Dbfetch

ID   CP000697; SV 1; circular; genomic DNA; STD; PRO; 3389227 BP.
XX
AC   CP000697; AAOO01000000-AAOO01000076;
XX
PR   Project:PRJNA15753;
XX
DT   12-MAY-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Acidiphilium cryptum JF-5, complete genome.
XX
KW   .
XX
OS   Acidiphilium cryptum JF-5
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acidiphilium.
XX
RN   [1]
RP   1-3389227
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Han C., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Magnuson T., Richardson P.;
RT   "Complete sequence of chromosome of Acidiphilium cryptum JF-5";
RL   Unpublished.
XX
RN   [2]
RP   1-3389227
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Han C., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Magnuson T., Richardson P.;
RT   ;
RL   Submitted (04-MAY-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 18cae151d1e88999698a3a6197afdca3.
DR   BioSample; SAMN02598339.
DR   EnsemblGenomes-Gn; Acry_R0001.
DR   EnsemblGenomes-Gn; Acry_R0002.
DR   EnsemblGenomes-Gn; Acry_R0003.
DR   EnsemblGenomes-Gn; Acry_R0004.
DR   EnsemblGenomes-Gn; Acry_R0005.
DR   EnsemblGenomes-Gn; Acry_R0006.
DR   EnsemblGenomes-Gn; Acry_R0007.
DR   EnsemblGenomes-Gn; Acry_R0008.
DR   EnsemblGenomes-Gn; Acry_R0009.
DR   EnsemblGenomes-Gn; Acry_R0010.
DR   EnsemblGenomes-Gn; Acry_R0011.
DR   EnsemblGenomes-Gn; Acry_R0012.
DR   EnsemblGenomes-Gn; Acry_R0013.
DR   EnsemblGenomes-Gn; Acry_R0014.
DR   EnsemblGenomes-Gn; Acry_R0015.
DR   EnsemblGenomes-Gn; Acry_R0016.
DR   EnsemblGenomes-Gn; Acry_R0017.
DR   EnsemblGenomes-Gn; Acry_R0019.
DR   EnsemblGenomes-Gn; Acry_R0020.
DR   EnsemblGenomes-Gn; Acry_R0021.
DR   EnsemblGenomes-Gn; Acry_R0022.
DR   EnsemblGenomes-Gn; Acry_R0023.
DR   EnsemblGenomes-Gn; Acry_R0024.
DR   EnsemblGenomes-Gn; Acry_R0025.
DR   EnsemblGenomes-Gn; Acry_R0026.
DR   EnsemblGenomes-Gn; Acry_R0027.
DR   EnsemblGenomes-Gn; Acry_R0028.
DR   EnsemblGenomes-Gn; Acry_R0029.
DR   EnsemblGenomes-Gn; Acry_R0030.
DR   EnsemblGenomes-Gn; Acry_R0031.
DR   EnsemblGenomes-Gn; Acry_R0032.
DR   EnsemblGenomes-Gn; Acry_R0033.
DR   EnsemblGenomes-Gn; Acry_R0034.
DR   EnsemblGenomes-Gn; Acry_R0035.
DR   EnsemblGenomes-Gn; Acry_R0036.
DR   EnsemblGenomes-Gn; Acry_R0037.
DR   EnsemblGenomes-Gn; Acry_R0038.
DR   EnsemblGenomes-Gn; Acry_R0039.
DR   EnsemblGenomes-Gn; Acry_R0040.
DR   EnsemblGenomes-Gn; Acry_R0041.
DR   EnsemblGenomes-Gn; Acry_R0042.
DR   EnsemblGenomes-Gn; Acry_R0043.
DR   EnsemblGenomes-Gn; Acry_R0044.
DR   EnsemblGenomes-Gn; Acry_R0045.
DR   EnsemblGenomes-Gn; Acry_R0046.
DR   EnsemblGenomes-Gn; Acry_R0047.
DR   EnsemblGenomes-Gn; Acry_R0048.
DR   EnsemblGenomes-Gn; Acry_R0049.
DR   EnsemblGenomes-Gn; Acry_R0050.
DR   EnsemblGenomes-Gn; Acry_R0051.
DR   EnsemblGenomes-Gn; Acry_R0052.
DR   EnsemblGenomes-Gn; Acry_R0053.
DR   EnsemblGenomes-Gn; Acry_R0054.
DR   EnsemblGenomes-Gn; Acry_R0055.
DR   EnsemblGenomes-Gn; Acry_R0056.
DR   EnsemblGenomes-Gn; EBG00001153611.
DR   EnsemblGenomes-Gn; EBG00001153612.
DR   EnsemblGenomes-Gn; EBG00001153613.
DR   EnsemblGenomes-Gn; EBG00001153614.
DR   EnsemblGenomes-Gn; EBG00001153615.
DR   EnsemblGenomes-Gn; EBG00001153616.
DR   EnsemblGenomes-Gn; EBG00001153617.
DR   EnsemblGenomes-Gn; EBG00001153618.
DR   EnsemblGenomes-Gn; EBG00001153619.
DR   EnsemblGenomes-Gn; EBG00001153620.
DR   EnsemblGenomes-Gn; EBG00001153621.
DR   EnsemblGenomes-Gn; EBG00001153622.
DR   EnsemblGenomes-Gn; EBG00001153623.
DR   EnsemblGenomes-Gn; EBG00001153624.
DR   EnsemblGenomes-Gn; EBG00001153625.
DR   EnsemblGenomes-Gn; EBG00001153626.
DR   EnsemblGenomes-Gn; EBG00001153627.
DR   EnsemblGenomes-Gn; EBG00001153628.
DR   EnsemblGenomes-Gn; EBG00001153629.
DR   EnsemblGenomes-Gn; EBG00001153630.
DR   EnsemblGenomes-Gn; EBG00001153631.
DR   EnsemblGenomes-Gn; EBG00001153632.
DR   EnsemblGenomes-Gn; EBG00001153633.
DR   EnsemblGenomes-Gn; EBG00001153634.
DR   EnsemblGenomes-Gn; EBG00001153635.
DR   EnsemblGenomes-Gn; EBG00001153636.
DR   EnsemblGenomes-Gn; EBG00001153637.
DR   EnsemblGenomes-Gn; EBG00001153638.
DR   EnsemblGenomes-Gn; EBG00001153639.
DR   EnsemblGenomes-Gn; EBG00001153640.
DR   EnsemblGenomes-Gn; EBG00001153641.
DR   EnsemblGenomes-Gn; EBG00001153642.
DR   EnsemblGenomes-Gn; EBG00001153643.
DR   EnsemblGenomes-Gn; EBG00001153644.
DR   EnsemblGenomes-Gn; EBG00001153645.
DR   EnsemblGenomes-Gn; EBG00001153646.
DR   EnsemblGenomes-Gn; EBG00001153647.
DR   EnsemblGenomes-Gn; EBG00001153648.
DR   EnsemblGenomes-Gn; EBG00001153649.
DR   EnsemblGenomes-Gn; EBG00001153650.
DR   EnsemblGenomes-Gn; EBG00001153651.
DR   EnsemblGenomes-Gn; EBG00001153652.
DR   EnsemblGenomes-Gn; EBG00001153653.
DR   EnsemblGenomes-Gn; EBG00001153654.
DR   EnsemblGenomes-Gn; EBG00001153655.
DR   EnsemblGenomes-Gn; EBG00001153656.
DR   EnsemblGenomes-Gn; EBG00001153657.
DR   EnsemblGenomes-Gn; EBG00001153658.
DR   EnsemblGenomes-Gn; EBG00001153659.
DR   EnsemblGenomes-Gn; EBG00001153660.
DR   EnsemblGenomes-Gn; EBG00001153661.
DR   EnsemblGenomes-Gn; EBG00001153662.
DR   EnsemblGenomes-Gn; EBG00001153663.
DR   EnsemblGenomes-Gn; EBG00001153664.
DR   EnsemblGenomes-Gn; EBG00001153665.
DR   EnsemblGenomes-Gn; EBG00001153666.
DR   EnsemblGenomes-Gn; EBG00001153667.
DR   EnsemblGenomes-Gn; EBG00001153668.
DR   EnsemblGenomes-Gn; EBG00001153669.
DR   EnsemblGenomes-Gn; EBG00001153670.
DR   EnsemblGenomes-Gn; EBG00001153671.
DR   EnsemblGenomes-Gn; EBG00001153672.
DR   EnsemblGenomes-Tr; Acry_R0001-1.
DR   EnsemblGenomes-Tr; Acry_R0002-1.
DR   EnsemblGenomes-Tr; Acry_R0003-1.
DR   EnsemblGenomes-Tr; Acry_R0004-1.
DR   EnsemblGenomes-Tr; Acry_R0005-1.
DR   EnsemblGenomes-Tr; Acry_R0006-1.
DR   EnsemblGenomes-Tr; Acry_R0007-1.
DR   EnsemblGenomes-Tr; Acry_R0008-1.
DR   EnsemblGenomes-Tr; Acry_R0009-1.
DR   EnsemblGenomes-Tr; Acry_R0010-1.
DR   EnsemblGenomes-Tr; Acry_R0011-1.
DR   EnsemblGenomes-Tr; Acry_R0012-1.
DR   EnsemblGenomes-Tr; Acry_R0013-1.
DR   EnsemblGenomes-Tr; Acry_R0014-1.
DR   EnsemblGenomes-Tr; Acry_R0015-1.
DR   EnsemblGenomes-Tr; Acry_R0016-1.
DR   EnsemblGenomes-Tr; Acry_R0017-1.
DR   EnsemblGenomes-Tr; Acry_R0019-1.
DR   EnsemblGenomes-Tr; Acry_R0020-1.
DR   EnsemblGenomes-Tr; Acry_R0021-1.
DR   EnsemblGenomes-Tr; Acry_R0022-1.
DR   EnsemblGenomes-Tr; Acry_R0023-1.
DR   EnsemblGenomes-Tr; Acry_R0024-1.
DR   EnsemblGenomes-Tr; Acry_R0025-1.
DR   EnsemblGenomes-Tr; Acry_R0026-1.
DR   EnsemblGenomes-Tr; Acry_R0027-1.
DR   EnsemblGenomes-Tr; Acry_R0028-1.
DR   EnsemblGenomes-Tr; Acry_R0029-1.
DR   EnsemblGenomes-Tr; Acry_R0030-1.
DR   EnsemblGenomes-Tr; Acry_R0031-1.
DR   EnsemblGenomes-Tr; Acry_R0032-1.
DR   EnsemblGenomes-Tr; Acry_R0033-1.
DR   EnsemblGenomes-Tr; Acry_R0034-1.
DR   EnsemblGenomes-Tr; Acry_R0035-1.
DR   EnsemblGenomes-Tr; Acry_R0036-1.
DR   EnsemblGenomes-Tr; Acry_R0037-1.
DR   EnsemblGenomes-Tr; Acry_R0038-1.
DR   EnsemblGenomes-Tr; Acry_R0039-1.
DR   EnsemblGenomes-Tr; Acry_R0040-1.
DR   EnsemblGenomes-Tr; Acry_R0041-1.
DR   EnsemblGenomes-Tr; Acry_R0042-1.
DR   EnsemblGenomes-Tr; Acry_R0043-1.
DR   EnsemblGenomes-Tr; Acry_R0044-1.
DR   EnsemblGenomes-Tr; Acry_R0045-1.
DR   EnsemblGenomes-Tr; Acry_R0046-1.
DR   EnsemblGenomes-Tr; Acry_R0047-1.
DR   EnsemblGenomes-Tr; Acry_R0048-1.
DR   EnsemblGenomes-Tr; Acry_R0049-1.
DR   EnsemblGenomes-Tr; Acry_R0050-1.
DR   EnsemblGenomes-Tr; Acry_R0051-1.
DR   EnsemblGenomes-Tr; Acry_R0052-1.
DR   EnsemblGenomes-Tr; Acry_R0053-1.
DR   EnsemblGenomes-Tr; Acry_R0054-1.
DR   EnsemblGenomes-Tr; Acry_R0055-1.
DR   EnsemblGenomes-Tr; Acry_R0056-1.
DR   EnsemblGenomes-Tr; EBT00001742935.
DR   EnsemblGenomes-Tr; EBT00001742936.
DR   EnsemblGenomes-Tr; EBT00001742937.
DR   EnsemblGenomes-Tr; EBT00001742938.
DR   EnsemblGenomes-Tr; EBT00001742939.
DR   EnsemblGenomes-Tr; EBT00001742940.
DR   EnsemblGenomes-Tr; EBT00001742941.
DR   EnsemblGenomes-Tr; EBT00001742942.
DR   EnsemblGenomes-Tr; EBT00001742943.
DR   EnsemblGenomes-Tr; EBT00001742944.
DR   EnsemblGenomes-Tr; EBT00001742945.
DR   EnsemblGenomes-Tr; EBT00001742946.
DR   EnsemblGenomes-Tr; EBT00001742947.
DR   EnsemblGenomes-Tr; EBT00001742948.
DR   EnsemblGenomes-Tr; EBT00001742949.
DR   EnsemblGenomes-Tr; EBT00001742950.
DR   EnsemblGenomes-Tr; EBT00001742951.
DR   EnsemblGenomes-Tr; EBT00001742952.
DR   EnsemblGenomes-Tr; EBT00001742953.
DR   EnsemblGenomes-Tr; EBT00001742954.
DR   EnsemblGenomes-Tr; EBT00001742955.
DR   EnsemblGenomes-Tr; EBT00001742956.
DR   EnsemblGenomes-Tr; EBT00001742957.
DR   EnsemblGenomes-Tr; EBT00001742958.
DR   EnsemblGenomes-Tr; EBT00001742959.
DR   EnsemblGenomes-Tr; EBT00001742960.
DR   EnsemblGenomes-Tr; EBT00001742961.
DR   EnsemblGenomes-Tr; EBT00001742962.
DR   EnsemblGenomes-Tr; EBT00001742963.
DR   EnsemblGenomes-Tr; EBT00001742964.
DR   EnsemblGenomes-Tr; EBT00001742965.
DR   EnsemblGenomes-Tr; EBT00001742966.
DR   EnsemblGenomes-Tr; EBT00001742967.
DR   EnsemblGenomes-Tr; EBT00001742968.
DR   EnsemblGenomes-Tr; EBT00001742969.
DR   EnsemblGenomes-Tr; EBT00001742970.
DR   EnsemblGenomes-Tr; EBT00001742971.
DR   EnsemblGenomes-Tr; EBT00001742972.
DR   EnsemblGenomes-Tr; EBT00001742973.
DR   EnsemblGenomes-Tr; EBT00001742974.
DR   EnsemblGenomes-Tr; EBT00001742975.
DR   EnsemblGenomes-Tr; EBT00001742976.
DR   EnsemblGenomes-Tr; EBT00001742977.
DR   EnsemblGenomes-Tr; EBT00001742978.
DR   EnsemblGenomes-Tr; EBT00001742979.
DR   EnsemblGenomes-Tr; EBT00001742980.
DR   EnsemblGenomes-Tr; EBT00001742981.
DR   EnsemblGenomes-Tr; EBT00001742982.
DR   EnsemblGenomes-Tr; EBT00001742983.
DR   EnsemblGenomes-Tr; EBT00001742984.
DR   EnsemblGenomes-Tr; EBT00001742985.
DR   EnsemblGenomes-Tr; EBT00001742986.
DR   EnsemblGenomes-Tr; EBT00001742987.
DR   EnsemblGenomes-Tr; EBT00001742988.
DR   EnsemblGenomes-Tr; EBT00001742989.
DR   EnsemblGenomes-Tr; EBT00001742990.
DR   EnsemblGenomes-Tr; EBT00001742991.
DR   EnsemblGenomes-Tr; EBT00001742992.
DR   EnsemblGenomes-Tr; EBT00001742993.
DR   EnsemblGenomes-Tr; EBT00001742994.
DR   EnsemblGenomes-Tr; EBT00001742995.
DR   EnsemblGenomes-Tr; EBT00001742996.
DR   EuropePMC; PMC3623192; 23396335.
DR   EuropePMC; PMC4767419; 26677108.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000697.
DR   SILVA-SSU; CP000697.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000181
CC   Source DNA and bacteria available from Timothy Magnuson
CC   (magntimo@isu.edu)
CC   Contacts: Timothy Magnuson (magntimo@isu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3389227
FT                   /organism="Acidiphilium cryptum JF-5"
FT                   /strain="JF-5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:349163"
FT   gene            261..1709
FT                   /locus_tag="Acry_0001"
FT   CDS             261..1709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator, DnaA
FT                   C-terminal domain; Chromosomal replication initiator, DnaA;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29230"
FT                   /db_xref="GOA:A5FUE8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUE8"
FT                   /protein_id="ABQ29230.1"
FT                   /translation="MDTQTWQEQGLETRSPGRTRGEISQDELAHQWSRVRGRLQEEIGE
FT                   VEYRNWLRQAVLHGLDGDEVTVMLPTRFLRDWVNKEYGNLLTAFWQAENPAVRRVDIRT
FT                   RPAGTSERAPDLAEVEPKTAIARPAAAARREAEERPDMSAPLDPRFTFDTFVVGKPNEF
FT                   AYACARRVADGHASPGFNPLFLYGGVGLGKTHLMHAIAWELSQRSDEVTVAYMSAEKFM
FT                   HKFVSALRRQSTIEFKNELRSVDVLMVDDLQFLIGKDGTQEEFFHTFNALVDSGKQIIV
FT                   SADKSPSDLSGIEDRLRTRLGCGMVADVHATTYELRLAILEAKAARAGVVVPGRVMEFL
FT                   AQKITANVRELEGALNRLIAHANLFERPVTLETAHEVLHDLLRAYDRKITIEEIQKQVA
FT                   EHYNIRVSEMSSARRARNIARPRQIAMYLAKQLTSRSLPEIGRKFGNRDHTTVMHAVSK
FT                   VTELIEADPDFAEDVELLRRILTV"
FT   gene            complement(1737..2588)
FT                   /locus_tag="Acry_0002"
FT   CDS             complement(1737..2588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0002"
FT                   /product="Carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /note="PFAM: putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29231"
FT                   /db_xref="GOA:A5FUE9"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUE9"
FT                   /protein_id="ABQ29231.1"
FT                   /translation="MTSATVLETVSTQKCFGGMQGVYRHEAKETGCTMRFAVFLPPQAA
FT                   AGTVPALYYLAGLTCTEENFTVKAGAQRVAAELGIALIAPDTSPRGLGYPGEDDAYDFG
FT                   TGAGFYVDATETPWRDGYRMYSYITRELPALINASFPVDPARVGIFGHSMGGHGALTIA
FT                   LKNPGAYRSVSAFAPIVSPMRCPWGEKALTGYLGVDRANWRAYDATALIEDRGWAGPAI
FT                   LVDQGTADPFLERELKPELLREACAAKGVKLDLRMQEGYDHSYFFIATFVEDHLRHHAR
FT                   HL"
FT   gene            2902..3105
FT                   /locus_tag="Acry_0003"
FT   CDS             2902..3105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0003"
FT                   /product="putative cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; SMART: Cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29232"
FT                   /db_xref="GOA:A5FUF0"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUF0"
FT                   /protein_id="ABQ29232.1"
FT                   /translation="MAIGTVKWFNTTKGFGFIVPQDGGKDVFVHITAVQAAGMRGLNEG
FT                   QKISYEVTQERGKAAATNLKAV"
FT   gene            3693..4202
FT                   /locus_tag="Acry_0004"
FT   CDS             3693..4202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0004"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29233"
FT                   /db_xref="GOA:A5FUF1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUF1"
FT                   /protein_id="ABQ29233.1"
FT                   /translation="MVLSPSGFYNSTGRPMTTRTSTGPAMAALHERHQREDEAAGQHGN
FT                   ALYSVSQLARQLGVTARTIRFYEDKGLVNPSRAGTTRVYTSRDRARLMLILRGKRLGFS
FT                   LREIKDYLDLYDVDPTQHTQLRQLLAGVRKRIAKLQEQRAALEQSLAELADIERQSENA
FT                   LKQAAK"
FT   gene            4227..5363
FT                   /locus_tag="Acry_0005"
FT   CDS             4227..5363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0005"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29234"
FT                   /db_xref="GOA:A5FUF2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUF2"
FT                   /protein_id="ABQ29234.1"
FT                   /translation="MPSAVIAAYARSPFALARKGGLSRVRPDEMAAAVVRELVNRSGIA
FT                   AGDVEDLIVGCAFPEAEQGLNVARLIGLMADLPISVAGATVNRFCGSSMYSIHMAAGAI
FT                   AMGAGEAFIAAGVESMTRVPMGGFNPMPSPTLFAKMPAAYMGMGETAENVAKRWQIPRE
FT                   AQEEFALASHIKAAAAQKAGKLAGEIVPISLSGAMVSEDGCIRHDASREALAGLKPAFD
FT                   AEGTVTAGTSSPLTDGASAVLVCSEDYAAKHGLAPLARIRSVAVAGCAPDIMGMGPVAA
FT                   SRKALARAGIEASALDVVELNEAFASQALACIGELGLDPARVNLDGGAIALGHPLGATG
FT                   ARITGKAAQLLQREGGKFALATQCIGGGQGIATVLEAL"
FT   gene            5363..7723
FT                   /locus_tag="Acry_0006"
FT   CDS             5363..7723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0006"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29235"
FT                   /db_xref="GOA:A5FUF3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUF3"
FT                   /protein_id="ABQ29235.1"
FT                   /translation="MGAIQSVAVIGAGVMGAAIAAQIANAGIKVRLLDIVPKEGDDRNA
FT                   IARRAIERLKKTQPAPLMSSRAARLITPGNTEDDFAALADCDWIVEAVIERLDIKQALY
FT                   RRLAEVRKPGSVVSSNTSTIPLAELMTDMPESLRPNFVITHFFNPPRYMRLLELVTGPA
FT                   TSADAIARITEFCDVVLGKSVIPCRDTPGFIANRIGTYWIQTALALALEMGIEIEEADA
FT                   IMGKPMGFPSTGVFGLMDLVGIDLGPHVNASLARLLPKTDAFHMMNREAPFLATMIAEG
FT                   YTGKKGKGGFYRSAGRGRDRVKETLSLAAAAQGRLEWRPSIRPDIAEVKDAKKDLKRLV
FT                   GAKSKYGRYAWGVLGRVLAYAASLIPEIGDDIAAVDAAMRLGYTWKYGPFELIDRLGAD
FT                   WVSSHLADLDEPIPPLLAKLGKGAFYREDGATLLRFMPDGGYRAVERAPGVLLLEDAKR
FT                   GRKPVLSNKSASVWDIGDGVLCVEFHSIMNSIDGDILALLGKTIALVQKSYKAMVIYSE
FT                   NLRAGPGKENFSVGANLGLAMFAANLRMWGKIEGTVKEGQKALQALREAPFPVVGAPAG
FT                   RALGGGCEILLHCDAVQAHAETYMGLVEVGVGLVPGWGGCATMLARWQGAKDAPRGPMP
FT                   AVSKVFEMISTAKVATSAAEAKELKFLRPGDGITMNRERVLADAKARALAMVAGYAPAE
FT                   PETLQLPGASGRVALGMAVDEFRKKGVATPHDVTVSSHLARVLTGGDTDMTDPVPVAAV
FT                   KDLEREAFMALFRTKESQARIKHILDTGKPLRN"
FT   sig_peptide     5363..5425
FT                   /locus_tag="Acry_0006"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.701 at
FT                   residue 21"
FT   gene            7746..9536
FT                   /locus_tag="Acry_0007"
FT   CDS             7746..9536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0007"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29236"
FT                   /db_xref="GOA:A5FUF4"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUF4"
FT                   /protein_id="ABQ29236.1"
FT                   /translation="MPVYKAPLKDMRFVLHELYDSTAIAELPGNADFTPELIDSVLEEA
FT                   AKISEEVLFPLNQVGDREGCTYENGVVRTPTGYREAYHTFCEGGWTSISADPDYGGQGM
FT                   PLTAAMMVEEMFCSANVAFGLYPGLSHGAYVALKHSGSDEQKKAWLPNIVSGKWTGTMC
FT                   LTEPHCGTDLGMLRTKAVPNDDGTYSITGNKIFISAGEHDLAENIVHLVLARLPDAPAG
FT                   VKGISMFLVPKFLPREDGTLGPRNGMQCTAIEHKMGLNGSATCAMSFDGATGWLVGEPN
FT                   KGLAAMFKMMNTERLSVGIQGLGIAEVAYQNAVAYARERIQGRSLTGTKAPEKQADPIL
FT                   VHPDVRRMLLTSRAYIEGCRALAGWVARELEILEKSDDGDAKQAADDFASLMTPVVKAM
FT                   FTDLGFEIASLAVQTYGGHGYIRDHGIEQYVRDARIAMLYEGTNGIQALDLVGRKLPQD
FT                   GGRLLTRFLDPVLEFIDAHQDNDALAEFLPALSQALEHVQEATGLIMEGAMTNRDEVGA
FT                   ASVDYLRLFGLASLAFVWARMVAVAAPKAGEDGEAAQFYRAKVQTAKFFMERLLPQTGA
FT                   LLAAIRSGAATMMEFEDAAF"
FT   gene            complement(9556..10113)
FT                   /locus_tag="Acry_0008"
FT   CDS             complement(9556..10113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0008"
FT                   /product="phospholipid-binding protein, PBP family"
FT                   /note="PFAM: PEBP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29237"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUF5"
FT                   /protein_id="ABQ29237.1"
FT                   /translation="MKRPVSFALALMALAGTARASGFSLRSGAFRDGGTIAAAQVFNRF
FT                   GCTGDDVSPALAWSGAPAGTRSYAVTLFDSDARQGKGYWHWIVADIPARVTSLPAGSGS
FT                   RGGALPRGAVQGIGSGSIHGYQGPCPPVGDPPHHYHLTVYALRVNRLPAAALASYGALR
FT                   RALARDALASATITGLYGRPAR"
FT   sig_peptide     complement(10051..10113)
FT                   /locus_tag="Acry_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 21"
FT   gene            complement(10125..10877)
FT                   /locus_tag="Acry_0009"
FT   CDS             complement(10125..10877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0009"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29238"
FT                   /db_xref="GOA:A5FUF6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUF6"
FT                   /protein_id="ABQ29238.1"
FT                   /translation="MTGARLGALLRGLVLLLLACPFAGLFIMTDWRKFALSSADGRSVA
FT                   ISLAYGLAALAVIAVLGTPLAYWLATGKGRMRDGAQVFLLLPLLTPPLALGILLAAFYG
FT                   PIGPVGILLERFGGIITNNPPALLIAGIYAGLPTYVVAARGAFAEIPAELAESALTLGV
FT                   SRRQIFRHITLPMARDGLGAALALAWVRGVGELGIVLIFAYFPQGMPVRLWVDLEDGGL
FT                   SATFPLLWLFLLAALPLPLWLLRRGSKR"
FT   gene            complement(10874..11788)
FT                   /locus_tag="Acry_0010"
FT   CDS             complement(10874..11788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0010"
FT                   /product="ABC-type molybdate transport system periplasmic
FT                   component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29239"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUF7"
FT                   /protein_id="ABQ29239.1"
FT                   /translation="MAISRRAFTRLAGAAALAPVTGRAAGRAATIAYAGSMGLLMDRAL
FT                   GPAFTAETSERFHGIGRGAFGLAHLIAAKTLQADAFISITSGPIEVLQKAGLVGHAVPV
FT                   ASTAMVLAWSPHSRFRKDFEAADAGAHWFDILEKPGLRFGRTDPRTDPQGRNVLFTFDL
FT                   AQRYYHKPDLIRRVLGRPVNPAQIFPEPSLLSRIDSGAVDATIGYESGVKSLKLPFLAL
FT                   PRQINLSDPAMVADWYSRAAISLTVKGRRQTLHTQPLVFYACVPRNARNPEAGRAFVSL
FT                   LQSRKGQELFARYGYNPPLGGPV"
FT   sig_peptide     complement(11702..11788)
FT                   /locus_tag="Acry_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.451 at
FT                   residue 29"
FT   gene            11903..12280
FT                   /locus_tag="Acry_0011"
FT   CDS             11903..12280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0011"
FT                   /product="putative transcriptional regulator, ModE family"
FT                   /note="PFAM: regulatory protein, LysR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29240"
FT                   /db_xref="GOA:A5FUF8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUF8"
FT                   /protein_id="ABQ29240.1"
FT                   /translation="MQMHGKTEPLTLRIRVVQGEDLLLGPGRADLLAFIRETGSIAAAG
FT                   RRMGMSYKRAWQLAESMNSTFHAPLILAAKGGVAGGGAQLTELGDAVLAAYRALEAASR
FT                   AGGAAALAILAEARAPLSQDR"
FT   gene            12360..12881
FT                   /locus_tag="Acry_0012"
FT   CDS             12360..12881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0012"
FT                   /product="TspO and MBR like protein"
FT                   /note="PFAM: TspO/MBR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29241"
FT                   /db_xref="GOA:A5FUF9"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUF9"
FT                   /protein_id="ABQ29241.1"
FT                   /translation="MRVFRLPERPEQHRTSGAQILALLGFLALALLVGAVGGTATVPNV
FT                   HSWYDVLPHPPGTPPDWVFGPVWTLLYIAMAVAAWLIWRGPDILTRQRRALRLWGWQLA
FT                   ANALWSPVFFALHRPDISFFVILVLDGLIVMTIAVFRPVSRIAAALMVPYLAWCLYATY
FT                   LNAGFWFLNR"
FT   sig_peptide     12360..12473
FT                   /locus_tag="Acry_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.880) with cleavage site probability 0.277 at
FT                   residue 38"
FT   gene            12925..13539
FT                   /locus_tag="Acry_0013"
FT   CDS             12925..13539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29242"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUG0"
FT                   /protein_id="ABQ29242.1"
FT                   /translation="MTYRSQLHLAALAVLMAGLGFAAPAKAQMAGGGLAGGLGPIGGVP
FT                   QPRHESQSIAPPALPGASAAGNVSAGPVTDTGGDPTTLLFKAINHGDYAQARAAVSRGA
FT                   NLDARNALGETPIELSVELNRNRITFMLLSARAEEHPMSVSVASAPVAAVPPTTSKGSA
FT                   HAKSPPFHKVEAKPAVRPLTISGDPGRPDPSAGFLGFGGSN"
FT   sig_peptide     12925..13008
FT                   /locus_tag="Acry_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.968 at
FT                   residue 28"
FT   gene            13684..14235
FT                   /locus_tag="Acry_0014"
FT   CDS             13684..14235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0014"
FT                   /product="GPR1/FUN34/yaaH family protein"
FT                   /note="PFAM: GPR1/FUN34/yaaH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29243"
FT                   /db_xref="GOA:A5FUG1"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUG1"
FT                   /protein_id="ABQ29243.1"
FT                   /translation="MNTFNPAPLGLFGFALTTWLLSMINAGLLPGAGLGMVLAMAFAFG
FT                   GSAQFVAGLGEMKVGNTFGFVAFCSYGAFWWSFALFVEIFAKGVPGVMVGWYLLVWGAF
FT                   SFVMFIGTFALNKALQLIFGFLTATFILLALNDLLGAAALGEFGGYLGLVTAVLAFYLG
FT                   AAGIINGAHGKEILPIGAKA"
FT   sig_peptide     13684..13764
FT                   /locus_tag="Acry_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.865) with cleavage site probability 0.227 at
FT                   residue 27"
FT   gene            14489..14716
FT                   /locus_tag="Acry_0015"
FT   CDS             14489..14716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0015"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29244"
FT                   /db_xref="GOA:A5FUG2"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUG2"
FT                   /protein_id="ABQ29244.1"
FT                   /translation="MGGLSIWHWLIVLAVVLLLFGTGRVGNLMGELGKGMKAFKNNIAD
FT                   DQPAKDASMLEQQTRAPEANAGQKAGQGKV"
FT   gene            14727..14984
FT                   /locus_tag="Acry_0016"
FT   CDS             14727..14984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0016"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29245"
FT                   /db_xref="GOA:A5FUG3"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUG3"
FT                   /protein_id="ABQ29245.1"
FT                   /translation="MGFDSPVHWLIVIAVIALLFGGSRVGNLMGELGKGIKAFKQNMSD
FT                   ADSAKPAPAAKSEPDVQNRIADSSAPAAEKAPEPADTARH"
FT   gene            15001..15642
FT                   /locus_tag="Acry_0017"
FT   CDS             15001..15642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0017"
FT                   /product="methylthioribulose-1-phosphate dehydratase"
FT                   /EC_number="4.2.1.109"
FT                   /note="PFAM: class II aldolase/adducin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29246"
FT                   /db_xref="GOA:A5FUG4"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR017714"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUG4"
FT                   /protein_id="ABQ29246.1"
FT                   /translation="MTVTLAAGPAEAGDVLASRARELVAIGARMDARGWVPASAGNLSA
FT                   RCTADSIAITRSGVHKGRLEAADIIEVWLDGTPLRAGDRPSAETQLHCQVYERLPAAGA
FT                   VLHGHSVAATALTLADNSPGIVLEGYEILKAFPGIATHETRIVLPVFDNDQDMRRLAAA
FT                   IAPAFAAPPIGYVLRGHGIYAWGEDVERCFWRLEALEFLLSCECERRRMR"
FT   gene            15639..16181
FT                   /locus_tag="Acry_0018"
FT   CDS             15639..16181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0018"
FT                   /product="acireductone dioxygenase apoprotein"
FT                   /note="PFAM: Acireductone dioxygenase, ARD"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29247"
FT                   /db_xref="GOA:A5FUG5"
FT                   /db_xref="InterPro:IPR004313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR023956"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUG5"
FT                   /protein_id="ABQ29247.1"
FT                   /translation="MSTLRIFDDANPDAPLVATSDAARMAAELKSIGVRFERWESPVAI
FT                   AADASPEEILEAYRPYLDRLMGETGAGSADVIKMTPDHPQAGTLREKFLNEHIHTEDEV
FT                   RFFVRGSGHFVMHLDGKVYDAYCTEGDLISVPANTRHWFDAGSTPDFIALRIFTDTSGW
FT                   VAHFTGDQISARFPVAA"
FT   gene            16198..16896
FT                   /locus_tag="Acry_0019"
FT   CDS             16198..16896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0019"
FT                   /product="acireductone synthase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; 2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29248"
FT                   /db_xref="GOA:A5FUG6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023943"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUG6"
FT                   /protein_id="ABQ29248.1"
FT                   /translation="MTTRPELVLLDIEGTIAPISFVHDVLFPYARARLAGFVAAHGDEP
FT                   EIAAALAELDAIAPGAPPVETLLALMDRDAKVGPLKLIQGRIWAEGFAEGALTSRLYPD
FT                   VAPVLRAWHGSGLRLAIYSSGSEEAQRLLLGHTPDGGLTALFERFFDTRMGGKRDAASY
FT                   AAIARSMAVAPAHVLFLSDVADELAAAATAGIQVCQIVRPEDGTIASADYPTAPDLAAV
FT                   AAAFDRPDPA"
FT   gene            16908..18437
FT                   /locus_tag="Acry_0020"
FT   CDS             16908..18437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0020"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29249"
FT                   /db_xref="GOA:A5FUG7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUG7"
FT                   /protein_id="ABQ29249.1"
FT                   /translation="MSPIDQLAARVPRRLRGEAWQCFALGLLAAVALPPFYLLPVLWFV
FT                   VPALLTRLARAGGWRRAAWLGWCFGFGFNLLGLFWVTEPMLIMASNFWWAVPFAAPALA
FT                   FATAFYMILPALAVFAVPQRNQAGRLAAVLLFAGALVLSNLAQEFLFTGFPWNYWGADW
FT                   TFAGRLGLAMIQPAAIGGIFLLTLLTALAAGLPLLGRRGWAASAVLLALWAGFGFARTS
FT                   AGPAPLTRYTVALLQPDFAVPGSFTQPALQARWRRDLALTREALDKAGKGPNIVVWPET
FT                   ASPALLQTDAAARAAIAAVAGNTPVLAGSFRLAADGSMRNSLVAVEGKGPAVAWYDKWK
FT                   LVPFGEYTPAWIPLKVTPGGGFTPGPGPRTLHVPGIPSVGPLICYESIFPGIITDPKDR
FT                   PAWLLNISDNAWFGDTTGPYQDFATTRLRAVEEGLPIVVDTNSGISAVIGPHGRVAGTL
FT                   GLDRAGILIGKLPVALPVTPFGRFSVTMSGILGFYTMVLGVVCLIVSITLM"
FT   gene            18742..19227
FT                   /locus_tag="Acry_0021"
FT   CDS             18742..19227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0021"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29250"
FT                   /db_xref="GOA:A5FUG8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUG8"
FT                   /protein_id="ABQ29250.1"
FT                   /translation="MNANGGASNDRSDRDGRPSPIDVHVGSRIRLRRTLLGMSQEKLGD
FT                   ALGLTFQQVQKYERGVNRVGASRLFDISRVLDVPISFFFDDMPEGMNEMPMSGPRGRSN
FT                   GLSEAQEPFGVGLDDHMTKRETLELVRAYYRITEPTVRKRMFDLIKSLAPADSFPTE"
FT   gene            19292..19963
FT                   /locus_tag="Acry_0022"
FT   CDS             19292..19963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0022"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29251"
FT                   /db_xref="GOA:A5FUG9"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUG9"
FT                   /protein_id="ABQ29251.1"
FT                   /translation="MSAMSRPSPIIAPSLLAADFGRLREEVAAVERAGAHWLHLDVMDG
FT                   HFVPNISFGALVLNALRPHTRLAFDVHLMIAPADPYLADFAKAGADHITVHAEAGPHLH
FT                   RSLQTIRALGLKAGVAINPATPAEAVRHVLDLVDIVNVMTVNPGFGGQSFLAGQLPKIA
FT                   ELRRMVTEAGRDIRIETDGGIDAASAPRALEAGADVLIAGSAIFGKPDYAAAIAALGTG
FT                   D"
FT   gene            19977..21551
FT                   /locus_tag="Acry_0023"
FT   CDS             19977..21551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0023"
FT                   /product="Heparinase II/III family protein"
FT                   /note="PFAM: Heparinase II/III family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29252"
FT                   /db_xref="GOA:A5FUH0"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUH0"
FT                   /protein_id="ABQ29252.1"
FT                   /translation="MRGARQWVARLAALRGGNVPDAPSVALRDPWPGEPARGARIIKGE
FT                   IEYQNVVRPLRPGLFHENDGSPVFIAHIQGFVWLRDLRALGTDAARSRARALIADWIDC
FT                   EALPPVASAPEVSGARIAAWLGHYDFFAASADDDFRQMLMARLVADARMLSANLPAEVR
FT                   DGRAFTAIKGLIAAAVALPEHGAFMQRALRFLVPEIERQILPDGAHVERSPAAHFAVLQ
FT                   DLTEIRALLQLARAEVPPQLPGAIERMAVGLRALRHGDGGLALFNGTSEDWPNLIDLVL
