcaactttac cagcctggga tagatttggg aggagacttg agatctgctc    332940
     aagaatgggt aaatcttcgg ggttagtgct gtagctggtg acgttggtct gtggggcact    333000
     cacttttagg gtgaggggtg ggattgaaac ggtcatagga ttttctctag atatgtggaa    333060
     cccccagcga atcggccagg ggaatttata ggtgtgaaat agattaatag gtgtaatacg    333120
     agggggagag tttgaggtag cttgtattgt ggatgcgatc gtactcacga agcagcaggt    333180
     gatcgcatcc gctaagacca agattgctat actttgctcc aatagaccag ccgcacccct    333240
     atcgcagcag catactccct gatgactgcc ccaaggcttt cctgggtctg agcttgctgg    333300
     aaatcaatca actggaagga gcggccattc cagacttcga ctttagcgat gtggattttc    333360
     atgggattac ctccagtgat tcagaaggaa gccccccagt ggtgaaccag gggctgattg    333420
     gtgtggggag aagcagaaaa gagaagagaa gaaagagaaa ggttttggga ggggagggga    333480
     gggggtgctg ttaattgggt tgcaaggctt ggagcaagag aaaaattctt tcaattcatt    333540
     gattaattgc agataatttt gggcaccctc agaaaagcat cctggcaggg gggagccaga    333600
     atgctgtctg ggaaaaattt tgtagagttg ggagcttcta ggaagaatta gctgccagtc    333660
     aaggaacggg taatcaccac agcagttgcg ccaatgatgc cagcccaagc tgtgctgatc    333720
     agggctaagg tcaaacccca gagccgacca tcccatttct tgacctgctc attggttttg    333780
     atagtctgct ctttgagaga attcaggtcg tttttgactg tactcaaatc ctcaccaaag    333840
     ccagtcagta aattttcaat gcggtcaagg cgatcaggtt cagatgctgt cattgcaagc    333900
     tccttggtta ctgtcattgt atcaatcgga gaagaaaagc accccagccc ggaagccagg    333960
     atgtagggga atgtgagcct attgctcgtc gtatagctgt tgcagttgat cgacctggga    334020
     aggactcagg tctagcctcg aaagcactct gaactcagct tcaggatatt cccaaccctc    334080
     gtcaatcatg ccgttgagca tctgtaacgc tctgtccatc aagctatcca tgattagtac    334140
     tcactggaat gcatgatggt caaaacccta gtagtgacct ttggatcact tgagtcttcc    334200
     gagccatatt tcaagttttt gtcgtaatag tctatcttcc agagatactg ctcatcctga    334260
     aactcaattc gcccgtaatc atgctctttc cacgggtcat tatcttcatt gaagtcatcg    334320
     aacgtgcgga ccagtcgaaa gagttcctgt tgttcctgtg acgaaagacc ttgaacaagc    334380
     tgagtggtga agacctggcc tagggtgtgg tcaccttggc gaaagcgatc attgagttgg    334440
     gcaatagtgg gggcttgggt tgcttctgta gtggtcataa gattgtgtcc tctgaactta    334500
     cctgagacgg ggcaggggca acaggtgccc ctgtagtgga tggactagaa ttcatcctca    334560
     gccagtaact gctgagtcgt gaatataggc tggacaaaaa tcaggcgacc tgaaggatag    334620
     ttttctacta cccaccgttc gcattgttgg cgactggtca catgggcctg actgggaagc    334680
     tcgatggtta ggtcgatttc ttcgccgccg cctctcacgc cagggtagaa atcaatggtg    334740
     atatcgaact tccgagtctt gggatagaga gcagcatatc gttgctctgg agtcagaagt    334800
     gctacagtca tgtcgtgaac ctcgtagagg gtttgcatgg agagccgctg gagttctgcc    334860
     aggaaaagca gcggctcttt taatgaaagt tttgtctcta tcctttgatt gcttcttcta    334920
     gcttctttac ccagtctgga agaccttgtg ctctgcctag aagatcatgt ctctggacta    334980
     tttcggtgga agcctttcgg ggcgctttcc tttcctttgg tatgtctata tattaccgta    335040
     aagatcttta cggtgtcaag aattttacat aaagatattt atagatataa tgttggtata    335100
     aatcctttat gggaaaattt cttgtgtcca acatcaaagc gttacgtgaa gatcggggcc    335160
     tctcccaatc tcaactcgca agaaaaatgc aaatgacgga aaccactatc cgaaattggg    335220
     aacacggtcg tactggcgtg gaatggtttg aacgggttgc acggctttgt gaaattctta    335280
     actgcacacc caatgatctg tttggatatg aagaggtaag taaagatgac cctgaaacgt    335340
     aaccaaaatc cctctattct ttgtaatcct tattattctt ttgagattaa atcatgacct    335400
     ctgaagagct tcagcaactc atcgaatcta acgccaaagc aattgaggca cttgccactc    335460
     agcaaacaga acggcaacgc catactgatc gacaaatcgc tgaattaaca agaactgtca    335520
     gtacttttgt tagagagacc tctgatgttg tctcaaattt aatgaatgat cgggcaacga    335580
     tgtatgaact catctcacaa aatagcgaag ctcaagcctc gatcaatgaa tcactgtccc    335640
     aaattgcgga agctatttct aggattgctg ataaagacaa ctaaccttgc ggcattctct    335700
     aacttggggt agaagcatac tttggcttga gatggtcaaa gaccgaccaa aggtcatcac    335760
     acttcggaca tcacttcaat cctttctcac cttagacagc cccagcccaa gccgacaggc    335820
     aagggctgaa ggacagaact accgagcgat cgcaatctct ctccaagtgg attggggcag    335880
     gctcaacact tgagacccca ttgcttctag ctccgtagct cggtcatagc tctcgacatc    335940
     ttgggaagtc cgggtgaccg cattcatcat gccgtatgcg gtcaggtcgc caccctggat    336000
     cagatgggtg agaattccag agcgttcttc ctgattgacg ttgagcttat cacccaacac    336060
     ctctacagcc gtgaccggat tgccctcaat cttgcgttcg gtggcatcgc gcatctgctc    336120
     tacaatctgg gtgaacttgg cgatatcagc agcaccacac accatgtctc gaactttgag    336180
     caaaagcgct ctatcatcag cttcacgggt ttcgtcgctg aacaattcta cggctgcatc    336240
     actttcaccg acttgacgac ccacatgata tttcttgaaa ctgtggtctt gagaaataag    336300
     accgttgaga cacacgagcc tgtataccag cggctcaatt cgaatggagc caagcccaat    336360
     ctcagagttg gagatgacca ccccagcttg gacagcatcc cctttcctca catcgagctg    336420
     aactcgctca tttactgcct tgatgtacag tcgtgaatca gtcaggccca cactcatgat    336480
     ttttaagcct tgaccaaatt cagccaagac gggtaatacc gtttcagcaa tctcaaagtt    336540
     gtccactctg cgatagcggt cggacaaaaa ggcacgagct gagccgtcaa gagtgcgaat    336600
     catgcgccgc tctggattgg tattgaacca gtggttgacg ttttctgcca gaagttgggg    336660
     ggctgacgat tgcatccgtc gatagtattt caggggaatg ctgaggcgtt gggaaatctg    336720
     gccgtgggta tgttcagtag ttgtgaatgt ttcttcaact gcttcagatt cgactgtgat    336780
     cgagccatca gggttcattt caagggtgcg tgtgtcagca acaaaatcgc gcttggcctc    336840
     agcctgatct tggacagctt gggccatttc aacgagcgta agtccttgtt tcattgttag    336900
     aatctccttg gtttgtctta agccagcgga agagagtcga ttgcaacccg tttctcttcc    336960
     gctttgactt gtaattgttt ttgaactttt aattcatcca ccgagggcat cagaccgtaa    337020
     tccagcgtta ccccggtttc gtgtctgcgg tattcagcag ggtgacctag cacttcgtag    337080
     aactcactta tttggttgag gtggaagcct ttcattgggc gctttccttt ccgttcactt    337140
     atactaatat attagcgcta aattattagt atgtcaagca attaccgcta tttaattagt    337200
     gctatcctgg cagtgtaaac ttggctttat gaaaaccatg aagactcttc gtcaagacgc    337260
     tggattaagt cagagtgagc tggcccgtgc tctcgatatt gccgaatcta cagtcaggaa    337320
     ttgggaccaa ggaaggagta ttccaactct ctctgccttg gagtatcccc atctgctcaa    337380
     attattaaat tgctctcctg aagaacttgc taatgctgct gctcaatcca aaattttatt    337440
     tgagcaaaaa caagctgcta aaggtaaaaa aggctctggt agctcatgac gcctgagaaa    337500
     taatcatatt tcgcttcaac cacgccccaa acaatagcca cacccacccc acccctcgga    337560
     cttgtcctag aaaactctgg ggtccgcctc cgacgcttca gcagtgccgc agatcttccg    337620
     gtggaggttc gggggaagat atcatcttta cgaattcata aatgctggca tcgacaacta    337680
     aaggcttacg attgctgaac agttttttca tacaaaaaca aatttcgtcc ctcatgttgg    337740
     gtttctccaa acagttgata gccacacttt tcgtaaacat gtctggctcg ctcatttgac    337800
     tcgaagacgt ctaaccacac ccgactcctc ccaagttcac tgctacagat gttatctacg    337860
     cttctgacga ctatagtccc gaggccctgc tcaggcttgg agactataat tctgcgaaat    337920
     tcaacgctct ggccgtctgg atccaaaacc aagataaaaa agccgatcag ctcttcattc    337980
     caccaaattg acttgtagat gacatctggt ttcgcaaatt ctacctgatg cttttgcaga    338040