FT                   SQAGRTGRSASALAGVGFHRLAAGRSLVLVDAGPPPGPGVDRFAHAGTLSFEFSVGRDR
FT                   LIVNCGAAPAASGEWRDALRNTAAHSTLVVADVSSSELRDEGLGRRPAHVEVQRQEANG
FT                   AHWLEASHDGWQKLFGAVHRRRLYLAESGEDLRGEDSIEADQPQPFTLRFHLHPNVTAS
FT                   IQQDGEGALLRLSSGQGWRLRAGGATLSIEDSIYFGGPEPRRAEQIVLTGTPDGPQQVK
FT                   WALTRMG"
FT   gene            21556..22554
FT                   /locus_tag="Acry_0024"
FT   CDS             21556..22554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0024"
FT                   /product="UDP-galactose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; NmrA family
FT                   protein; Male sterility C-terminal domain; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29253"
FT                   /db_xref="GOA:A5FUH1"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUH1"
FT                   /protein_id="ABQ29253.1"
FT                   /translation="MARIMLTGGAGFIGSHTAVVLLERGYDIVLLDDFSNAARDVPDRL
FT                   RQITGIAMPVIEADIRDPEAMRAAFAAFPVDAVVHFAAKKAVGESEADPLLYFDVNILG
FT                   TIRLLAAMRDAGVGRLVFSSSATVYGEPDTCPISETASLRVTNVYGRTKMVMEGMIEDL
FT                   SRTGVLAASAILRYFNPVGAHPSGLIGENPRGVPANLMPYLCQVAAGQRPYLTVFGNDY
FT                   PTHDGTGVRDFIHVMDLAEAHAAAVDRILAQDGGFTVNLGTGTGYSVLDLVHAFKAATG
FT                   IDVPYQVGPRRPGDVAACYADPGLAASLLGWRASRGVQDMCRDAWRWQSRH"
FT   gene            22562..23686
FT                   /locus_tag="Acry_0025"
FT   CDS             22562..23686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0025"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29254"
FT                   /db_xref="GOA:A5FUH2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUH2"
FT                   /protein_id="ABQ29254.1"
FT                   /translation="MSRHVVFLIGEDWFFASHFRVRALAARAAGWRVTILTRTGRAADA
FT                   LRAEGFEVIDVDFRRARLNPLAEFRLLRSIAGHYRALAPDLAHHVALKPILLGSLAAAL
FT                   ARVPAVINAPVGQGFVFTSATLKARLLRPAVSLGLRLAMGARGALAVFENHDDLTAMTA
FT                   SGAIPSERAYLIRGAGVDLVLYRPHTPPAGKVRIVLGARMLADKGVREFIEAARLLRLR
FT                   GVIAECLLAGGPDPQNPASLEAAELQRATEATWLGPVTDMASLLASCHIACLPSYREGL
FT                   PKFLLEAMASGLPCVATDVVGCREAVADGESGVLVPPRDPAALADALERLVADPELRAR
FT                   MGAAGRARAETLFADEVVCAATLAVYERAIRHDV"
FT   gene            23698..24165
FT                   /locus_tag="Acry_0026"
FT   CDS             23698..24165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0026"
FT                   /product="CreA family protein"
FT                   /note="PFAM: CreA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29255"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUH3"
FT                   /protein_id="ABQ29255.1"
FT                   /translation="MIRRLALLGIMAGAWAFAVATAQAETRIGAVSTNFRLLGANDKVV
FT                   VERLDDPKIPDIACYASFAKTGGVKGSLGVATDPSRFALSCIATGPVTLPAGLPAKQQI
FT                   AAISASFLVKHFNLYRLVDPDRKAVVYLLISTKIIHGSPANAVSAVPVSGH"
FT   sig_peptide     23698..23772
FT                   /locus_tag="Acry_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.702 at
FT                   residue 25"
FT   gene            24181..25722
FT                   /locus_tag="Acry_0027"
FT   CDS             24181..25722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0027"
FT                   /product="IMP cyclohydrolase /
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase"
FT                   /EC_number="3.5.4.10"
FT                   /EC_number="2.1.2.3"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM: MGS domain
FT                   protein; AICARFT/IMPCHase bienzyme, formylation region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29256"
FT                   /db_xref="GOA:A5FUH4"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUH4"
FT                   /protein_id="ABQ29256.1"
FT                   /translation="MNDRVNIRRALISVSDKAGLVELGRALAAAGVEILSTGGSARALR
FT                   EAGIAVVEVADYTGVPEMLDGRVKTLVPKIHGGLLGRRDLPEHLAQMQRHDIPPIDLLA
FT                   VNLYPFEETVAKGSDFETCVENIDIGGPALIRAAAKNHDSVAVLTSPAQYDDLIAALAA
FT                   GGTTLEQRRRLAAAAYARTAAYDAAISAWFAQQTGEMFPAHLALAGARQQMLRYGENPH
FT                   QSAAFYRTGNRPGVATARQLQGKELSYNNINDTDAAFECVAEFDRPAVVIVKHANPCGV
FT                   ALGADLAEAWDRALDCDPVSAFGGIIAVNRPLDVAAAEKMASIFSEVIIAPDAAPDAVE
FT                   LLARKKNLRLLLTGGLPDPAEPGLAWRSVAGGFLAQTRDAGRIGRDDLKVVTQRAPTNA
FT                   EFADLLFAFRVAKHVKSNAIIYAKAGATTGIGAGQMSRVDSSRIAAQKGGEKIPGSVVA
FT                   SDAFFPFADGLVAAIEAGATAVIQPGGSIRDNEVIEAADAAGIAMVFTGMRHFRH"
FT   gene            25728..26285
FT                   /locus_tag="Acry_0028"
FT   CDS             25728..26285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0028"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29257"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUH5"
FT                   /protein_id="ABQ29257.1"
FT                   /translation="MTHTPRLGLPDPARMSEAQRAAHDAIASGPRGRVEGPLAVWLHSA
FT                   ELANNAQALGAFCRFGSSLPPRLSELAILVMGSYWRAGFEWYIHAPIAAKAGVPEAVIA
FT                   AIKAGETPVFAEPDARAVHDFARELLTAHEVSDETYAFARRQLGDRALVDLVGILGYYG
FT                   LISMTIKAFRVPVPDGETEPFA"
FT   gene            complement(26325..28286)
FT                   /locus_tag="Acry_0029"
FT   CDS             complement(26325..28286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0029"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA topoisomerase IV, B subunit; PFAM: DNA
FT                   gyrase, subunit B domain protein; ATP-binding region,
FT                   ATPase domain protein; DNA topoisomerase, type IIA, subunit
FT                   B, region 2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29258"
FT                   /db_xref="GOA:A5FUH6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUH6"
FT                   /protein_id="ABQ29258.1"
FT                   /translation="MTDLFEQAAGQASYSAKDIEVLEGLEPVRRRPGMYIGGTDDAAMH
FT                   HLAAELLDNAMDEAVAGHASIIEMTLAPGNLLTVRDNGRGIPVDPHPKFRDKSALEVIL
FT                   TTLHSGGKFAGKAYATSGGLHGVGSSVVNALAERLEVEVAREKTLWKQDYARGKPLTKL
FT                   VNAGATPNRRGTLIRFVPDPEIFGDKKFSPARLYRMCRSKAYLFRGVRIRWTCDAALIA
FT                   AGADVPAQAELHFPGGLADSLAEELGAAPKLVAPVWAGQADLPDDAGRIEWACAWLEAG
FT                   EATLSTYCNTIPTTLGGTHEAGFRAALLKGLRGFGEQRSNKRAAVITAEDATGALAAKL
FT                   SLFIRDPQFQGQTKEKLTSPEAQKLTEAALRDRFEHFLTGDPANADNLLAFVIERAEER
FT                   IRRREQKDTPRKSATRRLRLPGKLTDCSRESREDTEIFLVEGDSAGGSAKQARNRETQA
FT                   VLPLRGKILNVASASTEKLRQNQELKDLIEALGCGVGDRFQIDALRYGRIIIMTDADVD
FT                   GAHIASLLMTFFYRELPELIRGGHVYLAQPPLYRLTQGGKSVYAMDDGERDRLVKTAFK
FT                   ANAKVEISRFKGLGEMPPAILKETTMDPKRRVLLRVLAPPEARAETAEIVESLMGRKPE
FT                   LRFRFIQDHASSVQELDV"
FT   gene            complement(28312..28950)
FT                   /locus_tag="Acry_0030"
FT   CDS             complement(28312..28950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0030"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="TIGRFAM: cytidylate kinase; PFAM: cytidylate kinase
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29259"
FT                   /db_xref="GOA:A5FUH7"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUH7"
FT                   /protein_id="ABQ29259.1"
FT                   /translation="MTRPIVIAIDGPAASGKGTLARRLAAAFNLPYLDTGLLYRAVARR
FT                   VLDRGGDPADPAASEEQARSLSRLDLERGDLRTPEVDRAASAVASIKPVRAALLDFQRR
FT                   FADASGAVLDGRDIGTIVFPEADVKLFVTASLDVRAKRRHLERLAHGIDPGFDSVRAEL
FT                   AARDEADRTRAAAPLVQAKDALLLDTSQMDANHAFTAAADLVNKVLARG"
FT   gene            complement(28947..30284)
FT                   /locus_tag="Acry_0031"
FT   CDS             complement(28947..30284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0031"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="TIGRFAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29260"
FT                   /db_xref="GOA:A5FUH8"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUH8"
FT                   /protein_id="ABQ29260.1"
FT                   /translation="MEHAATLPQTSRRPATPLTGTITVPGDKSISHRALMFAGLAVGET
FT                   RISGLLEGEDVLRTAAAMRALGATVERTGPGAWRASGPGIGGLQSPDDVLDMGNSGTAA
FT                   RLLCGILASHDIFAVMTGDASLRRRPMRRVIDPLGATGAVFAAREGGRLPLSVRGAAEA
FT                   MPLSYRLPVASAQVKSALLLAGLNARGITEIEEPEPTRDHSENMLRHFGAEVEVAAHGT
FT                   GKLIRLRGQPELRGADVVVPGDPSSAAFPIVAALIVPGSRVTIGGVGLNPLRTGLFLTL
FT                   REMGAAIEIVNAREAGGEPVGDLIVTASDLRAVDVPAERAPSMIDEYPILAVACAMARG
FT                   SSRLRGLAELRVKESDRLAATLAMITANGVKAQVDGDDLIIEGGGARGGATVATHMDHR
FT                   LAMSALVMGLATETPVTIDDARFIDTSFPGFLPLMRGIGAAIEAAA"
FT   gene            30423..30746
FT                   /locus_tag="Acry_0032"
FT   CDS             30423..30746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29261"
FT                   /db_xref="InterPro:IPR012644"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUH9"
FT                   /protein_id="ABQ29261.1"
FT                   /translation="MAKPELGDKHTCVSCGARFFDLGKVPAVCPKCGTEQPAEQPKLKR
FT                   SVPMPDDAKKPAKAQTTEDDVDTDDVEDTGDDDILTDADDLEDDDAIDADIEVERDSDE
FT                   NER"
FT   gene            complement(30796..31047)
FT                   /locus_tag="Acry_0033"
FT   CDS             complement(30796..31047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29262"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUI0"
FT                   /protein_id="ABQ29262.1"
FT                   /translation="MAMRAAGGRNAAAQGKADQPVGDGRQPGALGVLRQRNQAVDKNER
FT                   ADDRLVMVGGFRRGELGHRGFPSQECPSGTAVFGCART"
FT   gene            31136..32365
FT                   /locus_tag="Acry_0034"
FT   CDS             31136..32365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0034"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29263"
FT                   /db_xref="GOA:A5FUI1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUI1"
FT                   /protein_id="ABQ29263.1"
FT                   /translation="MSEQPSAGTVSPSGPLAGLTVFDLTRVLAGPTCVQMLADLGAEVI
FT                   KIEKPGSGDDTRGFAPPALPGTEQSAYFAGANRNKRSVTLDIAKPEGQKLARALIAKSD
FT                   ILVENFKVGTLPRYGLGYNDLRADNPGLIYCSITGFGQTGPYASRPGYDSLIQAMGGIM
FT                   SLTGVPDGQPMKVGVPVADLFAGLYGAIGVLAALRHREITGQGQHIDIGMLDTHVAWLA
FT                   NQGMNYLATGKNPPRLGNEHPNIVPYQVFATEDGHIVLSIGNDPTFARFCNAFGLEHLL
FT                   ADERFATNAARVANRAFVTDTLTAVLARHPSAWWLERLEELKIGCGPINTLEQVFADPH
FT                   VIARGNLIEMTRSDGVPVKLVANPVRLSETPVDYRLAPPMLGEHTDEVLTNMLGLDEPA
FT                   RAALRRDGII"
FT   gene            32380..33219
FT                   /locus_tag="Acry_0035"
FT   CDS             32380..33219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29264"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUI2"
FT                   /protein_id="ABQ29264.1"
FT                   /translation="MARQGFVPYLLGNDFHRLAFVEFGNPAAPAVLCVHGLTRNGRDFD
FT                   ILADSLADRYHVICPDLPGRGRSEWLRDGALYQPPSYVIALAHLLAWLNKPVAWVGTSL
FT                   GGICGMMVAAAAHTPITRLVLNDIGPHIPAAALGRIRDYMGEAPAAFPDLAALEAHLRT
FT                   VHAPFGPLTDPQWAALALHSARPVEGGGLALHYDPAIAEPIRASVPMDADLGAIWTAIR
FT                   VPVLALRGTTSDLLTEATLARMEEDGAATHTVPACGHAPALMDGPTIAVIRRFLDGA"
FT   gene            33219..34070
FT                   /locus_tag="Acry_0036"
FT   CDS             33219..34070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0036"
FT                   /product="putative ribonuclease BN"
FT                   /note="TIGRFAM: putative ribonuclease BN; PFAM:
FT                   ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29265"
FT                   /db_xref="GOA:A5FUI3"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUI3"
FT                   /protein_id="ABQ29265.1"
FT                   /translation="MRWRTRLDLWFRALRAAAIEVMSGEMSLVAAGCAFYATLALFPAM
FT                   TALISLYGLAFNPVTVEPQLLYLKHLMPPAAFALIGGRIQQLVSGGKTTLGIGLVISLG
FT                   FTLYSSASGIKSLIYALNVIHKRQETRGFFEFQAVTLAMTLIAMLGAVIAIAVLVGMPL
FT                   VLAFLGLAKAPAVLTVLPGFALLIGSMGLALGLLYRFGPAFGRDAGHPVVPGALVAILV
FT                   WLVVSYGFAVYVGQFAAYSRTYGPLATIIGLMMWFYLSAYAVLFGALFNATLDRASVAF
FT                   RP"
FT   gene            34256..36493
FT                   /locus_tag="Acry_0037"
FT   CDS             34256..36493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0037"
FT                   /product="RNAse R"
FT                   /EC_number="3.1.-.-"
FT                   /note="TIGRFAM: VacB and RNase II family 3'-5'
FT                   exoribonuclease; ribonuclease R; PFAM: ribonuclease II;
FT                   SMART: RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29266"
FT                   /db_xref="GOA:A5FUI4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUI4"
FT                   /protein_id="ABQ29266.1"
FT                   /translation="MTRKPVRRSAELPTEAVLREFIAEAGTRLRKGDIARAFGLGPDQK
FT                   PALRAMLRNLERDGMLVRAGGRQVRAAEALPERCVVEITGTDRDGDPLARPVGWDRQGK
FT                   PPIIFMLPEKRGHAALAPGARVLARLRRIDDDRYEGRTVRRLDEEPASIIGVFRAEGEG
FT                   GWIEPVDRKSRAEWKVPPGETAGAESGDVVRAMPLPAFGYRPKPARIAEHLGRMGDARS
FT                   ISLIAIAALGIPADFPETAIDEAKRARGVRPGRRTDLREVPLVTIDGADARDFDDAVFA
FT                   EPAGPGHRIVVAIADVAHYVRPGSALDREALKRGNSVYFPDRVVPMLPEALSNGWCSLR
FT                   PGEDRGCLFVEMIVDAEGRKLSHQFGRGLMRSFARLTYEEVQGAFESGWEADLPDGTID
FT                   HLYAAYRTLLAARQARGTLDLDLPERKITLDEAGRVTDVAPRPRLDSHRLIEEFMILAN
FT                   VAAAEELERLRQPCMYRVHAPPSPEKLDSLRNLLATFEISLKPGDQLHPRDLDHVLRLV
FT                   AGSDAAPLVNEAVLRSQSQAEYAPENIGHFGLALNSYAHFTSPIRRYADLLVHRALIAG
FT                   LKLGTDGLRPEHADGFETIAAAITSTERRATDAERQSADRYLAAYLADRIGEDFGARVS
FT                   GVTRFGLFVTLDATGASGFVPMALLPDDFWHFDEADGTLSGTRSRVVFRLADPVLVRLR
FT                   EAKPVTGGLLFTLIEGGSAPGEGGGQHRRLPARKGGRKPGRAPARHKRSRR"
FT   gene            36490..38094
FT                   /locus_tag="Acry_0038"
FT   CDS             36490..38094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0038"
FT                   /product="C-terminal processing peptidase"
FT                   /EC_number="3.4.21.102"
FT                   /note="PFAM: PDZ/DHR/GLGF domain protein; peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29267"
FT                   /db_xref="GOA:A5FUI5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUI5"
FT                   /protein_id="ABQ29267.1"
FT                   /translation="MKRRMARSLARRSRAHRARRPALVRPIRRIVTVLCVMLPICGAQA
FT                   GQRGFDSTHAAAVWGAALAFMAPRTLQPLGIPRMAVWGLSGITALDPDLTVQEQSGKLL
FT                   LFGPNRVIFATLAPPVGDAAKWGVACAAVAAHAFAASPTIERAGTGGMIRSFFDELFNH
FT                   FDPYSRYVAPREAATERALRLGLGGIGMTLARHDRIVTITGVTPSSPADRAGIAPGMQL
FT                   LAIDGRDAAAQPVAQLQQELAGPIGSMIDLTIRPGHSLPQTITLARALVPTQSVTGQID
FT                   DGIAHIRVLGFDHGTARQFAAVLAQLVQAQPAPKGIVIDLRGNRGGVLRQSVLSLDTLL
FT                   SQGTIIHTIGRDPAANKVWHAEGADIAHGLPVVVLVDGGTASAAEVFSAAIADNDRGVV
FT                   LGSATLGKGLVQSVTELPGGGELFVTWSRMIAPRGWPLQSLGVFPQVCTSLGTDQLAKQ
FT                   INALRHGVDLLAKPLAETRAARAPMPLAEVLALREACPAAIGGNGYERAAAALIDHPAA
FT                   YRAALIRPLLPHARAGG"
FT   sig_peptide     36490..36627
FT                   /locus_tag="Acry_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.988 at
FT                   residue 46"
FT   gene            38140..38307
FT                   /locus_tag="Acry_0039"
FT   CDS             38140..38307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0039"
FT                   /product="LSU ribosomal protein L33P"
FT                   /note="PFAM: ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29268"
FT                   /db_xref="GOA:A5FUI6"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUI6"
FT                   /protein_id="ABQ29268.1"
FT                   /translation="MAKTNTVQIKLVSTADTGFFYVTKKNAKAQTGKLEFRKYDPVARK
FT                   HVTFKEAKIK"
FT   gene            complement(38471..39610)
FT                   /locus_tag="Acry_0040"
FT   CDS             complement(38471..39610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0040"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="TIGRFAM: lipid-A-disaccharide synthase; PFAM:
FT                   glycosyl transferase, family 19"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29269"
FT                   /db_xref="GOA:A5FUI7"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUI7"
FT                   /protein_id="ABQ29269.1"
FT                   /translation="MTLVYVVAGEASGDVLGARLIAAMRARAGGIEVAGIGGARMAEQG
FT                   VASLFPMQELALMGLAEVLPKLFRLRRRLEQTEADIAARRPDIVVTIDSPGFTLRLLRR
FT                   IAPLGLRRVHYVAPQVWAWRQGRVKHFPGLWDRLLCLLPFEPDFFAPHGLNPVFVGHPV
FT                   LESGADAGDPARFRARFGLAESARSLILMPGSRRTETARLMPVFGATVERLRPRFPDLV
FT                   PVLAAAPALAGELQAQAAAWPRPPLIVTNVAERYDAFAGAEAALTKSGTSTLELALAGV
FT                   PMAVTYRVNPISAMLARRLIKVPHVAMINLLAGQELVPELLQDACTPERLSAEIASLLG
FT                   DPERAAAQRAGFSAALSTLAIAGSASPSEAAATAVLDLL"
FT   gene            complement(39607..40482)
FT                   /locus_tag="Acry_0041"
FT   CDS             complement(39607..40482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0041"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29270"
FT                   /db_xref="GOA:A5FUI8"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUI8"
FT                   /protein_id="ABQ29270.1"
FT                   /translation="MTMRVALSPFPIHRPTGLDDFLDRVDRLADEAKSGGADLLVLPEY
FT                   ASMALAGAFVAAPDVAAELDAVVSRADTLVEGFRAIARTHRLLLLPGSVPMRGADGNIR
FT                   NRAPLIDGDGRIAFQDKRVMTRFESERWGITPGGPPSVFETDFGRLGIAICYDSEFPLL
FT                   VRAQALAGADTILIPACTDSLHGFNRVRLSARARALENQCFTAVAPTTGMAPWSAAVDE
FT                   NRGYACVFGPVDRGFPEDGLLARGALDAADLLFATLDPARLAATRDDPAVRNRTDWPDD
FT                   PAPARIVRLT"
FT   gene            complement(40479..41000)
FT                   /locus_tag="Acry_0042"
FT   CDS             complement(40479..41000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29271"
FT                   /db_xref="GOA:A5FUI9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUI9"
FT                   /protein_id="ABQ29271.1"
FT                   /translation="MFRAWPYLYEGNEAYERDYVATYAASERAAIVIARDGDAIVGAST
FT                   CLPLTDEDEAMQAPFRAAGIDPASVFYFGESVLLPAYRGRGVGVAFFREREAHARAVSD
FT                   AAQAAFCAVIRDNADPRRPADATTLDVFWRKRGYAPVSGLVCRMRWREIGAAHEVENRL
FT                   QVWMKPLGGA"
FT   gene            complement(41089..42816)
FT                   /locus_tag="Acry_0043"
FT   CDS             complement(41089..42816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0043"
FT                   /product="Gluconate 2-dehydrogenase (acceptor)"
FT                   /EC_number="1.1.99.3"
FT                   /note="PFAM: cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29272"
FT                   /db_xref="GOA:A5FUJ0"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUJ0"
FT                   /protein_id="ABQ29272.1"
FT                   /translation="MPHSKKTIFRRAPLWAATLLIALTCGAVGIEAAFGQEAGGYMPTP
FT                   TAAKPEAFPALPEPVTKGMSQAEIAQVRRGEYLTAAADCMPCHTAPGAKPFSGGLSFVT
FT                   PFGTLYSPNITPAKTTGIGKWTPRQFYNALHYGVSPGSSLGVFPKYLYPAMPYTSYAKL
FT                   TRPDVMAIKAYLDAIPAVHAPHAPNRLGFPFNIRAMLLGWRIMFFSTAPVHYKKDWSPA
FT                   VRNGAYLAEALGHCSECHSPRNLLFAIKSGDTLAGAQILGEPWYAPNISSSKTYGVGGW
FT                   SRKDLVDYLHEGGNMNRGSAFGPMQSVVDYSLSQLPRQDVDDLAAYLQTATPPRENPVK
FT                   KVALAPGELAQGKALYDDNCAACHQADGKGVKDVFPNLAGNDAVTNGPSDNVIGIVLGG
FT                   MIPWHANGPAMPAFGSMLNDAQIAAIANYVRTAWGNKGVTDADAAKVLGIRASTPPHDI
FT                   ALADADYLDLPPIASAAARRMNCPLLTKDLVSPGHGTMEIMQGVTPATLGNRTRMLVAA
FT                   IRKAYPDITQKRMAEFLTAAYCPVVAQERGLSLGEKKKAIQRFLSEAASMDTAARKGS"
FT   sig_peptide     complement(42709..42816)
FT                   /locus_tag="Acry_0043"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.795 at
FT                   residue 36"
FT   gene            42985..43060
FT                   /locus_tag="Acry_R0001"
FT                   /note="tRNA-Lys1"
FT   tRNA            42985..43060
FT                   /locus_tag="Acry_R0001"
FT                   /product="tRNA-Lys"
FT   gene            complement(43236..43310)
FT                   /locus_tag="Acry_R0002"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(43236..43310)
FT                   /locus_tag="Acry_R0002"
FT                   /product="tRNA-Thr"
FT   gene            complement(43357..44583)
FT                   /locus_tag="Acry_0044"
FT   CDS             complement(43357..44583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0044"
FT                   /product="5-aminolevulinate synthase"
FT                   /EC_number="2.3.1.37"
FT                   /note="TIGRFAM: 5-aminolevulinic acid synthase; PFAM:
FT                   aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29273"
FT                   /db_xref="GOA:A5FUJ1"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUJ1"
FT                   /protein_id="ABQ29273.1"
FT                   /translation="MNRDHPFIAQCDKALADIRAAGRYRRFVALEKLADRFPYYKVTME
FT                   GRTQDILVWSSNDYLAMGTDPEVIEASIEAARTMGAGAGGTRNIAGSSPIHVALEAELA
FT                   ALHGKDAALLFTSGYVSNQATLTAILNSMPGWHVFSDAQNHNSMIVGIKGGKAATVHVF
FT                   AHNDLADLEARLAAAPADAPKMIAFESVYSMDGDIAPIGAICDLADKYNAITYLDEVHA
FT                   VGMYGPHGAGVSERDGVAHRLTIIEGTLAKAYGCHGGYIAGDASVIDYIRSVAAGFIFT
FT                   TALPPPTVAAALASIRRLKVDQARRDTLFERANLLKSKFDQARLPRLPTESHIVPLMIG
FT                   NATRATEVSMRLIREFGMYATPINYPTVPAGTERLRFTPGPKHTEAMMDQLVAALRHIL
FT                   SGETGTVAA"
FT   gene            complement(44723..45655)
FT                   /locus_tag="Acry_0045"
FT   CDS             complement(44723..45655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0045"
FT                   /product="thymidylate synthase, flavin-dependent"
FT                   /EC_number="2.1.1.148"
FT                   /note="TIGRFAM: thymidylate synthase, flavin-dependent;
FT                   PFAM: thymidylate synthase complementing protein ThyX"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29274"
FT                   /db_xref="GOA:A5FUJ2"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUJ2"
FT                   /protein_id="ABQ29274.1"
FT                   /translation="MPLSDSDRTEIEAARAETTPTRRATVPTLEAMLFSAIPVLDHGFV
FT                   RVVDYMGDDAAVVQAARVSYGRGTRKVSEDEGLIRYLMRHRHSTPFEMCEIKLHVKLPI
FT                   FVARQWIRHRTANVNEYSARYSVMDREFYIPSPANLAAQSASNRQGRGDLLEGDEASEV
FT                   LAMLRADAERNYNHYERMLNEGGADPSRRGLARELARMNLTLNTYTQWYWKTDLHNLFH
FT                   FLSLRADPHAQYEIRAYAEAILDIARAWVPASCRAFEDYRMGAATFSATMLAALRRMLA
FT                   GEPVDQAQSGLSKREWAEMMAALTPPTPG"
FT   gene            complement(46354..46794)
FT                   /locus_tag="Acry_0046"
FT   CDS             complement(46354..46794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29275"
FT                   /db_xref="GOA:A5FUJ3"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUJ3"
FT                   /protein_id="ABQ29275.1"
FT                   /translation="MTLSGFTTISVLLAVHLGGFAMWSGLLLGLLLAGPGPGAVAIRRQ
FT                   LDAAVPFMAVTLATGWALAFAEQGPPEHWNWTVNAMQALGIVMAAVLLVARFGALFLWE
FT                   ETDSGPDEEAKAAAYRRLARLFAADLAISGVILAVAVAGRYG"
FT   sig_peptide     complement(46693..46794)
FT                   /locus_tag="Acry_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.744) with cleavage site probability 0.374 at
FT                   residue 34"
FT   gene            complement(46791..47420)
FT                   /locus_tag="Acry_0047"
FT   CDS             complement(46791..47420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0047"
FT                   /product="plasmid segregation oscillating ATPase ParF"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29276"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUJ4"
FT                   /protein_id="ABQ29276.1"
FT                   /translation="MAQVIAVAQQKGGAGKTMLATQLGVALGMTRRVGLLDIDPQGSLG
FT                   AWARLRAANPKARADLAVGSVSGWRLANTLDAMRRDCDLLVIDTPPVLDSDARRAIRGA
FT                   DLVLVPLNPSPPDLWAAEGTLTLAAEERRPVALVFNRAPAASKLRRRLEAEIAARRLRL
FT                   IDEALGNRAAYANSFAEGLGVAETGPSTLAGTEIAALATRLASILE"
FT   gene            47474..48880
FT                   /locus_tag="Acry_0048"
FT   CDS             47474..48880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0048"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="TIGRFAM: carbohydrate kinase, YjeF related protein;
FT                   PFAM: protein of unknown function UPF0031; YjeF-family
FT                   N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29277"
FT                   /db_xref="GOA:A5FUJ5"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUJ5"
FT                   /protein_id="ABQ29277.1"
FT                   /translation="MGGMDALYTPQEMGLIDTAALSCGVSGLMLMENAGTAVARAIVRR
FT                   FRPCRVLVLAGPGNNGGDGYVAARRLAERGWPVAVAPLAPPRPASDAAAAAALWRGPVV
FT                   AADEGRVQSAELVIDAVFGAGLARDVDPGTVALLGAARRLVAIDVPSGVDGATGAVRGA
FT                   APRADLTVTFAGLKPGHLLFPGRALCGETVCAEIGMPAAAFARVETKTWRNTPALWRLP
FT                   APAATGHKYERGHLTILAGPMSGAAILAAAAARRIGAGLVTLAGPDPAGVPPGIIVSRA
FT                   ALDELVTDPRRRVWLCGPGLGVEAAGQTLARLVAAGRAIVADADALTSAAGEAERLRGV
FT                   AAITPHEGEFARVFPDLQADRLSRARAAAARIGAVVVLKGPDTVIAAPDGRAAINANAP
FT                   PFLATAGSGDTLAGIAAGLLVQGMPAFEACCAAVWLHGAAATRAGGGLIAEDLADHLPM
FT                   VVENIKKFNF"
FT   misc_binding    49221..49323
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   78.28"
FT   misc_binding    49326..49421
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   57.21"
FT   gene            49470..50570
FT                   /locus_tag="Acry_0049"
FT   CDS             49470..50570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0049"
FT                   /product="glycine cleavage system T protein"
FT                   /note="TIGRFAM: glycine cleavage system T protein; PFAM:
FT                   glycine cleavage T protein (aminomethyl transferase);
FT                   Glycine cleavage T-protein, C-terminal barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29278"
FT                   /db_xref="GOA:A5FUJ6"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUJ6"
FT                   /protein_id="ABQ29278.1"
FT                   /translation="MAESALLTVPLDALHRSLGARMVDFAGYDMPVQYEGIIAEHLHCR
FT                   AQAALFDVSHMGQAVLEGPDAAAALERVVTGDIRGLKPGRQRYTLLMNAQGGIVDDLMV
FT                   ANLGDRLLLVLNAGRKNVDVAHIRAHLPATVSLTPQFDRALLALQGPEAGAVMATLAPE
FT                   VAAMRFMEAREMALSGISVTITRSGYTGEDGFEIGLPAAEAEGLARALLADARVKPAGL
FT                   GARDSLRLEAGLPLYGNDIDETRDPIAAGLGFAIGKTRKMGWDFLGGDAVRAVHDAGPR
FT                   ERLVGLRAEGRAPVRAGAELRDAAGQPAGRVTSGTFGPSVNGPVALGYVRADCAGDGST
FT                   LIAGLRGRDIGITVVPLPFVPHRYHR"
FT   gene            50582..50956
FT                   /locus_tag="Acry_0050"
FT   CDS             50582..50956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0050"
FT                   /product="glycine cleavage system H protein"
FT                   /note="TIGRFAM: glycine cleavage system H protein; PFAM:
FT                   glycine cleavage H-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29279"
FT                   /db_xref="GOA:A5FUJ7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUJ7"
FT                   /protein_id="ABQ29279.1"
FT                   /translation="MTETRFSKDHEWVRLDGDVATVGITDHAQSALGDVVFVELPETGR
FT                   HVDAGEACAVVESVKAASDVYAPLAGTVTEANGALADDPGMVNAQAESGAWFFRMTLDD
FT                   RAAFDALLTADDYQAFLATL"
FT   gene            50971..53853
FT                   /locus_tag="Acry_0051"
FT   CDS             50971..53853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0051"
FT                   /product="glycine dehydrogenase (decarboxylating) alpha
FT                   subunit / glycine dehydrogenase (decarboxylating) beta
FT                   subunit"
FT                   /EC_number="1.4.4.2"
FT                   /note="TIGRFAM: glycine dehydrogenase; PFAM: glycine
FT                   cleavage system P-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29280"
FT                   /db_xref="GOA:A5FUJ8"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUJ8"
FT                   /protein_id="ABQ29280.1"
FT                   /translation="MPDTAPQTIDDFTALLAEERFALRHIGPGPAERAAMLRALGAADL
FT                   DALIARTVPETIRSAAPLDLPAALTEGEILDDLRRYAADNEVKRSLIGLGYHGTVTPPV
FT                   ILRNVLENPGWYTAYTPYQAEIAQGRLEALLNFQTMMAELAGLDLANASLLDEGTAAAE
FT                   GVSLAHAVHKGGSTVIAVAADLHPQSRAVIATRAAPLGWTLEDVAPGDAGAIEQAKPFA
FT                   VVLQYPGTTGAVRDLSDEIAAAHRAGALAIVAADPLALTLLRPPGEMGADIVVGSAQRF
FT                   GVPMGFGGPHAAYFATRDSLKRHMAGRLVGVSVDAAGSPALRLALQTREQHIRREKATS
FT                   NICTAQVLLAVIAGFYGVWHGPEGLARIARRVHLAARLLAGAARAAGLSIRHDVFFDTI
FT                   AIEAGAGADSLMQRALGAGFNLRRVDDGCVAIALDETVTAAEIATLAGVIGGAADAAAS
FT                   PLDALGRQSAFMVEPVFHAHRSEHAMLRYLKQLEDKDVALNRSMIPLGSCTMKLNATAE
FT                   MIPITWRAFADIHPFAPMEQTRGYRALITRLSEDLARITGFAAVSLQPNSGAQGEYAGL
FT                   LAIRAFHAAREEGHRDICLIPSSAHGTNPASATMAGYRVVVIGCDRAGNIDLADLEAKI
FT                   AAHAGKIAALMITYPSTHGVFEASVRDICARVHAAGGQVYMDGANMNAQVGLTSPAAIG
FT                   ADVCHLNLHKTFCIPHGGGGPGVGPIAVAAHLAPHLPNHPLRPDAGPSTGYGPVSAAPF
FT                   GSASILPIPYAYIRMMGPDGLREATAVAILNANYIAHRLAPHYPILYTGANGMVAHECI
FT                   IDCRHFQAEAGILVEDIAKRLQDYGFHAPTMSWPVPGTLMIEPTESETKAELDRFCDAM
FT                   IAIRGEIADVAAGALDRVDNPLKNAPHTAAEVMAATWTHGYGRDRAAFPLPHVRAAKYW
FT                   PPVKRVDNVYGDRNLVCSCAPLSAYAEAAD"
FT   gene            53949..54524
FT                   /locus_tag="Acry_0052"
FT   CDS             53949..54524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0052"
FT                   /product="Lipocalin family protein"
FT                   /note="PFAM: Lipocalin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29281"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUJ9"
FT                   /protein_id="ABQ29281.1"
FT                   /translation="MTLARRSLLAAAPALLAGCTFDTSPYPQPPLRHARVDLDRFMGRW
FT                   YIIGHIPYFAEAGYVGSYAVYTRRPDGAIDDQYNGYPKSFAAKRFQFTSVDQVEPGTDN
FT                   AVWRVTLLNGLVGVPYVIMHVEPDYSVFLGGFPNRSLGWIFAREKRMDEATYRAMLDRF
FT                   YRQGYDARQFRRVAQFPDQIGRPGFERV"
FT   gene            54608..56350
FT                   /locus_tag="Acry_0053"
FT   CDS             54608..56350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0053"
FT                   /product="Acid phosphatase"