     gagtacggta tgacaaacat ccgcatttca ccttgctcca gttcacagat acattcaagt    338100
     tcctcacgtt ttgtaatacg aaggacaggc atctgatgag acgacataat agtttcccgt    338160
     gacctatcgg cgctaaatta ctttatgaca gtctcggttg cctactgagt gaagccttca    338220
     gatgtcttca acatatcctc aaatttgact ggtagtttta tatagagtta catcttctgg    338280
     gggaaagtaa ctctggtaaa acacaccaca tctactaccc cttgagacga atgctcctcc    338340
     aaggggtttt gtggttgatc aattggttgg ggcactaggg tttaatacca tctgaatacc    338400
     tctgcttatc aaggtgaagc aacacacccg aaatgaacca ctcaaagcaa tttctagctt    338460
     aaatttggac gagcgaactg ggggatatcc aagatgacta gcactcggaa actgatcaaa    338520
     gcaatccccc tgaaggataa gccagcggga atatcccggt gtgggatgtc caaggcaacg    338580
     tttgcccaac actgttttac tagccagtgg tatgagcttt cagaacaggg gcagatcatt    338640
     gggtcagccc ttgatctaaa tttctacaag caggacgctc ttcacagacc aaatacaagg    338700
     tctacaacca tgaccaaaga actctcaagg attttgtaac tcatttctaa cccgagaagt    338760
     atttgctttc tctgatggac tttgaaattt gctcctgcgg gatgatggcc gttgacgtgc    338820
     cagggcaata cttggggaaa ccctctggat ggcaagcacc ccaagcctca gccatagctc    338880
     taactgcaac ttcttgagga agcttttgaa gatcttgata atggtgaaat tttaggctga    338940
     tcgcaagttg ctttcttcgg cgatatatct catctagctc acccgtatca cttaaatttg    339000
     ttggtttctc catttcgctc cccgctttca caacgcccca atccaagtat ggacaaacga    339060
     tctaaacaat gactcaccaa tagatttcgt cctacactca aaagcagtga ttttgcttat    339120
     caaactaagg gaataaaaga cattgaggtt taatgatgcc gaagagaact aaaaaaaata    339180
     agcctttaac aggtcaagct ctattagcca aagtgagtac cctaagtgat ttgactcggg    339240
     aagaaaaagc caaagcgtgt ggctacttca cattcgctaa agatagcact gaacgcatca    339300
     atgtaatggc cttcctcaat gcagtcttgg acgctgaagg gatggatctt ggtgctaaag    339360
     gtaaaagtaa cggaaaacta ggaggccgca aactcacctt tcgaaccagc gtacaatcca    339420
     atggcaatct attggtcggg agtgcctaca ccaagaaaat ggaactacaa ccgggagatg    339480
     agtttgaaat cgcgttgggc cgtaagcata ttcatttaaa actcatggct gaagaggatt    339540
     aatcgttgat acaaaagact cccctgtatt gtcttgtaca agggagtcgt aaaagttttt    339600
     gtaagctcac tacacggcaa aaacagaggg ggttatttcc aacctgtgat attcagaccc    339660
     attgatattg cccaggttcc cccaataaac ccaacagcaa ttcttgctat acaatgccca    339720
     caagcacatt gaggggaaga cgatgaacaa aggtgaatta gtcgatgtca tcgctgagaa    339780
     tactggagcc acgaagaagc aggccgacac tatcctcaca gcactaacag aaaccatcat    339840
     ggagaccgtt agctctggcg agaaggtcat tttggtcggc tttggtagct ttgaagctag    339900
     ggaccgtaaa gccagagacg ggcgcaatcc taggacaggg aaaaagctca caatcccggc    339960
     aactaaatca cccatattca gtgcaggcaa gactttcaag gagcaggtga aagactgata    340020
     gactaagaat atcgctaaag atttaacctc attccaacga cctagctggc ggatgctctg    340080
     gtgattctgc cagcttcttt atgcacatct ttaccttaag aaacatcaat tatccttccc    340140
     atgccaggca attcagggta attctctacc agtaatgttt gcaaggttaa gtgatggcta    340200
     caagctatga cagtcttcat tttttcttca aagaaatcgc tcgatatccc ctgctgtccc    340260
     atgaagaaga aattcaacta gcacgacaag cacaagcggg aagccttcga gctaaacaac    340320
     gaatgattga gtgtaacctg cgcttcgtcg tctcaattgc taaaaagtat caaaatcgtg    340380
     gattaccctt gctagaccta atccaagaag gcagcattgg attgagtacc gctgtagaca    340440
     aatttgacct cgctcaaggg tgtcgcttca gcacctatgc ctattggtgg attcgacaag    340500
     ggattacggc ggcggtgaga gcaaagtccc gtcctatcta tctcccccat tatcattggg    340560
     ataccgtcgg caagatcaaa aaacattttc gagtgctcac tcaacaactc ggtagagaac    340620
     catcactgtc tgagttatca gaagccacca atattaaacc gaaaaccatt agccgtactc    340680
     tgcaattatt ccaacagata tcatcccttg atcaactcgt cggccctcag caaaaagata    340740
     ctctcctcga tatgctagct ggagaggacc aacccactca ttatttagaa tcgctccaac    340800
     ttgatgatga gctttctcag gtaatggcat ctttggatga acgagagcgg tttgtcctta    340860
     gtcagaggta tgggcttgag gatgatcatc ccaagtcgat gaaagaaatc ggccaacaga    340920
     ttggtttaag ccatgaaggg attcgactga ttctcaagaa aatcatgcag aagctggaaa    340980
     gatatgctca gtctgcttag ggtctcagtt ttttgatgtt gatcaaagca aatgtattcc    341040
     gttaatggaa taacatgctt tccgaaatga gagagctgca ttggggtcag caatgtgagc    341100
     agctagagcc tcaatcagtt cttgatgact catttcaggt gattgattca atgtctgctt    341160
     agtcataaga tcagccattg gaccaatatg aatagccagt tcttttttgc actgactgat    341220
     aaactcatca tcatcattat cgattcccaa cgcttgttga gtggctattt caggtggtgg    341280
     agtctgcaca ttcttctgag atgacttttg agtagcagaa gccaccttaa gaggcccaag    341340
     cgaagttgat gatatttctt ctggttgcga agaatgtaaa gattgagccc gaactgatgc    341400
     tgcagtctga ttacatcgcc aagtcatcaa gtaagaaggg aactcaacta atatatactt    341460
     cactccctta gaacaagcat cttcacaaaa ctctatggct gtttgacgcc acgatttatg    341520
     aaaagaagga ccaggcacaa aactttcccc ctggatctcc agggaagacg accgatcatg    341580
     caagcatcct tgtgcttcta attcttctga tataaaaatg gacgccacgt tttccctaaa    341640
     tcatttgtat ctctctacgg aaagctaggt cttgagttca tctgaactga ctgtaaatga    341700
     actcgccttg atgatctact actctcaggt tgccccaaag tctaatttca gacatcaaag    341760
     tagatataaa gacaattttt gcgctattgc tacatctcaa ctggcagaca tttactatat    341820
     gctgccagtt ttttctattt tctcttactg gtagccatat cagcttttta ctcgtccgcc    341880
     actcgaaggt ttgacctaac tcatcaaggt cgagcaagcc gtgttgccaa agaatgatgt    341940
     ggatccgacc ttgtgaggga tctggataac gcaaggccaa atctattgcg gcaccagaaa    342000
     tggctaattc atcttgtatc actggatttc cgtaaacttt cggatacaga aaacataaga    342060
     gcttatttac tatggggaaa taaatagata aatatatatg gtaattaata actatgtcac    342120
     agttagagac agacaatctt cctataaatg aaactgatat cttgccggaa attgacgagc    342180
     tagatgatgt agaccttgat gatctactga aagatttaca acaagattga ggcttggaaa    342240
     tattaatcga caagattaac catacatgga tccaaataac ctagccgtct ggaaaaactt    342300
     ggagactcgt ctggggactc ctttcagaaa aaatatggtg gatcttgtgt tggaaatggc    342360
     ccgagatcgc accaccgatc cacataagat agcgacttgg atggtgacga cctctaccta    342420
     tatctgctct gctattttcg ggactaacga tcccatgcct ttgctctttc tatacgtccg    342480
     ggcactagat atccaatacc cagacaccat gcaggagatt tatgaaatat tttccgatga    342540
     aggtctagtg aaatatgctc cctcatctct taagcgtggc gacttcacga gtatcctctg    342600
     ggctgctggt tcaacctttg ccaacggcga attgaaactg atagatgacg agattcatat    342660
     caacccaaaa ggtttacagc gattgagatc gatttggcaa gcacccacta gaaagttcaa    342720
     taacccttca ggcaacgctg agtatccaag ccaatagtaa gggcggtgac tagaggcgaa    342780
     cagcatagac ctctaagatc aaattaacca cctctccgca agcggaagag gtatcgaaga    342840
     tctttcactt ccaaaccgtc gatttggact gtaagccaag taattcgctg caagcagcgg    342900
     ggatgtatcc tttctagatt caaccctacc cagtctcaac taaacgcgaa gttcaatcat    342960
     gccaacagcc gctacctagc ttgtaaagag tatgggcaaa tatacgttca tctcgttcct    343020
     caagaatgtt ctcgacctta gctcgatatc gttgccacaa accatccagg tctctggctg    343080
     gtctatcgat caataccgtt ggtgttgtct gactttcttt gatgtgtgtt gctacaaatt    343140
     ctcctcgctg ttcacacgta ggatatttaa ccagcaactg ttcgaccgtg ggcaatctaa    343200
     catgcacaac atcgatgtaa agaaatcctg caatcactat tacaagcgga gcaataacaa    343260
     tcaagaaagc cccaattgca taatcgctga gtttcttcat attcatgcct cctcaattac    343320
     tggatatcgg caacctgatg cttgacatag cttgattttg agtctctctt agtttctgaa    343380
     catcaaccca ttcagcttca tcaagattgc tgatgacatc actgaccctt gccgagagaa    343440
     cttcttgacc tactctcact gtatccaaga cggcacccct tggcttatcc tctatcctca    343500
     aggtaaatta tccctggact caaacagggg ggtatgacaa tgggcgcatc aggagttggc    343560
     agtttcgata acgataatgc aatggactgg gtggcagagc tagaaggcta cgctgatgat    343620
     agtccgattg ttgatgcact gaataccgtc atcgatcaag ctgacgactc tccaggaaca    343680
     ctggattgct ccatcgccat tgcagcggca gaggtggttg ctgcacagtt aggtcatcct    343740
     catgaagact gcccagaaga aattgaggta tgggtggaag gtcatccagc cccctcagca    343800
     acgagggttg cccaggctcg acaggcaatt gaggtaattc tggctgagtc agaactcaag    343860
     gggctttggg agaactcagg tggcttggag gaatggcagg gagcgatgga ggatctgctg    343920
     tctagactgc catattgagt gatggtttaa gaaaactatt cggctaattt gggtatccaa    343980
     ggataaagca agtgaaagcc ttaagctcaa atggatccga atactttaat cgcctggaaa    344040
     aacttagaga ctcgtctgga tgttcccttt aggaataata tgatggctct ccttttagag    344100
     atggcacgag aacggacagc cgatccccaa aagattgcca cctggatgtt gaccacatct    344160
     gcttgtatct gcaatgccgt gtttggcatc gatgatccga tgcctctgct ctctctctac    344220
     attcgagtgt tatgtgatca ctatcctcgc accatagaac aaattgcgca gatatattct    344280
     tacggtagct tgaagcgata tgtccctgtt attgcagatc gcgatgattt cattggtatc    344340
     ctcagtgcgg ctggttcaac ctttgcgaat ggtgaactga tactgatgga tggtgaaatc    344400
     gatgtcagcc aaaaaggatt ggagcgattt caattgatct ggaaagcacc cgccgtgaag    344460
     cttgcgaatc ctggaccttc agttttatgg tgatgtctta gtgatgaaaa taacagctcc    344520
     tcaaaatagt cattctgggg agctgttcaa gtgaggaggt tctcaagtaa cgctcagaga    344580
     agttcgttgt tgctgttaga gtgcccgtac ccgctgtgta tttctagctc aattacaatc    344640
     cttaaagaaa ccctgaactg taatatctgc aacgattcag gccatttata tgaacaaagg    344700
     cgaatgagtc gatgtcatcg ctgggaatat tggagtcacc aagaagcaga ccgataccat    344760
     cctctcagca attacagaaa ccattattga gacaatcaga tccagtgaga aggtcactct    344820
     tgcaacttct tcgacactct catattcagc gcactaaaca actcggactg cagcacctga    344880
     caacagccct aaccaagata caaacgcttg tccaacccgg ctggccgcta gttcacagcc    344940
     agatatcaat atttcagcgc tatctgataa atactctcgc cattggcgaa tctcatcagc    345000
     atactcccaa agatttttat cacttaaatg ggttgtgccc aattcaagct gaccaggttc    345060
     acccttgcaa atcagatgga gacaagacag tccctgatat tgacttaaga gtgttttaat    345120
     ttggataatc ccatccgttt caatatcgag aatatgaacc tccttgccta atagagaact    345180
     agcccacaaa gattggtaat tgtcgatggt ggcatcaacc acaacaagat aggggatact    345240
     ttgggaagtg ttagcctgag ggacctgctc ggtgcttaaa ctgaaggtca tggggaaata    345300
     cctgctctac tattagcgtc gtcttctcag ttacaggagt cacacaaatt caagattaat    345360
     cacactctaa ttcaacatac tgagcgtaga ctgggaaatt gcctaacttt tgccttagtc    345420
     ttaatttaaa tactgcaaca aaaaccccct gaagctatca gggggtgtac acacaaaaaa    345480
     gttaatgaga attaggttaa taaatcttgt aagggtgagg ctgatcagga aagatggtcg    345540
     attctttaac ctaactcttt cagtgtgatt catagtggtc tgagaacatg tttgcagagg    345600
     tgagtattat gtataacttc tcactaaagt tattaagaag ttttatcaac aaatagatta    345660
     ccaaatacct ctattcataa ccggagagga aagaaaatta aaggctggta gactcagtag    345720
     cagagtaaac gattgtgctt cgttctcgta acgcgagtat gacaactgac aggcaccacc    345780
     acacactgtc agttttttct tgtaaacgat acaccctcag aatggcccaa gagagaaaac    345840
     cccctcaaag tacgggggac tccagggggt ataccgttaa gagtttcacc ttataaacaa    345900
     gggggactct gagaaaagcc ctttcggaag ataccaatca aatgtgtgga aatgttgggg    345960
     ggacggaaat attactttgt tcttccttaa aggtgtcctt ccactgtttc cttgttatta    346020
     gaatcgggaa ctctgtctac acaataaccg tgtgctgatt gatgagtcat ctctaccctc    346080
     gcctcactca acctcaacaa aactgaacca ggaggttcaa catatgagct atgaagtttt    346140
     tcagcctgct gacctgatgg acggaatcag tgccaaccaa ttacgcagtg agattaacga    346200
     tgccctagct aatggtgtga aaacgattct gatagatctt agagatgtca cctttatgaa    346260
     tagttccgcc attggttcct tagtggctac gcttaaatca gtgcgaggag aagatggcac    346320
     cctctcgtta tgctcactga atgatcaggt tcgtattatt tttgaattaa ccaaaatgga    346380
     ccatattttc gatatttatg cagatcgcca agaatttatg cataaaaatg gtatttcctc    346440
     cagctaacct catccaggct ctcatgaatc aaagctttgt tctcggaaaa gatttcagcc    346500
     gcattgcaga gggtgaactg atcatctctc cccaggtcga ggtatttatc cactccatca    346560
     tctagtggaa aaacaaacct caaagggtca ctctaaagct atttacaggt tcaccttaac    346620
     gggaacctgt ataccgatgg cctgtactgc gttccagaaa tttagtaggc cggaagggaa    346680
     cccgtaaata gcaagagtgc cagtcctctg acataccccc caagcatatt aaccaatgcg    346740
     tagttttagg gcatttttgt cagcttaaga agctcatgtg attgccatga gaggactgaa    346800
     aggttccgaa acctcatcac cagcagcaag aaacccctca aagctcttca ggagattcaa    346860
     ggggcgaccc tgtattcatg gacatcaaca aggtcttaag gaatgcttcc cagaatctat    346920
     caatcaaatt tgaggaaatc ttggggaacg tacggctcat ccttagcagc agaatccctc    346980
     taaagactcg cactctagag ggattctagt ctcagcctct ctcctagaac cgtcaggctc    347040
     ctgggatatt ggctgatctt ttatttttaa tctatcaatc aactttgggg aaatttgggg    347100
     gaagggaaga cactagcctt aatgcttgcc ataatccaga catgaaaccc acccaagcct    347160
     tctacaacgg aactcccatc gccccaccct caatccatct gacgacagaa cagaagatgg    347220
     atctgctgga ctggcatccg attttcacgg gacggtgccc gaactgtgag aggccgatca    347280
     gggaaacaac gccaccgagg agtcactggg actgtgcgga gtgtggatgg agggaggatt    347340
     tggcgtgatt agttttcatg cttcaactcc ttctttaatc tcccgaccct gacagtaaag    347400
     gggaccgctg atctccaaat ctgggatgtc ctcggtgctc agcaaagata ttcgctattc    347460
     atcccgttta gatcattcac tttagagttc tgcctctctc atgagctaaa acgtttaaag    347520
     tctggacact cgctgagggt tgcaattctg tacgcacggt caaacttttt caagtttctc    347580
     cggcaaagtc ggggggttac caatcattaa ttagatttgc gtatttaccc gttgcgtatt    347640
     tacccgtaaa gatatgatga ccccattgag gtgtttaatt tacgacccaa acccttctaa    347700
     tgtctgactg tcaaacgtta cttgattttg ccgatcagtt gattgaatcc aatacaggcg    347760
     cagcgctgag tcagatacaa cgtttagtgc tgatggaggc attaaccctc cgggcaaaag    347820
     ccaagaccta tgaccaggtg gcatctgaga caggttactc cagtggctac attaaagcaa    347880
     tagccgctga actgtggaaa ttgctgtcaa aagtcagtgg caaaaaggtc accaaaggta    347940
     atgtccaaac gatgttgcaa cagcagctaa agcatgagcc atcactactg caggatgggc    348000
     gcttggtggt tgagacaggg atgatcccaa accgacagcc aattatccct aaagcaacgg    348060
     acgtgacggc ggtggtgacg gcggctaaag cgactgaaat taaggagact aacggtaaca    348120
     agactgacgt taatcaagcc gaagttaagg agaaggcgac ggttatacca tccgttattc    348180
     tggtggtgga tgaccagcct aatatcatga acctactcac cagcattatg gaacaggatg    348240
     agtatgaggt ctggcaggcc agcagtgggg cggaggggtt gcaaatggcc gcgaaggtgc    348300
     tgccggattt gattttgctg gatgtcaaca tgcctgatat ggatggttat accgtctgcc    348360
     agcagctcaa ggcagaccca cagactaccg ccattcccat tatttttgtc agcgccctgg    348420