FT                   /EC_number="3.1.3.2"
FT                   /note="PFAM: peptidase S49"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29282"
FT                   /db_xref="GOA:A5FUK0"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004634"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUK0"
FT                   /protein_id="ABQ29282.1"
FT                   /translation="MSESAAPLRRLARLLWRAARAIVFAIGLVTILLAGAGLWGLHRLA
FT                   GRPTALPEHFILSLNLQTAPPDVAAPSALLRRATGATPTLEQTIAAIDRAATDPRVRGI
FT                   DILLGGGCCGLTTAEELHDALARFRAISHRQVVARAMSFDGAEGLGAYIVATAANRIEL
FT                   SDAGDFGVTGLALQSPFAADLLKMAGVEAQFEHIGKYKTYPELFTRSGPSAAATEMMNS
FT                   LAGSLYDSALVPIAARLKRSPDQVKALFDQAPFSAAQAKQDGLVDTVLPLSAEVAHVRG
FT                   VHVSLADYVADAAPAPAGAPKVALIVAHGDINAPDAPGRRSGIDPARLAHEIATAVADP
FT                   SIRAIVLRLDTPGGTVTGSAMVGAEVARAARLHKPLIVSMGALDASGGYWISSHGAVLV
FT                   ADPATLTGSIGVLGGKFSFGGLLARLGVSVSTASRGANALFDSAVTPWTEAQLASLQGQ
FT                   LDLDYQKFVGWVAAGRRMSPAQVNAVGQGRVWTGAQARSRGLVDRLGGYHEAFMTVRAA
FT                   LHLPADAALDIVPGNEQPGLAALLATLARQANPLEAAALPEPLRGLFALTRLHRLSMVP
FT                   VELR"
FT   gene            56586..57107
FT                   /locus_tag="Acry_0054"
FT   CDS             56586..57107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0054"
FT                   /product="protein of unknown function UPF0040"
FT                   /note="PFAM: protein of unknown function UPF0040"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29283"
FT                   /db_xref="GOA:A5FUK1"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUK1"
FT                   /protein_id="ABQ29283.1"
FT                   /translation="MRRNVCSEAYQRRDERAATAPMSQFLGTHRNRLDAKGRVSVPAAF
FT                   RAALRREGDSQGLILRPSHKHRCIEVWPAPVFEALATRLQGLDLFSDTHDDMAAALYAD
FT                   AWPLEADKEGRILLPEPLVEHAGLRDSVVFMGLGRTFQIWEPEAADRRRAEARERARIG
FT                   GLTLPAGASA"
FT   gene            57104..58045
FT                   /locus_tag="Acry_0055"
FT   CDS             57104..58045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0055"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29284"
FT                   /db_xref="GOA:A5FUK2"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUK2"
FT                   /protein_id="ABQ29284.1"
FT                   /translation="MSGGLSHVPVLREEAVAMLAPRADGVYLDGTFGGGGYSASMLEAA
FT                   SCTVWAIDRDPAAIARGAALAARYPDRLHLIEGRFGDLLALLRDRGVTALDGAVFDFGV
FT                   SSYQLDDPSRGFSFRTDGPLDMRMGAAGPTAADIVNGYAEAELADILFHFGEERASRRI
FT                   AAAIVRRRAAQPFETTADLAAVIRTVVRPDRSGIDPATRSFQALRIEVNQELAEIERAL
FT                   EAAASLLAPGGRLVAVSFHSLEDRIVKRFMNAATGHVAAPSRHDPSGLARQAAAPRFRA
FT                   LTRGVVTPGEAETVANPRARSARLRGIERLAA"
FT   gene            58042..58911
FT                   /locus_tag="Acry_0056"
FT   CDS             58042..58911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0056"
FT                   /product="secreted (periplasmic) protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29285"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUK3"
FT                   /protein_id="ABQ29285.1"
FT                   /translation="MIRPVTLVTGLLMLGSGAWLFVVKHRAGTLEHKIGGVTAQIRSSE
FT                   QRIRVLRAEWALETDPNRLARLAAMFMPQLRPMKPDQLVSWQQLADALPPPGAELPHLP
FT                   LPPPLPGDLSGAPSSAAVAAAAAPETVALATIPLPVPPRSLPAPRFAAATSQTALAAPQ
FT                   AHLAVPHPAVRPVAVRRSVVAPAQHAVVVHRPASQRHDVVARAHSPAIAAARRPQTLGA
FT                   SVLAPRPAPRPTEPPVRSITASDAVPARPQAPAPPARIVAPAARGTSVFGDYGASLAPP
FT                   RPAGGVAP"
FT   sig_peptide     58042..58104
FT                   /locus_tag="Acry_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.674) with cleavage site probability 0.470 at
FT                   residue 21"
FT   gene            58908..60998
FT                   /locus_tag="Acry_0057"
FT   CDS             58908..60998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0057"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   Penicillin-binding protein, dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29286"
FT                   /db_xref="GOA:A5FUK4"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUK4"
FT                   /protein_id="ABQ29286.1"
FT                   /translation="MTAPPPRDSLSPRVPGRGGRDAARRAGAPERGAVPRMEHVRVTSP
FT                   DLARRAAIGVLHSRLAAGFAGFVLIYLLLAARVVYVTVVHPVPPDKAAIAAQTPSTTVV
FT                   LPPPARAEITDRNGEILAVSLPAAALYANPKQVEDPGVAAREIAAVIPGLDPGFLEARL
FT                   ADRSRDFVYLDRKLTASQELAVNRLGIPGVYFENTERRHYPEGNLAAHILGGVTPDQRG
FT                   IAGVEDWFNKRLTSAPGKPLRLSIDIGAEGIVRQAIWQAMSDYDAKGACGIVISARTGR
FT                   VLAMASVPDYNADDLGSAPADARFNRCVSGDYEPGSVFKLQTLSMAINSDMIQPWDRFN
FT                   TTHPLHVGRFTVTDFEPAHIWMAVPHILAVSSNIGASRIATILGPQIQRAWLRKLGFFR
FT                   RPPIQLPEATPPMYHPKSSWKLLTTMTVSFGNGIAMSPLQLISAVVPVVNGGIWYPPTL
FT                   LDHGKRSAGVRVMSERTSLIMRKMMRNVVTAPDGTGVYARVPGYLVGGKTGTAQVVGPN
FT                   GRYLQHLNNASFMAAFPMNDPRYVVYVVVLQPHATKQMLPFCHGFTTGGYVAAPAVAQI
FT                   ISRIGPMLGIMPLSGQTLAEAQAALSIPLDPPAPPGRLALGPGHLFPPGASKYAYILAH
FT                   QTPPANMDVAAHDQALARTEMWQPLAPAAQTVSLPPAPASSAHTLGHRIMNIALPVTRA
FT                   GG"
FT   gene            61003..62448
FT                   /locus_tag="Acry_0058"
FT   CDS             61003..62448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0058"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetase;
FT                   PFAM: cytoplasmic peptidoglycan synthetase domain protein;
FT                   Mur ligase, middle domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29287"
FT                   /db_xref="GOA:A5FUK5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUK5"
FT                   /protein_id="ABQ29287.1"
FT                   /translation="MDGLSRYGAPPGWILPPETVFSGITADSRAVRKGMIFAALPGARA
FT                   DGRDFIAQAVAQGAAAVLAPSGTRWPPGVPPRPLIEDPEPRRRLAEIAATLAGPLPETI
FT                   LGVTGTNGKTSTVDFIRQMAVASGRPAASLGTLGLIAPGFAPGASLTTPDPVTLSDILA
FT                   ALRAAGIGTVALEASSHGLDQFRLHGLRLAAGGFSNLTRDHLDYHGDMASYRRAKLRLF
FT                   QDLLLPGAPAVAMADLEPDTLAALRDIAQARRLDLATVGAGGDLFDLRGIIATPSSQVL
FT                   TIACGGVSREIELPLPGRFQVDNALLAAGLARAAGVSDPLDRLPGLAPVRGRLERAAVL
FT                   PNGAAAYVDYAHTPDALERLLMALRPHAAGRLVLVFGAGGDRDRGKRKLMGDVAARLAD
FT                   VAIVTDDNPRSEDPASIRAAILAACPGAREIGDRRAAIAAGLDALRAGDVLAVAGKGHE
FT                   SGQIVGDAVLPFDDAAVIRELAA"
FT   gene            62445..63800
FT                   /locus_tag="Acry_0059"
FT   CDS             62445..63800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0059"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase, middle domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29288"
FT                   /db_xref="GOA:A5FUK6"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUK6"
FT                   /protein_id="ABQ29288.1"
FT                   /translation="MSGLWSARDLAVATNGTWLRGEADATGVSIDSRTIAPGELFVALA
FT                   DARDGHDFVPDAEAKGAACVLVARDVGAGPALLVEDVQAALTRLGEFGRARSRARVVAV
FT                   TGSVGKSTTKEMLRRILSAFGATHAAEASFNNHIGVPLTLARLPAEADFAVVEIGMNHP
FT                   GEIAPLSAITRPHVGVITAIGSAHLGLMGSVEAIADEKAELLRGVVPGGAAVLPRGPFL
FT                   SRLARRARDGVRVVSFGAQDLAEARLIEAESDADGVAVTANILRMVVRCRLAAPGTHMA
FT                   MNAVAALAAAAALGLDPAQAAAALDGFAPLAGRGARRRVNVDGVEITLLDESYNASGNS
FT                   VRAALEVLSLLPGRRIAVLGDMLELGDYADDEHRDLADAVSGVADLVFACGPHMRVMFD
FT                   ELPERQRGAWAVDAASLAPAVRAALAVGDVVLVKGSYGSRMRDVVAAIEDKA"
FT   gene            63800..64888
FT                   /locus_tag="Acry_0060"
FT   CDS             63800..64888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0060"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   glycosyl transferase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29289"
FT                   /db_xref="GOA:A5FUK7"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUK7"
FT                   /protein_id="ABQ29289.1"
FT                   /translation="MLYALLLPHVAAFHAFNLIRYITFRAGGACLTALVVSFLLGPRLI
FT                   RWLKSLQKQGQPIRADGPERHLIEKKGTPTMGGFLILIALTVSTLLWADLRNGYVWAVL
FT                   MITIGYGALGFADDFLKLTKRNTKGVPGRIKLVVQAVLGLGAAVWITQLMPGSIADSLA
FT                   VPVFKHLMIPFGPLFPLVAMFVMMGASNAVNLTDGLDGLAIVPTIIAAGVFTLIAYLVG
FT                   NRIFSHYLEINFVPGTGELAVFCSALIGAGMGFLWFNAPPAAVFMGDTGSLALGGALGS
FT                   VAVATKNEIVLAITGGLFVVETVSVIVQVFWYKRTGRRVFLMAPLHHHFEKKGWAEPTV
FT                   VIRFWIVAMILALLGLATLKIR"
FT   gene            64885..66270
FT                   /locus_tag="Acry_0061"
FT   CDS             64885..66270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0061"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase; PFAM: cytoplasmic peptidoglycan synthetase domain
FT                   protein; Mur ligase, middle domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29290"
FT                   /db_xref="GOA:A5FUK8"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUK8"
FT                   /protein_id="ABQ29290.1"
FT                   /translation="MSAPVENWSHVFAGRRYAVLGLGVNGLPAAQALVAMGASVIAWDD
FT                   NEARRGAAAAVGITIGRPSDASKLDGLILSPGIPHALPVPHPEAAAVMARGVPIFTDAE
FT                   LLFRAVRDSGSSARFVGITGTNGKSTTTALLAHILADAGIEVAAGGNLGPAALALPRLG
FT                   DDGVYVLEMSSYMLERIVNMRFSAGAMLNLTPDHLDRHGNMAGYEAAKSRLFVGQEAGD
FT                   VAVFGIDDAATAAMATRFEDGKRRIVRISGCQRADIFARGRKLVDHSGVIADLDAAAAL
FT                   PGTHNAQNAAAAAALALAFGVPREVIGRAMASFPGLPHRQRVVASVAGVTFIDDSKATN
FT                   ADSAARALDCHERLVWIAGGIGKDGGITPLAPWFSRVAHAVLIGRDAPEFAATLASAGV
FT                   SCEIAGTIENAVPSAFAAARRIGVDTVLLSPAAASFDQFADYAARGRRFAELAARLVSM
FT                   EAR"
FT   gene            66270..67433
FT                   /locus_tag="Acry_0062"
FT   CDS             66270..67433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0062"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29291"
FT                   /db_xref="GOA:A5FUK9"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUK9"
FT                   /protein_id="ABQ29291.1"
FT                   /translation="MPVLSRADDSVVGRWWWSVDRVMLTALLLLVGLGYVLALAATPAT
FT                   NLSLNDPNTIVMIRQIVYLLTAGILMVGVSMLDLHYVKLAALATGVVFLVLTGFTLVHG
FT                   VVVDGGRRWIALPGFTIQPSEFLKPALIIATAWLLAERRRTPGFPGMFAAIGLNSLVVL
FT                   ILLRQPDVGSTALVLATFFVQLFLDGLNAFFVGLGVAGFGAAGFAAFELIAHVHKRVML
FT                   FLHPTKDKAYQALTALSAFANGGLWGRGPGEGQVKHYLPDARADFVFAVAGEEFGMFLC
FT                   LGIIALYAVIVLRGFMRVLRETDPFVALASAGLLTSFGLQAFINMASSLSMIPTKGMTL
FT                   PFLSYGGSAVLATGLHMGFLLALTRRRTHAERVTDGLFGLGMQDRAV"
FT   gene            67430..68536
FT                   /locus_tag="Acry_0063"
FT   CDS             67430..68536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0063"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="PFAM: glycosyl transferase, family 28;
FT                   Glycosyltransferase 28, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29292"
FT                   /db_xref="GOA:A5FUL0"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUL0"
FT                   /protein_id="ABQ29292.1"
FT                   /translation="MRGAMLNPIVIAAGGTGGHMVPAESVADELMRRGQRIVLMTDARS
FT                   AGQKSAVFAGCERHVLAGAGLAGRSLGRRLLGVAQLARGTVAARHILAKLDAAAVVGFG
FT                   GYPSVPPVLAAATLRRRPAIVLHDQNAVLGGANRFLARFADHLALSFEGTVGLPGRARA
FT                   TVTGNPVRAAISVLAASPYEPPAETIRLLVLGGSLGARIFATLVPEALARLPEGLRRRI
FT                   ALTMQCPGEAIGAARGALDAAGITHELAPFFSDVAPRMAAAHLLVARSGGSTVAEVATI
FT                   GRPAIFIPLAINTDQRHNADVLARRGGAFRLDQATTTPDRLAGVLESLLDDPLRLAAMA
FT                   EAAASARIEEAAARLADLVLSAIAERVR"
FT   gene            68533..69972
FT                   /locus_tag="Acry_0064"
FT   CDS             68533..69972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0064"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate--alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase, middle domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29293"
FT                   /db_xref="GOA:A5FUL1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUL1"
FT                   /protein_id="ABQ29293.1"
FT                   /translation="MRAMPLSIGTIHFVGIAGIGMSGIAEVLHNLGYSVQGSDLSENAN
FT                   VARLRAAGIPVAIGHDAANLGNAQVVVVSTAVPRDNPEVQAARKRMIPVVRRAEMLGEL
FT                   MRLRWSVAIGGTHGKTTTTSLVAAVLEGAGLDPTVINGGIINAYGTNARLGGGDWMVVE
FT                   ADESDGSFLRLPAVIAVVTNMDPEHLDHWGSAEAMEAGYRQFVSNIPFYGFAVLCIDHP
FT                   GVQRMIPDLSDHRLITYGLSPQADVRAERIMSDRNGATFEVRLSERVAGRERVLAPMRL
FT                   PMLGNHNVQNALAAIAIGIEMEVPEVDLRAALASFRGVKRRFTKTGEVAGITVIDDYGH
FT                   HPVEIAAVLRAARQAGARDVIAVVQPHRYTRLATLFEDFCTCMNDAGKVIVADVYPAGE
FT                   EPIPGIDRDALVEGLRARGHKSVVSLGSPDHLAEMINAMARAGDYVVCLGAGSITNWAQ
FT                   ALPNQLQALIETTRRGAGGMR"
FT   gene            69969..70898
FT                   /locus_tag="Acry_0065"
FT   CDS             69969..70898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0065"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /note="TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; PFAM: FAD linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29294"
FT                   /db_xref="GOA:A5FUL2"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUL2"
FT                   /protein_id="ABQ29294.1"
FT                   /translation="MMAAPVMADWRAALPEVRGRIGFDVPLGPVTWFRVGGPAEVMFRP
FT                   ADIEDLSRFLAALAPEVPVLPIGAASNLIVRDGGIAGVVVRLVRGFADIEVQPDGIVAG
FT                   AAALDATIAEHAAAAGLTGLEFLSGIPGSLGGAVAMNAGAYGAEIRDVLDWAEIVGRDG
FT                   TVARYAAGDLALTYRHARLPEGGIVVRARLHARPGEAAAIAARMADIRASREATQPVRA
FT                   RTGGSTFRNPEGDKAWRLIDEAGCRGLIHGGAQVSEKHCNFLINLGEATAADIEGLGET
FT                   VRRRVRERTGVELIWEIRRVGLPCRGAA"
FT   gene            70895..71800
FT                   /locus_tag="Acry_0066"
FT   CDS             70895..71800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0066"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="TIGRFAM: D-alanine--D-alanine ligase; PFAM: protein
FT                   of unknown function DUF201; D-alanine--D-alanine ligase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29295"
FT                   /db_xref="GOA:A5FUL3"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUL3"
FT                   /protein_id="ABQ29295.1"
FT                   /translation="MKRVAVLLGGISEEREVSLASGRQVAAALRKAGYDVFEIEVGADL
FT                   GAVIAALTPAPDAVFNALHGRFGEDGTIQGVLDYMGIPYTHSGVRASSMAMDKGAAKAV
FT                   FAAAGLPLAQHRIVPLDELAEADPLPRPYVIKPVNEGSSVGVFILREGDNRRADIARAW
FT                   RHGSVAMTEEYVPGRELTVSVLEDRALAVTEIRAEGFYDYTAKYAAGASRHEIPADVPP
FT                   SVSARARDVAVAAHRALGCRGATRSDFRYDDETDRLVLLEVNTQPGMTPTSLLPEQAAH
FT                   CGIDFPALCAWMVENAACRV"
FT   gene            71788..72666
FT                   /locus_tag="Acry_0067"
FT   CDS             71788..72666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0067"
FT                   /product="Polypeptide-transport-associated domain protein,
FT                   FtsQ-type"
FT                   /note="PFAM: cell division protein FtsQ;
FT                   Polypeptide-transport-associated domain protein, FtsQ-type"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29296"
FT                   /db_xref="GOA:A5FUL4"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUL4"
FT                   /protein_id="ABQ29296.1"
FT                   /translation="MPRVKQRKATVQDRPSPRTLLLRRLRRAGRPTAVLGVMALLLIAV
FT                   PLGLRGVLAVFRPVRAAAATVAADAGFRIAHIELSGVTPGSRAVVERALDVERGKAIFA
FT                   VSPAAVAARVGALGLVRSAVVERVLPDTLRVEVTERRAVAIWQRPDGRFALVGAGGAVL
FT                   EDRDAGAARAHDPNLRLLVGAGAPKHAQDLLDLLARFPAIDSKVVAAERIDRLRWNLIL
FT                   RDHTVVELPDSHPARALTVLMQAERKIRLLDRPVRRIDLRLADRLVVRPYPKGFVTDAA
FT                   TPSAASGNHKS"
FT   sig_peptide     71788..71973
FT                   /locus_tag="Acry_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.802) with cleavage site probability 0.365 at
FT                   residue 62"
FT   gene            72674..73987
FT                   /locus_tag="Acry_0068"
FT   CDS             72674..73987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0068"
FT                   /product="cell division protein FtsA"
FT                   /note="PFAM: cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29297"
FT                   /db_xref="GOA:A5FUL5"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUL5"
FT                   /protein_id="ABQ29297.1"
FT                   /translation="MGMNDLSRRATLTATRAEPRQQETRRQPARSGPFGVLDIGSTKIS
FT                   CLIGRAESDGRLRALGFGWQRGRGVKSGGIVDLEDAEKAIRAAVGAAEDQADMRLKSVT
FT                   VNLSCGQPESRLFNVQWPIDGRAVTEDDIRRVVREARARAASEGRGTIHALPLNFSTDE
FT                   TGGVADPRGLYCDTLTAQLHVVDAATTAIKSVTACLERCELEIASMVSAPFASGLATLV
FT                   EDERELGATVIDMGGGTTTIAVFAEGQMLHTAQLPVGGNHVTNDVARLLSTQVAHAERL
FT                   KTLYGTCQESPDDARELLPVPLVGEAEHQIAKVPRSALVSIIRPRLEEIFELVRDRIET
FT                   SGLGRAAGARVVLTGGASQLVGARELAAQILDRQVRIGKPIGVIGLPDAATGPNFATMI
FT                   GLLAFASGDGQTMHDIDLTAAAPQGRLARFMNLLMRRM"
FT   gene            74052..75620
FT                   /locus_tag="Acry_0069"
FT   CDS             74052..75620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0069"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ, GTPase; Tubulin/FtsZ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29298"
FT                   /db_xref="GOA:A5FUL6"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUL6"
FT                   /protein_id="ABQ29298.1"
FT                   /translation="MTLNLIRQTTTQTDFTPRITVIGVGGGGTNAVNNMIALNLPGVEF
FT                   VVANTDAQQLMLSRAERRIQLGPHITQGNGAGGRPEIGKASAEEASEDLARHLDGAHMV
FT                   FITAGMGGGTGTGAAPVIARMARERGILTVGVVTKPFAFEGRRRLRSAEEGINELQQFV
FT                   DTLIVIPNQNLFKVANERTGWKEAFEMADHVLYMGVRGVTDLMVVPGLVNLDYADIRSV
FT                   MSVMGKAMMGTGEAEGEDRAIRAAEAAISNPLLEDTNMKGARGLLINITGSSDFSLHEL
FT                   DQAANRIAEEVDEDANIMVGMALDESLGGRVRISVVATGIDTPVPAQAERPRLAAVSGD
FT                   SVMVEANATVAAQPHMTAAPAAASHPAHFQPQSAPAQHQAAQAMHPQPAPGPVPARPQF
FT                   QAEGPVRAPISAPAAFRETPRAAEPPRKQSLFGRMTSSFRNAAAPQPMPQAEPRAAAPS
FT                   WPAREEPSYQAPQHLDREMPQAPAAEHASYHVPPQHHEPRAAVRLTQNEEIGIDIPAFL
FT                   RRQQS"
FT   gene            75755..76138
FT                   /locus_tag="Acry_0070"
FT   CDS             75755..76138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29299"
FT                   /db_xref="GOA:A5FUL7"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUL7"
FT                   /protein_id="ABQ29299.1"
FT                   /translation="MRMTIPLSLLLLAASLGAWLGVRAMQQGGVNGGGVFGRLLGPLHG
FT                   VLGAMGLTALVIALARHPVPARMGLGGFGAGAEILLGLALLLGLFVVIAAWRQRRPAGL
FT                   LLGTHATLAIAGITLVLAIASLT"
FT   sig_peptide     75755..75829
FT                   /locus_tag="Acry_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.744 at
FT                   residue 25"
FT   gene            76201..78294
FT                   /locus_tag="Acry_0071"
FT   CDS             76201..78294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0071"
FT                   /product="ComEC/Rec2-related protein"
FT                   /note="PFAM: ComEC/Rec2-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29300"
FT                   /db_xref="GOA:A5FUL8"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUL8"
FT                   /protein_id="ABQ29300.1"
FT                   /translation="MDVALIAVRAAKPAAAPPPGALRSSAAYAGRIVLFLPVAMMAGIL
FT                   LYFDLRAEPPAWLAPVAIVLAAGVITVLWRRPVGRRLAALALFALLGLGRAQWQAMLMP
FT                   PPIVVPHGVVTVTGRVSSIDLLATGRRVRIAASRLNGGPALGRAVRIKLRRGDDVRLAA
FT                   GDSVRVRAFLFAPSRPAYPGGWSFGRDQFFSGLGAVGFAVGKLDVTRVAAPGWGGALRR
FT                   LRETIAARVLAAMPPTTGPIAATLLTGFEESIPARERQAFITAGLAHILAVAGLHIGIV
FT                   MGALFALARFCVGWSEFLLLRVPAKVIASAVAFAGGVVYAALTGFHVPIERSLAMAALV
FT                   LLGIVAGRRALSLRGLAVAAFVLMLIEPQAVPGPSFQMSFSAVLALIAGYEAVGRRFDT
FT                   EGAGWRGRLGRHIAALAFTSLLAGGASMPFAAYQFQQVQPYYILANLIAVPLTALVVLP
FT                   AGMVALVLMPLHLEVLALAPMGWGIAAMLAVARFVGQLPHALIVIGPSPGWPVALLGLG
FT                   MALLGLLRGRVRLAGLAPVVIGLAGMMLGRAPDVLVSPTASLVAVRDGAVVRILETRRP
FT                   DQYTLAQWRPVFAHDRVAVARAADICAGGRCRFDHGRVLYLADATAAENGCGDARVVIS
FT                   PEPLRGACRARGRYVIDRFSVWRDGAIALRFAGGRVRLTTDRWVQGVRPWVAAWPKRWH
FT                   RRQ"
FT   gene            complement(78221..79246)
FT                   /locus_tag="Acry_0072"
FT   CDS             complement(78221..79246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0072"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29301"
FT                   /db_xref="GOA:A5FUL9"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUL9"
FT                   /protein_id="ABQ29301.1"
FT                   /translation="MPSEPRLLAGTPPPGHAYDADIVILSHHRPRETIAAIRSAAAQTG
FT                   LDSHVIVLDQNSPPGMRAALATVATEFPHVALYGVGQNFGVPGGRNRVSALGHGRTIIA
FT                   LDNDAVFAARDTAARAAIRIAGTADLAAIGFRILAADGRSLDLTSWGYPKRLLPRADGF
FT                   FAATTFVGCGHALSRACFERLGGYDESLFFTWEEYEFARRAIAAGWRIEHHGDLAVIHE
FT                   VSPEARVNWNAGRWHQYVRNRLLIAHDWNGLSGFLFRAGIYLARGINACRLRPTLDAIA
FT                   EAHALARTRPRHQETAEARHYVFRNEIRHRLPGGARLIGAGATASARRPPTAAPPAPTG
FT                   P"
FT   gene            complement(79236..80720)
FT                   /locus_tag="Acry_0073"
FT   CDS             complement(79236..80720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0073"
FT                   /product="sugar transferase"
FT                   /note="PFAM: sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29302"
FT                   /db_xref="GOA:A5FUM0"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUM0"
FT                   /protein_id="ABQ29302.1"
FT                   /translation="MSQTILEPLAEPVRRMAAIPVKRAHRFRPHLGPSSGIAFLLVTDA
FT                   ATVLIGPRLATRVLAPAPTMAAGPFNELVFGGLTLLALFAAGLYAVGPARAPLVHIGAM
FT                   LRALVAADVLALLRIALLRPVPAILPLDRSIAWAVGAFTFTAVLMLGERAMVAAFWRRH
FT                   GIGIPRGASALVAATPCDRMLCTRLDRMTDHRLGYVFCWGLAPTSGLRTIADAATLEAM
FT                   IRSGQIGDLVVFVQRGDGPEARSKIDALLARLADQPVRIRLAFDAVAEIGACDLATGRS
FT                   LRLVTVLDRPIRPFGAVAKRSMDVGGAALLIILLGPLLALIALALRMTGPVLFRQRRIG
FT                   LDGAPFTVFKFRTMRPQPPRQAAGPVSQAQPGDRRITRLGAILRRLSLDELPQLFNVLR
FT                   GEMSLVGPRPHAPHTTAGDFTFEQAIAFYGVRHRVKPGLTGLAQVRGLRGPTDRRDLVA
FT                   ARVAADLDYIERWSPWLDLAILLRTIPAVLIGRNAI"
FT   gene            complement(80774..81214)
FT                   /locus_tag="Acry_0074"
FT   CDS             complement(80774..81214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0074"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29303"
FT                   /db_xref="GOA:A5FUM1"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUM1"
FT                   /protein_id="ABQ29303.1"
FT                   /translation="MPALPSPIELVTNRLPARHRAAAGELLRFGLVGVFGLLVDIAAVY
FT                   ALIPSLGLYGAGMAAYLIAASCNWVLHRLWTFRARAQRPAHTQWLRFLMVNLAGFMVNR
FT                   GAYSALIASFVLPRHYPVLAVAAGAASGFLINFLLSRRLVFG"
FT   gene            81403..81900
FT                   /locus_tag="Acry_0075"
FT   CDS             81403..81900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0075"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29304"
FT                   /db_xref="GOA:A5FUM2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUM2"
FT                   /protein_id="ABQ29304.1"
FT                   /translation="MPQVKLTVNGKPATADVEARTLLVEMLRENLHLTGTHVGCDTSQC
FT                   GACVVKVDGKSVKSCTMLAVQADGAEVTTIEGLAAADGTLHPMQEMFREHHGLQCGFCT
FT                   PGMVMSAIDLVESHPEGLTEQQIRDGLEGNICRCTGYHNIVKAIAAAWPLMHGRELPQA
FT                   AE"
FT   gene            81966..84371
FT                   /locus_tag="Acry_0076"
FT   CDS             81966..84371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0076"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead; aldehyde oxidase and xanthine
FT                   dehydrogenase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29305"
FT                   /db_xref="GOA:A5FUM3"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUM3"
FT                   /protein_id="ABQ29305.1"
FT                   /translation="MNDMTQPHIVKGGIGDSPKRVEDRRFLSGRGHYTDDINRPGQAYA
FT                   VFRRSDVAHGNIRSIDAGAARAMPGVVAIFTGEDIAKAGIGGVPCGWQIHSKDGSPMVE
FT                   PPHPVLAQGKVRYVGDAVAMVIAETVDQAKDAAEALVVNIDPLPAVSNMVAATAAGAPL
FT                   VHDDAKGNVCFDWHIGDKDAVDAAFAKAFKVAKIDVVNNRLVPNPIEPRAAIGDFDQAT
FT                   GEHTLYTTSQNPHVIRLLMGAFVLQIPEHKLRVVAPDVGGGFGAKIFHYIEEAAVTWAA
FT                   AQVNRPVKWTCERSESFITDAHGRDHITHAELALAEDGAFLGLRVKTMANLGAYLSTFA
FT                   PSVPTYLSATLLAGVYTTPAIYSEVKAIFTNTVPVDAYRGAGRPETTFLLERLVDVAAK
FT                   TMGMDRVAIRRRNFIPPDAYPYQTPVALQYDSGNHEATLARCMELADWNGFEARRAESA
FT                   KRGKLRGIGMSTYLEACGIAPSAVAGALGARAGLYEVANVKVHPTGSVTLYTGTHSHGQ
FT                   GHETTFAQLVADQLGVPFEQVEIVHGDTSKIPFGMGTYGSRSLAVGGSAIVKAVDKIIA
FT                   KGKKIAAHLMEASVDDIEFKDGKFTVAGTDKSKAFGEIALTAYVPHNYPHDELEPGLDE
FT                   TAFYDPKNFTFPGGCHICEVEVDPDTGVVTLLNFTAVDDIGRVINPMIVHGQVHGGVAQ
FT                   GIGQALLEHAIYDEAGQLLSGSLMDYTMPRADNLVSIHVGTESTMCTHNPLGAKGVGEV
FT                   GAIGSPPAVINAVVDALRDYGVTHVDMPATAQKIWSIINAASPRMAAE"
FT   gene            84384..85178
FT                   /locus_tag="Acry_0077"
FT   CDS             84384..85178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0077"
FT                   /product="Carbon-monoxide dehydrogenase (acceptor)"
FT                   /EC_number="1.2.99.2"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29306"
FT                   /db_xref="GOA:A5FUM4"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUM4"
FT                   /protein_id="ABQ29306.1"
FT                   /translation="MYDFKYQKPAAVDDAVKALAADPEAKALAGGMTFIPVLKQRLAKP
FT                   SAVVDLAGLGLSGIRREGNTLVIKAMTTHREVATSKDVADAIPALAHLASHIGDRQVRY
FT                   RGTIGGSLANNDPSACYPSAVLALGATIRTTKREIAADDYFQGMFTTALEPDELITEVS
FT                   FPIPEKAAYEKFPNPASRYAMVGVFVAKNAGGVRVAVTGAGNNGVFRHTAMEQALSAHF
FT                   APDAISGVKTPEEDMSSDIHASAAYRAHLVGVMARRAVAACG"
FT   gene            85538..86461
FT                   /locus_tag="Acry_0078"
FT   CDS             85538..86461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0078"
FT                   /product="coenzyme PQQ biosynthesis protein B"
FT                   /note="TIGRFAM: coenzyme PQQ biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29307"
FT                   /db_xref="GOA:A5FUM5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011842"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUM5"
FT                   /protein_id="ABQ29307.1"
FT                   /translation="MKIIILGAAAGGGFPQWNCACGNCARARCGDPAAKPRTQAALAVS
FT                   VNDSDYVIFNASPDLRGQILATPALQPRSGLRDSPIAAAVLTGGDVDFTAGLLNLREGH
FT                   RFGLYAGRRIFDLLGDSQIFRVLDAGLVPRRELPVDVPTRLANGAGQDLGITVEAFVVP
FT                   GKVALYAEDVSRADFGSSEGDTIGLRIADDHGRAFFYIPSCARVSEDVARRVRGAALVL
FT                   FDGTLWHDNEMIEAGLMPKTGARMGHISVSGPEGSIAAFAGLDVARKVFVHVNNSNPMI
FT                   LDDTPERAEAERAGWIVAHDGMEIVL"
FT   gene            86458..87198
FT                   /locus_tag="Acry_0079"
FT   CDS             86458..87198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0079"
FT                   /product="coenzyme PQQ biosynthesis protein C"
FT                   /EC_number="1.3.3.11"
FT                   /note="TIGRFAM: coenzyme PQQ biosynthesis protein C; PFAM:
FT                   TENA/THI-4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29308"
FT                   /db_xref="GOA:A5FUM6"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR011845"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUM6"
FT                   /protein_id="ABQ29308.1"
FT                   /translation="MTVLMSPDELEAALRAVGAARYHNRHPFHQLLHGGKLDKRQVQAW
FT                   ALNRYCYQAAIPIKDATLIARTDDSELRRIWRQRLVDHDGTQPGEGGIVRWLALAEGLG
FT                   LDRDMVISERRALPATRFAVRAYVDFVRDRSLLEAVASSLTEMFSPTIISERVSGMLAN
FT                   YDFITRETLAYFNARLDQAPRDADFALDYVKRHARTPEQQQAAIAALTFKCDVLWAQLD
FT                   ALHHAYVSPGLIPPGAFGHDGIWS"
FT   gene            87195..87470
FT                   /locus_tag="Acry_0080"
FT   CDS             87195..87470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0080"
FT                   /product="coenzyme PQQ synthesis D"
FT                   /note="PFAM: coenzyme PQQ synthesis D"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29309"
FT                   /db_xref="GOA:A5FUM7"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR022479"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUM7"
FT                   /protein_id="ABQ29309.1"
FT                   /translation="MTLTADSVPHLPRHVRFRFDAARNCHVLLAPEMVIMPDAIAVAIL
FT                   DAVDGIASVGVIADTLAARYEAPREAVLADCIEMLNDLARKGMIAS"
FT   gene            87467..88588
FT                   /locus_tag="Acry_0081"
FT   CDS             87467..88588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0081"
FT                   /product="coenzyme PQQ biosynthesis protein E"
FT                   /note="TIGRFAM: coenzyme PQQ biosynthesis protein E; PFAM:
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29310"
FT                   /db_xref="GOA:A5FUM8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR011843"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034481"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUM8"
FT                   /protein_id="ABQ29310.1"
FT                   /translation="MNDLAPATVNATRHAPAPPLAMLMELTHRCPLKCPYCSNPLAMDR
FT                   ARDEMSTETWKRVISEAAALGALQGHFSGGEPMVRDDLVELVRHAHREGLYTNLITSAV
FT                   LLDKRRMDELAEAGLDHVQISFQGSETALADHIAGLRHAHVKKLAAARLVRGAGLALTV
FT                   NAVMHRRNLHQLPAMLDLAVEAGAQRIEVAHVQYYGWALKNRAALIPTRAQLDEATRIV
FT                   EVARQKLEGVLNIDYVVPDYYASRPKACMGGWARRFFNVTPSGKVLPCHAAETIGHLHF
FT                   DTVQEKSLAEIWAHSEAFNVYRGTEWMPEPCKGCDRAEIDWGGCRCQALALTGDAAATD
FT                   PACGLSPHHAMMKELAVAESAAGAEDFAYRMIS"
FT   gene            complement(88570..89400)
FT                   /locus_tag="Acry_0082"
FT   CDS             complement(88570..89400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0082"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase, substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29311"
FT                   /db_xref="GOA:A5FUM9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUM9"