     atgaaagctg ggataaggtg aaagggtttt ccgtcggtgg cagtgactac attaccaaac    348480
     cctttaacac cctagaggtg attgttcgca ttgaggatca actgaaaatt cgccagatcc    348540
     aagaccaaat gctgaaggcg gatcaagcgc caactgattc tcctcaatcg aagccatctt    348600
     ccgccaaagc cgtcattcta atggtggatg atgaacccaa gaacttagcc ctgctgacgg    348660
     atgtattaga gcaggaaggg tatgaaatct ggcaggcgga tagtggtgcg gaggcgttaa    348720
     gggtggccgg catggtgcta ccggatctga ttctgctgga tatcaatatg cccgatatgc    348780
     aaggctacga tgtgtgtcaa caactgaaag caaacgctaa aaccaaacta attccggtga    348840
     tttttgtcag cgccctggat gaaacctggg ataaggtgaa ggcattttct gtgggaggca    348900
     gtgattacat taataagccg attcagatcg ttgaattaat ggctcggatg aagcatcaac    348960
     tgcaaatttg gcactaaaaa tttaacgaga tgacgatgca acgccactca gccagggatc    349020
     tcaaactgac aaaaccgatg gcaaatttag catgaaggaa tcatcagatg aaccccaaaa    349080
     caccttcgct ttccctccgt tgggttctca tcattccatt cgttgtgcaa atttttgctg    349140
     ccgtgggagt ggtcggttat ttttcatacc gtagcgggca gcgagcggta gaagatgtgg    349200
     tgaatcagct ccaaaatgag attagcgatc gcattaccga acgcctcgat acatatttac    349260
     gcacgccgag ccttgtggct gacaatttgt cactagccat ccaaactcga gaactggata    349320
     tcaaccaaat caatcgagat tgggagcttt atctttggcg acatattaat ctatacgaca    349380
     acgttaaagg cgtttatgtt gccaccgaag atttgcaata caggcacatc atttctcagg    349440
     aagaagggct ggtgatggag ctcttctctt tagaggatca gttcctccgt tattatttag    349500
     tcgatcccaa gggcagtgtt accgatgaac tcatagaagt tctggaaaaa gagttcaagc    349560
     cacgctctcg tccttggtac acggccccca agcaggctgg taaagcgaca tggaccccga    349620
     tttttatttg ggttcaaggg gatacgatga gcgtcgattt tgcaaccccg gtttatggtc    349680
     catcgcaaca attcgaaggg gtggtgggaa ccagcttttc attgtcgaat atcagtgatt    349740
     atcttgccac acttaaaatt gctgaatctg gtgaggcatt tatcctcgaa cgctctggcg    349800
     cagtcgtcgc cacctccact ggagaaaaac cccatgggat cgatctcgac agtcaaacag    349860
     ttgcgcgatt aaatgccata gatagtcaaa atactctgat gcgccaaacg actcaatatc    349920
     tcttcgatcg ctttggcagc ttagagatta tcaactccct cactcaagat cgctataaaa    349980
     ttgagggtcg ccaatatttc ttaaaggttg aatcttatcg tgacaattta ggtttagatt    350040
     ggctgattgc cattgtcatc cctgaatcgg attttatggc ccaaatctac gccaacattc    350100
     gcacgaccct ggccctttgc ctgggggcat tgggcattgc tacctttttg ggcatcctta    350160
     cctctcgttg gattttgcag ccgattttac gcttacaaac cgcctccaac agcttggcgg    350220
     ctgggcaact ggaccaagcc attgaggtta aaggcatcca tgaactctct agtctcggca    350280
     gcgctttcaa cagcatggcg agacaattgc aagaatcgtt tcaagcctta gaagacaaca    350340
     atgcaaagtt ggatcaacgg gtgcaacaac gaaccgccga gctgaaagtc gcaaaagaaa    350400
     aagccgaagt ggcgaaccag gccaaaagtc tgtttattgc caatatgagc cacgaactgc    350460
     gcacccccct caatggcatt ttgggctatg cccaggtgtt ggagcgatcg cccactatct    350520
     ccgataaagc gcagcagcaa gtccacatca tccataagtg tggcacccat ttgttgggca    350580
     tgattaacga cattttggac ctgtctaaga ttgaagcggg caaactcgac ctgatgccca    350640
     aacccgtcca tctgacctcc tgcttacagg gggttgccga agcctgccgg gtgcgggccg    350700
     cccaaaaggg actggagttt gtctatgccg ttgacccagg gttgcccgag ggggtggaac    350760
     tggatgaaca acggctgcga caggtgctgt tcaacctgtt gagcaatgcc attaaattca    350820
     cccagcaggg caccgtgacc ttgcaggtgt cggtcgctga ggtaacccga tccgattatc    350880
     ggcgactgcg ttttggggta accgataccg gcgtgggcat tgccccagcc catctggatc    350940
     agctatttaa tgcctttgtg caagtgggcg atcgccaaaa gcaagctgaa ggcaccgggc    351000
     tcggcctcgc tatcagccgc cgacttgtgc aattgatggg ctcacagatt gaagtgcaaa    351060
     gcgcagtggg acaaggcagc caatttagct ttgaactcga agtgccattg gctaccgaat    351120
     gggagctatc tcccagtacc ctacagaacc acgctattat tggctatgcc ggtgaacggc    351180
     ggcgtgtgtt ggtggtggat gaccgctggg acaaccgcag tgttttggtc agtctcttgc    351240
     agcccattgg ctttgaaatc gtggaagcgg aggaggggca gaaggccctg gctgtgctcc    351300
     aacagcagcc ctttcatctc atgattactg atttggctat gcccgtgatg gatgggtttg    351360
     agttgctccg gcaggtacaa cagttgccca tacgcccccc caaaatgatt gtgtcttcgg    351420
     cctatgtttc taagcaggaa caggaactgg cgatggccgc aggggcagat gcgctgctgc    351480
     caaagcccgt tgatgcggcc aagctgtttg agcttttggc gcgtgagcta gggttggagt    351540
     ggcaatatgt ggggaatgag gcccctcagg acattacctc tgcacccgca gcggcaatta    351600
     ccctgccgtc ccgagagcgg ttgcgatcaa tgtatgacgc ggcggatgcg ggggactttc    351660
     gcatggttcg ccgacagttg gagcagctga tggcgacgaa cccagagtat gaggggtttg    351720
     taaggccgct gctagcgttg gcgaagaagc tgaagacgga tgagattaag gggatgctgg    351780
     cgcagtatgt cgatgatgaa gcgtcgggat aagggatctg cggtacaagt tgacaaaatc    351840
     ttactttttc taactccatc actgaagtaa tggagttaga aaaagtaagg tgggtcggct    351900
     gtgtaacgcc tcgtaaacaa aacccgttaa tttcgcttca actaattagg ttttaaatcc    351960
     atttttgatg gggaaaccaa ctggataatg ctgatttgtg atttgaatca cgtctagaaa    352020
     aagactagat cacaagaaga aagaaagtct ttcgaacctg gctttttgca tcactaaatc    352080
     taactttttc ggtatttcgc cttattgaaa agttgacgat agtgggttca acagcacggg    352140
     acattaaatc ccacagccaa tctcaacaaa tctgaggtgc cgatctaaat actggttggt    352200
     atcaagagca agaagctcaa cttacccaca aaaaggagca aggacaatga ctattgaagc    352260
     aagatatgac atcgaccccg acctaactgg aatctctcgt attactgatg attctcccat    352320
     tcagttccta tcgaatcgcc tcgatcattg gaagggattg aaacattatc gatttgactt    352380
     aaccgttcgc aattcttacc agtttgctac tgcacctaat catgatggca agcacggtgg    352440
     ttcgctagaa ctcaccagat ttaataagaa gtggactaat cagaaacagg actactatca    352500
     gtataaaacc ctctttggta ctgattcaag agacgttatt tacgaaaccc aagactatag    352560
     atacttaggg ggttggggtg aataccttga cgaaacattg aaacctgttt cacaaaacat    352620
     atacggtggt ggcggtaatg acaccattat tgctcatgat ttgcaaggtt atagcgacag    352680
     cgtaaagagt tatttaaacg gtgatccaag tagtattaat caatttcatg gtgaagctgg    352740
     aaatgacatt ttgaaaggta acgcgttcca gaacctcctg tatggaggga ctggcaacga    352800
     tacgctagat ggtggcggag gcgatgattt tctctcaggc aatgaagata atgacaaact    352860
     atggggtgga gatggagaag atcaactctt tggcggaata ggaaatgaca ttctggttgg    352920
     tggagacgga tacgatgaaa tagacgctgg tgatggtgat gacacgattt ttctggatgt    352980
     tccaattgag ggtaacaata agggtgacta tgtaattggt ggaacaggtg ctgacacctt    353040
     cgtcattggt ggcacgacaa tgactactac tactaccacc accaccaccc cctatgactg    353100
     gaaggggaca ggtttaggtg ccactactga tgtaatgggt gctgtcattg atggtactgg    353160
     tttaggtgtc gcctcgaaag ttaccaaagg tgttgttggt gctgttattg atatttttaa    353220
     gggtgctgaa agcaaaaatg ttgaaacaac cacagtggaa tcagtacctg gcaacatagc    353280
     aacaggaaat tatatccaaa tcactgattt taatcctaga gaagatgtca ttgttattcc    353340
     tataagtgct gaactgtcta atgttgggcg tactatcaca gatgataatt tgcgtacgct    353400
     agaactctac tacaaagaca gcgggcgagt ttttgccgaa atcaagcttg aagaactcta    353460
     taaactttac aacaacgacg aagttgctct gaatatcaac aatcgtgatg agttggagag    353520
     cgtttgggaa tctgttctag acagctcact ctatcttggt acatatgatg ccaatgactc    353580
     tagtcccacc attaagttag gtacaacaac agaaaacttt aaaaatgctg atggcagtct    353640
     taccgaaatc aaaaccactg tatctgagct agatgctaac tacatggtta ttggcgctta    353700
     tgcaggagct aatattctta cttcaggtaa ggacgatgat ctctggggaa ctgactataa    353760
     tgacgttctc gtagcctatc ccacagcttc caataaagaa cctcagcata atgagatcaa    353820
     taagctatac ggtttcaacg gggatgacat tttagctggt ggtgctggtg ccgattatta    353880
     ctttggtggt gacggtactg atattgtgtc ttatgctgac gatagatttg acgataacga    353940
     ttctaatggc atcacagtta atcttgcaga ctcgcttgaa ggaaataaag aagactatgc    354000
     ctacttagac cctgaaagtg aaaaagcaat tttttcttgg gcttgggatg tttatgcaga    354060
     tcctctggac ccagatcagg ctgacaagct attcagtatt gagggcatta ttggttccaa    354120
     atgggatgac agtattaaag gagataagtg gaacaacata ttcaatggtg gtgacggaaa    354180
     tgacacccta gagggtggcg ccggaaatga tactctcatt ggtggtgagg gtgaggatac    354240
     cctagagggt ggcggcggaa atgataccct cattggtggt gctggtagcg atactctaat    354300
     cggcgatgtt gttgctggta acgatactct aatcgtcgat gctggtgcag atacttttgt    354360
     gttagatacc actgaaggtg gcatcgacac gatcagaggc tttagccttg cagaaaatga    354420
     tgtgctcttg attgacaata agagcctagg tactagtcat gcgaaagccc ggaacttgaa    354480
     tggaatgctc tccgctacgg gccttaagct tcagttaggc aacgtaggaa ttgcgactat    354540
     cgaaaacgtc gatagctcta acgttcatcg agtgctgggt cgtgtcgaat tcaccactag    354600
     ctcacacatc aacacaccac ttggcctcgg cgatgatttg ctggcaacag gtgacggcaa    354660
     tgataggctc acgggaggat cgggtgacga ccttctcagt ggtggtgctg gaaatgacac    354720
     tctgctaggc ggcacgcaca aagacctttt actgggtggt cgtggggatg atttactcaa    354780
     cgggggcaag ggcattgacc gtctctatgg cggcagtggt gccgacacct tcgtcatcaa    354840
     caacacggta tcaggcctca ataagagagc aggcatcgat gttatccaag acttcagtgt    354900
     ggatgaattc gatcacattc agattgatgc ttctgtcttc ggtattggga ttaacgatca    354960
     ccatttagtt cagcttggca atgacagttt cttacgagtg aacaacagaa aaattgcaca    355020
     gcttaccggt gtggatgtga atactttcgt caccgacgaa catgttgact tggtctaatc    355080
     ccaagggagc gggtgggtgt tgaccaccgc attggaaacg caatatacca ggcagtaccc    355140
     actaattgtt tgaatgttca ttccctagca atgactgtat aaaaagagcg atcacggttg    355200
     gccaaactgt gatcgcattc ccagtatcac cccgcgtctt ccttcccgtt attgcctcta    355260
     ctgacattcc agaagaaagt ggcacgtctc aagccaatga cacccgctcc acaacaagcg    355320
     agcactagcg aaccgtgatg aagagcatca ttggcatcgg gcttatggat aagagcttca    355380
     gacaagatgt aataggcgtc gagtcttgct tgagcatagg ttttggttgt tgtgacacag    355440
     gccagcttgc tttttaagta gcagtattta tggtttatcc agaatatatt tggattggga    355500
     ggcaccttag taacttttcc tgacgccact tcctcaatca caggcatttg acatcctcca    355560
     ttacttgggt tcgcaaccaa ggatcctttt ggggtgttga cgtatctttc gtaattgtct    355620
     aatccgtgaa gcgtcatggc atgaacttca agggccaaac caggcttata ccgtcggtgg    355680
     ttaatacctg ccattaattc agggtttaac aggcaatctg caaggtcggt gtaggtctct    355740
     tcatctgaga aaaacagatg cttccaattc caaacgtcgt aaagatctat ctcgtctagt    355800
     tctgtttctg ggtccacatt tggctgatgt gttgcaccat aatacttctg caataggtag    355860
     caaacatgct ctgaaaatat ggcttcttct aggtttggga agtcttgaat tgcattacgt    355920
     ccgtattccc atgcgtccca atggattgaa aggatatgca aaatggattc aactaaatca    355980
     agcttagtgc cggggaatgt aatgtttgtt tctgttggct tattaatgcg agggccaaaa    356040
     gtaatccagt aaacggggtt gcccacggga gtaactgcgg ttttcatcgc tatttcctca    356100
     attgattgat aggtatgaag ttgagaatct ggctaggtaa tacagattcc gcgcggatac    356160
     tgaaagtagt gagagttcaa tcttccgtag ctttgctagt accgctggac aatacccacc    356220
     cgtatactca aagccgtctc agactcaggt ggtatcagcg gattgaactc acttaaccag    356280
     gacgcaaccc ggtctaggat ctgatctgat ggcagtcctg tgcatgggtc tgggtgctga    356340
     ccgtagtcgg tctggtggta gatccaggct tgctcgatat agccgataaa ggggttagtc    356400
     gtcattgggg atcctcgtta taattaaatg aaaggattta tttacgacct cctgggctgg    356460
     gaagatcaag gaggtcgttt tattgtggtt gggtgggaag tctgggaggt ggtattgggg    356520
     atgcgatcgc gtttacacac cgatccactc aaatatcttt ctgctcatct gtgattacat    356580
     ggggcaagaa agaaatggaa gttagctgta ctccaatcct gcctggcttt tcagatgaaa    356640
     attgcttcaa ggcttttgtc tcctcagcag caagaaaagc atctagggct gttttggaag    356700
     acaaggcgaa atagctagga gagtgtttag atttttgtgt aagcagcagt gtattcaata    356760
     gttgaatcgt gttgggaaca gaatagcaaa atgggacagc gccgctttcc aattcagaat    356820
     tggtctggtc catcgcttcg aaatattcct catcgctaga aacatcaatt tgtagacaga    356880
     ctcttcatta gggaaaaccg ctttggtctt aatcaccttt ctcagtgagc ggttgagcga    356940
     ctcaatggca ttggtggtgt agataacctt acggatggcc attgggtatt gaaacaacgg    357000
     ggcaacatta tcccaatgtc gtatccagat ttggctaatg ccaggatacg tctcgtccca    357060
     tttatgggca aatgcatcca acgcagcctc agactcttcc aaagtggccg cttggtaaat    357120
     gggcttgagg tctgcagcta cggctcgact ttccttccac ggcacatggc gaaggctatt    357180
     acgaataaga tggacaatac aaacctgcac ctgggtctga gggtagaccg actcaatcgc    357240
     ttgaggaaaa cctttgagtc catcacagca agcaatcaag atatcctgag ttcctcgatt    357300
     tttaaggtct gtgagcaccg aaagccagaa ttttgctccc tctcgttcag cggctcctat    357360
     ccataatccc aacagttcct tgttgccctc cacagtcact gccaaagcga catagacagc    357420
     tcgcttgctg acttgaccat tgactttgat gttcacatac agcgcatcaa gatagacaat    357480
     cggatacacc tcatccagcg gccttgaacg ccagtctttg acctcttcca tgacgctatt    357540
     ggtgacgtca ctaatcagag cttcagagat attggcccca tacagctcca ccaattgggc    357600
     tcgaatatca cgggtggtca tgccccgagc atataaggcg atgattttct catcgagccc    357660
     tgcgatgcgt cgctggcctt taggcaccag gacaggctca aactcgccgc aacggtcacg    357720
     aggaatcgat aggtccatct ctccttgttc agactggacg gtctttttcg agtaaccatt    357780
     gcgactattt ctggggccat tagaattctc atcacctgac tgatcgttgg aggattgctg    357840
     caggtgatga gtcaattcac ctgcaagggc tcgttccact aggcgtttgc tgagtcgttt    357900
     aagcagtcct gattcgccca gaatatcttc cggttgaggg ttctctccga tgagttcatc    357960
     taacagttca tcgactcgat tgggagcttt tttctttcta gacatcgtac ggtctcctga    358020
     tgtgtttgga tcctagaccg cttacacaaa actctgaaca gtccctagct agcctcatct    358080
     tccagagcca tcgttgccgt cgtaggcatg aaatagactt ggcctgtgtc gtaatctttg    358140
     acctggtaaa ttagcgctgc gataaagtgt ttcattcttc agttgtcgct ctaatgatga    358200
     gatcagactt gggtctggcc tgatgaatta ctcaggagcg gaacttgagg actccttcac    358260
     ccgagcctga tcctgggttg cagcctgggt aacttcgggg atatcccaag aggtttttaa    358320
     gtacaggccg gggatgtcct tgaatgctgt ctgaagtcga ttcatacaat ctcttgctct    358380
     ttcctcagat ataaatgcat tgcatcttgt gacttcaaag gcaaagacaa cttgagggga    358440
     agatttttgg aaggggagcc aataatagct tcgggtgccc agacctcctc ctgttgggag    358500
     gatgtgattt gcgcttgatt gaaaagtgtg aatcatgaga atcacctcaa ttgttcgtca    358560
     gttgatcagc ggaatccttc aggtgttttg tcctcagcac atccgtctga accatcggag    358620
     gggcggtctg tgcggaactg gaattgagta cgagtgtttt acaaaattgc gcgggtaatc    358680
     gcttcctggt ctagcgggtt gcaccagggc aaaggggaag cttggtaatt gtcgttggta    358740