FT                   /protein_id="ABQ29311.1"
FT                   /translation="MDKRDSHGKAGNGGRHKLPRGPHPHRRPQGDAPRDRRPASSAGGL
FT                   WLYGLHSVEAALANPARRLRRLVVTEEGEAALAGRLPHPWPIQPERIERDRLDQMLGRG
FT                   IVHQGVALQADPLVPPSLNDALKRPGPVLVLDQITDPRNVGAILRSAQAFGAAMVIAQE
FT                   RNAPEEGGALAKAASGALERIPLLRTVNIARALIALKAAGLWVMGLDAAGLSHLSRDAI
FT                   GNRRAALVLGAEGEGLRRLTRETCDELVSLPMPGGMESLNVSAAAAVALYEIIR"
FT   gene            89466..89551
FT                   /locus_tag="Acry_R0003"
FT                   /note="tRNA-Tyr1"
FT   tRNA            89466..89551
FT                   /locus_tag="Acry_R0003"
FT                   /product="tRNA-Tyr"
FT   gene            89808..90368
FT                   /locus_tag="Acry_0083"
FT   CDS             89808..90368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29312"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUN0"
FT                   /protein_id="ABQ29312.1"
FT                   /translation="MSEILDPRYYRLVAPVNVWVCIGRARAERSGGRAGAMHPIYLAAG
FT                   LLPGDELVEYWREAFVVFAEGMERWPVQFETPFDRDEGIRNQPTVGKSVPEGIRQFCLR
FT                   PLPGGPRHRAQEQAPADQNRHPVQASRVVRLDPDVEGNQARMFRSPVMATQYLAGTLLG
FT                   LRLTGQFRPDIAHHAPKRWLAAS"
FT   gene            complement(90445..93444)
FT                   /locus_tag="Acry_0084"
FT   CDS             complement(90445..93444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29313"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUN1"
FT                   /protein_id="ABQ29313.1"
FT                   /translation="MLIGAAALYGPRLISGDYHRGAIERLASGVVGRPVYIEGPITLSL
FT                   LPDPQLVAENVIIGGPHGAQVTTAVLKLDLAPGPLLLGRLRATRLALQHPYITLPWPLP
FT                   GGAEALAPPPWLGSLHATLHDGTFRIGPLRLDHANLSIFTGGPQAVISASGTTMLGKTP
FT                   AAIALRVDDTGSDGPAPMTAELKLGKDALTTLSFHGALGHDSRLEGVIDIAADKKAVSE
FT                   LLPELQKSSAPLHVTGQLAATGHLAAFENVSAQFGSAQVEGQGALALVPAPLLRITAKG
FT                   DGLDLGIAAALLARIRSVVPVAANLDVSGTVAGVPIAKANALVLADDRSLRAQSLTATL
FT                   PGNAELGFAGALGPAAAGHFSLRAPDPAATVAALRPLLPFLPSWPARAGPLDVDGRMTL
FT                   GPDGTISLDDLQGKEAATAAIPAFTGAARITPAGDRAHIVARLDLTRLTLDHLLLDHLA
FT                   VALSSAKPRYDGSVQITARQLAVPAATKGAKPEIEATDLLVDASLHDAAIGGGVHIRLA
FT                   SAHLGRGLLLGRGLRKANGDVIGARLFLAGPDAQNTMTALARILGLPDRWATHQALRQP
FT                   FSLAIAADGAEKALATTWALRLGSLNAAAAPVIDLTNRSVVGPITLRAPNAVALIRSLG
FT                   GANLLGEHAGLGWPGPGSASLRAAGFFVGGHMGLSDFVASLGALTISGRINADLADGPP
FT                   QISGRIAADTLAVPAPPALEGAARAALGSGLRVNFPILSAARVERFGETVARHASFSLA
FT                   LDQGKLAPRIAVTLNRAEVVGGRLSGRAILTGAAGSTPATLSLQASLTGARASAVASIA
FT                   ATHGLALPLSGGTVDLGANLMAQGDSGRAWQRSLAGSLTASSHGITISGLDLAGVGQTL
FT                   GAAIQAPHPVGPIATAHALRGLLGKGTTTFNLLDLTATIGQRTVRLDHAALSGPAGELA
FT                   AAGDLNLAQDHLNLTLAARPAVSQAKTVPSLSMTIAGPAAHPGSRIDVAAAISWIHDML
FT                   ATTETSSATH"
FT   gene            complement(93545..94156)
FT                   /locus_tag="Acry_0085"
FT   CDS             complement(93545..94156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0085"
FT                   /product="Nicotinamidase"
FT                   /EC_number="3.5.1.19"
FT                   /note="PFAM: isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29314"
FT                   /db_xref="GOA:A5FUN2"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUN2"
FT                   /protein_id="ABQ29314.1"
FT                   /translation="MDSRTALLVIDVQTDFCAGGALAVPNGDVVVPVINALARHYQTVV
FT                   ITQDWHPADHVSFASQHPGRSPFETIPLVYGTQVLWPDHCVMDSPGAALHRDLHIPHAA
FT                   VIQRKGLNRLIDSYSAFLEADRTTRTGLDGWLAARGIERVDLCGLATDYCVAWSAQDAR
FT                   RFGLEARVIEPACRGIDLDGSLAAAWQAMTAAGVARIAAV"
FT   gene            94285..95037
FT                   /locus_tag="Acry_0086"
FT   CDS             94285..95037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0086"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29315"
FT                   /db_xref="GOA:A5FUN3"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUN3"
FT                   /protein_id="ABQ29315.1"
FT                   /translation="MAHFGRVAGKTALVSAAGQGIGRAIAEALIREGAQVIATDRDPKL
FT                   LDGLTGAETVQLDVLEDTSIRALASSLGKIHILVNAAGFVAHGSVLECSERDWAFSFDL
FT                   NVTAMFHMIRAFLPGMLEGGGGSIINVASAAGSIKGVPNRFAYGASKAAVVGLTKSVAA
FT                   DYVTQGVRCNAICPGTVESPSLRGRIAALAAARKVDEAVIEAEFIARQPMGRLGMPEEI
FT                   ASLALYLASDESRFTTGVAHVIDGGWSN"
FT   gene            95049..96830
FT                   /locus_tag="Acry_0087"
FT   CDS             95049..96830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0087"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29316"
FT                   /db_xref="GOA:A5FUN4"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUN4"
FT                   /protein_id="ABQ29316.1"
FT                   /translation="MSSTPKRLRSTQWFDNPDNPGMTALYLERYLNYGLTREELQSGKP
FT                   IIGIAQTGSDLSPCNRHHLELAKRVSDGIRAAGGVPIEFPVHPIQETGKRPTAALDRNL
FT                   AYLGLVEVLYGYPLDGVVLTTGCDKTTPAMLMGAATVDLPSIVLSGGPMLDGHFEGELV
FT                   GSGTVVWEARRRLAAGQLDYDKFIDMVAGSAPSVGHCNTMGTASSMNAMAEALGMSLPG
FT                   CAAIPGPYRERAQIAYETGKRIVAMVHEDLRPSKILTRKAFENAIVCASAIGASTNCPP
FT                   HVIAIARHIGVELDIKDWDRIGYEIPLLVNMMPAGKYLGESYYRAGGLPAVIGELIRQG
FT                   KFHADALTVSGRSMGEENAGKRSIDADVIRSFDDPLAEHAGFAVLSGNLFSSAIMKTSV
FT                   ISEEFRDRYMRRPGDEDAFEGRAIVFEGPEDYHHRINDPTLNIDENCILVIRNCGPIGY
FT                   PGSAEVVNMLPPDALVRQGVNQLPCIGDGRQSGTSGSPSILNASPESAVGGGLALLKTG
FT                   DVIRVDLKDRSANILIDEADLAARRAALTLPDLVNQTPWQEIHRRFTGQLETGAVLENA
FT                   PQYQRVAERFGVPRDNH"
FT   gene            complement(96885..97679)
FT                   /locus_tag="Acry_0088"
FT   CDS             complement(96885..97679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29317"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUN5"
FT                   /protein_id="ABQ29317.1"
FT                   /translation="MNRVAGWIGTRLARFLSAPTHGHAIAPATDIGQLVACLQPADVVL
FT                   VEGHSRFSIAIKYLTQSTWSHVALYVGLRRRLPDTPPEPCFIEADVVEGVRMVGLEAFR
FT                   DYHLRICRAVGLSESERQRVIDFALSRRGARYDLRNVLDLLRYMIPTPPVPVHLRRRLI
FT                   AFGAGDPTRAICSTLVAQAFQSVLYPILPMIGPNDSHAHDCDICVAEILRVRDHQLFVP
FT                   RDFDVSPYFEVVKPSLVGNPGAIEAARDALRGPDGTGRRLWR"
FT   gene            complement(97812..98225)
FT                   /locus_tag="Acry_0089"
FT   CDS             complement(97812..98225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0089"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cu(I)-responsive transcriptional regulator;
FT                   PFAM: regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29318"
FT                   /db_xref="GOA:A5FUN6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUN6"
FT                   /protein_id="ABQ29318.1"
FT                   /translation="MTRTEITIGEAAARSGVSAKMIRHYERIGLITPPLRGEANNYRFY
FT                   DERLVHELRFIHRARDLGFAIVDIRALLSLWRDRNRPSRDVKAIAVAHIAELEAKAAAL
FT                   HSMSAELRRLVESCHGSDRPDCPILEELANPGS"
FT   gene            complement(98250..101312)
FT                   /locus_tag="Acry_0090"
FT   CDS             complement(98250..101312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0090"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29319"
FT                   /db_xref="GOA:A5FUN7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUN7"
FT                   /protein_id="ABQ29319.1"
FT                   /translation="MKNLTTLFIRRPVLSIVVSAAILVLGLRALAGLPVLEYPKTENAT
FT                   ITITTTYPGADPNTIAGFVTTPIEHAIAQVNGIDYMTSQSQTSTSTIKVFLILNYNPDK
FT                   ALTEIQAQIQSVLNQLPSGTQQPQLKLQVGQQLDAMYIGFKSNVLSPNQITDYLTRVVQ
FT                   PQLQSVPGVQTAEILGAQNFAMRIWLEPAKLAAYGLTATNVYDALAGNDFISALGNTKG
FT                   TMTQDTLTASTSLHSAAAFRRLIVKQSGGAIVRLGDVARVKLGSDSYDAEVAFDGKPGV
FT                   YIGIQVAPAANLLSVISGVEKRFPEIQKQLPAGLDGAIVYNSAAFVNASIHEVVAALIE
FT                   ALLIVVLVVFAFLGTPRSVFIPVIAIPLSLIGTFAAMLMLGFSINLLTLLALVLAIGLV
FT                   VDDAIIVVENVNRHLDNGETKLHAAINAAAELANPIIAMTVVLAAVYVPIGFQSGLTGA
FT                   LFTEFAFTLVSAVTVSAIIALTLSPMLSSRLLHHIPRDGTDWEARLVHFIDKLFNTVHR
FT                   RYMRMLRGSLRTLPVTLVFGAIVLGSIYFLAAGAKSELAPQEDQGVVILSSTSAPNATL
FT                   QQKLLWDRELNRLMMSHKSVGHTFQFETPTFAIAGMVLKPWTERTKSATALQNEIQKQA
FT                   AEGVAGQQIVAFQPPPLPGSQGLPVQFVIKTTDPFSALNGVAQKVLAGALKTGKFIFLQ
FT                   SDLKIDQPQATVVINRAKAATLGLDMSQVGAAMAQALGGLYVNYFSLDNRSYKVIPQVT
FT                   QASRLNVSQLLDYPVANINGVPIPLGAIATIRNEVIPESVNHFQQLNAATIQGVAAPGV
FT                   STGEAVKVLQQIAAKDLPSGYEVDYGGPMRQFIQQQGGFLATFGFAVIVIFLALAALFN
FT                   SFRDPLIILVSVPMAIVGALIFIYLGFGLSLNIYTEVGLVTLMGLISKHGILIVEVANE
FT                   AQLAGMTKREAIEHAVGIRLRPILMTTAAMVLGVLPLIIASGAGAAARFNMGMVIAAGL
FT                   SIGTLFTLFVLPAVYMVVGQKHRTEDEVSHG"
FT   sig_peptide     complement(101217..101312)
FT                   /locus_tag="Acry_0090"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 32"
FT   gene            complement(101322..102506)
FT                   /locus_tag="Acry_0091"
FT   CDS             complement(101322..102506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0091"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29320"
FT                   /db_xref="GOA:A5FUN8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUN8"
FT                   /protein_id="ABQ29320.1"
FT                   /translation="MTAPAPGTASETPEHKTKKPSILLRMIVMLVLAALVLGAIFGFGA
FT                   FRDVMIAKFIATLKNPPQTVATMVAKETPFQNTETATGSLVALQGAALSAQVAGIVNTI
FT                   DFRSGQDVNKGQLLLTLRPNNDDAVLAQLEATAKLDAITYRRDLAQYQARAVSAQTVDT
FT                   DRANLASAEAQVRSQKALMQEKRIYAPFSGRIGIRAVDIGEFLAAGTTIATLEQLNPIA
FT                   VDFYLPQTALRTIRPGMKADISVDGFPGIEFKGKITALDSAVGTATRMIQIRAVLTNPH
FT                   EELRPGMFARVSIDVGAPQNEITLPKTAIAYNPYGDTVFLVKPDKRSKTHKSAEQVFVT
FT                   LGQTRGDQVAVLKGLKSGDEVVVAGQMKLKNGTPVAINNKILPQNLPNPSVPNE"
FT   gene            complement(102503..104176)
FT                   /locus_tag="Acry_0092"
FT   CDS             complement(102503..104176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0092"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29321"
FT                   /db_xref="GOA:A5FUN9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUN9"
FT                   /protein_id="ABQ29321.1"
FT                   /translation="MNFNIKSASFRYLDASAENSVVSTCPLRRLPRAGWRFCPRSVQAR
FT                   QVLHIMNFSDILLHRRVRLATVLLGTTLLAGCAVGPNYHQPAAPKLHSYTTSRLPNSTA
FT                   STSGAGGTAQHLVIGQKIAGEWWTLYHSKPLDTLIRKALANNPSLKSAQYTLLAARDTA
FT                   RAAEGGFFPSISGSFQAERVRSGLGTTGLGSAGAGLTYSLRNASVAVSYAPDVFGGTRR
FT                   QVESLHAQAEQQRFALEATYLSLTANIVTASVTEASLTAQIEATERIIRAEKGLLDILD
FT                   RQVALGGIPETNAITQRTQLAQTEATLPPLRKQLAQTRDQLAAYEGVPPSRFHAADFTL
FT                   ADLALPESLPVSLPSALVRQRPDIREAAAVLHQDTAQVGVATANMLPQITLSAGIGHEA
FT                   LDGQALFAPQTLLWNLAAGITQPFFEGGTLFYKRRAAVATMKAAAETYENTVVLAFQNV
FT                   ADALEALHYDAIALAADTAAEHDAQRSLNLIERQFRLGGVPYTSVLTAEQTYESAVITR
FT                   IKATAQRYADTAALFQALGGGWWHRHDVKKQVETCCGVLP"
FT   gene            104218..104907
FT                   /locus_tag="Acry_0093"
FT   CDS             104218..104907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0093"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29322"
FT                   /db_xref="GOA:A5FUP0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUP0"
FT                   /protein_id="ABQ29322.1"
FT                   /translation="MGIVTRVCRRRDAADAARQRRDALIETAERVFLRKGYHAATMDDI
FT                   AAEAGMSKRTLYQLVDSKEDLFTALLERRRRPLDVSGIETEGRPVDDVLNDMLRLWAHH
FT                   VLSPSIIALARLIMAEYMHGRTLSRLLDREGAKPCRDALRDYFSASAASGSLAIDDPEE
FT                   AAHMLYGMAIGNIHIEMLLGIGKARSRAEIDARIARAVGLFLGGARPSGRVGSDVPAQV
FT                   RETMAQS"
FT   gene            complement(104863..105732)
FT                   /locus_tag="Acry_0094"
FT   CDS             complement(104863..105732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0094"
FT                   /product="transcriptional regulator, PaaX family"
FT                   /note="PFAM: PaaX domain protein; PaaX domain protein,
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29323"
FT                   /db_xref="GOA:A5FUP1"
FT                   /db_xref="InterPro:IPR011965"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUP1"
FT                   /protein_id="ABQ29323.1"
FT                   /translation="MNHHVAALVARLHEQPSHTGSLIVTLFGDALLPRGSAIALATILD
FT                   LFESLGIGPGVIRTAISRLAADGWLVASRRGRSSYYRIGPSRRGEFIRAARHIYGRPRG
FT                   TAARSLIIALPEPGPGREPARERFNRLGFASWQGILLAPDRPLPRSLEAGSIVLRATGG
FT                   PESLRRLAARAWRLDALCDHYKGFLAIFGGLTADAPAFDPRDALLARLLLIHDYRRIVL
FT                   RDPRLPATFLPEEWAGDGARRLCAQLYEALLDASELWLSHNGATETGALPTADSTLRHR
FT                   FADLRGHV"
FT   gene            complement(105939..106820)
FT                   /locus_tag="Acry_0095"
FT   CDS             complement(105939..106820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0095"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29324"
FT                   /db_xref="GOA:A5FUP2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUP2"
FT                   /protein_id="ABQ29324.1"
FT                   /translation="MAWTDIARQRYCRAGLRYASALTNAEWALIEPFMPLPPHRGRPRT
FT                   VALRRIVEAIFYMLATGCQWRRRLKVPPAEQVECRRRWQIPKEFAPFTTVLGYFYRFCR
FT                   DGTLDRINHVLVMQAREMARRQASPTAGVIDSQSVKTTEAGGPRGFDAGKKIKGRKRHI
FT                   ITDTIGHHVGAVVHHAGIQDRDGAPDVLRSVKSLYPWLRHVFADGGYAGPKLKGRLTKI
FT                   GKWTIQIVKRSDAASGFVLLPRRWVIERTFAWLSRCRRLAKDFEATVTSATAWLFLVVW
FT                   QHGYNTGGRTRN"
FT   gene            complement(107093..107329)
FT                   /locus_tag="Acry_0096"
FT   CDS             complement(107093..107329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29325"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUP3"
FT                   /protein_id="ABQ29325.1"
FT                   /translation="MRLFLHIGAYWLMWSLRSLMPRRSRWRGIQFDTLRLRLIKLAVRL
FT                   ETLKRSIRLHLPRSMPDQGILGYAPARLPRLVS"
FT   gene            complement(107462..108439)
FT                   /locus_tag="Acry_0097"
FT   CDS             complement(107462..108439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0097"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29326"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUP4"
FT                   /protein_id="ABQ29326.1"
FT                   /translation="MPATVETTPCLPGLSPVAGKPVLARFDGEMLSSDGGLLALREVEK
FT                   RLGIAAQLAACIDDPRTPEGVQHGLDEIIRFRMLMIAAGYEDGNDADRLRNDPMFKLAM
FT                   ERLPEAGDLCSQATVSRTENLPGPRALLRMGLAMVEHYCASFRTIPNRIVLDIDDTFDA
FT                   AHGAQQLCLFNAHHNEYGSQPIVVFDGDGRMLAAVLRPACRPKGAQIVKWLRRLIDAIR
FT                   GHWPRTAIMLRGDSHFCTPAVLRFCRARRLDYIFGVARPRRCANTSSRWRPAPRRARNR
FT                   LRERKSGGSKSSMMAQQAGTASSGSSPASRPGRWGAIPASSSPA"
FT   gene            108572..108994
FT                   /locus_tag="Acry_0098"
FT   CDS             108572..108994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0098"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29327"
FT                   /db_xref="GOA:A5FUP5"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUP5"
FT                   /protein_id="ABQ29327.1"
FT                   /translation="MVDGLKGGPEAITAVFPETIVQTCIVHLLRNSMDFVSYKDHKAVA
FT                   TALKDIYRTGPLMPKPPRPLSPPSTPVHGGQKYPDIGQSWRRVWQEVIPFFSFPGEVRR
FT                   IIYATNAIEALNSKLRRAIPARGHFPAMRPRPSCSI"
FT   gene            complement(109068..109578)
FT                   /pseudo
FT                   /locus_tag="Acry_0099"
FT   gene            109937..110284
FT                   /locus_tag="Acry_0100"
FT   CDS             109937..110284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29328"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUP6"
FT                   /protein_id="ABQ29328.1"
FT                   /translation="MERFVLTDAQWARIEPHCLGKASDPGRSGRDNRLFLEAVLWIVRT
FT                   GSPWRDLPSMFGNWSTAYRRFNDWRRADVFKRIFDAVSDEPDMEYAMVDATIVKVHRHG
FT                   QGAKGGLKARP"
FT   gene            110302..110688
FT                   /locus_tag="Acry_0101"
FT   CDS             110302..110688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0101"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29329"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUP7"
FT                   /protein_id="ABQ29329.1"
FT                   /translation="MTTKILALTDALGNLVRFRLMPGNRYDSIEVPPLIDNVEFGGLIA
FT                   DKAFDSNALVAELNERGARIVISQHPARALKLKIDHETYKWRHLIENFFCKLKEFKRIA
FT                   LRACKTDQSFQPMIHLAAAVINSR"
FT   gene            complement(110707..111912)
FT                   /locus_tag="Acry_0102"
FT   CDS             complement(110707..111912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0102"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29330"
FT                   /db_xref="GOA:A5FUP8"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUP8"
FT                   /protein_id="ABQ29330.1"
FT                   /translation="MIQFSARVGRTRPAATFAMAARARALRAAGHDVISLSIGEPDLPT
FT                   PPHVVDAAHRAALGGQTRYPPIAGTDALRCAAARKFERDQGLPATPADVLVTNGGKQAI
FT                   FDAVMSVIDPGDEVLIPAPCWAGYIQVVEFAGGIPVFIDCPAEAGFRVDAATLAAAIGP
FT                   RTKLLVLNYPNNPSGAIADAAMLIGIADVLRRHPHVLTISDDIYEHLIFEGAYLTLAAA
FT                   APDLAGRVLTMSGVSKSYAMTGWRLGFCTGPRDWLAAMTLVQGTATAGVSTISQAAAVA
FT                   ALDGPQDLLEERRTIYRRRRDLVLGALAGAPGLTCSRPEGAFYAFPSITSLLGCRTPSG
FT                   RILGNDEDVANALLDEALVATVPGSAFAMPGHIRLSTAASDALLEEACERILRFCITTC
FT                   NH"
FT   gene            complement(111944..114145)
FT                   /locus_tag="Acry_0103"
FT   CDS             complement(111944..114145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0103"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29331"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUP9"
FT                   /protein_id="ABQ29331.1"
FT                   /translation="MLDQVASAPALHENMTNAADVIAAGVALDAGNTRECARKLFQQAS
FT                   ELAPSWDEPLIRLAQSYRADGHVAEAKELYIQASIRNRWRIEPLLAYGILALQSNDPHD
FT                   AVGYLSRATDLNPTNHQAWHGLALALGALGLQGAALRAMANAGNLAPDILHYAITYNEL
FT                   RDTVDHDLILQIREPKWTTAIELCLEANAALRRGGAEEAIALLETAIDVEPDASDILAL
FT                   LGNAYLANQMPEMAELHLRKALLRAPENIDIANDLAVALGRQYRFGDASDILNKLDIPA
FT                   NASSTILLNRATIRASAGDLAGSARDIKAATPKANDRSRLRAECSLIPYQSNATAELLL
FT                   DSTRKLAATLPEDCEPLMKPSVVDPDRPLRIGLLSHSLRQHPVGWLTFAGLENLDRDAY
FT                   ELYCFGHFAAGDPFAQRLARRVHKWQDRITKYEAEIASNIADCNIDILIDLSGFGDNGL
FT                   IGSLAYRPAPVQIKWVGSQASTTGMKRVDWFITDRWETPEGFDQYYTEQLLRLPDGYVC
FT                   YSPPPTSPPVSNLPALANGHVTFGCFNNLTKLTDETLSLWGRILEQVDNAHLLLRCPQF
FT                   SEDGIPERFISRAHALGVDTSRVELRGRAPHPEFIEGYKDVDIALDPFPYSGGLTTCES
FT                   MFMGVPVITLAGDFFAARHSVSHLSNVGLTDCVTESPEQYIDRAVAMSSDLEALAARRA
FT                   RLREQMLTSPLCDAKRFGRNLGAALRYAWQDYCRNGCRA"
FT   gene            complement(114138..114929)
FT                   /locus_tag="Acry_0104"
FT   CDS             complement(114138..114929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0104"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29332"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUQ0"
FT                   /protein_id="ABQ29332.1"
FT                   /translation="MSDLHSNSQLQPAVRGDNSSVNRVLFARVRQLIDQGQVNAASLLL
FT                   PTLEKRGENPGTIVALSAAIEFVKGRHARAKEIVSDGLAAFPENSIILCFSAEISLEEK
FT                   NWVEAAKAASEAVVADPRNSTAKSILGRALLELGHIDDAATCLREVLDEMPANFLALAG
FT                   LCRSAPAEAEDTLRNILRDGDEEHSDRPQDDLRLRHLLISVLIERGAYTEATDQIRRLV
FT                   AEGRADLDTSLLAVQAAVGTGNWDEATLLFSDNTRSLPRHA"
FT   gene            complement(114995..115867)
FT                   /locus_tag="Acry_0105"
FT   CDS             complement(114995..115867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0105"
FT                   /product="protein of unknown function DUF1217"
FT                   /note="PFAM: protein of unknown function DUF1217"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29333"
FT                   /db_xref="InterPro:IPR010626"
FT                   /db_xref="InterPro:IPR023157"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUQ1"
FT                   /protein_id="ABQ29333.1"
FT                   /translation="MSSTLSPNIATLFTSSVNTTSSSIASILEASYGGATSGTVTSSQN
FT                   PIIALRIAQQNETKDIQAEAKSPQVQRDIAAFTKAVNSAKTAKQLLQNPTVLKVLLTAN
FT                   GLGSQVGFPALAQKALLSNPSDPNGLANQLSSTNSQWLSTAQIYQFATKGLSIIQKPSS
FT                   ISTLTNAYAEVLWRQSLDKQTPGLSNALYFIQNAQKFTNATQILGDSVMRSVVTTALGV
FT                   PQQIAFQPLLAQEQAITSRLDVSKFQNKQFVQSFADRFLAVTQASNMNAYGSSSSLVGL
FT                   AAQARSLIA"
FT   sig_peptide     complement(115790..115867)
FT                   /locus_tag="Acry_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.779) with cleavage site probability 0.668 at
FT                   residue 26"
FT   gene            115953..116216
FT                   /locus_tag="Acry_0106"
FT   CDS             115953..116216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29334"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUQ2"
FT                   /protein_id="ABQ29334.1"
FT                   /translation="MIICLLKNVIRNRNDLRPKWCRQRIEWIEICSENRLPEPAGSCQC
FT                   SCTTQIIVGRTEHRTHSAEHFGILLTLTSQLIGGFIGLEGLC"
FT   gene            complement(116241..116639)
FT                   /locus_tag="Acry_0107"
FT   CDS             complement(116241..116639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0107"
FT                   /product="Flagellar biosynthesis regulator FlbT-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29335"
FT                   /db_xref="GOA:A5FUQ3"
FT                   /db_xref="InterPro:IPR009967"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUQ3"
FT                   /protein_id="ABQ29335.1"
FT                   /translation="MSVLVLELRQGDIMILNGAPIRFRTKSRIELTAKARFMFGKQILR
FT                   PDEVNTPAKQIYFALQTAYIGTDEERQSALVRARELIEQFKEATTSALAREILDRALEC
FT                   AKSDDCYEALKLSRRIMRHEAAVLQSCQ"
FT   gene            complement(116711..117595)
FT                   /locus_tag="Acry_0108"
FT   CDS             complement(116711..117595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0108"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29336"
FT                   /db_xref="GOA:A5FUQ4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUQ4"
FT                   /protein_id="ABQ29336.1"
FT                   /translation="MSGVVSSIITNSAAMVGVETLNSINTSLNNVQNQISTGYSVSSAV
FT                   DNGAAFAVAQSVRTNMAGLTAANQQLGDTQGLLATTNTALTNISNLMQSMDATLVNLSS
FT                   STISTSQKSQYVAQFSSQLQNLQYYIKGASYNGKALIGASSGTLASSSSSFTSKALQVS
FT                   SDASGGQIKIAAQSMTTVYLALSKIGTSLGTASAGSTTITNWMTAGGTFSTQVSNVGSY
FT                   LNTYGNLTNQVDAQITYNQNKMDALSNGLGALVDANMAAESAKLQSLQIQQQLATSALS
FT                   IANQQPSILTKLI"
FT   gene            complement(118749..120206)
FT                   /locus_tag="Acry_0109"
FT   CDS             complement(118749..120206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0109"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="TIGRFAM: flagellar hook-associated protein FlgK;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29337"
FT                   /db_xref="GOA:A5FUQ5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUQ5"
FT                   /protein_id="ABQ29337.1"
FT                   /translation="MSVGTGLAIASSGLSAIDQQLAVVSQNIANANTSGYSVETANLSA
FT                   ATAGGQGSGVISAPATRQVNTSIQTQVNNSIAQQSYQAVISTTLSGIDQVMGTPGQGND
FT                   LPSLLANVQSGFQTLMTDPSNVVQQNTVVSAAKTLTGQINSIASTLQSAGQSAASTITA
FT                   DIKKLNSTLGTIGSLNAQIVNLAQQNKSTADLANQRDAAIQTIASLTGAKALTQTNGSI
FT                   ALFTVNGIQFPLNGSSPITATTTTNNTSYSIGGTPVTFGGELGGAQQLINATLPQIQAG
FT                   LDSFSQALSSRFAGAGLSLFTDPIGNVPTAATKGLSAVITVNPAVISNPALVRDGNVTV
FT                   TNASGTPIPPNPAGGPAGYTALIQNVLNSAFGTTTVGGSAQPPAITAYTDATGTVSLPY
FT                   SGSGSLSAIATNFTANEASISSAALTQVSNVGNLVTALKAQASSTSGVNIDQQMSLLVT
FT                   LQNAYAANAKTVTIAQQMWQAVQAMVQ"
FT   gene            complement(120249..121526)
FT                   /locus_tag="Acry_0110"
FT   CDS             complement(120249..121526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0110"
FT                   /product="flagellar basal body FlaE domain protein"
FT                   /note="PFAM: flagellar basal body rod protein; protein of
FT                   unknown function DUF1078 domain protein; flagellar basal
FT                   body FlaE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29338"
FT                   /db_xref="GOA:A5FUQ6"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUQ6"
FT                   /protein_id="ABQ29338.1"
FT                   /translation="MSIFGALDTSVSGLQAQSSAFTNISDNIANSQTIGYKGVNTHFTN
FT                   YLVQSTASNNGPDSVVANPEYTNTVEGTITQSSNPLSLAINGNGYFNVSLPGPTTTTAG
FT                   KTTQTFDAQQYYTRAGDFTLNSSGYLVNGAGAYLDGWSVNPTTGTVNTSSLAPIQVSQG
FT                   ASPPVPTSNVTLSATLPTTPSSTPVTTQVDVYDSLGNMQPLNLSWSPVTGSANTWTLNV
FT                   SSPNATPSTVGSATMAFNTNGTLSSITAGTGTTSPAAGQLQISPSYNGSAQPITLDFGA
FT                   PGSTAGLTQYAGTSLNLQGVSQNGSPSGAFSNLSIDTQGNITANYTNGFSKQIAQIPLA
FT                   SFASPDALQNKSGQIETATQASGAATINAVGGSGGALVTGSVENSNVDIATQFTDLINA
FT                   QQAYTANTKVVTAAQQILTTTVNMVQ"
FT   gene            complement(121659..122114)
FT                   /locus_tag="Acry_0111"
FT   CDS             complement(121659..122114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29339"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUQ7"
FT                   /protein_id="ABQ29339.1"
FT                   /translation="MAELGDWDAFPAACWDDDADAPARAALNEPEAALPAPQSALPCPA
FT                   LMVRVPETLAGPDESDVGTALVDAGAAVPHPEVAPAAALAVDVAGTAEMAVPMLMPPHM
FT                   QDIGQTKIRDERRLALHSRRQAGKICRAISMKPGRFCRVGNFNYGTE"
FT   gene            122185..123468
FT                   /locus_tag="Acry_0112"
FT   CDS             122185..123468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29340"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUQ8"
FT                   /protein_id="ABQ29340.1"
FT                   /translation="MRDRTASPPGAAYANAQGMAPVATEHGKAPNKSGHHDLARANAGP
FT                   SSGQAQQAQAVQTSQPTPVSAGLSAQASAALAVQALSSHQVADIAPQSDSHAPVVPGLA
FT                   RQVTPATDAKAQSVPVEGSAGSPGSATTGSSSQLAASSGSTTSGVPHSTIDSLAREAIG
FT                   RLQSAAGGQAHHTAAAGPSSSATAHASAETRISATSANSTVARQVQPAMSSAGPAPVVS
FT                   ISSSAVPALPGGGETNGAASSASSNSVSGQIAAALVGVSQIQPPQGSSSATPGTRLTIA
FT                   LAPPAIGTVTLQIDRHADGSLTVAIGASHADTLQQLQNDRNTLNQVLTQAGLPDTHRTV
FT                   TFDLIAPHADASGSHQASVGAGANGFGGGFSLAGGGPNGGSSGSEGSGRLPVYVRSPAA
FT                   AAGIAPAVDTVSSVPAVTLRRFGVNVVA"
FT   gene            123517..124278
FT                   /locus_tag="Acry_0113"
FT   CDS             123517..124278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0113"
FT                   /product="flagellar hook capping protein"
FT                   /note="PFAM: flagellar hook capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29341"
FT                   /db_xref="GOA:A5FUQ9"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUQ9"
FT                   /protein_id="ABQ29341.1"
FT                   /translation="MTSSVASVAYQQSQLTAAANAAAAGIGSSTSSSGTSGASGTSSTS
FT                   GTSGNSTTSALGALSSNYNDFLTMLTTQLQNQDPTSPMSSSQFTSELVQFSQVEQQIST
FT                   NQSLTQLLQLTQAGDLTQASSMLGSKVTATSSQLPLQNGTGTLNFTAPTSGPVAIAVYN
FT                   GAGQQILDTSMNATAGSNSWTWNGKDASGTTVPDGAYKVAVVEGGANGSTTTLPFTVTG
FT                   TATGVTSGSNSVSLQMGGVSVPFTAVTNVTK"
FT   sig_peptide     123517..123633
FT                   /locus_tag="Acry_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.774) with cleavage site probability 0.297 at
FT                   residue 39"
FT   gene            complement(124372..125823)
FT                   /locus_tag="Acry_0114"
FT   CDS             complement(124372..125823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29342"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUR0"
FT                   /protein_id="ABQ29342.1"
FT                   /translation="MRNISNQAGDVPARSATRKLRRAACAAGVISLFGLAPLAHAQSLG
FT                   DALRQTTFQGMIGAIHFDYANNGHTSKSTHSFAIGGHLIAHTGSFNGFSVGLGGYTAQS
FT                   LGLYSKNDTHYDSELTGSYFGIQSFRQAYLQYQTPKVEIRFGRQLIQTPYANQDYYTFN
FT                   PRAFMGVAGVVNVLGNGSDKVDAGALSLEDNPAAFSVFMTRMFDYESRYSSSFTAANRY
FT                   SGTKPTNGFIAIGARYHGDVGSMQLTAQAWYYDFYQYAQMVYGQLDVVQPLSNGQAIFG
FT                   AVQALTEGNSAGNSNNIAALTNNNVGSVNAHVYGAKLGYSFGDGSIALVGDYAPTEYNS
FT                   FHHGGVVHPYNDNTGTSFTDTMQTGIANLGPGYAYGVTTSYAFLNKKLKVDVSYIRYLA
FT                   RYGFGGDSRNYTYGGAYGFSSTNYIPNQQLWALDASASYDLSSVLKGLSVAEDTDIAQA
FT                   ENRAGYTQYNHNPYFSSRFYLEYNF"
FT   sig_peptide     complement(125698..125823)
FT                   /locus_tag="Acry_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 42"
FT   gene            complement(126107..127360)
FT                   /locus_tag="Acry_0115"
FT   CDS             complement(126107..127360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0115"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29343"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTD8"
FT                   /protein_id="ABQ29343.1"
FT                   /translation="MASSDIFTLGLGLTPPWRVVDQRLETDYQPHELHLAVAADPGARF
FT                   PCPTCGRLCKPHDWKELSWRHLNFFQHACIIEARVPRTDCPEHGVLRIAVPWARPDSGF
FT                   TLLFEQAALALMREMPVAAAARIIGVTDQRLWRILRYYVGRAIERLDLSGVEAIALDET
FT                   AAKRGHSYVTVFIDLDAAERPVLFVTPGKGKECMTAFRAFLAEHGGEARRIAEVVCDMS
FT                   AAFLAAAAESFPQASVTVDWFHVVQIFTTAVEQVRRAEAHQHNLPKGVRWATLKRPENL
FT                   TMAQRQALDQLENSGFATAEAYRAKEMLRWVRLAATPQAARWRLTNFLNHVTARLDDPD
FT                   HLLDPVRQAVDTVRRNAKRIIRRWKSGHSNARLEALNGLFQAARARARGYRNTATFACI
FT                   IYLLGAPINAMLDVFHST"
FT   gene            127815..129011
FT                   /locus_tag="Acry_0116"
FT   CDS             127815..129011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0116"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29344"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUR2"
FT                   /protein_id="ABQ29344.1"
FT                   /translation="MTRARVNSALVRRINSARLFHMIRQNPGISQQKLSQISGIDPATI