     ttgttttgcg atcgcaaaat ggcatcaccc tcaatcaatg agttgggaag gggcaaataa    358800
     tatgccaccc tcccttgaaa taggcaagta ggaattacag atccccccga atctcttcaa    358860
     tgacaccatc ccgcagtacc atctcgacct gcatcttgcg aataaagtgg tcgccttgct    358920
     tgacgtaaaa gtagctatct acctggcctt gttcaacttc ctcgcccagc tccaatgttc    358980
     cgaccttctc cagttgctgc aagacttgag ctttttgctg gagcagttcg tttttgcgtt    359040
     tttcagcttg cacctggatg ccttggatct ggttctgggt ttcggcaata gtgcggccct    359100
     ctcccccagt actctgaatg gtgtgctggc tcagttcact caccatctgc tggacttggg    359160
     tatcgagctg agctaattgc tcatccaact gatcaacttg ggactggaga agttgctgtg    359220
     cctcgtcttt ccatatagga gtgacgatgg ccttgatggt gatcggacga ttgagtaaga    359280
     gctgattaga tgatggagac tcaacccaaa gttctggttt gggctgggtg ggacggtctt    359340
     gaataagcat gattgctctc cttaattaga tggttttgaa ggtgacggat aatatgccac    359400
     cgttaatttg ctagttggcg gtgacggata atgtgccacc agctttattc gctccagtcg    359460
     gaggtgccag gtaatgtgcc accgctctga tttgcttagt tggaagtgac cgataatctg    359520
     ccaccttccg aatttggctg tgcggtgacg ggtaatatgc cactcttgtt atttgccgat    359580
     gatggggcga tggtcccccg cagccaccag ccaccagccc cagcgatgag ggcgactagc    359640
     acgacgagcc aaccccaata gctgaaatcg ccaagcacgg ccatgcggta gtcatgttct    359700
     ctttgttgtt tggctgcttt gcggatggct tcttggtctg cgaggatcat ggcccgttca    359760
     cggatggcga tggcctcttt cgactgcatc gcccacacct gaaattgggt gttcatcagc    359820
     tccaacaaga tttgacgttc taaacttccc ggacctcggc ctccaaacac tttcccggca    359880
     ccgtctcgcc ttcaagagct tcttgggctt cctctttcgc ccattcttcg gcaaacatct    359940
     tcttcaagtc acgactcagc tgctgcatat ggtacttatg cgcggcttgc accacccgct    360000
     ctgaagtctt ccgggcattc ttgacgactc ggcggcaggt tcgcagtgag tcagctttta    360060
     aagctaactt catatcctcg tcaacctcct ccacatcatc aatggttact tcctcctcgg    360120
     gttcttcggt gccctgtaat tcagctttga ccgcatcaac ggggtccatg ctttcctcag    360180
     aaacccgctc acagaccaat gtgaacagcg ggtggtacag gtcattgccc gtctcaatcc    360240
     cctcagcagt aatggccttg tggataggct taaggtcaac ttgatgggtg tcagcggtgt    360300
     agatgcacca ggcatgggtg tagttatcag ccgatttctc ctctctcagc ttcacgacac    360360
     cttgcagagt ttccaggtca tagccgtctt cactcattcc gcaggctctc agtagatgac    360420
     cgacttgctt gtcatccatg ccgagggttt gcattagatc attcataata gtcattcgtt    360480
     tatttctcca aatgttgaac tgtgggaatg taccaccggg ggttttgaga gtggtggagt    360540
     gaggggacat ggaaatatgc cccctcttcc tgctgaggtc agtcgtccat aacgaactcc    360600
     tcgaatctcg tctgtgaatc atcccaaggg aatatgccac cagcattttt tcggtactgg    360660
     catgagcctt cctaatcgaa ttagtcatcc tccttcaacc ctgcatagat acttattgca    360720
     gggctatcag aatctaccgc cgggggttcc tcttcttctc ttggaggttc ataaggctca    360780
     gggggcggct gtacagtctc aggttctacg accattgggg cggctgtgga tggagctggt    360840
     gagggtggcg tcaattcagg agaatcccca tcagcagtaa ccataatcaa tgccagttcg    360900
     taaaacgtct caacctgatc tcttgaaatc aggatggcct tgcgaacctc agctacggaa    360960
     ttggttcgaa gggcaacaac cactggctta aagacggcat agagaatcgt cacgcactta    361020
     gtcgcaaacg ttccgtagaa gtgttgcttg gatgcttgca agatttcctt atactctgca    361080
     ttagggtata cagcatctac ttttaatcgc tcaggcatta cacaacctcc ttaactggag    361140
     caggttgcag ttgcatcaca ggggctgcat gttgtcgcca aatcagatat agatcgataa    361200
     atctctgctg ctgagacaac gacaatcgaa gttgagcaaa tgttgtcttg atttccctgc    361260
     gaaccggagc gaggatatca gccttgacct ggcataaatc agccaaatag tctccccaga    361320
     aaaaggagcc tcccccgccg acatacacac gcttagaatt catgaagtcg gtatccgctg    361380
     ccaagtcatc actcaggtca gtccaaacta aatctttggc ttctttgagt gcagctagct    361440
     taatcggctt ctcctcttca gtgagcattg ccgataatcc cccttcgccc caggccatcg    361500
     cctcctcata cagcagcttc gcccccgtca attcattgct gaaggcaaac gggaagttcc    361560
     gcaaaatctc aatggtgccg taccccgtcc aggtataagc attcggcacc acattcgcct    361620
     gctcatcctt gaggttgata atcgtcacat ctctgtgacc aaacatcagg attgaacagg    361680
     ggtacacgtt ggcgtagctg gcaaatcctg caccctctgg atggacctgg acccgaacgg    361740
     gattacatga aactgtgtca atcccatact ggaaactgcg gatatgcttg aaaatcagct    361800
     cctcagtttc tcggaagtag ggggcttcat ttgaaggcag catcagatca atctcaacat    361860
     ccagggggct atcgatttcg ctgatgtact gacccacaat cgacagcacc ttagccacgg    361920
     catggtgctt tttgatccga ttcaccttgg tccgacgtac agccccctcg gcatactcac    361980
     ccacaatcca atgggcacca tcaaatgaca ggtgtgaccc ttgccgattg ttcactaagt    362040
     tcaaagattc gtaatagctt gccgtgactt tgcggatggc actcgattgc aaaatcaagt    362100
     cctcaacacc caccttgcca gggtgagtgg tttggacaag aactttgtta ccggatgccc    362160
     cagtatcgat tccaaatttg gcgatagcgt tcatggattt tcgcttctcc ataatcaacg    362220
     aaataatgta ccgccacccc aaatcacgat tcacacaaat ccccctaaat ccccacaaat    362280
     ccccttgcaa ctcccccaaa tccccctcga aataggtgag acttggggga atccagagaa    362340
     tgacctgaga acttgcagga aagcttggag tggtgctact ttgagggcag attcaagagg    362400
     ttttggaggg gtcgctgagg ctcccacacc catcaccact ccgaggcacc ggaacggaaa    362460
     tttacccaat cggactgacc ctaaattttc gtagtacatt cagaaacatt tttgtactat    362520
     cacgtagtac ttccgtagtt gttttgtaac ttcactttgt agtacaccgt catatctttg    362580
     tagttttcat gagaacgatc acttctgtgg tcgatggaat cgctttttaa aaatttcaca    362640
     gcaggtattc ccatgcttaa aactttcctg aaacatctga acgactaagc caggggccga    362700
     tgtcatgaag acgatgcgga ccatctatgg agaaatgatt gactattacg atgaggatga    362760
     atctctcgta gatgctccag agcgctatta cagcgaatcc gaggttatca ctgacatcga    362820
     ccgcatgagt accgctgtct gggtcggctc caacgcgatt gttcaaaagt taggcaccta    362880
     cgttaaacga gaggacttca aagccctcag tcgagggttt ctacctgaag ccttaaaaag    362940
     tgtcgcgggt ggtgcagtcc aacggattcg gggcaagaaa cccaacgagg aagacaaaga    363000
     acgccatgcc catgacgtgg tgctgtctgc tcccaaaagt gtgtcgatgg ccctgcactt    363060
     ggaaggggat aaccggatct ttgatgccca catggaggca gtcctcgaaa cgtttgagtt    363120
     gcttgaacgg gagtatgccc agacccgaat tcaagtgaat ggggtgcgct ctgtcgtcga    363180
     tacgggcaat atgattgcgg cgttgatgcc ccatcacact tcacgagatg gagatatgca    363240
     gctccacacc catatgctga tcatgaatgg cacacagggg ccagatggtc ggtggcgatc    363300
     cctctctcat gaaaagctgg ctcaggccaa gtggatcggc agcttctatc gtcagaagtt    363360
     agctgagaag gtccagcgac tgggctatcg catctaccaa accaaggatg catttgagct    363420
     agtgggctac gaccgttctg atgtcgaagt cttcagcaag cgtcatcggg ccatcgtcaa    363480
     agcggttcgg gatgaagggc tagaagttac tcctgagaac aagaagctga aggtactccc    363540
     cactcgcaag gctaagcggg gtgtcggtaa aaagcttgaa atcatccaag accattggcg    363600
     tgaagaagcc cgctctcaag gggtgggcca tccagtattg gctgaacctt tggccgtcct    363660
     acctgaccca ggtagagcca ggtatgaagt tgagagtgct attcgccatt atgcagagtg    363720
     gtcctcaatc tttgagaagg atgacatcta tgcctatgtc ttcaagaccc tcaagcgaca    363780
     gggcatggct atggaacagg tggatgaggc catcaagcaa agcaaggaac tgatccccgt    363840
     tgaccgtgga ttcaccaccg tcactgccgt tgaagaagaa gcccagatcc atcagcgctg    363900