FT                   SIIINNLESGGIVRRDTDAPTGRAGRPTTALSLDPRAGYLAGISVEPDAIRIVISTIDG
FT                   TACADLAVPGSTAPEAAIAAARSGVTAALRSLRATRATLLAAGVAMPALVSTGGRIVFA
FT                   PNIGWRDLDVAENLAQKLKVPVRVENDVKAAALAEHLFGASRDIADFVYVMGRSGIGGG
FT                   LYLMGELYRGPHGLAGEIGHMKIVPGGRACGCGGQGCFEAYVSEKAILSDLAARGHGAR
FT                   DVASVRKACEAGDPVARAVLAEAGRHLGLALANLINIISPRRIVLGGSLAQLAPFLLPA
FT                   AMETLEANALAAIYRDVEIVVSEMSGSAAAMGGIALALQQFLDDPPVRLDRARPTPSP"
FT   gene            complement(129367..130599)
FT                   /locus_tag="Acry_0117"
FT   CDS             complement(129367..130599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0117"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29345"
FT                   /db_xref="GOA:A5FUR3"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR017830"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUR3"
FT                   /protein_id="ABQ29345.1"
FT                   /translation="MTRVHVIGAGMAGLSAATTLAARGCRVVLYEAAKWAGGRCRSYHD
FT                   AALGCRIDNGNHLLLSGNRSTMAYLRRIGAEETLTGPSRPLFPFIDLISGDAWTLRLNR
FT                   GRLPWWVLRRDWRVPGTDALDYLALRRLERAAVTDTVAGMLGGLGTLYDRLLEPLAIAA
FT                   LNTKPETASAAPLAAVVRESLARGGAATIPRMPKIGLSESLVDPALAFLRASGAELRFG
FT                   ARIAGLTMTDARVTGLVGPNVDEIVGSDERVILATPPWVAAELLPGLTVPDAHEAIINL
FT                   HFRAGIDPGPAGFYGLIGGTAEWVFEKPEVVSVTISAANDRLEQETDRLAAEVWSDLRR
FT                   GFGLPRAMPPWRVVKEKRATFAATPEQLARRPGSSTRLVNLRLAGDYTATGLPSTIEGA
FT                   IRSGESAAQHI"
FT   sig_peptide     complement(130534..130599)
FT                   /locus_tag="Acry_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.648 at
FT                   residue 22"
FT   gene            complement(130596..131468)
FT                   /locus_tag="Acry_0118"
FT   CDS             complement(130596..131468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0118"
FT                   /product="Squalene/phytoene synthase"
FT                   /note="PFAM: Squalene/phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29346"
FT                   /db_xref="GOA:A5FUR4"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017828"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUR4"
FT                   /protein_id="ABQ29346.1"
FT                   /translation="MFIPANAARFADDAATVAAATRAAGTSFYRGMSVLPAPRRTAMYA
FT                   IYTFCRIVDDIADEEAPLAAKREGLDAWRRRIDALPEGGDDPVTRLLRDASLRYALRRE
FT                   DFHAIIDGMEMDAGAPIIAPDMATLDLYCDRVASAVGRLSIRVFGEVSAQGDRVAHHLG
FT                   RALQLTNILRDVGEDAARGRIYLPREALEAADAAANPATLLADPGLKRAMAEIAGLAEQ
FT                   HFAEAAAAMRGCDRRAVLPARMMADAYRPLLGVMRAAGFAHPERRLSLPAWRKLRLAAE
FT                   LLIRTDRHR"
FT   gene            complement(131468..132304)
FT                   /locus_tag="Acry_0119"
FT   CDS             complement(131468..132304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0119"
FT                   /product="Squalene/phytoene synthase"
FT                   /note="PFAM: Squalene/phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29347"
FT                   /db_xref="GOA:A5FUR5"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017827"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUR5"
FT                   /protein_id="ABQ29347.1"
FT                   /translation="MSAAASIEHASGKDRGDENFPVGSWLIRAGLRRHVHAYYAFARNA
FT                   DDIADHPDLAPAEKIARLDAMEAVLDGDDPTRSPSAARLRESLAETNVDPVHARELLVA
FT                   FRQDATKTRYASWDELMRYCRYSAAPVGRYVLDLHGESRQSWPASDALCASLQVLNHLQ
FT                   DCAKDFDTLDRSYIPGDWLQAVGLGPDAVTAKATPPALRSVFDAMLKRTAELNAKAARL
FT                   PGFVVARGLRVETAIIVGLARRLHRRLLREDPLAGRVKLRRNDAISAVLAGLPRLL"
FT   gene            complement(132301..133428)
FT                   /locus_tag="Acry_0120"
FT   CDS             complement(132301..133428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0120"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29348"
FT                   /db_xref="GOA:A5FUR6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR017832"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUR6"
FT                   /protein_id="ABQ29348.1"
FT                   /translation="MTLLALLALLAWIYLYLLHGQFWQSGPELAPARPATAVPVDIIVP
FT                   ARDEAETIGAVVQSLLAQDYAGPFRVILVDDGSTDRTGDIAIRAANGDPRFALLRGGEK
FT                   PAGWSGKLWALEQGVAHGAAPVLLFTDADIVHDPRHLATLAARLVTPERGARLDMVSEM
FT                   VRLNCESAAERALVPAFVYFFQMLYPFARVNDPLDGTAAAAGGTVLIRREALERAGGLA
FT                   AMHGALIDDVTLAGRVKRGGAVFLGHSGLARSIRPYPRLADIRAMISRTAFTQLHYSGL
FT                   LLALTLAGLAVVWLVPPLALVFGHEVAALCGLIASLLAVLSYQPTLRRYGRGWYWGLAL
FT                   PLIALVYMEATLASALRYWRGTGAAWKSRDYGADA"
FT   gene            complement(133425..134510)
FT                   /locus_tag="Acry_0121"
FT   CDS             complement(133425..134510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0121"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; NmrA family protein; Male sterility C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29349"
FT                   /db_xref="GOA:A5FUR7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017829"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUR7"
FT                   /protein_id="ABQ29349.1"
FT                   /translation="MAGMSSDSSSPLETVARPIADDRPVLVTGATGFVGAAVARALVRH
FT                   GFRLRLMHRASSDMRNLAQLPGERVVGDLTDPNSLAQAVEGCAHIFHVAADYRLYVPDP
FT                   TAMRAVNIDGTIALFRAAQADGACRMVYTSSVAALGLTHDGSPADEATPHAAEDHVGPY
FT                   KRSKYEAELAVKKLVAEGLDIVIVNPAAPVGPGDIKPTPTGRMVLDAARGHMPAYVETG
FT                   MNIVHVDDVAEGHVLALTRGRRGESYILGGENLMLSEIGRMITRLAGKPPPRVKLPIGP
FT                   LMPVAALMEAWARISGHEPLMTRDMLTMARKRMFYSSEKAVRELGYHARPAEEAMRDAL
FT                   ADFCRRGLLPSLAFEPDGATA"
FT   gene            134658..135707
FT                   /locus_tag="Acry_0122"
FT   CDS             134658..135707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29350"
FT                   /db_xref="GOA:A5FUR8"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUR8"
FT                   /protein_id="ABQ29350.1"
FT                   /translation="MKSSVGILSCPSLLAERRVVIRRLGIWPAVFALVGLLLFTGTIAW
FT                   LGWGDVIRALERISLPGFIAYLGVQMVIIAGLALAWRLLLRRRYGGSFLLLYWGRMVRD
FT                   SAGEFLPFSHVGGFVIGGRAIALGGVAFADAAASTLADVTLEFLAELVFVGIGVILLVA
FT                   LVPDSALVLPMSIGLAMALVAGLSFLLMQKGMSRLFSGLAMRIAGQSADAASIGIQRLQ
FT                   SALDTIYARRGRLIAAGAMHLLCWFGTGVASFVAFRALGQNISLRDALAIEALLHAILS
FT                   TGFFVPGRLGVQEAAYTLLGAVFGIPPDIALSVSLLRRARDLLIAVPVLLAWQGIEARR
FT                   LQPVSGDLG"
FT   gene            135777..136031
FT                   /locus_tag="Acry_0123"
FT   CDS             135777..136031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0123"
FT                   /product="Transglycosylase-associated protein"
FT                   /note="PFAM: Transglycosylase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29351"
FT                   /db_xref="GOA:A5FUR9"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUR9"
FT                   /protein_id="ABQ29351.1"
FT                   /translation="MHLIGFIILGLIAGWIASQIVDNGGKGPILDIVLGIVGALVGGQI
FT                   FLALGFAPGGGFLYSLFVSVVGAVIILVAYHALLGRRRL"
FT   gene            136075..137256
FT                   /locus_tag="Acry_0124"
FT   CDS             136075..137256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0124"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29352"
FT                   /db_xref="GOA:A5FUS0"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUS0"
FT                   /protein_id="ABQ29352.1"
FT                   /translation="MVAREEGSAIGRLIRLDGLRGVLAIYVLVGHLVPFLPLPPLAMWA
FT                   AQGLVSHGLAAVDLFFALSGLVIVQSMTRFGRRPGSFLVARARRLLPVYMIVLVGSTLL
FT                   MLKGGSPFATMPWLAPGDPAADIWPAGPPQHPVFEILAHLVFLHGALPHRLLPDGPFAL
FT                   LGPAWSLSTEWQFYAVIALVALRCDGRDGTLVRLSLALIGLAVLARIYAACIPAPWRFS
FT                   RAFLPNEAAYFALGVAASRFWSGDRVGAWRLFVIMLIMTMALGASHGAGWGRLAKLLPP
FT                   LAWAIAVAAQRVPAWRPFRLLARCLGSPPVLWLGLISYPLYLVNEPVGRALALALGPIL
FT                   SGSPLLFGLCWGGATVAGSIILAAMLHYGIERRFLRRRRIVRPPVAVPATGGA"
FT   gene            complement(137216..138400)
FT                   /locus_tag="Acry_0125"
FT   CDS             complement(137216..138400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0125"
FT                   /product="HemY domain protein"
FT                   /note="PFAM: HemY domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29353"
FT                   /db_xref="GOA:A5FUS1"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUS1"
FT                   /protein_id="ABQ29353.1"
FT                   /translation="MLRAFRFALVAITLLGIAWFLAGLQGHVTVEIGTYAATASTPVAI
FT                   LLLVLLIVVVVLVLGLLRGALSLPRRISVRRGRARRDAADSAALRALSALAAGDTEAAA
FT                   GHARTARRHAPEAPLTLYVSAETARQAGDAAGAEALFSNLAKHGDAGFLGWRGLLTARP
FT                   LPQDDPDRLARSAEQARQAAASYPNSAWLREQRVRIALGQGRFSEAARLATDPAARAAL
FT                   AIMASREVAGEPLAIDWARDAVRLAPGLPEAHLALFEARAKAGQAWRAKRALKRGWRIA
FT                   PHPDLADAWLAALTSPLERATAAAKLAELNPGHPESEALLARTARAANLVGEAERHERH
FT                   GGGKGVWVCATCDTEHEAWQPTCRKCGAIGSLGWLRRTNPESTPRLLPAPQPAA"
FT   sig_peptide     complement(138320..138400)
FT                   /locus_tag="Acry_0125"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.857 at
FT                   residue 27"
FT   gene            complement(138400..139353)
FT                   /locus_tag="Acry_0126"
FT   CDS             complement(138400..139353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29354"
FT                   /db_xref="GOA:A5FUS2"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUS2"
FT                   /protein_id="ABQ29354.1"
FT                   /translation="MTEHDPNQTPTAPSATGEPALAAAPEPQAADPATAQAATDVPRHR
FT                   RTALGLVTVAILALAVGEVFLLRAQFDAAGQSARIAQLSTRIGALRNRVASLEQKLTTV
FT                   AAEAKKPVPAEPAPALPADLAARIGKIESSIAALSTTTLADHAAVTRLRQQSGDLPALA
FT                   AKAKTLALIAQASLNLQNGLPLGNIPGAPAALAAYATAKPPTLAGLKASFPTYAEAATH
FT                   AAGDAAPQGGFWQRTKARVESLVTVRHGDKVLIGSLAEGILGKAQAALGRDDLKATLAV
FT                   LAKLPPDAATAMKPWTEKASGLLAARTALAGMAEKA"
FT   gene            complement(139350..140063)
FT                   /locus_tag="Acry_0127"
FT   CDS             complement(139350..140063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0127"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29355"
FT                   /db_xref="GOA:A5FUS3"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUS3"
FT                   /protein_id="ABQ29355.1"
FT                   /translation="MTDPGATEPLTVLVTRPEPGGSATAAALRAAGYVPVLAPCLEIEP
FT                   LPGALPTLVDGIVIASTQALPGLPPALRAVPLFAVGDATAARARAAGFIDVASAAGTAR
FT                   ELAALLGERLDPGARLLLACGAGHSMDLAADLRGRGFRVTRRVVYRSRPARQLDAAAQA
FT                   ALEAGEIDRVMVFSPASARRFVTLITEAGLDGALAGAIAVAISPAAAAPLTRLPFRDIR
FT                   SAVSPDQDHMITILA"
FT   gene            complement(140056..141057)
FT                   /locus_tag="Acry_0128"
FT   CDS             complement(140056..141057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0128"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="TIGRFAM: porphobilinogen deaminase; PFAM:
FT                   Porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29356"
FT                   /db_xref="GOA:A5FUS4"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUS4"
FT                   /protein_id="ABQ29356.1"
FT                   /translation="MHQESSSGSKVAPHSGRRLPLRVGTRGSPLALRQTDMFLAALREI
FT                   CPALGFAPDAFAPEIISTTGDRVTDRPLAEIGGKGLFAKEIHEALLDGRIDFAVHSLKD
FT                   LETALPDGIILACTMKREDARDALILADGLGPVNDGDIWSSLPKGARVGTSSVRRQAQL
FT                   LHARPDLQIGLLRGNVRTRLDAARIGTFDATLLALAGLRRLGFEEEVAAAIDPEAMVPA
FT                   ACQGIVGITVRAADSRLAELLAAIENHEAKAVSKAERALLAALDGSCRTPIGGHARLLP
FT                   DGNLHLTGLTARPDGSFLLKRSEVANAADAVRLGAELGASLRRDSPADIFLD"
FT   gene            141081..142172
FT                   /locus_tag="Acry_0129"
FT   CDS             141081..142172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0129"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="TIGRFAM: putative metalloendopeptidase,
FT                   glycoprotease family; PFAM: peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29357"
FT                   /db_xref="GOA:A5FUS5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUS5"
FT                   /protein_id="ABQ29357.1"
FT                   /translation="MERKAASGDALGHDSLILGIESSCDETACAVLDGAGRIRAEFVAS
FT                   QIADHAPFGGVVPEIAARTHLALLPDMIHRALAAAGTTPSGLVAIAATAGPGLIGGLIV
FT                   GANTARGMALAADVPFIAINHLEAHALTARLPDTGGNPPNFPYLLLLVSGGHTALIAVE
FT                   GVGRYRRLGTTLDDAAGEAFDKVAKLLGLPYPGGPALERLAAEGQGGRFDLPRPMLGRP
FT                   GCDFSFSGLKTAVAQLVARQPEGGLPRDFAADLAFAFQSAVVAALADRLRHALAMLPGA
FT                   TAVVVAGGVAANKAVRAALADIAAGAGLPLAAPPLRLCTDNAVMVAWAAIERLRAGDAA
FT                   DPLGVRCRPRWPLEHVRNMQIAG"
FT   gene            142327..144843
FT                   /locus_tag="Acry_0130"
FT   CDS             142327..144843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0130"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="TIGRFAM: glycogen/starch/alpha-glucan phosphorylase;
FT                   PFAM: glycosyl transferase, family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29358"
FT                   /db_xref="GOA:A5FUS6"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUS6"
FT                   /protein_id="ABQ29358.1"
FT                   /translation="MSNVSTRDHSDLPASGRAPGPAVPLALAPIRSVADWRDAILAKLV
FT                   YALGRDQRTASDRDWFEALALALRDRVVAHALDSDDLTRVAGHKRVYYLSLEFLVGRLL
FT                   VDTLTNLDMTGLTRAALGELGADFERVRAAEPDAALGNGGLGRLAACFMESAASLAIPT
FT                   CGYGIRYENGLFRQEIRNGVQVELPEDWLAAGNPWEIRRPERDCDIGFGGHVEQVGDDD
FT                   GATRCVWHPAELVRAVAHDTPVIGWRARHANRLRLWSARAVAPLRLDAFNAGDYLGAVA
FT                   DDVRARSVSRVLYPSDTTPAGQELRLRQEYFFSAASLHDILRRHLAEGYDLSRLPDMAA
FT                   IQLNDTHPAIAIAEMMRLLVDRHGTAWNEAWRITCGCFSYTNHTLLPEALETWPVALME
FT                   RLLPRHMQIIYRLNADHLEAARAKGAASDSLQASLSMIDETQGRRVRMGTLAFVGSHRV
FT                   NGVSALHTGLMRETVFHDLHVLHPDRITNVTNGITFRRWLFEANPRLTGLLVDVLGDAV
FT                   LDDPSVLAGLRGLAGDPGLRARLIACRRANKVALSNLVGEQLGIGLDPDALFDVHVKRL
FT                   HEYKRQLLNILEAVSLWQAIRARPAAGWVPRVKIFAGKAAASYAQARLIIRLINDVASV
FT                   INNDPVTSDLLKVVFLPNFNVSLAEIIIPAADLSEQISTAGMEASGTGNMKFALNGALT
FT                   IGTLDGANIEIRDHVGADNIFIFGLTAAEVAVRRLDGWHPECSIVASPALAGAIEAIGR
FT                   GTFSPGEDTRFAPIVDELRRTDRFLVTADFDSYAEAQRRVAALWRDRDAWWRAAVLNTA
FT                   GMGPFSSDRAIGEYAEKIWHVTGLER"
FT   gene            144902..146173
FT                   /locus_tag="Acry_0131"
FT   CDS             144902..146173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0131"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /note="TIGRFAM: glucose-1-phosphate adenylyltransferase;
FT                   PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29359"
FT                   /db_xref="GOA:A5FUS7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUS7"
FT                   /protein_id="ABQ29359.1"
FT                   /translation="MNGRTERTTPLSRSAMAYVLAGGRGSRLHELTDRRAKPAVQFGGK
FT                   WRIIDFALSNALNSGIRHIGVATQYKAHSLIRHLQLGWAFFRRERNESFDILPASQRIS
FT                   EQNWYLGTADAVYQNIDIIESIGPEYIIILAGDHIYKMDYEVLLQQHVAQQADVTIACV
FT                   EVPLADARGFGVMHVDESDRIIDFLEKPANPPPIPGREGVALASMGIYVFQRDFLFDVL
FT                   RRDADDPHSKHDFGGDIIPALVREGRACAHHFARSCVRSAQEPEPYWRDVGTIDAYWEA
FT                   NIDLTDFVPALDIYDRTWPIWTHTEGTPPAKFIHDEEGRRGQAISSLVSGGCIVSGASL
FT                   RRSLLFTGVRVNSFSQVSDAVILPGADIGRHARLANVVIDRGVRIPEGLVVGEDPEDDA
FT                   RRFRRTAQGVCLITQPMLDRLMTA"
FT   gene            146176..147615
FT                   /locus_tag="Acry_0132"
FT   CDS             146176..147615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0132"
FT                   /product="glycogen synthase (ADP-glucose)"
FT                   /note="TIGRFAM: glycogen/starch synthase, ADP-glucose type;
FT                   PFAM: glycosyl transferase, group 1; Starch synthase
FT                   catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29360"
FT                   /db_xref="GOA:A5FUS8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUS8"
FT                   /protein_id="ABQ29360.1"
FT                   /translation="MRVLSVGSEIYPLVKTGGLADVMGALPAALSSEGITVRSLVPGYP
FT                   AVTAALDRAESVLRIPDLFGGAAEIRAAAAGRHDLFVLDAPHLYARPGNPYIASNGVDW
FT                   SDNAQRFAALCRAGALLARGAVGGFVPDLLHAHDWQAGLVPAYLHYEGHAAPPCVFTVH
FT                   NLAFQGWFPAHLLGALGLPASAFVIDGVEYFGGIGFLKAGLQFADAITTVSPRYATEIA
FT                   TQDGGMGLDGLLRKRGSAVHGILNGLDTATWNPATDEHLAARYDVANLAARAVNKRAVQ
FT                   ARMGLAPDPRALLFGVVSRLAGQKGIDLIIEALPVLDALGAQLAVLGTGETGIEASLRE
FT                   AVAARPGRVAAIIGFEESLSHLIQGGADAILVPSRFEPCGLTQLAAQRYGAIPVVSLVG
FT                   GLVDTVIDANPVAISAGVATGIQFGPVSEAGLSDGLRRTAALYADPDKWSRMQRNAMAL
FT                   DVSWTEPARNYAALYRSLTSR"
FT   gene            complement(147623..150715)
FT                   /locus_tag="Acry_0133"
FT   CDS             complement(147623..150715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0133"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29361"
FT                   /db_xref="GOA:A5FUS9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUS9"
FT                   /protein_id="ABQ29361.1"
FT                   /translation="MNVSSIFIRRPIGTTLLALGILIAGALAYLQLPVAPVPSIPIPAI
FT                   VVFASDPGASPAIMASTVAAPLEHALGTIPGVNDIRSQNSVGSTSVVLLFNPGPDISVY
FT                   AHAVQAAINAALPNLPASMPRRPYYKEFNPASRPVMSLALTSDTMSLAQIYNVADTVLD
FT                   QRLAQVPGVAQVGIYGGGSPAVRIRLNTQALAAAGLTSADVYNAVRSANVTQPLGVIEG
FT                   PHRAWTLVANGQLTSATQYRDIVLKSASGALLRLSDVASVIDGVANTQLAASANGKPAI
FT                   TIEITKTADANVIKTVEGVRKLLPDIRTWLPPSVKLSILNDRTTTIRASVADIQITLLI
FT                   TILLVLAVVTLFMRRMTPTIAAGVTVPLSLAGTVGVMWALGFTLDNFSLLALTICVGFV
FT                   VDDAIVMIENIVTQHERGLSGIEAALVGARQIGFTVISITISLVVVFLPLTLMGGVIGD
FT                   LFYEFAMTLSVAILISGAISLTVTPMVCGHFMGRTPKVGRDSRIARGIDRLYRRSLDAY
FT                   ARSLDWALAHRWLMLASFALTVALTIFLYIKVPKAFIPEQDSGLIISHTMAPSDVSFSR
FT                   MKRLEARVVAAILKNPAVDTVSSRIGVANGFSTANRGQMFIQLKPLSERTASAQEVVRQ
FT                   LQARLARIPGITTFMFVAQDLFFGGQSNGGEYSFSVVDPSLAGLDQVTTEIERKLRTLK
FT                   QVDNISTDQNKAQTQITVEIDRNAAARLGVSIAAIDGVLQNAFAQQQISRIYEAENQYS
FT                   VILKVPEGLDRSPVDLQHIYVAGTKEPLPLSAVAHYVRATAPLSVTHLDGLPAGTISFN
FT                   VAKGTSLGQAITAVKQAIASLPLPASVKISFGGNARYFMKSVNDEPLLILAALIAIYIV
FT                   LGVLYESLVQPLTILSTLPSAGVGALLALLVTGTPLSVIGIIGIFLLMGIVKKNGIMLV
FT                   DFALNAEREHDMTPAEAIRAACLERFRPIMMTSLAAALGALPLAFAVGTGEQLRRPLGI
FT                   AVIGGLIVCQALTLYTTPVIYLALTGFGRRRARRLATLPAE"
FT   sig_peptide     complement(150629..150715)
FT                   /locus_tag="Acry_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.916 at
FT                   residue 29"
FT   gene            complement(150719..153916)
FT                   /locus_tag="Acry_0134"
FT   CDS             complement(150719..153916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0134"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29362"
FT                   /db_xref="GOA:A5FUT0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUT0"
FT                   /protein_id="ABQ29362.1"
FT                   /translation="MNISAPFIARPVATSLLAIALLLIGAMGYRALPVSSLPQVDFPTI
FT                   QVVTKLPGASPDTASKLLTAPLERQFGQIAGLAAMSSISSQGTSAITLRFDLSMPMTTA
FT                   AQDVQAAINAASGTLPPNLQYPPTYSEVNPADAPILTLALTSRTLPLDAIADAAQTRLV
FT                   PKLSQVKGVGKVTVEGGLTKAIRIEVNPARLAAYGVSLEDVRNAIANANQSGAKGALDG
FT                   HNQAYTIGANDQITMPAQYRDLIIAYRNGAPVRLSAVGTVSPGLENDLQSASYDGTPAV
FT                   VVDIQRQPGANIVSTVADVRAALAGLRAAMPPGIDVKVVADRTGTIRASVRDVQITLIT
FT                   AALLVVLVIFLFLPNPRAVLVPAVALPLSIVATFAVMNELGFQLDNLSLMALTVASGFV
FT                   VDDAIVMIENIVRFIEQGESPLRAAYLGSAQIGFTIVSLTVSLVAVFIPLLFMPGVIGR
FT                   LFSEFAVTLSIAVVISAVVSLTLTPMMSARLLRGAEASQPGRIARAAEAALASVRERYR
FT                   AGLAWSLRHQRLMLATFGATVVATGILFAIIPKALLPQEDTGAIVAVTEGAQSISLDAM
FT                   TRLQDRAIRAIRADPAVAGVTSLLGSGLTNPTPNTGRLGITLKPIGQRPAIDTVMSRLQ
FT                   ARLAGIPGLHAYMQPVQDITLSSRVSPTQYQYTLTDADQTELDAWAPKIRAALAALPQI
FT                   TDLASDQQNQGLETYIDVNRAAAARLGISMATIEATLYDAFGQRQVSTIYTQNAQYRVV
FT                   LGVDPAYARSPQALASIYVPTGSLSASVSSTALGPGGSVSGNSTTATGAAGSVSTSVAG
FT                   EVPLLEVAKIDQRYGPLAITREDQFPSVTLSFNLAKGASLGAAESAIRSAEQKLGVPDT
FT                   ISGRFSGAAAEFETSLAQEPWLIFAALVVIYIVLGVLYESTIHPVTILSTLPSAGIGAL
FT                   LALMLFGADFTLVALVGIVLLMGIVKKNGIIMVDFAIEAERTRGLSPEAAITEAAILRF
FT                   RPIMMTTMAALLGAVPLVLEGGAGAELRAPLGITIIGGLLVSQLLTLFTTPVIYLAMDR
FT                   LRPARREAPAAQTGPAE"
FT   sig_peptide     complement(153821..153916)
FT                   /locus_tag="Acry_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.907) with cleavage site probability 0.627 at
FT                   residue 32"
FT   gene            complement(153913..155073)
FT                   /locus_tag="Acry_0135"
FT   CDS             complement(153913..155073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0135"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29363"
FT                   /db_xref="GOA:A5FUT1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR022824"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUT1"
FT                   /protein_id="ABQ29363.1"
FT                   /translation="MAKRRGRIIFGLVALALVGAVAYRLAHRTKPAHGGGATAIPVEVA
FT                   KATRQNVPVYLDALGTVVAYHTVTVQPMITGPLTRILFTPGQFVKKGDLLAEIDPAPYR
FT                   ATLDQAEAKLAQDKASLANAEMQARQYASLVKQNYTSKLQAATALATAAEDRALVKQDE
FT                   ASIETDRINLGYTRITAPISGRTGILQVNAGNIVSPSTTSGIVVINTLQPISVQFSLPQ
FT                   QDLPAIIAAMKRGKVDLLATEEGDPQTAKVLDHGTLAVLDNTVNANTGTLTLKGTFANP
FT                   DLTLWPGAYVNVRTLVRTIDNAVTVPPVAVQQGPSGSFVFLVKPPAKKGGSFTVIDQKV
FT                   TLGVQTARVVVVTSGLVPGDEVVTEGNSRLKGGSAIHIVTGSAGAP"
FT   sig_peptide     complement(154993..155073)
FT                   /locus_tag="Acry_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.770 at
FT                   residue 27"
FT   gene            complement(155076..156584)
FT                   /locus_tag="Acry_0136"
FT   CDS             complement(155076..156584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0136"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29364"
FT                   /db_xref="GOA:A5FUT2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUT2"
FT                   /protein_id="ABQ29364.1"
FT                   /translation="MRQTSKNTSGLKSYRDEKTGAERPEARDTTTNHRMRRLRLAAAAL
FT                   LTPGLAGCAVGPAFHMPQTNVPARFSATADAKPAWPKPGWWRHFGSPELDRLVEAAKAH
FT                   NFSVIEAIDQLEAANAQAQIAGAPLLPAITGSGSGSFQQIQANAGNGLQAVDTRSFTAT
FT                   FQASYQLDFWGKNYDALRAAQANAAAAEFNAATVALTAEASVATVYFQVLAYQDQLGIA
FT                   QRNLKAAEGLLAQLRAELRAGIVDAPTVAQQAALVASERANIPNLVSQMRQEAIGLGIL
FT                   TGRAPEFLRVRGGSLGALTVPALAPGLPAGLLERRPDIAEAKANLIAANANVRGAIAAF
FT                   FPSITLTGSGGWQSKALNLLFAPGSTLISAATSIAQPIFEGGALTGQLRVSRATYREDV
FT                   AKYEQAVVQAFTDVETAMTALRYATDQEALQQVAVARARAALDGARAQLRAGVVDIGTV
FT                   LNAEQTLLSDETTLVTTRLTRLDAAVNLYKAMGGGWTAGAGKDH"
FT   gene            complement(156613..157167)
FT                   /locus_tag="Acry_0137"
FT   CDS             complement(156613..157167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0137"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29365"
FT                   /db_xref="GOA:A5FUT3"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUT3"
FT                   /protein_id="ABQ29365.1"
FT                   /translation="MILLRHGQSEFNLHFTATRRDPGIEDPGLTEHGHAQAEAAASALE
FT                   GHSLRRLIVSPYTRTLQTAAPVLARRPLDVEISAEIRERFHFTCDIGSPPDRLAERFPD
FT                   HDFAHLPTRWWPDETETEEAVIERANRFRAAMAARPDWRETLVVSHWAFILALTGQSLT
FT                   NGSWINYDPTSPPPSALRWRP"
FT   gene            157294..157959
FT                   /locus_tag="Acry_0138"
FT   CDS             157294..157959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0138"
FT                   /product="import inner membrane translocase, subunit Tim44"
FT                   /note="PFAM: import inner membrane translocase, subunit
FT                   Tim44"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29366"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUT4"
FT                   /protein_id="ABQ29366.1"
FT                   /translation="MHTGFPVDIVLLALVAGFLVLRLRSVLGRRTGYERPPMPEPTAAG
FT                   GMQRPGGPVIEGVAEPPRSTRPVPAPHTVVGQTLARIAQAERGFDPARFLDGAEASFRR
FT                   IVLAFAAGDLAALRPLLTPGVFATFEQAVAQRAEAGETQHTEIVRIVEATIDEAELLGG
FT                   EAVIVVRFVSDQQNYTRDRQGQVIAGTEAMTEIVDLWSFEKSLGAADPTWRLAAARSG"
FT   gene            157963..159165
FT                   /locus_tag="Acry_0139"
FT   CDS             157963..159165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0139"
FT                   /product="MltA domain protein"
FT                   /note="PFAM: MltA domain protein; 3D domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29367"
FT                   /db_xref="GOA:A5FUT5"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUT5"
FT                   /protein_id="ABQ29367.1"
FT                   /translation="MHRSTLRGLAAPFTAITLLAGCALPPAGAPQADHAGLTPVPFATL
FT                   PGWSVEAAVAGLPSFQRSCKVIAVMPVDQTLGGAGVAGALGGKAGQWRAACAAAEAVPP
FT                   DDAAAAQHFFEAWMVPYAASGATRITGYYEPVYPGSEIRERGYDVPIYGRPRNLVNANL
FT                   SAFRDSSGKRRIVGRLRYGTMVPYYTRAQIEAGEINREAKVVAWVKNPVDAYMIQLQGA
FT                   ARLRLPDGTLIDLGFDGTNGRTYTPIGKLMVEKGYLKPDQVSITSIRAWLLAHPVEARG
FT                   LMDANKNYVFFKRIRGVPDDLGTPGALDVPLAPEGSIAVDEKAIPLGAPVYVATKSLAR
FT                   LTTAQDIDVGAHGTSAAQIFFGIGNEAAAQASAQDGTGRIFIFLPRQPAAAPTSAKGAS
FT                   S"
FT   sig_peptide     157963..158049
FT                   /locus_tag="Acry_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.569 at
FT                   residue 29"
FT   gene            159162..159953
FT                   /locus_tag="Acry_0140"
FT   CDS             159162..159953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0140"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224,
FT                   cysteine-rich region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29368"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUT6"
FT                   /protein_id="ABQ29368.1"
FT                   /translation="MSESAAAAPRVALFVTCLADLYRPSVGFAAIRLLEAAGCTVEVPR
FT                   AQTCCGQPAYNSGDHETARALAEGLLTALAGYDYVVAPSGSCAGMLRKHMPGLFEADPD
FT                   LRFKADVIAAKTFELTSFLVDVMGFAGLDVALPQRATYHDSCAGLRELGVKDQPRVLLS
FT                   RVEGLEIVEMDTPEVCCGFGGTFCVKHPDISARMVSDKTADIAATGAELLLAGDLGCLL
FT                   NMAGRLTREGKPVAVRHVAEVLAGMTGEVAPIGRGRDGSAA"
FT   gene            159950..161842
FT                   /locus_tag="Acry_0141"
FT   CDS             159950..161842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0141"
FT                   /product="potassium transporter"
FT                   /note="PFAM: K+ potassium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29369"
FT                   /db_xref="GOA:A5FUT7"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUT7"
FT                   /protein_id="ABQ29369.1"
FT                   /translation="MSESATPHGSPGEKLRLAGLIGVLGVVYGDIGTSPLYAVQASLSY
FT                   FPGNKLQESDVLGLLSLIFWALIITVTIKYVLLIMRADNEGEGGTLSLMALAQRVTQSD
FT                   RTKWIIGIIGICGAGLFFGDATITPAISVLSAVEGMEVVSPGLKEFVLPIAIAVILVLF
FT                   FVQRFGTARVGGAFGPIMVIWFVVIGALGLHQIFIHPNVLRALVPVYGAAFIMRHDLLA
FT                   FIALGSVVLAVTGAEALYADMGHFGAKPIRVSWLFFVLPCLLLNYFGQGALVIRDPHAA
FT                   SNPFFFLLPHALVVPMVILATIATVIASQAVISGAYSVARQSTQLGLLPRMPIRYTNET
FT                   EQGQIYVPPVNSFLFVVVVLLVLGFGSSSALASAYGIAVTGTFLSTNALAAFVYCRHFN
FT                   WPLRRTVLVFGAIGLVDFAFFSSNVLKVFDGGWVPLAIGFSLITVMTTWRRGRALLHQR
FT                   WQQDSLPLASFLGRLPQSRIVRVPGVAVFMTGNPEYTPSSLLHNLKHNKVLHETVVFVT
FT                   VRNPGVPFVGDARRAKVEELSEGVYRVLLSFGFMESPNIPRALDLLREQGLPFNPMQIS
FT                   YFLGRETIVAATVPKLGFIRRAIFLFMLRNAISATEFFKIPSDRVVELGVRIAI"
FT   gene            161848..162345
FT                   /locus_tag="Acry_0142"
FT   CDS             161848..162345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29370"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUT8"
FT                   /protein_id="ABQ29370.1"
FT                   /translation="MAVAIPRAVAADGTELHLVPIPPARLPRVQKRDLEQAWEAAHRAA
FT                   RAGAEGPRRGFRFAGGPDVVLRDRDARVWASSVDHIADLSTAHGVSVCLRLLGLVALLA
FT                   GGGWTARFVRFDRGAAELDGALLGAAARTGLTDTGALDENALRAQLLPRESEENPPCRA
FT                   PS"
FT   gene            162327..162671
FT                   /locus_tag="Acry_0143"
FT   CDS             162327..162671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29371"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUT9"
FT                   /protein_id="ABQ29371.1"
FT                   /translation="MPRPILTLALLILPLAACTFGAPPPASPAEQADIAACTQQANAYE
FT                   RAHDYAYLSRTDQFATPFQGTPDQGSRFDRLAEIHARRDMISRCVRNANPAYVGSGAAL
FT                   PEPTIVGPAR"
FT   sig_peptide     162327..162392
FT                   /locus_tag="Acry_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.654 at
FT                   residue 22"
FT   gene            162788..165346
FT                   /locus_tag="Acry_0144"
FT   CDS             162788..165346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0144"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29372"
FT                   /db_xref="GOA:A5FUU0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUU0"
FT                   /protein_id="ABQ29372.1"
FT                   /translation="MKPLGYSIVNRFDPEALFAPKTIMLSGGDTAVGRSLRASLDAAGF
FT                   PGDVREPGEGAQTVDLALIADPPEAVPGVIAGLAGRLRGAAVVYAAVDGLREAALAARV
FT                   RVVGPRSFGIAAPGARLNALRSHIPPPPGRVALLGQSPALARAVIDWAAPNGIGFSHVV
FT                   GIGGNADIGFGRVLDHLSRDPGTGPILMEIAGLRDPRLFLSAARAAARLRPIVAIVPGA
FT                   RLGDPSGIALAGFEAALRRAGVMLTTSLGEFLAAAETLTRARPARSDSLAIIGNSVGAC
FT                   RLAADTALAAGIGLAALSDETRRVLGLLLGASPEPAGPIALQDAPGTRLADVAAMLAAS
FT                   PEVGGVLVIHAPSGPADDAAIAGLIACSGSIKAPLLAAVLGETTAAPQRRRLAEAGVAA
FT                   FATPERAVEGFGDLLRHRAIRAAARELPPSAVLDVAPDRAAVHAALSLARNGGRTALPQ