     gatggcaggc caaggtcaag ctcagccaat ggtcgctcat ccttcacttg ctgggatttc    363960
     ggtcaagctg aacgaagacc aggccaagac catactcaac accctcacta gcactgacca    364020
     ttatcaaatc tggcaaggct ttccaggggt gggcaagtcc agaaccttgg gggtactcaa    364080
     gactttactc aatggatccg gtttcacgat tcgggggttc agccctacca tcccagccgc    364140
     aaagaagctc caagatgagc taggcatcac gaccaacacc gttgagcatc tagttctcca    364200
     tcaagttgat gatagcccta accaagtctg gctgattgat gaagcgggca tgatgagccg    364260
     acgacagatg aaggtgattc tggaaaaggc agaggcagtc aaggcacaag tcatcttcgt    364320
     aggggatgcg ggccagaact cttcaattga agcgggcaat cccttcaagt ttatgcaggc    364380
     caatggagcc accactcacc gaattgagga gattatcagg caaaaagttg atgtccaaaa    364440
     gcaggccgtt gaactgattg ccagaggtag aggaattgca gcactagaac tccttgatgc    364500
     taatggatat gtgattgagt cgggctgtaa agcggaaatg gctcaagccg cagcagatca    364560
     gtacctcgct ctccccctca aagaacaaga ggaaaccctg attatcgctg gtaccaatga    364620
     ggaacgactc gatacggagc aagccattcg tagaggggag aaacaagcag gacggctagg    364680
     ggaatccagc aagattgttc agctcaagtc ccgcaacttg agtatcgagc aaaagcgtcg    364740
     ggtggattgg tatcgcaaag gggattacgt ccgattactt caaacctccc ataccgcatc    364800
     catcaagcga ggagaactct acaaggtgga aaaacgcgaa ggggatgagc tggtggtatc    364860
     ttcctttggc ggtcgcctct atcgattcaa acccgcgaaa tacaaactaa aggaggtcta    364920
     cagtgcccat aaatttgatg tggccgttgg ggacaagttg cggtggacga caacgatcaa    364980
     agaaaacaac tggattaacg gtcagcagct cacggtcacc gcccttgatg gcttgaacat    365040
     gaaagtcaga gaccatgagg gacgttccca tgatgtgccc ctcacgcaac cgcttgcctt    365100
     ggaatatgac cgggtgtgga cttcctaccg ctcccagagt ggcagcaaga aacggacgat    365160
     tgtcatcacc accaatgacc ggacctccag ccgggagccg ttcctcgtcg atatttctcg    365220
     gcaagaacat gaattgactg tctataccga gagcctgaac aaactcagga atcgggtcgc    365280
     caaatccaat gcccaaaaaa gtgctttaga tctaatcgag ggaacctatg gaaaccaacg    365340
     aacaacaaca gcagatcatc aacgagcttc gagtccagtt agccccactc acggacgcga    365400
     tcaccatctt gaccaatcaa gtcgaagagg tccaagccca gaaccaacac atcctagacg    365460
     agaacagaga actcaagtcc caagtcaggg agcggatcaa caccattcca atggaagtca    365520
     aagccgttct caacctgttc atccaggaat tcaaggaggc gatggcatcc aagaaaccct    365580
     cggatatgag cgagtcgatc aaggaactcg ccaaggcaat ggacaactta aggttgaaaa    365640
     tcgaggatac cagcgtcttg cagttgacga tgagcgacaa ggtattggag gccgcagagg    365700
     agatcatgca gatcaaggac aagctccccc gacacgcacc acccaagacg gtcgctcaac    365760
     agaatggggg gcaacctcct cagacatagc taattgggtg atgcattggt ctgaggagaa    365820
     tgagcttgca gcaagcgggt tggaggatca cttgctagcc cttgataagg atatagagtc    365880
     actcactcaa agtctagaac catattcctt tgaaggtttg gaagaactgg ctgagattgt    365940
     tgaaaatgca gataaacaac aagatctcag ccagaacctc acttatattg cccaaactat    366000
     agataacttt aaccagataa tcacccaaag tcttgattct agacctttta taggcttgga    366060
     agaattggct gagattgttg aaaatgcaga taaacaacaa gaactcagcc aaaaccttag    366120
     ttatatttcc cgatctatag ataactttga ctacactatc gagcaattcc taagccagca    366180
     acgaatcaag accattgctg atgccgtagc agaatggcga acgggtcagg agctggcaaa    366240
     tgccgtcact gaaatggtgg atgtcctgac tcagggcact gaagggctag accgggcaat    366300
     catccgactc caagcgggga ttgagaccac ccaatctctg gatgtccaat tccccgcaat    366360
     ggttgagtta gtcgatgccg ttcaagattg gcaaactgag gtggaagttt ctgcggtcat    366420
     aggcgaggtg caggagctgg ttgagtcaat cacggtgcct caattccctg gaatgaatga    366480
     cctggctcag gatgtccatg acctcaatga agaacaagcc ttagctgaga gtggcttggt    366540
     tgagcagtta gctgagttga ccactcagat caatacctta gttgaacccc agcaagctca    366600
     gtttgagggc atggcacagc tagctgaggt ggttactgaa ctccagcaag gtcaatccct    366660
     cgctcaggtg cagccccagc tccaggccat cacccagcag attgaagcgt ttaacgccaa    366720
     gcaacccact tattcttttg ccaagattaa ggagctggcc gataccgtca gtgagtggag    366780
     ggcacatgaa tccatcactc aacacattgg cgcactcaat gatctgaccg ttcgcgctca    366840
     acggagtctg aagaccttcc cagctatgct gcaattggct aaatccgtga aggcaatgcg    366900
     ctctgtggat gcactcatga atgggccagt cgcagaccag atcaaggaag tcgcccaaca    366960
     gttaacggac aaggggatga gtatcactcc taagccaaag accattgacg atcaggtgtt    367020
     ctggaagccg gactataccg gggtagaacg acctgaccac attgacgaga agcattggaa    367080
     tgaatgggtg gcaagctgcg cccatcctga tgtgattgct gctcggctcc aatccattgc    367140
     tgatgatcag gtgattgatc ggttgctcgg agccaagatt gaagacatcg ccactcgcag    367200
     acgggatggg tcgttcaaga cggttcgcag ccagtatcac attgagccga tccgagcctt    367260
     gattaatgat cggtcgcatc ctgaagtgtt gagctatcaa gagctagctg aagggggagg    367320
     ctggtgggct gatgctggag tggatccgct gtcctttgaa gaacttggac ccaatgagga    367380
     acctacactg agtctgtatg gcaccttcaa gcctgatact ccccgcatcg acgtagacaa    367440
     aactcgcaga gctagggcta aagactccaa tgccccaacc aaatatcgca agtatgagaa    367500
     tccattggga accaagcgcg aactctttga gcgagacatg gccttccaac ccgtcccaaa    367560
     tcatatcgct gagcggatct ttgataagta tggtgttgtg caaacggatg aggaacggac    367620
     caagggattc tggtacacgg tctacaagca tcctgagatt cccatctacc ggactgaagg    367680
     agacaagaaa gatgcggcat tagtctctca aggaagagtc gtcattggtg gtcagggggt    367740
     caacatcggc tatcgggcca agaaccagca cgatgaaaag ctcgaaagac gagtactgca    367800
     tcctcatcta gacgtgtttg cggttccagg cagagagttc aggtatgccc atgactggga    367860
     ttctgagcag tccacggtct ggaacgtgcg ccgtgaaatg gtcagagaag ctgaactcat    367920
     tgaagaaaga gactgcaaga catggagaat tccttgggat tctgaacaag ggaaaggcgt    367980
     cgatgacctg atcgctaatc atggccccat cgcctttgag cgggctgaca agaatgccta    368040
     tccgatggag cgggaaatca cgatgcacta tcggggccag tacacccaga ttaagaagcg    368100
     attgaatcgg cactttggat gcgcggtgca cgatattccc atttacctag aagcgatgaa    368160
     ggatggggac gagatggatg gcattcgggt cctatgggag tcttccactg cccggtcctt    368220
     ccagcattac catgacaagc agcactatat cgagggcatc atcaagctct cggatgccta    368280
     tcgtagactc gtcagaaaag acggtgaccc caaggccatg caaatcctcg tcaacagact    368340
     aaaaaggccc cgacccatta tcaaggtcga ggccagaagt cggaatataa aacgaggcta    368400
     tggacgttag tctacacgac gggagttaat caccgtacca ccactagaac taatccaatc    368460
     agaacccggc atgggaggtg gccctggaat aatctcggtg agtctcattc ctgatctatc    368520
     ttcaatctct acgcgactgc gttgttgagg cttgggatca ccgggtagcc gctgactcca    368580
     gggatcatta aatgaattgc cgattggatc gttatacata tctgacatgg gatttctcct    368640
     tgatttgatt aacaacgtga aactgattcg agagaatatg ccaccccctt tatcgggaca    368700
     tggaaacttc tcgtttgggc tgttctttct tctccacggg gggacgggca aggttctttt    368760
     taatcttggc aatgagcttg ctagaatcta gtcctttctc tcgcctccga tgaatcgtat    368820
     ctttctgttc ttgggtaaat ccagcgaact catcctggac ttctgccgta ggatgcttgg    368880
     actgggaaga cgctacttgt tgattctcag gctcagtggg ctgttcttta tcattgggct    368940
     tgggagcttc cgcctcggtc ttctggcctt tagtttcact ctgctgctgc gcatccttgg    369000
     ggatatcagc ctcagccttg atatcctttc cagaaagtcc atatcgatct ggaatcgcaa    369060