FT                   DAGFAILRAYGIETAATRIVDTPEHVAAAASSLGFPVVVKVSHPDLARRRPEGSVSLDL
FT                   PDAASASAAATLITARLRRRGEFPEGARFLVQRQLPRARELRILVGEQPFVGPTIGFGP
FT                   GGGDAADTSRLAFDLPPLNLKLAEGLILRAGGNALLRPARGLDEADRAAVAGTLVRISQ
FT                   LVVDWPEIERLEIDPLFATGAGVIAANVRITLHAPGERRQPLPITPYPAHLAHTMTLKG
FT                   RGFQIRPIRPEDAAAHQRLFSRLTPEDVRFRFFSAVRQLTPEQVVRLTEVDYGRELALI
FT                   AVETATGETVGVARLVRSDTDGTEGEFAVLVEGAAKGVGLGSALMRDLIDWARDEGVVD
FT                   IIGQVLADNHPMLAFIRHLGFAIAHVPGEEDVVEARLRLT"
FT   gene            165383..166282
FT                   /locus_tag="Acry_0145"
FT   CDS             165383..166282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0145"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29373"
FT                   /db_xref="GOA:A5FUU1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUU1"
FT                   /protein_id="ABQ29373.1"
FT                   /translation="MEAMSDIARPSSPVSGFLSRPNAPVLVLLSVTVIWGWTFLLTRLS
FT                   LLFIGPYAFVGWRFGVAALAVVLVTRPHPASFNRMEITGGITIGLVLFLGYGLQADGLR
FT                   TVASGESAFLTALYVPMVPLLEFLIFRRRPGLFATAGLVLAFVGLVLVSGMTGLSLAFD
FT                   RGQWLTLGGALGAALEIVLIGHSALAADPRRIAIVQLATVSVISFAVEAVRGGIMITTR
FT                   AFPFAAMTGMGLATAFVLVAQNWAQRSIPANRATLIYTLEPVWAGLVGAAFGEIFAPAQ
FT                   VLGGVLIIASVVLSQWKS"
FT   gene            complement(166351..167226)
FT                   /locus_tag="Acry_0146"
FT   CDS             complement(166351..167226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0146"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29374"
FT                   /db_xref="GOA:A5FUU2"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUU2"
FT                   /protein_id="ABQ29374.1"
FT                   /translation="MEIRTLGVLGAGAMGNGIAHVAALSGLDVVLVDTAQAVLEKSMAT
FT                   MRKNLERQVQKGTIDAAAEAAALARVSPMTTHDAFAKCDMVIEAVPEREEIKRAVYAQV
FT                   IPHLAPHAILASNTSSISITKLGRASGIAERFVGMHFFNPVPMMKLVEVISGLETADAT
FT                   VAAVEDLAKRMGKITIAAQDMPGFIVNRILVPMLNEAIFALHEGIGDVVSIDNGMKLGA
FT                   GHPMGPLTLCDLVGLDVALEVMRVLHAGLGEDKYRPCPLLVNYVEAGWLGRKTGRGFYD
FT                   YSTNPPTPTR"
FT   sig_peptide     complement(167161..167226)
FT                   /locus_tag="Acry_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.776 at
FT                   residue 22"
FT   gene            complement(167310..168245)
FT                   /locus_tag="Acry_0147"
FT   CDS             complement(167310..168245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0147"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /note="PFAM: electron transfer flavoprotein beta-subunit;
FT                   electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29375"
FT                   /db_xref="GOA:A5FUU3"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUU3"
FT                   /protein_id="ABQ29375.1"
FT                   /translation="MAEVLVLIEHDGAHVKQPARSAVAAAAKLGTVHALVAGENVGGAA
FT                   QEAAAIAGVDKVLVADSKALAHALAEPLADLIVKLAGNYTHVLAASTATGKNVMPRAAA
FT                   LLDVQPISDIAGVVDADTFVRPIYAGNAMATVKSADAKKLITVRAASFDPAPAEGGAAA
FT                   IETIEVGVDAGGSSFVGAELSKSERPELTAARIVVSGGRGMQNGENFGKLLDPIADRLG
FT                   AAVGASRAAVDAGFVPNDYQVGQTGKIVAPDLYMAVGISGAIQHLAGMKDSKVIVAINK
FT                   DEDAPIFQVADYGLVGDLFTVLPELQKELG"
FT   gene            complement(168248..168997)
FT                   /locus_tag="Acry_0148"
FT   CDS             complement(168248..168997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0148"
FT                   /product="electron transfer flavoprotein beta-subunit"
FT                   /note="PFAM: electron transfer flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29376"
FT                   /db_xref="GOA:A5FUU4"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUU4"
FT                   /protein_id="ABQ29376.1"
FT                   /translation="MKLLVPVKRVVDYNVKVRVKSDGSGVELAGVKMSMNPFDEIAVEE
FT                   AVRLKEKGVATEIVAVSMGVSACQETIRTALAMGADRGILVETEAELQPLAVAKMLKAL
FT                   VTREQADLVIMGKQAIDDDMNATGQMLAALLGWPQGTFASKVAIADGTVTVTREVDGGL
FT                   ETVALKLPAVVTADLRLNEPRYASLPNIMKARKKPIETVKPEDLGVDPAPRLTTLKVAE
FT                   PPQRKAGVKVGSVAELVEKLRNEAKVI"
FT   gene            complement(169102..172176)
FT                   /locus_tag="Acry_0149"
FT   CDS             complement(169102..172176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29377"
FT                   /db_xref="GOA:A5FUU5"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUU5"
FT                   /protein_id="ABQ29377.1"
FT                   /translation="MRRRLRQAGRVAGHVGHHGARLAGTLVLVALLLLGGAAWRLGQGP
FT                   VDLPPLAARIGAAVSAAEPGLTVTVGRAGLAWEGFRRGGAPIDLRLADIAIRNRSGVVA
FT                   ARISTLRVTLSLAALIKGAITPIRIIAHDPAIVLRPALQAPGGLAAPPEAVGELLALIS
FT                   QSPRTGLLDLSALRAIRIADAHVAIEPVGALPELVATDGALVFTRHPGGRMGGAASADF
FT                   HNGGEVIPLGLTIAGDAGAGRVTALLGPFDPGRLMKPGSPFTAVDLPVMLAASWPVGRF
FT                   TTPELDLGVSAAAGGIAAGTGQVPIAGLQAHAVATRNEVLLSDARIDLAGPNGTAGPAV
FT                   RLRGQIALRGALPAAIDATVDQVSATDLTRYWPQGLLRDARHYVTRHIKAGVARDGRFH
FT                   AVFDLATGKLAPGAVTGEFAASGVTLDWFPGAPAMTALAGKLHFAADDSLDIDATAGRL
FT                   DGLALRGNMRITTLSRHDQTATIGAHATGGLADALGLLRKPPLRLKTTALKLDRATGQM
FT                   AATIHASVPLKRRLALADIAIRADAALTAVHLPLPFAGLALEDGSAALEVDPHHLALHG
FT                   NGRVAATATRFTAAMTLPGGPLTLEAKANATRLALARMGLPVAAWRSGAAPLTVTYRDQ
FT                   AGGGVLEIGADLTGATLAAPAFGWHKAAGQPGRATLRIGLSGGGPFGGLEAAHVEAPGL
FT                   LFDGVRRAGRFAVAMARLGRLRARGSVAPPARLGAPWRISLSGGTLDLSALIAQARAQA
FT                   GTAAAAPRPASGPVWALNGAFAQLRLHAAPAPLLGATQLAATGDGDRLTGLEATLAQGP
FT                   RQTGRLTYRRAGGLTRIRLDAPDAGALLAATGATGGVNGGTLTLDATRQGGLTKGRLGI
FT                   DDFRLTEVPVMAKVLQALTIYGMPAATSGPGLAFTRLVAPFTMSGEVVTLGGARAWSPS
FT                   LGFTTTGQIDLARKRYDLSGTIVPAYALNTLPGRIPLIGRLFSPEKGGGLFAARYTVVG
FT                   PFGAPRVVVNPVSALAPGFIRDLFGIGPPEAPAKP"
FT   gene            172194..175103
FT                   /locus_tag="Acry_0150"
FT   CDS             172194..175103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0150"
FT                   /product="(Glutamate--ammonia-ligase) adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="PFAM: glutamate-ammonia ligase adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29378"
FT                   /db_xref="GOA:A5FUU6"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUU6"
FT                   /protein_id="ABQ29378.1"
FT                   /translation="MNEFLAPASGFPPPADTRAAASFVADFAAIGAAARRFADAAPGRA
FT                   LLDCLGGNAPHLANLALRESDIPPRVLAEGAGPVMDEALALLREADPLATRAAIGRILR
FT                   EVKRRAALAIALADLSGAWGVEQVTAALSDLADASIGLALRHLLRHLHERGTISLPDPA
FT                   DPERASRFAVLGMGKLGARELNYSSDIDLVLLFDPSSSVYRDDSQSAMARLARDLVPLL
FT                   TERDADGMVFRVDLRLRPDPAATPPVVSLAAALSYYESQGRTWERAAFSKARPVAGDRD
FT                   FGASFLEQIRPFIWRRNLDFAAVAEIHEMKRRIDQRRRDAPGRIAGRDVKLGRGGIREI
FT                   EFIVQTLELVWGGHEPALRIPATLPALRALAAAGHLPRAAARDLAAAYRALRQVEHRLQ
FT                   MVEDRQTHTLPETEAGLARFATFMNMPDAARFAAWLDAVCETVNAIFADFFDTDPGSGK
FT                   DGAPDPGESGAAPDAFAGQAQSLGFADPQHLAVRLRLWRNGTLPALRTARARELLDSIM
FT                   PALLRALGRQTDPDLAFRRFDRMLERQSAGVSLLSLFQHNPALLDRLATVLGAAPPLAD
FT                   HLASHPGALDALLAPVARFTRPGPALRRLLRDAADLETALDTLRRFVRREEFHLAVATL
FT                   ERRIGADQASLWRTDLADAALAALLPRVMADFAARHGRVRGGRFAIVALGRVGAREMQP
FT                   GSDLDLMLIYDHPPEAAAARLPPSQYFLRLAHALVAAITAPGAEGAIYAVDMRLRPSGN
FT                   KGPVAVSLAAFRRYHAEEAWTWERLALTRARVLAATRGFAPVVDAEIRAALARDIPPAT
FT                   TCADTVAMRARLARDAPPAGPFDLKHRAGGMMELGFIAEALQLVHFRGAPSRFRQRTAE
FT                   ALAELEACGALDPAEAGALAAADRWYRAVQAMRRITGLADPRPDSPKSALAPILAAAGA
FT                   LDFDGIIATMEAQAAVVRTSFVRHLGDPRGITNPRGDTA"
FT   gene            175100..175573
FT                   /locus_tag="Acry_0151"
FT   CDS             175100..175573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0151"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29379"
FT                   /db_xref="GOA:A5FUU7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUU7"
FT                   /protein_id="ABQ29379.1"
FT                   /translation="MSVAEGDQAPDFTLPATGGRTVSRAGYKGRPFILYFYPKADTPGC
FT                   TKEACAFQEALPALGGIGIDVIGVSKDKMPALEKFAAKYNLAFPLASDESGAVVEAFGA
FT                   WVEKSMYGRKYMGIDRSTFLVGADGRIAKAWRGVKVPGHAKAVMDAAAALQKA"
FT   gene            175669..176145
FT                   /locus_tag="Acry_0152"
FT   CDS             175669..176145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0152"
FT                   /product="Disulfide bond formation protein DsbB"
FT                   /note="PFAM: Disulphide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29380"
FT                   /db_xref="GOA:A5FUU8"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUU8"
FT                   /protein_id="ABQ29380.1"
FT                   /translation="MTSHRRYGLFLALAAFAALGTAYFAQDVLRMIPCPLCYIERWPWR
FT                   IAAALGILAAILPRLPARVLISLAALALFVNVAIAFVHVGAEQHWWKSPLPECNAPPPS
FT                   FGANLPLRPSASCDAPVFLIPGLPISFATMDLIWSLVVALAASAHIFRDRRSNA"
FT   sig_peptide     175669..175746
FT                   /locus_tag="Acry_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.799 at
FT                   residue 26"
FT   gene            176142..176690
FT                   /locus_tag="Acry_0153"
FT   CDS             176142..176690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0153"
FT                   /product="Ubiquinone biosynthesis protein COQ7"
FT                   /note="PFAM: Ubiquinone biosynthesis protein COQ7"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29381"
FT                   /db_xref="GOA:A5FUU9"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUU9"
FT                   /protein_id="ABQ29381.1"
FT                   /translation="MSKDIDYLPGDRPPRAEIARMIRVDHAGEFGAKQIYAGQLAVLGR
FT                   GRHGDTLRHMKAQEQVHLDTFSRLIGERRVRPTALLPLWRIAGFALGAATAAMGPRAAM
FT                   ACTVAVEETIDAHYAAQRDRLGDAEPELSATIETFRQEELEHRDIGLANEAEQAPFYRL
FT                   LSGTIRAGCRAAIAISERI"
FT   gene            176760..177413
FT                   /locus_tag="Acry_0154"
FT   CDS             176760..177413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29382"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUV0"
FT                   /protein_id="ABQ29382.1"
FT                   /translation="MSSTERFEQDLVRAAFELGAAQGWRRVSVAAAARHGGLDLDRARR
FT                   SFACTGMILARFGRLADMHALHGAATDGAVRDRLFDLIMRRIDFLQQHRAGVIALMRHA
FT                   PTDPLLACWLTRANLAAMGWMLEGAGISSAGLRGAIRKRGLLAVWAWTLRAWLRDESED
FT                   LSATMAALDVALMRAEQAALQFAGLPRAPVAADPAGDAPFTPDPDLSDEAADNA"
FT   gene            177497..177970
FT                   /locus_tag="Acry_0155"
FT   CDS             177497..177970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0155"
FT                   /product="phasin family protein"
FT                   /note="TIGRFAM: phasin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29383"
FT                   /db_xref="InterPro:IPR010127"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUV1"
FT                   /protein_id="ABQ29383.1"
FT                   /translation="MAESPKSKHGAEHNPMSAFMPDFDFTKAFSSIKVPAMADAEVVLA
FT                   AYRRNLEALSEANRVALEGAQAVARRHMEIMQKTMADLSEQLRNLSSVSTPQDRAAQQA
FT                   ELLKHAYESAVANMRDLGDLIQRSSHDAVETLNKRFSEAMDEMKHLVEPKKKS"
FT   gene            177999..180185
FT                   /locus_tag="Acry_0156"
FT   CDS             177999..180185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0156"
FT                   /product="Excinuclease ABC subunit B"
FT                   /note="TIGRFAM: excinuclease ABC, B subunit; PFAM: helicase
FT                   domain protein; UvrB/UvrC protein; SMART: DEAD-like
FT                   helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29384"
FT                   /db_xref="GOA:A5FUV2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUV2"
FT                   /protein_id="ABQ29384.1"
FT                   /translation="MTATIAAPRLPFIPERQGARPMHKPLRVVSEYEPSGDQPGAIADL
FT                   VRGVRQGERDQVLLGVTGSGKTFTMAKVIEQVQRPALILAPNKTLAAQLYAEMKSFFPE
FT                   NAVEYFVSYYDYYQPEAYVPRTDTYIEKDAQINEAIDRMRHAATQALLERGDVIIVASV
FT                   SCIYGIGSVETYSQMVVRLEVGGSIDRDRLAKALVELQYRRNDAAFQRGTFRLRGETVD
FT                   IFPSQYEDRAWRVTLFGDEIESIAEFDPLTGEKVTDLPAIAIYANSHYVTPRPTLTQAI
FT                   GKIKVELQQRLHEFTETGKLLEAERLQQRTTFDIEMMETTGSCKGIENYSRYLSGRNPG
FT                   DPPPTLFEYLPDNALLIVDESHVTVPQIGGMFKGDFARKSILSEFGFRLPSCIDNRPLK
FT                   FEEWESFRPQTVFVSATPGPWEMERTGGVFAEQVIRPTGLVDPVIDVRPVEHQVDDLLA
FT                   ECRATSQAGGRVLVTTLTKRMAEDLTEYLTENGVRVRYLHSDVDTLERIEIIRDLRLGA
FT                   YDVLVGINLLREGLDIPECMLVAILDADKEGFLRSATSLVQTIGRAARNVDGRVILYAD
FT                   TMTRSLKYAIDETERRRAKQTAWNEAHGITPQSVKKQIGEIMHSVYEQDYVTVAPIRDS
FT                   GATEFVGKDLKSTIAELEKRMRNAAADLEFEEAARLRDEIKRLEALELGLTPPPAPSSS
FT                   PQRRPRNRTPEPLGPGGGGYDPDKRRGGRRKRGP"
FT   gene            180182..181009
FT                   /locus_tag="Acry_0157"
FT   CDS             180182..181009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29385"
FT                   /db_xref="InterPro:IPR015000"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUV3"
FT                   /protein_id="ABQ29385.1"
FT                   /translation="MKPVLTAALLAALALPAVAAAASPIHLVGQNATYTLALSKVRGHS
FT                   VTGATGRLEFDVRNTCDAYTVTQKMTLLIRNQDGTLSRTTSDYDTWEAKNGHRFTFLLR
FT                   QGDGKKMEVQDQGTAVMGPKGGEVTYLVPKGRTEKLPPGTLFPMAHTRAILEAAEAGKP
FT                   YIDPPLFDGTSTHGAEHTFVAILERQAAHHDRFAHLSKLPSTLVDIGFWPRTEKDDEPD
FT                   FRTQMRYFTNGVSRDVRLDFGNFVMDGKLTALTILKDTCPSGKAVPSAPTPKG"
FT   sig_peptide     180182..180247
FT                   /locus_tag="Acry_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.619 at
FT                   residue 22"
FT   gene            complement(181110..181787)
FT                   /locus_tag="Acry_0158"
FT   CDS             complement(181110..181787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29386"
FT                   /db_xref="GOA:A5FUV4"
FT                   /db_xref="InterPro:IPR005819"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUV4"
FT                   /protein_id="ABQ29386.1"
FT                   /translation="MTRQTEDRAQALAVRASTKTAKPKAAAKPAAKAVAAKPAAKAKPK
FT                   AVPAKMTTVKAVAKKPTATKAAAKPPAKAAKPAAKTAAPKAAAKPATKTATAKAAPKKA
FT                   AAAKAAPAKTPAKTAAKAAPKKAATAKAAAKPAAKATAVKAAPKKASAAKSTTAAAPKA
FT                   KRTAATTRKTANGKPTSAARPTPTRRTAKPVVAKTPARRTRKSAEPAPAPVPTATEGGE
FT                   GSN"
FT   gene            182359..182802
FT                   /locus_tag="Acry_0159"
FT   CDS             182359..182802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0159"
FT                   /product="Uncharacterized protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29387"
FT                   /db_xref="GOA:A5FUV5"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUV5"
FT                   /protein_id="ABQ29387.1"
FT                   /translation="MVEDTEINWIASRQRTRSAVAMPGWRTAIGRGIRMRCPSCGKVSA
FT                   FEGYLRVRRECPICAAPLGRVPCDDAPIYLTLVIALHIVILSMVLADEDGGMSWVESLV
FT                   IFVPLALALLLLLLRPVKGATLAIMLKVNLLRPAAIRATPGNG"
FT   gene            182795..183283
FT                   /locus_tag="Acry_0160"
FT   CDS             182795..183283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0160"
FT                   /product="Uncharacterized protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29388"
FT                   /db_xref="InterPro:IPR008321"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUV6"
FT                   /protein_id="ABQ29388.1"
FT                   /translation="MADGAAEIRGRLRRVVLDEDIGGALSPMQEADRNQAIADLAADNR
FT                   FALGTHPDAVTILHLSVQDGRLVFDVRDEADETLQTLVLAPGPFRSMIRDYQMLLDSYA
FT                   TAVAEGREARIQAIDMGRRGLHNEGAELVMARLDGKVLLDFDTARRLFTLICALHRRA"
FT   gene            183407..184510
FT                   /locus_tag="Acry_0161"
FT   CDS             183407..184510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0161"
FT                   /product="methylthioribose-1-phosphate isomerase"
FT                   /EC_number="5.3.1.23"
FT                   /note="TIGRFAM: eIF-2B alpha/beta/delta-related
FT                   uncharacterized protein; PFAM: initiation factor 2B
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29389"
FT                   /db_xref="GOA:A5FUV7"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUV7"
FT                   /protein_id="ABQ29389.1"
FT                   /translation="MKIDGTPYRSIWVDDADRWSVRIIDQTKLPWAIEIPRLTTPEQIA
FT                   HAISAMLVRGAPLIGATAAYGVALAMRADPSDEALETVVPMLAATRPTAINLRWALMRM
FT                   QRALSAHPPAERADAAYAEAAAICDEDVATNRAIGEHGLGLIRARAQGRRRVNILTHCN
FT                   AGWIATVDWGTALAPIYMAHDAGIDVHVLVDETRPRNQGFSLTAWELGKHGVPHTVIVD
FT                   NAGGHFMQRGEVDMVIVGTDRVTRAGDVANKIGTYLKALAARDNGVPFYVALPSSTIDW
FT                   TIADGLGSIPIEERAPAEVTTITGRALDGSMLTVRIVPKDSTAANPAFDVTPARLVSGL
FT                   ITERGICAANERALAAMFPDQALQTAA"
FT   gene            184507..185319
FT                   /locus_tag="Acry_0162"
FT   CDS             184507..185319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0162"
FT                   /product="Uncharacterized protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29390"
FT                   /db_xref="InterPro:IPR014545"
FT                   /db_xref="InterPro:IPR019262"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUV8"
FT                   /protein_id="ABQ29390.1"
FT                   /translation="MSTAALRRLGLVAILAALAGCAARPDAHAPPFANKPYAAFSRGAA
FT                   IRIAEGEWRYWGSPVIDGPADDEPVLSPPALQERDNAGWQEVGLYWWIGMNAGHPEDRW
FT                   TGKHDAAGRVFPRAVNGSYAWSAAFISYVMRMAGAGPRFPYAADHARYIDAAWRAAHDG
FT                   AKHPELLAENPETHAPAPGDLICAGRASAAHITYADLPTRGYFPAHCAIVVAATPSELS
FT                   VIGGNVDNTVALTHVPLTASGTLLHRDGTIVDPRYDWFVVLRVLYRRD"
FT   sig_peptide     184507..184590
FT                   /locus_tag="Acry_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.842 at
FT                   residue 28"
FT   gene            185334..186668
FT                   /locus_tag="Acry_0163"
FT   CDS             185334..186668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0163"
FT                   /product="Recombination protein MgsA"
FT                   /note="PFAM: AAA ATPase, central domain protein; ATPase
FT                   associated with various cellular activities, AAA_5; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29391"
FT                   /db_xref="GOA:A5FUV9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUV9"
FT                   /protein_id="ABQ29391.1"
FT                   /translation="MARTPSPDGDLFGEAATAQTSAPRGAVPLAERLRPHELAEVIGQP
FT                   HLVGPDGTLTRMLERGSLASLILWGPPGVGKTTIARLLADRAGLVFVQISAVFSGVADL
FT                   KRVFEEAARRRRTGARTLLFVDEIHRFNRAQQDGFLPVVEEGTITLVGATTENPSFELN
FT                   GALLSRCQVLVLRRLDDDALEQLLRRAEAVTARKLALTDAARAALRAMADGDGRAILNM
FT                   AEQLFAANPSAPLDEAALATIIARRAALYDRDREEHYNLISALHKSMRGSDPDAALYWY
FT                   ARMLAGGEDPRYIARRLTRFAVEDIGLADPGALTQAIAAWEAYERLGSPEGDLAIAQLV
FT                   LYLATAPKSNAAYRAFGAARRAAQATGSLMPPAHILNAPTKLMKNLGYGAGYEYDHDSE
FT                   EAFSGQTYFPDGMSRETFYRPAGRGAEQEIKRRLLHWAKLREDRE"
FT   gene            186665..187639
FT                   /locus_tag="Acry_0164"
FT   CDS             186665..187639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0164"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="5.4.99.-"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29392"
FT                   /db_xref="GOA:A5FUW0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUW0"
FT                   /protein_id="ABQ29392.1"
FT                   /translation="MSVRIVTVGPDQADMRLDRFLRSLHPGLTQGAIQKFCRTGQVRVD
FT                   GKRAEASTHLAAGQAVRIPPVPETPAPKPRQTVVANEWDVKELNARILHRDADVLVIDK
FT                   PAGLATQGGKGIARHLDGMLDALRFDAAERPRLVHRLDRDTSGVLVLARNAFAANRLAA
FT                   AFRGRDMEKTYWAIVVGLPIPMEGQIDLPLARIGGAQGARTRPADRDDEDAAKAITDYR
FT                   TLDHAGRKFSWLELHPLTGRTHQLRAHCAAIGTPILGDAPYGEHLAFAEGFPRQLHLHA
FT                   RRLVLPHPRGGRLSVEAELPAHMKTTFATLGFTAPHATPARRG"
FT   gene            187697..189640
FT                   /locus_tag="Acry_0165"
FT   CDS             187697..189640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0165"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29393"
FT                   /db_xref="GOA:A5FUW1"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUW1"
FT                   /protein_id="ABQ29393.1"
FT                   /translation="MHMPLSPEMMEERRFRSVKRGFPRIPPGFVHVMGLAVAAGALVPV
FT                   PTVRAADPQPYDVTFVPTGDAPLDKLIRQSSSLETLRRKLEVGPFALIARARADRKTFL
FT                   TVLESEGYDSGKVTITIDGHTLSDPALPDLLRKAPASPPARVRVAIAKGPLYHVGAVST
FT                   PGLADPAAAAALGVSPGEPATAAPLVGAAVRLETRLRNLGYAFAKVSPPVAEADDATHT
FT                   LSVTYPVSMGPRVDVGSITFTGMQRMNGRFMARHIALKPGQRYSQKALDASRDQLLGLG
FT                   VFSSVTASTAAAPRPAGQVPVTFTVRERKRHTVALGASYSSDLGIDANVSWTDRDLFGE
FT                   AQSLTLSLGATGIAGSGRSQTATFGKHTYVVAPGYDAKATYRVPDFIRPGQSLVATIEA
FT                   LKQYLPAYSRTAFLGSAAIAHPLAPHLTLDYGAGFVFEKVNQQGVSRTYRLLQLPVTLS
FT                   YNTANSLLNPTRGVKLALHVTPTLALGAGAKPFVITELTGSTYINLEAPGRGVLALHGV
FT                   LGRIFGASQFQIPPDQRFYAGGTGTVRGFTYQTVGPLFPDGIPEGGTAIDALETEFRQR
FT                   IGKHFGVAPFIDAGQVSANGTPFTGTLRVGAGLGLLYYTGIGPLRVDVGVPLNRAPGSS
FT                   SFAVYIGLGQAF"
FT   gene            189640..193599
FT                   /locus_tag="Acry_0166"
FT   CDS             189640..193599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0166"
FT                   /product="protein of unknown function DUF490"
FT                   /note="PFAM: protein of unknown function DUF490"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29394"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUW2"
FT                   /protein_id="ABQ29394.1"
FT                   /translation="MRRVFKVILWIVAILIALPVLAVLALDIALNTGAGRNFATHEINA
FT                   LSGGTVRITGLAGHFPKYIAARRIAIADRKGRYLVIDDAVLRWSPFSLLHRMIDISDLT
FT                   AKRIDILRQPVPAAAKPKPKPSAASGIPKVALVLGHLEIGRLAIAKPVLGHALALKITG
FT                   HARAKSLETIAAEIDATSLAGPGTYRLAATLDANRVNAHLTVHEPPGGPIAAFAGIASQ
FT                   PDLAKKPVDLSLTIAGPRDHAALRFASALGDLKARGTGTVDLSQTAPGGDLTITIPELA
FT                   PYAALGKQTLGGRTVLHVVAKHQRGATTLHFDDTVEITKATKPVPVLVGKRAMLAGDFT
FT                   LAGGKTTIHSLTLDMAALKVKLAGTATRLHVALKGTLIQPDIGLVDPQLAGHVTENLAI
FT                   DGPTDNLALHGTVDGLVTAKGVKSGPFHVTIDATHLPGAPQGNLTGTGSLYDSPLSLSA
FT                   AFARSAAGAVDLDLKTLSWKSLRGQGRITRAPGAMLPDGAMHLAMARLADLAPLLHMKL
FT                   AGAFTADFTHKSGQPAAIALTASHLTDGRTASLRAARIDATIDHLAQTPAIDATATLTG
FT                   VDTKAAAGNLTLTAKGSETALAVTAAGRFARLAGKPAQLDLGAMLDGKTRTIRLAKLDA
FT                   AARGVTARLLGPATISAGTTTSIRHLALALGGLGGAARITADGTIRPALDLAAKITNLP
FT                   AGIARAADPKLAATGLLDATAHLTGTLAAPTGTIALQGRGLGLATGPGAKLPRATLAAR
FT                   ETLLGHALRGTIAATLGSARLSLHGTAPLALTGPMDLSFRLDNLSASLLHAADPKLAAS
FT                   GIITARARLTGTPRAPRGTVDLAAKSMRLLTGPASSLPPADLTVHETLLGQSVRGTARL
FT                   ALGNRADLTLAGTAPLSAAGKIDLALNGRTDLRLVDPLTAAGGTVVGGILTPDLRVTGT
FT                   LAAPGAAGTLTLAGGRVQNIASGLDLSAIDATITAAGRTIRLDRLSAKAGVGTIDGSGT
FT                   FGLAKPMPVDLRIAFHHASPIASDILTERLGGALSLTGDIDTGTRLAGTIAIETANIQI
FT                   PQGLPPSVVKLDIRRKGARPPPPAAPAPPVALDLTVDARNEVFVRGKGLFANLGGRLHV
FT                   GGTLASPQPTGGFHLIRGYFNLGGQTLNLSRGTVRFNGNGVMPVIDLEVSGTASDGTVS
FT                   TLALTGEASAPKITLSSTPSLPSDEVLAHLLYGSSTQNLSALQAASLAASLAELAGIGG
FT                   GGPDVVGGLRSALGLDQLSIGGGTSAPTINAGRYVAPGVYVGAQQSATGGGTGAKVEIN
FT                   LYKGLKLKTEVQSNSGTGGTTGPGESVGLTYQFDY"
FT   sig_peptide     189640..189708
FT                   /locus_tag="Acry_0166"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.563 at
FT                   residue 23"
FT   gene            complement(193712..194989)
FT                   /locus_tag="Acry_0167"
FT   CDS             complement(193712..194989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0167"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="PFAM: enolase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29395"
FT                   /db_xref="GOA:A5FUW3"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUW3"
FT                   /protein_id="ABQ29395.1"
FT                   /translation="MSAIADITAREILDSRGNPTVEVDVILDSGAMGRAAVPSGASTGA
FT                   HEAVELRDGEPARFGGKGVQRAVEAVEGEIFDAIGGMDASEQVAIDETMIDLDGTPNKA
FT                   RLGANAILGVSLAVAKAAADEIGLPLYRYLGGVYARTLPVPMMNIINGGKHADNPIDIQ
FT                   EFMIQPVGAASIAEAVRMGSEVFQALKKILHDAGHNTNVGDEGGFAPGLKSAEEALGFM
FT                   TRAVEAAGYRAGEDIAFALDCAATEFYKDGRYHLEGEGKVLDAGGMTDYIAALAKSFPI
FT                   ISVEDPLSEDDWEGWAHFTSTLGGAMQVVGDDLFVTNPTRLRRGIAAKSANSILIKVNQ
FT                   IGTLSETLEAVELAQRAGMTAVISHRSGETEDATIADIAVATNAGQIKTGSLARSDRVA
FT                   KYNQLIRIEAELDIAGRFAGRTILRG"
FT   gene            complement(195047..195508)
FT                   /locus_tag="Acry_0168"
FT   CDS             complement(195047..195508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0168"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29396"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUW4"
FT                   /protein_id="ABQ29396.1"
FT                   /translation="MDIRARLAENGITLPPAAKAVANYVPVVVAGGMAIVSGQLPLAGG
FT                   KLAVTGKLGDGVTVEDGTAAARACFINVLAQIEAHVEGGLDAVAQVVRLGGFIAATADF
FT                   AEHAKVMNGASDLAVAIFGEAGRHARSTVGVASLPLNAAVEVEGMFLLR"
FT   gene            complement(195512..197038)
FT                   /locus_tag="Acry_0169"
FT   CDS             complement(195512..197038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29397"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUW5"
FT                   /protein_id="ABQ29397.1"
FT                   /translation="MRKDPASRHRPTPHRAWRGIRLKRVEIGIDPDAAPEPAIIPADWS
FT                   DQAAAGLVALRADRSMIGVDQAADAWIAPLAAAAERLGRGEDVASTLHRLVATRRAAPS
FT                   PGIWQGRAEPVPGFVFNLPQFLDESGMFDAAAFGEAVEHAVLALSLAQPSAQRLALGMA
FT                   DLALLLARLDIDYASPTARDVAATIGALLAAHADITSAGLLARGIAPGCAITPVPVPAS
FT                   CAQPGLRAALLDARERALACGLRQHRSLTGLLPPGPVEMLLDVETVGIAAPLSALDSEG
FT                   GLARWARARLAASGRTAESALAASLAGADPFGVTDAAGIAAMREAIAPVCAILPEVPSL
FT                   PAPRAASAGRGKLPARRGGYTQKVSVGGHRLFLRTGEYPDGRLGEIMISLPKDSATLRG
FT                   MAEAFAGAVSIGLQHGVPLDEFVDEFAFTRFAPAGAVEGDAMISQATSLLDYVFRHLAA
FT                   TYSQRPDLAALDLADDAAGVDAAAPLLPLDLPETGTGRPKRQRPVLKLVS"
FT   gene            197148..197636
FT                   /locus_tag="Acry_0170"
FT   CDS             197148..197636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0170"
FT                   /product="NADH:ubiquinone oxidoreductase 17.2 kD subunit"
FT                   /note="PFAM: NADH:ubiquinone oxidoreductase 17.2 kD
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29398"
FT                   /db_xref="GOA:A5FUW6"
FT                   /db_xref="InterPro:IPR007763"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUW6"
FT                   /protein_id="ABQ29398.1"
FT                   /translation="MPARGWTDPTVSCIAGGMNEHRDTADASTVPTLASLGGLRRLIAN
FT                   PGLTLHTLRHGLMVGQDSFGNRYFEERRASRPDGRKRRWVIYACGAREASLVPPEWHAW
FT                   LHFTTDAPLSEASRRPWQKPHQPNLTGTPGSYRPRGHDYRGGTRGMATGDYESWTPEG"
FT   gene            197674..198174
FT                   /locus_tag="Acry_0171"
FT   CDS             197674..198174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0171"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29399"
FT                   /db_xref="GOA:A5FUW7"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUW7"
FT                   /protein_id="ABQ29399.1"
FT                   /translation="MKNRVSEIIAGLVVIVAAAVFLAYAASRTRTVGGTGYDLRASFGS
FT                   IGPLTVGSPVKIAGVTIGEVTRTSLDPQTYAAIVQFRIQPDVKIPKDSSAAIESASLLG
FT                   SDYLSISPGGSETMLKPGQAITATQSAINIESLLGKFVFSAANLATSTAKANGGGTSAP
FT                   APK"
FT   sig_peptide     197674..197751
FT                   /locus_tag="Acry_0171"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            198171..198752
FT                   /locus_tag="Acry_0172"
FT   CDS             198171..198752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29400"
FT                   /db_xref="InterPro:IPR019225"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUW8"
FT                   /protein_id="ABQ29400.1"
FT                   /translation="MSLRRAGAVVLVVAMFAALPGRGLAQSGQSVVTVPEAPPVASAPS
FT                   PAMPDGALPAPDLPNAPTLPGDQGGAFAGPATPKGSQATPPAPPKQVKPIWDPRQAAIL
FT                   DVLEKADGAVNRIIAPVGSSFTEGALRVTIGACVVRPADMPPDAAVYMTVRHGMAAPDL
FT                   FRGWLIRSEPGATVVGDAAVTFRLIGCSAG"
FT   sig_peptide     198171..198248
FT                   /locus_tag="Acry_0172"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.922 at
FT                   residue 26"
FT   gene            198903..199997
FT                   /locus_tag="Acry_0173"
FT   CDS             198903..199997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0173"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29401"
FT                   /db_xref="GOA:A5FUW9"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUW9"
FT                   /protein_id="ABQ29401.1"
FT                   /translation="MTHRSILCTACCAAALALGMQAARAANPPPVTGPYVDLGIGTNLM
FT                   QNQKYDFAQPNGARGGNLLFRPDYAGQLGVGYGLGNGFRVELDTNFFRNNAVKADDNVE
FT                   GKNRAYGGVNTYGFMVNGYYDIPTGTNFVPFIGAGLGYQWQKFQHIGVADPSGDVYGGT
FT                   YGSLAYDLSAGVAYDLPQVPGLAVTAQYQYMSLVHNRKYNDTGAVPNTQINVGQSGNHT
FT                   FLIGLRYELFPPAPPAPAAAPAPTPVAAPAPAPARTYLVFFNWDKANLTPRAQQIVSEA
FT                   AKASQTTKVTRLNVNGYTDTSGAPAYNMKLSLRRAHNVAAQLVADGVSKNDIVIKGYGE
FT                   THLLVPTGPNVREPQNRRVEIILH"
FT   sig_peptide     198903..198980
FT                   /locus_tag="Acry_0173"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            200253..201338
FT                   /locus_tag="Acry_0174"
FT   CDS             200253..201338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0174"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: surface antigen msp4 family protein; OmpA/MotB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29402"