     taccattttg aatcctaaga atcgtgcgag tgcctacctt aatcgtcaat gtccctttga    369120
     atttctctgg attcctcagt gcctctcgaa tcatccgaga ctgttctaaa ttaacggaac    369180
     tgcgattatg atcgattatc ccgtcatcat ttagtcgaaa tatctctttc tgatttaaaa    369240
     acactcgcat attgccaatt tcaatattgc gacttagctt ctcaacaata tcctcgttga    369300
     gcatgcggag tgggtcaagg tcttcagatt ccgaggcttt cgctttcggt gcttccgctt    369360
     caggtgcttg agagggttca gccctttctg ggtctgagga gttgcggacc acagccttcg    369420
     cttcctcctc actcataccc tcgtcttgac cctgcatcac gaccagctcg tcatagtatt    369480
     cctgcaactg cggatcttcg ctgatgtatt cttgagtgtc agcataggtt agctcttcgt    369540
     ccagggcttt agacaataac tccgcatatt ggtcttggct tgtggattca gtctgtacct    369600
     ctgccccctg ctcaaaggca tcaaagttag cctcagtggt gacgagtttc tgaacgtctt    369660
     ctaggtctac cccattaaca gcagcttgag ccacgacctt ctgatccagc tcactcaata    369720
     acgttggatt ctcaccgagg cgagactgaa tatcctccca ggtcaaatct ggattcttct    369780
     caaattcacc cagtagttga gaatattgct gttgggcatc cgttgatagt tccaccgatg    369840
     gattcacgac agaagcattc acttccaata ctgtttgagc ttcaggctcc tgggtcagct    369900
     cctgattaac ctctggggtg gggttatcta gtttgtattg cgcctccact gactttgctg    369960
     tctcagctag ataaacagag gtatcttgaa gcttcgcgtc agccatctga gatacatttg    370020
     gtccctggga gataatcgcg gttgcttcat ccgggccttt ccctgctttg agcgcttggt    370080
     agaagacttg cttgtcatag tcagctccta agtcgggctg attctggaga gtctcctgaa    370140
     tgcgctcata ggtgagattg gggtcattct gttgctcaga taggatcttt acatattcat    370200
     ctcgtcgctc catatcgcgc tctgtgggga tggaggcttg gttctgtgct tcagccattg    370260
     ttgcttgtct cctttgtacg gtttccattg cactacgaac gttctgctgc acttgctctg    370320
     gcagcttgct caaggtctct tcaaaccaat ccttggcccg gttgatgtag tggttggtca    370380
     tcctccacat atgaaccact ggacgagcca ccactgtagg aatgccctgt ctggcatagc    370440
     taatggctag cttgctcgtg tccacgatgc ctttcccgat catcgtcggg gcggcaaacc    370500
     cactcaaggg ccgtgcccag gcatctgtct ttgccaacat gtctgcggtt ctcacattcg    370560
     cccaggcatt gaaagcactc tgcctccccc atccaggctg tatctgaccc gctatctcag    370620
     caaagttctt ggcgatctga tccgctgcaa cgccatgtat ccctgagtgc atcagatgag    370680
     tggcctgacc cactaccccc gccacggcag ggccaacgat gggagcatga gtcgcggcca    370740
     ccgcagcagc aggaggcagg gcggcaaact ggatcagttt tttagccact cgcatagtgg    370800
     gagcagcctg gaaaaagagt tgttcttctt cccgtagttc ccgatacttt gcactgatga    370860
     aattctgaga ttcaagtttt tccattgttc aagttctcca tagttagagt cctgatttgt    370920
     tccgaggtaa tgtaccgcta ccgtccaaac ccccgatttt ggcctcggtt ccgattctgg    370980
     gtgagcttgt ggccgtgggt ttccaccgcg actttgagtt gggcactctt cacataccgc    371040
     tccgccatct tggttgggtc ttgcactttc tcggcatagt cgctcatccg tagcttggtc    371100
     ttaatcacat ccgtgggggt gttattccgt atctccttct tcgccagttc cattgcctgt    371160
     tcagcagtct cgatcttgac cgccactcgc ggcttgcgga gggcgacggc attgatgatg    371220
     acgctgttgg tggcattcac ggcctgctgg ccgatttgca acgcttctct aaattgctgt    371280
     tcttcgctac tcatgcggct ttctcctctt gttgcttcaa tttgtgggat tcaacttctt    371340
     gggtagaggg cagcaaggca tccgcagaca ccatgcggtc ggacatgatt tgttctggag    371400
     aatctaacac ccgctcttgg gctatccgca ccatctgctt atggacatgg ctgttgtaca    371460
     tccgctcaca ttcggtgaac cgctgcatgt ccgtgccatt ccgcttcttc aagttgaagc    371520
     gcatccgaat gggccgatca tccatgccgg ggttggtgca gataaattcc cctttcttca    371580
     atcgcttgat atctgaagcg gtaatcagcc gcttcttctt ctcctgttca ttgcgggagc    371640
     ggctgttgcc catcttcccg tagctgcgag atttggaatg gtagtgcttg gtgtactccc    371700
     ccaagtccgc actcaggtct tctcggactt tgtagctccc actcttgaat atgaattggg    371760
     tggaggtgtt atcaaagatg gactctgagg tctccgactg atatttaatc ttgggttggc    371820
     tatagctctg catggacaca aaggaataga acccatagct ccgatccaag gacaccactt    371880
     cttcaaaact cggcagcatc agtcgggcga attcatctag gaacacacca aaaggccgat    371940
     cccgttccgt atcctcattc aagttgcgct gaattaaaag gtgaatggca acagcgacta    372000
     atggggccgt agctttcttg gcttgtccat ccaactcaaa gaagatgatt tgcttacccg    372060
     gtaggtccaa aggaatggtg gattgggtgg gttcgcgccc atcaatggac agacagggga    372120
     tggtctgccg attgaccatt ggtaagagat agttgatgcc actcgctaat atgccgccag    372180
     cggtatcttg ggtgcccgtc acgctcatca ggcccacgag ctgttgcctc acccacatgc    372240
     ctaaatcgct atctaccttg aatgcgcctt cttgatcggc catttgaatc cgctctgcga    372300
     tacccggcag gcccatcaaa gcccatacca tcggcaagtc ggaatagtcg gcccgcttcg    372360
     ccatcatcaa cagggcttgc aggaagtact ccgcatgatt gtcgaagaag ggatgcttgc    372420
     ctgaaagatt gacgatcacg ttatcggaca aggttgaggc gatggaccgc gctctcaatg    372480
     agtcatcagc atcttgcata aattttaggt agtcaaagcc atgactgtat cgcttgccgg    372540
     gggcaaagca gtagcactca tatggatctg gttgcttgag ggcaaagggg atgaatttct    372600
     tcttgagagt acccttcaca tcaaagacaa tcagggtgtg ctcctggcgt atagcatctg    372660
     ccaaggctag ttcaatcacc gtagcggtct tacccttacc agacccaccc acgatggtga    372720
     cgaggggctg aaggtccggg aggatcaggg ggtcatcgct gcccaggcga agggcaattt    372780
     catcccgttt tcggtctctg atttgcttga gtcccagcat cttagctcga tgctgctccc    372840
     gtctcgtggc ccaccgggca tcatcgggtt cgcgtctcgt ctcatcctca aaccaccaca    372900
     gggcaattac gatcagggcc aataaacccg tcaaccaggg gagagggcca ctgaaaagtg    372960
     gggacaggtc aaccccttca gattggggtt gaggaggctg ttcggtatgc tgcgacatta    373020
     ctcacctcct ttgctttcag cgatgggagt ggagtaacct aactgcacga gcaggggtac    373080
     tgccaaaaat ctgatgttgg tcatggcggt cgaaattatc tacgagataa cgtaccgcca    373140
     gttgaatttt gagtgggcag aagccacacc tctatgaaaa gatatgccag attaacaaca    373200
     attcttacca gggagacaac aagaggcgat atcagggtga ttatcacagc aatcattcag    373260
     aagaaaagaa atcagtccac caagacatgc gaagtccgct ttgtagacaa tatgtcgtga    373320
     ctgacgttca gacgaaacaa gccctgcatt ctcaagtttg gacagatgaa atgacattcg    373380
     agaagaagtg acctcaacag ccttgccaat ctcaccagca gcggcacccg cctcgccaca    373440
     ctgtactaag tatcgaatta tgtcgagccg agtttcttga gatagggcgc ttatcgcttt    373500
     aagcgcttca acctgtttca tatttcaata tctcttgaaa tattgaacta taatcaatac    373560
     gatacctcat cactcaaatg aatccttgtg atgagtatga tacaggagac tatcgatgaa    373620
     aatcgtcagc ttcaagatct gcccatttgt tcagcgagtt acagctttat tggaagccaa    373680
     aggcattgac tacgacattg aatatattga tctaagccat aaaccacagt ggtttttgga    373740
     tctttctccc aatgcacaag ttcccatcct cattacagat gacgatgatg tactttttga    373800
     atctgacgcc attgtggaat tccttgatga ggttgtcgga acaccgctct cgtcggataa    373860
     cgccgttaaa aaggctcaag acagagcatg gtcttatttg gcgacaaagc actacttggt    373920
     tcaatgcagc gcccaacgaa gtccagatgc taaaacgctt gaggaacgtt ccaaaaagct    373980
     atctaaagct tttggcaaaa tcaaggtaca gcttggagag agtcggtata ttaatggtga    374040
     tgacttgagt atggtggata ttgcatggct accattactt catcgagccg ccatcattga    374100
     acaatactct ggctatgatt ttctggagga gtttcccaag gtgaaacagt ggcaacaaca    374160
     t                                                                    374161
//