FT                   /db_xref="GOA:A5FUX0"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUX0"
FT                   /protein_id="ABQ29402.1"
FT                   /translation="MKLRTTLLAATIIAAPALVPAAAMAQPVTGPYVSLGLGYNIMGSR
FT                   KVKSISTPYGDFASGARTLFHNGFTGEASVGYGFGNGFRVELEGDYFHNQAAKVDGNGA
FT                   QAVVSGTEQKYGFMANALYDFDVGVPYVYPYVGAGVGYQWLQWRNAGVTGARFNGTPGA
FT                   FAYQAIAGLAFPIPAAPGLSATVEYRYMRTMGSDNYRATVGATPVTMKVGDEGNNMLMV
FT                   GLRYELFPPAPPAPAAAPAPTPVAAPAPAPARTYLVFFNWDKANLTPRAQQIVSEAAKA
FT                   SQTTKVTRLNVNGYTDTSGAPAYNMKLSLRRAHNVAAQLVADGVSKNDIVIKGYGETHL
FT                   LVPTGPNVREPQNRRVEIILH"
FT   sig_peptide     200253..200330
FT                   /locus_tag="Acry_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            complement(201391..202158)
FT                   /locus_tag="Acry_0175"
FT   CDS             complement(201391..202158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0175"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29403"
FT                   /db_xref="GOA:A5FUX1"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUX1"
FT                   /protein_id="ABQ29403.1"
FT                   /translation="MTTLANAPNFRDVGPLPLTGGGTLRPGRLFRSGQLSGLDEADLKR
FT                   LEALGIRLVCDLRSSGERKRFASRWPTLAPARIIEMPASTDSAAGMQTLILRLAGQPGA
FT                   AGARRAMLDLYASLPALLAATISAATEAMASGWGVPVLLHCHVGKDRTGVATALLLTAL
FT                   GVRREAILADYEETGRRIDIVEETRHIARSLNKLLGHTVDPGALDALGRTDPAYLDSAF
FT                   TAIDRDWGGIDAYLAASGITTSRRERLATLFHA"
FT   gene            complement(202166..202660)
FT                   /locus_tag="Acry_0176"
FT   CDS             complement(202166..202660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29404"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUX2"
FT                   /protein_id="ABQ29404.1"
FT                   /translation="MRRIAPLLFAAAFITGNASACVTPQNQEALDIIGLKSTLMVSALT
FT                   CGQRSQYDQFMTRFHPYILREQHVLDAYFRARHGRAYQHYEDSYVTNLANAQSTAGIHQ
FT                   GSDFCAASQHLFDQVLGQPDQTALVTFARQNPAAQPIVVLTCGIVESDEFRRMEQYTPR
FT                   H"
FT   sig_peptide     complement(202598..202660)
FT                   /locus_tag="Acry_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(202767..203078)
FT                   /locus_tag="Acry_0177"
FT   CDS             complement(202767..203078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0177"
FT                   /product="Ethyl tert-butyl ether degradation EthD"
FT                   /note="PFAM: Ethyl tert-butyl ether degradation EthD"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29405"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUX3"
FT                   /protein_id="ABQ29405.1"
FT                   /translation="MIAITVLYPKTATSTFDTTYYHDKHMKLVGDRWGSMGLKGATVLH
FT                   GVNGPDGAAPPYAVITTLQFESLEAFGKAVQAHGPEVMGDIANFTNVQPVLQFSEIAA"
FT   gene            complement(203141..204565)
FT                   /locus_tag="Acry_0178"
FT   CDS             complement(203141..204565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0178"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="PFAM: pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29406"
FT                   /db_xref="GOA:A5FUX4"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUX4"
FT                   /protein_id="ABQ29406.1"
FT                   /translation="MASRLRRHRRTKIVATIGPASSTPEILSQLFETGADVFRLNFSHG
FT                   THEDHLARLQMIRALERKFDRPIGILADVQGPKLRVGQFRGGRVQLQTGAEFQLDLNPA
FT                   PGDTRRVNLPHPEIIEAASIGATLLLDDGKLRLRVLRKREDHLLTEVVTGGPLSDRKGV
FT                   NVPDVVLPIPALTKKDRADLAFALEHGIDYIGLSFVQRAADVLEAKEIAAGRALVMTKM
FT                   EKPQALDNLDEIMDATDAVMVARGDLGVELPPEEVPIVQKRIIRAAQQRGLPVVVATQM
FT                   LESMISAPAPTRAEASDVATAVFDGADAVMLSAESAAGQYPREAVNMMDRIVARVERDD
FT                   DWRRTIDAKRPDPEPSSADAIARAAEQVAHTIGARAIVAFTSSGASALRVARERPDCPV
FT                   IGLTPSLDTARRLAAVWGVHAVVTQDVGSMTEAVALSAKVARQEGFAQPGEEIVVVAGV
FT                   PFGQSGTTNALRVARV"
FT   gene            204710..205024
FT                   /locus_tag="Acry_0179"
FT   CDS             204710..205024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0179"
FT                   /product="protein of unknown function DUF1244"
FT                   /note="PFAM: protein of unknown function DUF1244"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29407"
FT                   /db_xref="InterPro:IPR023163"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUX5"
FT                   /protein_id="ABQ29407.1"
FT                   /translation="MDNDRFDDATRTELEAAAFRRLVAHLRERTDVQNIDMMNLAGFCR
FT                   NCLSRWYREAAEARGLELSDPDAREIVYGMPYKEWQARHQTPASDAQKAAFEVASRQGH
FT                   "
FT   gene            205082..205357
FT                   /locus_tag="Acry_0180"
FT   CDS             205082..205357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0180"
FT                   /product="Uncharacterized protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29408"
FT                   /db_xref="InterPro:IPR018753"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUX6"
FT                   /protein_id="ABQ29408.1"
FT                   /translation="MAFDAAETQEDNASHGNIAADRLRSIVERIERLEEERKALGSDIK
FT                   DIYAEAKSAGFDVKVLRQLIRLRKQEPAEVEEQEMLIDVYRRALGM"
FT   gene            complement(205407..206402)
FT                   /locus_tag="Acry_0181"
FT   CDS             complement(205407..206402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0181"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29409"
FT                   /db_xref="GOA:A5FUX7"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUX7"
FT                   /protein_id="ABQ29409.1"
FT                   /translation="MITGSFPTTRLRRNRRDGWTRRMVAETTLSVDNLIWPIFVRAGDG
FT                   EPTPVATMPGVVRVGLDRLAAHVEPAARLGIPAIALFPATPPELKNPEGTEALNPDNLI
FT                   CQAARLLKREFPELGLIGDVALDPYTDHGHDGVLREGYVANDESVEILERQAVNQALAG
FT                   IDVIAPSDMMDGRIGSIRAALDSEGLIDTRIMSYAAKYASAFYGPFREALGSNAALKGD
FT                   KKTYQMDPANTDEALREVAMDIDEGADMVMVKPGMPYLDIIRRVHERFAVPTFAYQVSG
FT                   EYAMLATAMEHGLLDRERGILETLMGFRRAGAAGVLTYFAVEAATLLRRG"
FT   gene            complement(206484..207557)
FT                   /locus_tag="Acry_0182"
FT   CDS             complement(206484..207557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0182"
FT                   /product="tartrate dehydrogenase"
FT                   /EC_number="1.1.1.83"
FT                   /note="TIGRFAM: tartrate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29410"
FT                   /db_xref="GOA:A5FUX8"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUX8"
FT                   /protein_id="ABQ29410.1"
FT                   /translation="MKTYRIASIPGDGIGPEVIGAGLDVLDALARRDSGFALDVTAFDY
FT                   GSDYYRRHGVMMPDGALERLKAFDAIYFGAVGAPDIPDHVTLWGLRLAICQGFDQYANV
FT                   RPTRVLRGLDSPLRACAPADLDWVIVRENSEGEYAGQGGRSHRGHAEEVATEVAIFTRA
FT                   GVARIMRFAFALAASRPRRHLTVVTKSNAQRHGMVLWDEVAAETARDFPEVTWDKMLVD
FT                   AMTVRMVHAPASIDTVVATNLHADILSDLAAALAGSIGIAPTANVNPERNYPSMFEPIH
FT                   GSAFDITGKGIANPVGAFWTASQMLEHLGEADAARRLMAAVERVTAAGIRTRDLGGDAT
FT                   TAEVTAAVIDAIEGGNA"
FT   gene            207590..209005
FT                   /locus_tag="Acry_0183"
FT   CDS             207590..209005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0183"
FT                   /product="membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29411"
FT                   /db_xref="GOA:A5FUX9"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUX9"
FT                   /protein_id="ABQ29411.1"
FT                   /translation="MRAGPACPKGGRGASSAAVTCLAPGQNRWQRRACGDDAGRMKTDA
FT                   GMIALGHTGFAAWLILVGLGFFFGLAYEDFNARAGRSRPGGVRSFPLLALAGGVLYALD
FT                   PAPPLLLGVGLAVLGLWLGLYYWRGMEELAPDGSRNVGLMAPLSNVLAFLIGPLALAGP
FT                   FWMAVGLTVAATLLLTARETLHSLARGIDLAEIVNAGRFLLITGLVLPLLPDRPVTTIT
FT                   SVTPYEAWLAMVAVSSISYASYLLRRYVVPRGSGLLVAFLGGIYSSTVTTVVLARRAAA
FT                   EAAAVVEAQSGIVLANAVMYPRLLVVILLFDPAMALSLAPWMLGVGALGGLIALVWYRL
FT                   RNHAATAPPAIADVSNPLGLGTAATFGVLFVVVSILASVTMRAYGSSGLYTLAGIVGVT
FT                   DINPFIISLATHGAGAAPDPVEMEAVLIATGSNHIFQAIYASAYSRFRTGAPLVAFMVL
FT                   MAAASLGAAILVH"
FT   gene            209070..209957
FT                   /locus_tag="Acry_0184"
FT   CDS             209070..209957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0184"
FT                   /product="CHAD domain containing protein"
FT                   /note="PFAM: CHAD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29412"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUY0"
FT                   /protein_id="ABQ29412.1"
FT                   /translation="MAESGTRHAAAAAKAHPPRLRTRTAWRRIVAARCAELGRDDVDDV
FT                   ESVHRRRVAIRRLRSVLALFAPCLDRAERRRFDAALRELGRAYSPARDWDVACLRSFPA
FT                   AMKGEVDAAAAAAVLAASDAARRQAHERLAASGAASECADLARDIARWAAGPSIIAPDA
FT                   TSRPIDVLAPELLRRLDRRVRRRGRRIARLSDKELHALRKALKRANYAAEALEGVAPGL
FT                   ALGDFRAAAAAVLDQLGRFNDAGVAHDLAEELAADDVPVASLVRRWATRRARKAKRRLE
FT                   PAWRDYRAASRPWK"
FT   gene            210057..212342
FT                   /locus_tag="Acry_0185"
FT   CDS             210057..212342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0185"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase large subunit, N
FT                   terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29413"
FT                   /db_xref="GOA:A5FUY1"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUY1"
FT                   /protein_id="ABQ29413.1"
FT                   /translation="MDIPADFSASLSSVIDTMAPISAQIWDAKYRLKDEAGEPVDRTVE
FT                   DTWRRVARALAETEREPSSWEAPFYEALRDFRFVPAGRIISGAGTARRVTLFNCFVMGD
FT                   IEDDLGRIFAHLREAALTMQQGGGIGYDFSSIRPKGAAVRGVGADASGPLSFMDVWDSM
FT                   CRTIMSAGARRGAMMATMRCDHPDIEAFIAAKREPGRLRNFNLSVLVTDDFMRAVEADA
FT                   AWDLVFEGKVYRTLQARALWEAITRATYDYAEPGVIFIDRINKRNNLYYCETIHATNPC
FT                   GEQPLPPYGACLLGSINLARLVRDPFGSGARIDEAELAELVTIAVRMLDDTIDASGFPL
FT                   EAQREEAVAKRRVGLGMTGLADALMMCGLRYGTPEAAARAGDWARQIERAAYLASAALA
FT                   AEKGAFPLYDAAQYLAGETIAGLDEDVRAAIAAHGIRNALLTSVAPTGTISLLSDNVSS
FT                   GVEPVFALAYTRKVLQRDGSRREEEVTDYALRLFRAKFGEGAPLPAHFVTAQELTPAEH
FT                   VRMQAAVQRHVDSAISKTVNVPEDIGFEAFQEVYLDAYRSGCKGCTTYRPNAVTGSVLE
FT                   VAPPADAKPAVAAPATTAAGLLVRADKLIGATYKLRWPDSEHAMYVTINDIEQDGVRRP
FT                   FEVFVNSKNLEHYAWVVALTRMISAVFRRGGEVAFVAEELKQVFDPRGGQWSGGRYVPS
FT                   LVAAIGDVIERHMVETGFLVPPSSQQRVAEAPATTPLGALCPKCSQPGLVREAGCLSCL
FT                   HCGWSKCG"
FT   gene            complement(212360..213367)
FT                   /locus_tag="Acry_0186"
FT   CDS             complement(212360..213367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0186"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29414"
FT                   /db_xref="GOA:A5FUY2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUY2"
FT                   /protein_id="ABQ29414.1"
FT                   /translation="MAVSIKDVARAAGVSPATVSRTLGGGPVSAALRDKVEEAVRRTGY
FT                   RPNLSARRLRSQESQTVGLIVADISNPFFTAVARAVEHAAYRAGLRVILCNTDENPEKE
FT                   AMYLQLMEQERVTGVIFAPTRASVERLDQGPRPSFPMVLIDRAGRASAQDAVVLDNFAA
FT                   GSMLVEHLAGQGYRRIAGLFGNASTTGVERRDGYEAAMLRAGLSPSSRFIAPSIEAAEQ
FT                   EIARWFAKGNLPEAVIASNGLLLMGVVRALRATGRRMPEDLAIAGFDNESWTDLVGPGI
FT                   TVIEQPVAQIGEEAMRLLLERLDAPEAPVRKTVLGGRCVIRGSTARRALDEAAE"
FT   gene            213562..216075
FT                   /locus_tag="Acry_0187"
FT   CDS             213562..216075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0187"
FT                   /product="Phosphocarrier protein HPr / PTS system
FT                   D-fructose-specific IIA component (F1P-forming), Frc
FT                   family"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: phosphocarrier HPr protein;
FT                   PEP-utilizing enzyme; phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2; PEP-utilising enzyme,
FT                   mobile region; PEP-utilising enzyme domain protein;
FT                   4.A.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29415"
FT                   /db_xref="GOA:A5FUY3"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUY3"
FT                   /protein_id="ABQ29415.1"
FT                   /translation="MPVSTQDDLLRRERVRLGATPSSKAAAIEEAAQLLIASGCVEPGY
FT                   AQSMLRREAVANTFLGHGVVIPHGMGEDRHMVRRDGIAVVQVPGGVEWGTGQMAWLIVA
FT                   IAARGDAHIAILRRLTALMQDGEKLAALAVAEDVDEIVAALAGEAPRAAPAAPAADLAH
FT                   RFDFVVDYPAGLHARPATAWVEAVRQSGLRVQVRHGDEVADGRNLVALLQLGLRAGDRV
FT                   VVSAEGDDAAAGLARLRARMDSLTAQEVADAAKAAARGTDATRGWTPPGPLAAIEGIGA
FT                   SPGIAIGRLHVVAGGAVEVADVPVSLAEGGARLEAALAATRQQLAALVDDTARRLGAAD
FT                   AAIFRAQAELLNDSDLITLACQLMVEGHGPAWAWNQAIERMAASLSALGNPVLAGRAAD
FT                   LRDVGRRVLALLDPSAVPGSLRDLPAAPCIVVAEELSPSDTAGLDLTLVVGLVTAQGGP
FT                   TSHTAILARTLGLPALVAGGGALLAAASGQMAILDGAAGRLYLDPPEPAIASAIAWREA
FT                   MRARQAEAAQQRGAPAVTRDGHRIEIAANVNRPDQVRTALEAGGEGVGLMRTEFLFLER
FT                   GATPDEDEQEAVYRAMIAALEGRPLIIRALDIGGDKQVAHLGLPREENPFLGVRGARLL
FT                   LRRTDLLEPQLRAIYRAAMAGGDVSVMFPMVTSASEIVRLRAACERIRAELGAPVLPVG
FT                   IMIEVPAAAVAADRLAAQCDFLSIGTNDLTQYALAIDRQNPELAAEADSLHPAVLRLIA
FT                   QTVAGAAKHGRWVGVCGGIAGDPFGAALLAGLGVNELSMTPRDIAAVKARLRGSRFDEL
FT                   RALAGRALDAATADEVRALDAGAQR"
FT   gene            216072..217025
FT                   /locus_tag="Acry_0188"
FT   CDS             216072..217025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0188"
FT                   /product="fructose-1-phosphate kinase"
FT                   /EC_number="2.7.1.56"
FT                   /note="PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29416"
FT                   /db_xref="GOA:A5FUY4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR023314"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUY4"
FT                   /protein_id="ABQ29416.1"
FT                   /translation="MSPVITLTLNPAIDETILLDRLSPGTVHRARSVAFHAGGKGVNVA
FT                   SCLADWGGIPVIAAGLLGRANEAPFARLFASKAIRDECLRVPGETRTNVKLAHAGETTD
FT                   INLPGLEVTAESVRAVRERLLGLAAPGSVVLLAGSLPAGVDEGLYAELTASLAARGARV
FT                   LLDSSGPPLARALAGGTPPWCIKPNRAELEALAGRRLPDAVTVRDAARGLLGRGVALVA
FT                   VSLGAEGALFVTGEDCLHAALPPMRAASTVGAGDAMVAGIIAGIHAGEGIEGVARLGTA
FT                   FAAAKLRAPGANLPERAVVEALAGAVIIQYEGVNAA"
FT   gene            217022..218716
FT                   /locus_tag="Acry_0189"
FT   CDS             217022..218716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0189"
FT                   /product="PTS system D-fructose-specific IIC component
FT                   (F1P-forming), Frc family / PTS system D-fructose-specific
FT                   IIB component (F1P-forming), Frc family"
FT                   /note="TIGRFAM: PTS system, fructose-specific, IIB
FT                   subunnit; PTS system, fructose subfamily, IIC subunit;
FT                   PFAM: phosphotransferase system, EIIC; phosphotransferase
FT                   system PTS, fructose-specific IIB subunit; 4.A.2.1.1;
FT                   4.A.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29417"
FT                   /db_xref="GOA:A5FUY5"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUY5"
FT                   /protein_id="ABQ29417.1"
FT                   /translation="MSDIVAIIAGGEGTVTRALAAEALRRAAREAGHDIEIEVRTGEGV
FT                   LDPLAASRIAVAGVAIEVGGSEAGDPRFAGKATIRATLADVLADAAAVLGRAAGTTPPG
FT                   GRRIVAITSCPTGIAHTFMAAEGLLQAAKALGHEIRVETQGSVGAGTPLTEDEIAAADI
FT                   VLIAADRQVDLGRFGGKRVFQSGTKPAINDGKALIARALDEAELQGGTARPAARTGARK
FT                   PRTGPYKHLMTGVSFMIPFVTAGGLLIALAFAFGGIHATDAAQAHSFAGALFEIGAKSA
FT                   FTLFVPVLGGYIAYSIADRPGLAPGMIGGLLASLTGAGFLGAILAGFIGGYATRWLNEI
FT                   LRLPRGLQGLKPVLLLPVLGTLFTGLLMIYVIGRPVAELLHLMTHVLRSMQGSSALALG
FT                   LLLGAMMAFDMGGPVNKAAYTFSVGLLSAQVYTPMAAVMAAGMTPPLGIALATRLFASR
FT                   FNTLERESGLSTGVLGLSFITEGAIPYAAEDPFRVIPCTMTGSAIAGAISMVADVKLRV
FT                   PHGGVFVLPIPNAVTHLGLYVVAIVAGSMLTAVMLGLVKKPAGEADG"
FT   gene            218787..219227
FT                   /locus_tag="Acry_0190"
FT   CDS             218787..219227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0190"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29418"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUY6"
FT                   /protein_id="ABQ29418.1"
FT                   /translation="MPDTTPPLPGIDQLRALMESDVTLAMGRTLGFHLVEIGEGRVVFE
FT                   GTPGREVYNPLGTVHGGYAATLLDSACGCAVHTMLTAEQAYSTLELKVSYHRAMTAETG
FT                   TVRAVGTVISLGRRAGFSEARLTDASGRLYASATSTLIIMQR"
FT   gene            219239..220156
FT                   /locus_tag="Acry_0191"
FT   CDS             219239..220156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0191"
FT                   /product="ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="TIGRFAM: 2-dehydropantoate 2-reductase; PFAM:
FT                   Ketopantoate reductase ApbA/PanE, N-terminal domain
FT                   protein; Ketopantoate reductase ApbA/PanE, C-terminal
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29419"
FT                   /db_xref="GOA:A5FUY7"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUY7"
FT                   /protein_id="ABQ29419.1"
FT                   /translation="MRILVVGAGSIGGYFGGRLIEAGADVTFLVRPARAAALAETGLAI
FT                   RSAKGDFHEPAPKLVTADRLGPAFDLVLLSCKAYDLEEAVAALAPAVSQRTLILPLLNG
FT                   MRHLDVLDARFGAESVLGGQCVISSVLDADGRVLHLNDAHMLTFGPRSAGQEARARAIA
FT                   ELFGQAAFTTRLSDAIMQDMWEKWVFIASLAGITCLMRASVGAIVAAGGAGIALDLAAE
FT                   CAGIAARHGFELRPAAAARLKEWLATEGSPMTASMLRDMEQGGRIEGEHIIGDLLRRGE
FT                   TASCPLLAVANTHLRAYEIRRAGA"
FT   gene            complement(220129..220764)
FT                   /locus_tag="Acry_0192"
FT   CDS             complement(220129..220764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0192"
FT                   /product="Uncharacterized protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29420"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUY8"
FT                   /protein_id="ABQ29420.1"
FT                   /translation="MATRVSLPVIVVFSRIPRLGVGKRRLARTVGDRAAWRLSRIMLSG
FT                   LLREMRRLRGVVRHLAATPDHHARLATPGFIRTGQGRGDLGARMLRVFRRHPRRPVIII
FT                   GSDIPGITAADLRGTLRRLRGAQAVFGPATDGGYWLIGLAGRRPAAPFRDVRWSSPHAL
FT                   ADTLRNFPRHRVALLRPLTDLDDAESLGVHARPAASRAIRQAPARRIS"
FT   gene            complement(220749..222866)
FT                   /locus_tag="Acry_0193"
FT   CDS             complement(220749..222866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0193"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   dimerisation region"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A;
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29421"
FT                   /db_xref="GOA:A5FUY9"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUY9"
FT                   /protein_id="ABQ29421.1"
FT                   /translation="MSTTTVGRAGRRGTARALGFAALALALVALVVALQRQGLGIARLE
FT                   GDLAGLRGMVAAHPLAGFLLYFGLYVAATSLSVPGAAVLTLGAGALFGVAEGAVLVSFA
FT                   SSIGASLAFLAARFLLRDFALARFPALFERIERGIARDGAFYLVSLRLAPVVPFFAVNL
FT                   LAGLTSLRLRSFYLASQIGMLPATLIYVNAGASLATLGGHGPILTQRLVIGLLLLAALP
FT                   LAAPRLRDALATRRLYARFRRPKRFDRNLVVIGAGAGGLVAAYVASAVKAKVTLVEAGE
FT                   MGGDCLNSGCVPSKALLHAARAGKDFRAAIADVRAAIAGIAPHDSVARYEGLGVEVRRG
FT                   RAVIESPWCVAVDGVPITTRAIVIAAGAEPFVPPIPGLAEAPHATSETLWDIEDLPRRL
FT                   VILGGGPIGCEMAQAFARLGSAVTLVEMSERLLVREDDEVSAAMAAALARDGVAIRTGH
FT                   RAEAVTRTEAGFALVAASGVQTIELPFDRLLVAIGRRPRVSGYGLEALGIPLTPARTIE
FT                   TDDGLRTLYPNIFACGDVAGPYQFTHMAGYQGGYAALGALFAPFWRFRPSYRAVPAVTY
FT                   TSPEIARVGLNAREAAARGIEAEITRYDFAELDRAIAEGDTEGFVTVLTRKGSDRILGA
FT                   TIVGPQAGELLTGFTLAMQHGLGLKKLMGTIFPYPTRSEAIRAVAGQWRQAHASARGLA
FT                   ILERFHRWRRG"
FT   sig_peptide     complement(222765..222866)
FT                   /locus_tag="Acry_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.406 at
FT                   residue 34"
FT   gene            complement(222874..224613)
FT                   /locus_tag="Acry_0194"
FT   CDS             complement(222874..224613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0194"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: metallophosphoesterase; Radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29422"
FT                   /db_xref="GOA:A5FUZ0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUZ0"
FT                   /protein_id="ABQ29422.1"
FT                   /translation="MLDMAGSAPAIGPETVPVIEADGPVLVFGGCYSNLQATRALLEAA
FT                   RAHGIPPERMICTGDVVAYGADPQACAALIRDHGIATVMGNCEEQLGAGAADCGCGFTE
FT                   GSSCDRLAAAWFAYAVARIDDATRRWMAALPRRIDLVIGGRRLAVVHGAPSRINRFLFA
FT                   SDPDLVLEREIGITGCDGVIAGHCGIGFTRRIGDLVWHNAGAIGMPANDGTPRCWYSIV
FT                   TPTDAGLEIVLHPLDYDHHAAAAAMRSAGLPEEYAGTLESGIWPNLDILPHAERAATAT
FT                   RLECAPAADATVALEGLETLWFNTGTLCNLACEGCYIESSPRNDRLAWLRLDGFRRVLD
FT                   EAADRHPELREIGLTGGEPFMNPDIEALIGMALDRGYRVLVLTNAMTPMRHHMAAIAGW
FT                   RGRDLHLRVSLDHHTEAGHAALRGERAWGPALEGIGALFASGFQPSIAARFDPAVEDEA
FT                   ATRAGFARLFAAQGWEIDAFDPEHLVLFPEMDVPAAAAGVSASAWAALRPRGADAMCRT
FT                   SRMVVQRKGAEALSIVACTLLPYEARFDLGATLEDASRAVTLDHPHCARFCVFGASSCM
FT                   SAR"
FT   gene            complement(224624..226021)
FT                   /locus_tag="Acry_0195"
FT   CDS             complement(224624..226021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0195"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29423"
FT                   /db_xref="GOA:A5FUZ1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUZ1"
FT                   /protein_id="ABQ29423.1"
FT                   /translation="MTRRPSAPPSDSHLLHTLSELSWNRFHTTAVLLFGLGWALDAFEV
FT                   TLIGNVLGALRQHFGLGSNAMSVILAAWFVGLMIGAAGFGALSDRLGRRRVFLASLVLY
FT                   GVATLATAFAPNLAALLVLRLLGGIGVGAEYSAINAAIAELVPSRSRGRAAAIVLNFWP
FT                   LGSFIAALLAWLVLSSLPPDLGWRVVFGLGGVVALSAAWFRRHLPESPRWLIDADRAED
FT                   ARAIVAGIEAGLTTLPPASAVPVVHRIRREAGQFGRLVRQYPGRLLLGAALDFAEAAGY
FT                   YGLFAFLPIVVLPVLHLPADRLPLFYLAGSVGAAVGGLAAASLLDRIGRSWTVGGFYLA
FT                   TALGLVLFALVTGLGAGPIMLGFALVNLLATGSWIAAYPTFSELFPTALRATGIGASVA
FT                   VGRVGAALSPFLVGYVGARSMPAALVMLAGFWALGAVAILIWRLRGGIEARGLALEQLS
FT                   AASARGV"
FT   gene            226341..227264
FT                   /locus_tag="Acry_0196"
FT   CDS             226341..227264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0196"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29424"
FT                   /db_xref="GOA:A5FUZ2"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUZ2"
FT                   /protein_id="ABQ29424.1"
FT                   /translation="MTFDRDTFRARLAGISGILATPFDGNDRLDTARLRPVVERAVAAG
FT                   VHILTANGNTGEFYALTTDEAERAVHAAAELVAGRVPLIAGIGRSIGDALALTRASRAA
FT                   GASALMVHQPPDPFVAPRGVVEYVRRVAEAGQGLPVVIYLRNDGIGLDAIGDLCAIPEV
FT                   VSVKWATPAPMRLAAAMKRADPALIWVGGLAETWAPAFYAVGARGFTSGLINVWPAHSL
FT                   AIHAALEDGDYAKARALIEVMEPFEALRAEEGNGTNVSVVKAALALMGEDCGAVRPPGA
FT                   WPLAERQQAELHRNLVTWGLLKEHAA"
FT   gene            227261..228829
FT                   /locus_tag="Acry_0197"
FT   CDS             227261..228829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0197"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29425"
FT                   /db_xref="GOA:A5FUZ3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUZ3"
FT                   /protein_id="ABQ29425.1"
FT                   /translation="MTAEIDIAEGITLLGAGLVKTGGVAFHGRTAATGEPRAPGFGEAG
FT                   AAEVALACARAEAASVAFADSTPEARAAFLEAAAANIMALGDRLVEAACAESGLPRGRI
FT                   EGERGRTCGQLRMFAGVLRAGRFADLRIDTAQPARQPLPRPDLRLRNIPLGPVAVFGAS
FT                   NFPLAFSVAGGDTASALAAGCPVVVKAHPAHPLTSALVGHAVADAVASCGLPEGVFTVL
FT                   FGAGNELGGALVADPRIKAVGFTGSRGGGLALAAIAARRKEPIPVYAEMSSINPVLLMP
FT                   GALARRGAGLGTAFVGSLTLGAGQFCTNPGLLLAIEGEGLQAFLDAARAGLAAAAAQTM
FT                   LTGAIRSACERGIEARAAERGVEEVARGPGGALFATDAATFLATPSLAEEIFGAAGILV
FT                   RCRDAAELRQVIVGLEGQLTATLHLEPEDHAAARDLLPLLERKAGRILANGWPTGVEVC
FT                   EAMVHGGPFPATTDSRTTSVGSKAIERFLRPVCYQDLPADLLPTALADGNPLAMPRLVD
FT                   GVMRD"
FT   gene            complement(228858..229571)
FT                   /locus_tag="Acry_0198"
FT   CDS             complement(228858..229571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0198"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29426"
FT                   /db_xref="GOA:A5FUZ4"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUZ4"
FT                   /protein_id="ABQ29426.1"
FT                   /translation="MLKPDTREKLTRVSTATLATALYKRGLRQQFIQGALPLSPPERSM
FT                   VGEAFTLRYIPAREDLNPITVFRDRDHKQRQAIETCPPGAVMVIDSRKDARAASAGGIL
FT                   VTRLMQRGAAGIVTDGGFRDSAEIAALGFPAYHVRPSAPTNLTLHQAIAINDPISCGDA
FT                   PVFPGDVIVGDADGAIVIPAHLADELADEATEMTVFEDFVTEQVKAGATILGLYPPTDP
FT                   ETETRFAAWRARTGR"
FT   gene            230055..230918
FT                   /locus_tag="Acry_0199"
FT   CDS             230055..230918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0199"
FT                   /product="Heat shock protein, Metallo peptidase, MEROPS
FT                   family M48B"
FT                   /note="PFAM: peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29427"
FT                   /db_xref="GOA:A5FUZ5"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FUZ5"
FT                   /protein_id="ABQ29427.1"
FT                   /translation="MPNLIRTGLLMAALTALFVAIGYWIGRGAGAAIALAFAAAGNFVA
FT                   YWVSDRAVLAMYGAQPANQAAFPRLVAQVDRLASKAGLPPPRVYVIDNDQPNAFATGRN
FT                   PQHAAIAVTTGLLGALDEAELAGVIAHELSHIRHRDTLTMTVTATLAGAIGMISNLAIF
FT                   FGGSDERRSSPFAGIAGLLLLLLAPLTATLVQLAISRTREYAADARAASLTGQPLALAR
FT                   ALMRIDEMARWVPNDDAERNPATASLFIVNPLSGTTFDTLFATHPPIRERVARLRHMAQ
FT                   FDVSKN"
FT   sig_peptide     230055..230150
FT                   /locus_tag="Acry_0199"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.433 at
FT                   residue 32"
FT   gene            complement(231000..231530)
FT                   /locus_tag="Acry_0200"
FT   CDS             complement(231000..231530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0200"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29428"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUZ6"
FT                   /protein_id="ABQ29428.1"
FT                   /translation="MPSTQVEPRPKAAEPERRPQAAPEFWRPFESLRREVNRLFEDFDG
FT                   GLLRRALPTSLPFEPFLSRGLGAPAVDIVEQEKAFVITAELPGLTEKDVEIKATDDTLA
FT                   ITGEKRTEQETSEADYQLCERRYGKFERRFSLPAGADASKIEARFANGVLTITLPKRPE
FT                   AIRAERKIEIKAG"
FT   gene            complement(231784..233073)
FT                   /locus_tag="Acry_0201"
FT   CDS             complement(231784..233073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29429"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUZ7"
FT                   /protein_id="ABQ29429.1"
FT                   /translation="MTAPDSHTARAPRVVALLIAALLSLGLPVARAQGAGGIGGTGIEQ
FT                   EAGGIGGTGIGEETGGIGGTGIQRAPGGIGGTGAPIVGYGPIQRFGSVFVNGREYRIDA
FT                   DTLVTIDGHPATVASLRVGDIALVRGVAIGAHGGFARSIATWQAIIGPVSHVADGGHVI
FT                   TVLRQTVTLGASVRPPRLRPGQVVGLSAQRLANGEWVAHRVTVLPPTHAFRLEAAVNTA
FT                   GAGHVTIGRLTLRADPAQIAGLHAGERVVASGIIVNGHPVLTTLEPRPIQLGAPGTRVE
FT                   VRNYFRSTGNGRLLAADGMEATERAGRQRLSGLYPVEVVGEIAENGEISATEVTPEVPS
FT                   LPQSEPPATKAGPSGSTTKSSAAAEVRTNEGPAGNPGTAHASGDVEPPEVGETPDTEAA
FT                   EVEAPEIEVPSPQTPEPDIDAPEIEPPADQ"
FT   sig_peptide     complement(232975..233073)
FT                   /locus_tag="Acry_0201"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.909 at
FT                   residue 33"
FT   gene            complement(233060..234001)
FT                   /locus_tag="Acry_0202"
FT   CDS             complement(233060..234001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29430"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUZ8"
FT                   /protein_id="ABQ29430.1"
FT                   /translation="MELQFSYLALCGILSHSLMGQGAGSADRQACDGRAGMESDIEHML
FT                   RRLLRPLVAYLMRRGLGYIAFRDLLKRVYVDEALRGHEGDEAPTDSQISVVTGINRREV
FT                   KRLREIATHPDTAEPRDRMAGVNAAARVVGTWVSAAAFRGPDGAPLPLTTRGEGDDPGF
FT                   DALLRAAKVDVRARTVIEELERAGVVERLADDRLRLLRTAFTPTEPREKLLFLGANVGD
FT                   HMRSAFHNLAGETPVFIERALFHNGIGASRLNAARPVLSDMADRLLRQCNEQLLEGNLA
FT                   STDAAGGDPEREALRRLRLGVYYYETDADDRP"
FT   sig_peptide     complement(233939..234001)
FT                   /locus_tag="Acry_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.901) with cleavage site probability 0.752 at
FT                   residue 21"
FT   gene            234071..234883
FT                   /locus_tag="Acry_0203"
FT   CDS             234071..234883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29431"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUZ9"
FT                   /protein_id="ABQ29431.1"
FT                   /translation="MTTGAGVRAKGRGRGRGVLLPALAALATAQWPVLVHAASPAGFTI
FT                   GLEPSYFTGRFGTRHTIHIYDLPLSITYRHRNLRLRVELPYIAVTGAGIVAGQSIIAST
FT                   GSGAVRSGPGDMWLKAEYRLDRARGVRPSFEPYVKVKVPVASYAKGLGTGRFDEEAGLR
FT                   MVWRAGTRVFPYLQLGYRIVGRLPALHLQNVVTFEPGVAVAVAPRQFLSVIVIGHTPIQ
FT                   KRRTAVASAILAYNLRMNFRWELQVYATRGLTSQSAAFGAGFGVMAHF"
FT   sig_peptide     234071..234184
FT                   /locus_tag="Acry_0203"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.940) with cleavage site probability 0.886 at
FT                   residue 38"
FT   gene            235043..236467
FT                   /locus_tag="Acry_0204"
FT   CDS             235043..236467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0204"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29432"
FT                   /db_xref="GOA:A5FV00"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV00"
FT                   /protein_id="ABQ29432.1"
FT                   /translation="MRDVQVVELDNGPGGAGAVWRQGWMPGRDPRDAEAGDRDPAPSER
FT                   RHQGNARRARLRPLIPCAGRVGPAVVFLYSHDTFGLGHLRRNLAIAERLLEAGQFSVHL
FT                   LTGSPVIAQWRLPSGLHVHPLPPVVKTGAETYAAREAGHSFGLVKGYRAALILTLALRY
FT                   RPDIFLVDHAPAGMNGEILPTLAMMRRDLPDTRVMLGLRDILDSPDTVRATWAEQEILP
FT                   LLEQAYDDILVYGSRKLFDVVDAYGIAGETAARVRYCGHVVAADLLRPDAEEGTPCWSA
FT                   ARAAGRKVVLVTAGGGGDGFALMEAYLHGLSRMAPGACHSVIVTGPLMSVDQRAALTAT
FT                   AAGREDIDLVDYITDPLPSLRAADLVIAMAGYNTSAELIAARKRTILVPRPAPRAEQRL
FT                   RAHLLARLGLVRAIEQGPDLADRLAREIPAALAAPPPSSVAWAQLDLNGAERVAAHLAT
FT                   AIEARSAASGIAGEFA"
FT   gene            236467..237831
FT                   /locus_tag="Acry_0205"
FT   CDS             236467..237831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0205"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29433"
FT                   /db_xref="GOA:A5FV01"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV01"
FT                   /protein_id="ABQ29433.1"
FT                   /translation="MPAFAYLDLAGEPDLADAPIAYVMKRYPRLTETFILNEIRAMERL
FT                   GTKLHIVSLLPPEPPPHHPMVAEVEAPLHPVPAASARAGRREIAHAHARAIAAAPLRYL
FT                   GAVARAALWCTRSPTPLSVWKQFLRGGVIATLCRTHGIRHIHAHFANAPAASAWFASMM
FT                   TGLPFSFTAHAKDLYLTPPEVIRKRGQAARFVATCTGYNVRYLASLLGDQADKIHLVYH
FT                   GIDLGLFGARKVAEAKPAEGRLILSVGRLVPKKGHDDLIAACALLRDRGIAFRCRIVGE
FT                   GPLRAELQAQITASGLEGIVTLDGAMTHADLITLYGTADAFALAPRITEDGDRDGIPNV
FT                   IAEAMAIGVPVVSTSVSGIPELVRDGETGRLVPPRDPAALATAIEATLADRAQARRLAA
FT                   AGRARLEGEFDLWKTTRRLHALFGCAECEEAPPKGGSRFRAEGLAAQPSLAEVAP"
FT   gene            237828..239027
FT                   /locus_tag="Acry_0206"
FT   CDS             237828..239027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0206"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29434"
FT                   /db_xref="GOA:A5FV02"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV02"
FT                   /protein_id="ABQ29434.1"
FT                   /translation="MKILYLNLDRGIPVEGDKGASVHVREFVTAAAALGHEVTLACTTR
FT                   GVGNPPPPARILQFGAPPADMSIGNEIERRERVRLDHDGLVADRICSTLARLGIEPDLV
FT                   YERHALFHRAGVSIAARLGVPRILEVNAPLVEEQRRFRGLYLVDEALEAEEASYRGADA
FT                   IIAVSRQVAAQVAGVIGRTDRIHVVPNGVDLARFANVDAIGAVIRARLGLAGRRIAGFI
FT                   GSFKTWHGVPFLIEAIAAAAAWHPDLHLLAVGDGPEREAVAALVAKLGLANRVTLPGRI
FT                   PHGEIPGWLGAMDFTVAPYLPQPDFYFSPLKIFESLAAGRAVVAPEIGEIDGIVAHGET
FT                   GLLYPAGDGIALQAALSRLLADQAACQTMGWRGRQRLAGRDWRDVVRLCLALAPVRLPA
FT                   "
FT   gene            239024..240832
FT                   /locus_tag="Acry_0207"
FT   CDS             239024..240832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0207"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter, transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29435"
FT                   /db_xref="GOA:A5FV03"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV03"
FT                   /protein_id="ABQ29435.1"
FT                   /translation="MTGPGGAWLRAYLRSEWRALSAGAAVMAARAGVLLMLPWPLKFII
FT                   DNVIFQRRLAPWLHGVLPDPLTHRMALLDTLGLAMLGLGIADALLVYLGNRLFLDAGQR
FT                   IVFAIRADLFAHLQRLSLAFHRRQRAGELMARLTGDVRQLQDFIVAVGIDLLPHGLTIL
FT                   GMATVMLLIDWRYALIALSVAPLLFWIARVYAGRLRHALRQVRRHETTLSGVMQEILGS
FT                   VQVVQAFGREPHEDGRFGAHAGRSLEAGLHANAVQAQFSPVMNLAIAVATGAIAWYGAA
FT                   TVIRGTLTPGELLIFLAYLRGIATPARQLAKTGRVFGRASVAIERIGEYRAERSSVAEA
FT                   PEALPFAGRASRIEFREVGFGYRDDHEVLHGVSFALEAGRTIALVGATGSGKSTIASLI
FT                   PRFYDATSGAVLLDGQDIRGLRLADLRRQVALVLQDPVLFQASVWENIAYGREGAGRDE
FT                   AIAAARAVGIDAMVEGLPDGFDTMVAERGQSLSGGQRQCIAIARAMLCDAPIVILDEPS
FT                   SSLDAGTERRVMAALDRLAANRAALVIAHRLSTVRAADEILVLDDGRIVQRGTHEALLA
FT                   EGGRYKALWQALRDDSPSPQLRLVAQ"
FT   gene            240829..241671
FT                   /locus_tag="Acry_0208"
FT   CDS             240829..241671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29436"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV04"
FT                   /protein_id="ABQ29436.1"
FT                   /translation="MTRSVPAVPRLLAGIVAGAALAVPLRAARADPWIPAAGDGVVKPM
FT                   VRLFHGNQAFPAGGFTTNALRGSSESSKQYRVTGVQGIGHDLSIEYDLRGGRVRSFADR
FT                   HHIPTASVSSGLQDEEIGLNYGLIQTARFADSITLNVIVPAGRTKPSPALGTGRWSVEP
FT                   DFQAGISRPWGSLTMVAGARMFLDGAATQLRATIDLSLHLTRRLALTGEVFAVKTIRQS
FT                   GTIPPGAQGEIYNLVRPAVGLTWRLTKVIRPFLLYEVNVAGEGIHAGSRLELGVAVHY"
FT   sig_peptide     240829..240897
FT                   /locus_tag="Acry_0208"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.417 at
FT                   residue 23"
FT   gene            241628..242284
FT                   /locus_tag="Acry_0209"
FT   CDS             241628..242284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0209"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29437"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV05"
FT                   /protein_id="ABQ29437.1"
FT                   /translation="MPAAGWSWALQCITDPRAGGRALLLARHGRTAWTGEGRYQGRSDL
FT                   PLSPEGWADAAGLAAALSDEPLVSIYTSPLLRARQTAGCIAARRGDVAVIVDDRLAEIA
FT                   FGDWEGRTQTEIRAATPEALRCWKRDPGGMRFPGGETLAEARARLHGFFADLPQRGGAV
FT                   LAVTHAGMIRLACLCAEGRGDDGFRGIRIAPCAVRRFSLGGAAVVAPPFQHETVE"
FT   gene            242289..243650
FT                   /locus_tag="Acry_0210"
FT   CDS             242289..243650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0210"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29438"
FT                   /db_xref="GOA:A5FV06"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV06"
FT                   /protein_id="ABQ29438.1"
FT                   /translation="MRIVMIGAGYVGLVSGACFASMGTEVIVVEKDPCRVAALQAGRIP
FT                   IYEPGLERLVADSVRAGRLRFEAALDRALPGADAVFLAVGTPSRRGDGHADLSHVFAAA
FT                   AELAAALPAPTVLVTKSTVPVGTGRRLAALMREIRPDLDVPVASNPEFLREGSAIEDFM
FT                   RPDRIVVGTDSVQAEAVLRALYRPLNPAGVTLLCTGLETAELIKYATNAFLAMKITFIN
FT                   EMADLCEQVGADVHELARGMGLDRRIGPKFLHPGPGFGGSCFPKDTQALMRIAQDAHAP
FT                   ARLVETVVSVNEARKAAMAGRILAAFGGTVRRRRIAVLGLTFKPETDDMRDSPAIPIVH
FT                   RLVELGAEVVAYDPAGMEQARRDLPAEVVYASGAASALAGADGAVLVTEWNEFRALAPD
FT                   WLRATMRGRVVVDLRNVFDPAAMRAAGLDHHAIGRPAPHRALAGEAELALAAAD"
FT   sig_peptide     242289..242351
FT                   /locus_tag="Acry_0210"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.827 at
FT                   residue 21"
FT   gene            complement(243647..244348)
FT                   /locus_tag="Acry_0211"
FT   CDS             complement(243647..244348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0211"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29439"
FT                   /db_xref="GOA:A5FV07"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV07"
FT                   /protein_id="ABQ29439.1"
FT                   /translation="MAKERVLVTGGAAGIGAASVARCREEGYEVVVIDRIGDGIVADLS
FT                   DPAATEAALAEALRGGPITRLVNNVGTVRPAPVEAQTVADLDAVVSLNLRCSLQCVQAL
FT                   LPGMKAAGFGRIVNIASRAALGKEDRTAYAATKAGLIGMAKVWALELGRFGITANAIGP
FT                   GPIRTELFDRVNPPDDPRTTAIIEGIPVRRIGTPADVAHAIAYLLDQRSGFVTGQVLYV
FT                   CGGMTVGAAGA"
FT   gene            complement(244450..247137)
FT                   /locus_tag="Acry_0212"
FT   CDS             complement(244450..247137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0212"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /note="TIGRFAM: aconitate hydratase 1; PFAM: aconitate
FT                   hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29440"
FT                   /db_xref="GOA:A5FV08"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV08"
FT                   /protein_id="ABQ29440.1"
FT                   /translation="MSMIGRDSLQVEKTLSVDGKDYAYFALNAAAEKLGDISRLPRTLK
FT                   ILLENVLRFEDGSACTVDDAKALVEWTAQAHSDKDVPFRPARILMQDFTGVPAVVDLAA
FT                   MRDGILRLGGKAEKVNPLVPVDLVIDHSVMVDVYGRKDALEKNVDIEFERNGERYEFLR
FT                   WGQEAFDNFRVVPPGTGICHQVNLEYLAQTVWTSAANGKNYAYPDTLFGTDSHTTMVNG
FT                   LGVLGWGVGGIEAEAAMLGQPIAMLIPDVIGFRLTGSLREGITATDLVLTVTQMLRKKG
FT                   VVGKFVEFYGEGLDHLPLADRATIANMAPEYGATCGFFPVDGITLDYMRLSGRDEHRIK
FT                   LVEAYAKAQGLWREGADPVFSDTLELDLSTVEPSLAGPKRPQDRVALSQASSAFEAELT
FT                   KGLGVPADKAGVTAEVKGKNFSLTHGDVVIAAITSCTNTSNPSVLIAAGLVARKARALG
FT                   LTPKPWVKTSLAPGSQVVTEYLNRAGLQDDLDALGFETVGYGCTTCIGNSGPLDDAIAD
FT                   AIEDNKLVAVSVLSGNRNFEGRVHPNVRANYLASPPLVVAYALLGTMRKDITKDPIGKD
FT                   KNGNDVFLKDIWPTTAEIAAMVQSSLTREMFLDRYGDVFKGPKQWQAIAVEGESDTYRW
FT                   SDSSTYVKNPPYFEGMTKEPAPVKDITGARILALLGDSITTDHISPAGSFRKTTPAGEY
FT                   LLERQIQQKDFNSYGSRRGNHEIMMRGTFANIRIRNEMLDNVEGGYSKHFPSGEQLSIY
FT                   DAAMRYKKEGVPLVVFAGREYGTGSSRDWAAKGTVLLGVKAVIAESFERIHRSNLVGMG
FT                   VLPLVFKDGTTRKTLALKGDETIDIVGLENLSPRMDLDMVIRRANGTTDKVSLLCRVDT
FT                   RDEVLYYQNGGILHFVLRNMAKAA"
FT   gene            247168..247860
FT                   /locus_tag="Acry_0213"
FT   CDS             247168..247860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0213"
FT                   /product="heme exporter protein CcmA"
FT                   /note="TIGRFAM: heme exporter protein CcmA; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29441"
FT                   /db_xref="GOA:A5FV09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV09"
FT                   /protein_id="ABQ29441.1"
FT                   /translation="MRCAAAKPGFAPLKSRCGARVHVPRRSLAMLEAKGLAAIRGERLV
FT                   FRDISFRLERGGALVLVGPNGAGKSSLIRLLAGLTPPAAGEFVWDGENALDDPPLHATR
FT                   LCFVGHMDAIKPGLSVAENLGLDRKRQRENVLTALASVDLERFADLPARLLSSGQRRRL
FT                   ALARLALSDAPLWLLDEPTTGLDAASVRRLEANIAAHRDRGGMVIAATHLPLDLPGAIP
FT                   FDLAKAAA"
FT   gene            247857..248510
FT                   /locus_tag="Acry_0214"
FT   CDS             247857..248510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0214"
FT                   /product="cytochrome c-type biogenesis protein CcmB"
FT                   /note="PFAM: cytochrome c-type biogenesis protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29442"
FT                   /db_xref="GOA:A5FV10"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV10"
FT                   /protein_id="ABQ29442.1"
FT                   /translation="MTHFFSLIRRELILALRHAGDSVASLLFFVIAASLFAFAIGPSAN
FT                   VLSGIAPGVVWVIALLAALLPLNRLFAADFEDGSLDQLMLSGLPASAVALGKIVGHWLT
FT                   TGLPLLVIAGPVAIMLRLDGGAVPQLLATLLPGTMLLSLVGGMSAAVTLGARGGTVLLP
FT                   LIALPLMIPAVIFGAAGAVAQSPFAEFAMLGGLLALFLPIAPLAAGAALRASVS"
FT   sig_peptide     247857..247976
FT                   /locus_tag="Acry_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.721 at
FT                   residue 40"
FT   gene            complement(248503..250272)
FT                   /locus_tag="Acry_0215"
FT   CDS             complement(248503..250272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0215"
FT                   /product="peptidase M24"
FT                   /note="PFAM: creatinase; peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29443"
FT                   /db_xref="GOA:A5FV11"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR028980"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV11"
FT                   /protein_id="ABQ29443.1"
FT                   /translation="MMKTQFDSLRNALHDQGLDGFIQPRNDEFLGEYVPESASRLAWLT
FT                   GFTGSAGLAIVLADRAAVFSDGRYTLQLVEQTDPATWERRHIVETPPVEWLKSAAPGAR
FT                   IGYDPWLMTANAVATYADAGFTMVPVDNPIDQLWADRPAPPASPALAHPPEFAGESAES
FT                   KRSRIAEAIARDGADAVMLTDPHAVAWLFNLRGADLPHTPIVLCFALLRRDGSAIIFID
FT                   PARVPPATRAHLGAGVEIVPRAAMERSLATLRGKRVLLDPATAPIRFSQLLGDAGAITV
FT                   SGGDPCVLPRAIKNPTEQEGARAAHRRDGVALCRFLAWFAEASPAGGQTERSAAAQLFA
FT                   FRSTAPEFHGESFPAISGAGEHGAIIHYSVTAASDRPIRHDEVYLIDSGGQYPDGTTDV
FT                   TRTLWTGPGEPPPTLRDRFTRVLAGHIALARARFPQGTSGPQLDALARAPLWDAGLDFD
FT                   HGTGHGVGSYLSVHEGPASFHRLAKPIPLAPGMILSDEPGYYEPGGYGIRLENLLLVVP
FT                   SPVGAAKPFLEFEPLTLAPFDRRLIDPTLLGPAARAWLDAYHARVLTMIGPHLDGATRT
FT                   WLEAACAPLQEVN"
FT   gene            250436..250705
FT                   /locus_tag="Acry_0216"
FT   CDS             250436..250705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0216"
FT                   /product="protein of unknown function DUF1127"
FT                   /note="PFAM: protein of unknown function DUF1127"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29444"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV12"
FT                   /protein_id="ABQ29444.1"
FT                   /translation="MSSTTHNKHSLPVANSMAAHAAAIDAALADSARRAANSFARVSAW
FT                   FAERRAAREAYRELQSLSDRELADLGISRADIRAVVNGTYQRPI"
FT   sig_peptide     250436..250501
FT                   /locus_tag="Acry_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.857 at
FT                   residue 22"
FT   gene            complement(250751..251668)
FT                   /locus_tag="Acry_0217"
FT   CDS             complement(250751..251668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0217"
FT                   /product="[LSU ribosomal protein L11P]-lysine
FT                   N-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: methyltransferase small; ribosomal L11
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29445"
FT                   /db_xref="GOA:A5FV13"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV13"
FT                   /protein_id="ABQ29445.1"
FT                   /translation="MARGGVEMLERVTVTVPEEALETFEAALETCCRSVGFFLDEANGT
FT                   WIVEGLREPGSADGDLAAALLLAEAASGVSPAVERELVPAGGWLARSYEGFPEQLIGHR
FT                   FAIRGTHVTTPLAAGRITILLDAGLAFGTGEHGSTRGCLLALERLAKRRAPGRILDLGT
FT                   GSGILAITAAKIWGKPVLATDIDQRAVRVASANAALNGVAPLLRVIGSDGWSAPMLARR
FT                   APYDLVFANILARPLVAMAHELSAHLAPGGTAILAGLLGRQARWVMSAHRRHGLVLKGR
FT                   IDDGEWTTLILGKGRATPDGKNPG"
FT   gene            complement(251668..253854)
FT                   /locus_tag="Acry_0218"
FT   CDS             complement(251668..253854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0218"
FT                   /product="ATP-dependent DNA helicase, Rep family"
FT                   /note="PFAM: UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29446"
FT                   /db_xref="GOA:A5FV14"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV14"
FT                   /protein_id="ABQ29446.1"
FT                   /translation="MSDYLDRLNPAQREAVEAVDGPVLVLAGAGTGKTRVLTTRFAHIL
FT                   LTRRAFPNQVLAVTFTNKAAREMRERVSALLGEPAEGLWLGTFHALAARMLRRHAELVG
FT                   RTSNFSILDPDDQLRLLKQVMEARRMDVKRFTPQGLMGTIQRWKDRGLLPDQVPRELDI
FT                   DWGAESARDLYAAYQERLQALNAMDFGDLLMLATDLLKREPEILAQYHRRFRYILVDEY
FT                   QDTNLVQYYWLRLLAQASKNICCVGDDDQSIYSWRGAEIENILRFEQDFPGAKIVRLEA
FT                   NYRSTAPILRAASALIAHNEGRLGKTLHAGRNDAEGEKVEVLAFWDSDEESRAVASRIE
FT                   GLRADGHKLAECAVLVRAGFQTRGFEERFITIGLPYRIVGGLRFYERAEIRDAIAYLRL
FT                   LAQPADDLAFERIVNTPKRGLGDTALRTLHERARADGVPLAEAASRVVAEGGLRGKARD
FT                   GLRTLLAQFAEWRETLRLDGHVVALSTLLDASGYIAMWQEQKTPEAAGRIENLKELVRA
FT                   VAEFETLGGFLEHVALVMDNDNEPDDDKVVLMTLHAAKGLEFDTVFLPGWEEGVFPNQR
FT                   ALDEGGGRALEEERRLAYVGITRAKQRAIISHCANRRIYANWQSSVPSRFIEELPEDAI
FT                   RTGGSAALEQRNAPPVFATARPLVAARRASGEHADAWAATPRPPRTDRITEGTRVFHQK
FT                   FGYGVVIDAEDDRLDIRFDNAGEKRVLDRFVERA"
FT   gene            complement(253851..254783)
FT                   /locus_tag="Acry_0219"
FT   CDS             complement(253851..254783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0219"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /note="TIGRFAM: 5,10-methylenetetrahydrofolate reductase;
FT                   PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29447"
FT                   /db_xref="GOA:A5FV15"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV15"
FT                   /protein_id="ABQ29447.1"
FT                   /translation="MSHTPPRAVLERWLSGPRVDPLPTPALRAPAPAISFEFFPPKTET
FT                   LEAQLWACIRRLEPLAPRFVSITYGAGGSTQERTHATVTRLVRETTLVPAAHLTCVGAS
FT                   RGEVDDVARRYWDAGVRHIVALRGDPPGGTAYAPHPEGYAYAADLVAGLRRVADFEISV
FT                   AAYPETHTQAPSPQADLDNLKRKLDAGATRAISQVFFETGHFLDFLDRALAAGITAPII
FT                   PGIMPVSNFGQAKRISEMAGTHVPAWMGEMFDGLDDDAETRKMVAASIAAEQVRTLQAN
FT                   GIDEFHFYTLNRADLTYAIARILGVKPAR"
FT   gene            254938..255810
FT                   /locus_tag="Acry_0220"
FT   CDS             254938..255810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0220"
FT                   /product="VacJ family lipoprotein"
FT                   /note="PFAM: VacJ family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29448"
FT                   /db_xref="GOA:A5FV16"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV16"
FT                   /protein_id="ABQ29448.1"
FT                   /translation="MRAVAAKDNAASVRGCRKRRPVGNVKTSILPLVAASVLLAGCATP
FT                   PPRSNKAAFEAYQQQNDPLKPANKVFYHFDNVLDTYVLRPVAVGYSHITTPAIREHVSD
FT                   FMQNMDGPAELLEFMAAGKPRDAGTTLVRFIVNSTVGIGGIFDPASAIGYKRVYTDLGL
FT                   TLAGYGVPEGPYLYLPFAGPSDVRDASVLPAGFFLTPTVAAPPSTGLTIFNYSSDALDV
FT                   VNKRANLLGTISNIKKSSLDPYATFRSLYRQHRAAQLRTINERDIATPPAWYPAKEREA
FT                   MKPRPYGSP"
FT   gene            255848..256474
FT                   /locus_tag="Acry_0221"
FT   CDS             255848..256474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0221"
FT                   /product="toluene tolerance family protein"
FT                   /note="PFAM: toluene tolerance family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29449"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV17"
FT                   /protein_id="ABQ29449.1"
FT                   /translation="MASSVRRVLLGAFAVLPVLGALPATALAAAPAASVAQSFIKQSGD
FT                   HLVAIVNGPDSTKVKADKLRELVDRIVAVDQIGRFVLGRYWRVATPAQQQEYLRLFHQT
FT                   LAYNITNQIRAYKGVQFAVDGTKPGPEGEMVSTTVTRPGQSPADVQWVVDTVGGKPRIV
FT                   DVVVEGTSLRITERSDYSSVINDNGGQVSALLDAMKKQIARMEAG"
FT   sig_peptide     255848..255934
FT                   /locus_tag="Acry_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.877 at
FT                   residue 29"
FT   gene            256531..257136
FT                   /locus_tag="Acry_0222"
FT   CDS             256531..257136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0222"
FT                   /product="protein of unknown function DUF150"
FT                   /note="PFAM: protein of unknown function DUF150"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29450"
FT                   /db_xref="GOA:A5FV18"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FV18"
FT                   /protein_id="ABQ29450.1"
FT                   /translation="MQINLQTDGGGPNRPPFLLPGYPESFPVNDTRPQHTGLEGRIAEL
FT                   IAPGLESIGYELVRVAIMGKQTPTVQIMADRADQTPLSLDDCERISHLVSAVLDVDDPI
FT                   SSAWTLEVSSAGIDRPLTRVKDWNRYAGHLARIDLDVPTASGRKRLTGTVLGADEAQAR
FT                   VKLDSGETVDLPHAHIRRAKLVLTEELIKATETPPAAN"
FT   gene            257162..258682
FT                   /locus_tag="Acry_0223"
FT   CDS             257162..258682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0223"
FT                   /product="NusA antitermination factor"
FT                   /note="TIGRFAM: transcription termination factor NusA;
FT                   PFAM: RNA binding S1 domain protein; KH, type 1, domain
FT                   protein; NusA N-terminal domain protein; SMART: KH domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29451"
FT                   /db_xref="GOA:A5FV19"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV19"
FT                   /protein_id="ABQ29451.1"
FT                   /translation="MTMDTAIARPELLLVADAVAREKQIDREEVLEAMEQAIQKAGRAK
FT                   YGHEKDIRATIDRKTGDVRLSRWTEAVETVENEETQIPIHIARKFKPDIEVGGHLVDPL
FT                   PPIDFGRIAAQTAKQVIVQRVREYERKRQYDEYKDRVGEIITGVVKRTEYGNLMVDLGR
FT                   SEALLRRDETIPRENLHNGDRVRAFIYDVREEPRGPQIFLSRTHPGFLAKLFAQEVPEI
FT                   YEGIIEIKAVARDPGSRAKMAVISRDSSIDPVGACVGMRGSRVQAVVAELQGEKIDIIP
FT                   WSPNPATFVVNALAPAEVSKVVLDEEAGKVEVVVPDTQLSLAIGRRGQNVRLASQLTRW
FT                   DIDILTEAEESERRQEEFRRRSGLFVEALDVDDVIAGLLVTEGFEGVEDLAATPVEELA
FT                   AIEGFDEGIAAELQRRAEVALERKATELEDKRRALGVADDLAGLEGLSPAMLVALGEKG
FT                   VKTLDDLADLASDELIEIVGADAMDEDAANAIIMAARAHWFEGEEDAG"
FT   gene            258675..259415
FT                   /locus_tag="Acry_0224"
FT   CDS             258675..259415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0224"
FT                   /product="LSU ribosomal protein L7AE"
FT                   /note="PFAM: protein of unknown function DUF448"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29452"
FT                   /db_xref="GOA:A5FV20"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV20"
FT                   /protein_id="ABQ29452.1"
FT                   /translation="MADPDFSADLADDDAAAESGPLRRCLVTRERQQREAMLRFVVAPE
FT                   AVAAEALVFDVAATLPGRGMWLSARRDVIEKAMKANIFSRAAGRRIALPSGLVEIAGRA
FT                   LEKRIVELLGLARRAGDAVCGFEKVKERIAAGQCALLVEAADGSLAEQDRLIQHRKTNV
FT                   VRPISAARLGAVFGRDRVVHVAIGPGRLAGMIETDSLRLAGVLGAEPSARRLQAPQGAG
FT                   RENADLGGREARPPADMTQTKTQN"
FT   gene            259432..262095
FT                   /locus_tag="Acry_0225"
FT   CDS             259432..262095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0225"
FT                   /product="bacterial translation initiation factor 2
FT                   (bIF-2)"
FT                   /note="TIGRFAM: translation initiation factor IF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; GTP-binding protein, HSR1-related; elongation
FT                   factor Tu, domain 2 protein; translation initiation factor
FT                   IF-2 domain protein; Miro domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29453"
FT                   /db_xref="GOA:A5FV21"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FV21"
FT                   /protein_id="ABQ29453.1"
FT                   /translation="MSDEQDQGETKGRLSLRPVNRGELGRTVDAGSVRQSFSHGRSKVV
FT                   QVEVRKKRGGAAGAETGRPSAPSRASGGAAAPRGLTAAEQAARQRAVVEQQREAARLEA
FT                   ERREQEKISILSAAEEARRKAEEEARAAEEAERLRAEEEARRREEEEAERRRAAEASQA
FT                   TAAPPAPAAAASPRAAMPAPTAAPARPGAAPARRTAPVPPATSASETLRLRAARTGRDE
FT                   EEEASRPARRPGSGAAPSRKPSVPAPKKVGDDRRRGARIDVQAALSGDDERVRSLASVR
FT                   RQRDRERRQAELERLRSDQVRVVREVVLPETITVQELANRMAARVPEVVKSLMKLGVMA
FT                   TATQTIDADTAELVVEEFGHRSKRVSESDVELGLEGQEDSETDLKVRPPVVTIMGHVDH
FT                   GKTSLLDALRSTDVAAREAGGITQHIGAYQVTLESGAKMTFIDTPGHEAFTAMRARGAS
FT                   VTDIVILVVAADDGVMPQTVEAIRHAKAANVPIIVAINKIDRPDANPNRVRSELLQYDI
FT                   AVEAMGGETQDVEVSALKRQGLDALQEAILLQAELLDLKANPNRSAEGAVIESSLDRGR
FT                   GPVATVLVQKGTLRQGDIVVAGTEQGRVRAMLDDHGQPLKDAGPSTPVEILGLSGVPGA
FT                   GEVFVVVENEGRAREIAEFRQRKLREHAAAAGAAARGTLDQMLARIQAGEQKEVALVIK
FT                   ADVQGSAEAIQATVQKLGNDEVRVRVLLAGVGQITESDVQLAKASDAIIVAFNVRANAQ
FT                   ARTLASRDGVDIRYYSIIYQVSDDIETMVKGKLAPIEREKFLGYAEIRQVFNITKVGKV
FT                   AGCYVTEGLVKRGAGVRLLREGVVIHQGELSQLKRFKDDVREVARGYECGLSFAGFSDL
FT                   REGDVVECYETETVPA"
FT   gene            262065..262487
FT                   /locus_tag="Acry_0226"
FT   CDS             262065..262487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0226"
FT                   /product="ribosome-binding factor A"
FT                   /note="PFAM: ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29454"
FT                   /db_xref="GOA:A5FV22"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FV22"
FT                   /protein_id="ABQ29454.1"
FT                   /translation="MLRDRNRSGVRGGAEGPSQRQRRVAEDLRHRLAELFARTEFRDPE
FT                   LAGVHITVAEVRMSPDLKHATVFVSRLGATDIDRYLPALKRIAPFLRGEIGHGLRMKFV
FT                   PDLHFQPDHALDEATRINELLHRPEVMRDLLKPDEE"
FT   gene            262484..263452
FT                   /locus_tag="Acry_0227"
FT   CDS             262484..263452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0227"
FT                   /product="translation factor SUA5"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5 domain protein; SUA5/yciO/yrdC, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29455"
FT                   /db_xref="GOA:A5FV23"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV23"
FT                   /protein_id="ABQ29455.1"
FT                   /translation="MTERLAADAAGIAHAAELLRAGELVAFATETVYGLGADATNASAV
FT                   AAIYEAKGRPRFNPLISHFPDADAAFRHAAADARAREAAQAFWPGPLTLVLPRRDESDI
FT                   AALATAGLSSVAVRVPGHGIARALLAATGRPVAAPSANRSGRLSPTRPAHVIAGLEGRI
FT                   AAILESGACEVGLESAIVDLTGATPVLLRPGGISRETLEAVLGPVSIASEMGAAVKAPG
FT                   MLASHYAPVLPMRLGATAPEDGEAWLGFGIEPPTLPPVSRNLSPAGDLVEAAARLFDSL
FT                   HELDAAAELAGLQRIAVARVPERGLGAAINDRLARAAAPRS"
FT   gene            complement(263478..266747)
FT                   /locus_tag="Acry_0228"
FT   CDS             complement(263478..266747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0228"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29456"
FT                   /db_xref="GOA:A5FV24"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV24"
FT                   /protein_id="ABQ29456.1"
FT                   /translation="MRIVIDVQGAQTSGSAFRGIGRYTMGLAQGIARWRGPHDVIIAAS
FT                   DAFPESPPLLRATFAPLLPPGHFRVWQCPRGISAADDTNHARRRAAACVREAYLAALRP
FT                   DVVLVSSLFEGLIDDAVASIGTLHDIPTAAVLYDLIPLIHRETYLSHHAVIEKWYEAQL
FT                   DHLRRADLLLAISASSSKEAKDHLGFPAGQTVNIGAAADPQFHRRNLPLSTLDTVRARY
FT                   GLNLPFVMYTGGIDHRKNLDRLVTAFARLPAHLREAHQLAIVCKADDDAQDRLRTLARR
FT                   EGLGASTLMFTGFVPEDDLIHLYHACTAFVFPSWHEGFGLPALEAMACGAPVIASNASS
FT                   LPEVVGLDEALFDPLNPDSIANSLQQVLEDRGFRERLVSHGLGQATRFSWDITAQRAVK
FT                   ALEALHLRHALQPQRRRAQTPRPKLAYVSPLPPEQSGISDYSAELIPELSRFYEIEIIA
FT                   SRPDIGPEWLRSQFPIRSPDWLSANPSSYDRVLYQFGNSAFHQHMFDLLREVPGVVTLH
FT                   DFFLSGVAWWMEGDVGRAGHLARALYRSHGYAAAEQRYKRGDINSVIWDFPCNADVLSD
FT                   AIGIIVHGPNAVRLARQWYGPDTARDWAIIPLLRAPAFGFHRSEARRRIGLPEDAMLTC
FT                   SFGGLNATKLNHVTLEAWLASAHADRPDAYLAFVGGHSNDDYGRALLATARNSRAAERI
FT                   LITGWTDQSTYRDYLAAADIAVQLRTLSRGETSAAVLDCMNYGAATIVNANGSMADLPA
FT                   DTVWKLPDKFERAQLAAVLDVLARDTGKRKALGQRARERILRTHAPRACAAAYHEAIEV
FT                   AYRQADATTRGAISSIGRSASGLTAADLAQISGCLAQNGAQPITRQFLVDVSGLLAPDS
FT                   KDRIQSSPRELLLELLRRPPAGFRVEPVHASVKVNGYRYARRWTMSLLGVPSEGFEDEP
FT                   VDAHAGDVFLALYPNHRASSGQADLYRRWRTLGVRTAFIIDDQPPARVPRQVSHDGEKP
FT                   CTDWLEIVAEADNALCVSRSVADDFRAWLDEQGARRSTPIEIGCIHRGGDVKNTAPSRD
FT                   MPAARIAATCPLTLTESVDMLVQALGLPPRQSALPGGTATV"
FT   gene            complement(267076..268038)
FT                   /locus_tag="Acry_0229"
FT   CDS             complement(267076..268038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0229"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29457"
FT                   /db_xref="GOA:A5FV25"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV25"
FT                   /protein_id="ABQ29457.1"
FT                   /translation="MAPEAGSERQFISYAQNFEDVMLWRALGHVSPGTYIDIGAQDPII
FT                   DSVSLAFYERGWRGVHVEPNPAYAERLRVARPDENVIEAAIGATSDTIDFYEIADTGLS
FT                   TGDAFLADEHRQRGFSVNRIKVPCRPLSDILDEMTDQVIHWMKIDVEGMEREVISTWAP
FT                   SAVRPWIIVIESTKPNTKNPTFSDWEEIISKLGYKFVYFDGLNRFYISIRHLELQSYFC
FT                   YGPNIFDNFSLSGLASAPFCRQMLAVIQAREQEAEQRMEREKALRHDAEQQANQAASRL
FT                   REAERLIMEIHASRSWRVTSPFRAAMNFIRRMSRQTHEG"
FT   gene            complement(268531..268935)
FT                   /locus_tag="Acry_0230"
FT   CDS             complement(268531..268935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0230"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29458"
FT                   /db_xref="GOA:A5FV26"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV26"
FT                   /protein_id="ABQ29458.1"
FT                   /translation="MHDVRFQCLVPAVNDGRRKALTLPLPKDRRQEEVAQDRFLPRGDP
FT                   RRGAGLRIRAWNVLAYVISGPKGTIAAIFLASRILSIAPLGRQGLKLAAIAAAVIGIAS
FT                   LYSGHGSIIGTLFSAFVTMFIGNGLNLLNV"
FT   gene            complement(269117..269206)
FT                   /locus_tag="Acry_R0004"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(269117..269206)
FT                   /locus_tag="Acry_R0004"
FT                   /product="tRNA-Ser"
FT   gene            269405..269719
FT                   /locus_tag="Acry_0231"
FT   CDS             269405..269719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0231"
FT                   /product="LSU ribosomal protein L21P"
FT                   /note="PFAM: ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29459"
FT                   /db_xref="GOA:A5FV27"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FV27"
FT                   /protein_id="ABQ29459.1"
FT                   /translation="MFAVIRTGGKQYRVVPDAVLKVEKLEAEAGSTVTFTDVLAIGGEQ
FT                   GVTLGKPVVEGATVTATVIAQDKLDTVIIFKKRRRQNSRRKNGHRQPVTVLRVSGINAA
FT                   "
FT   gene            269735..270004
FT                   /locus_tag="Acry_0232"
FT   CDS             269735..270004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0232"
FT                   /product="LSU ribosomal protein L27P"
FT                   /note="PFAM: ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29460"
FT                   /db_xref="GOA:A5FV28"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FV28"
FT                   /protein_id="ABQ29460.1"
FT                   /translation="MAHKKAGGSSRNGRDSEGRRLGVKKFGDEQVIAGNIIIRQRGTKV
FT                   KPGANVGVGRDHTIFALVDGRVKFSRKAEGRVHVSVEPLPLAAE"
FT   gene            270067..271065
FT                   /locus_tag="Acry_0233"
FT   CDS             270067..271065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0233"
FT                   /product="GTP1/OBG sub domain protein"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; GTP1/OBG
FT                   sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29461"
FT                   /db_xref="GOA:A5FV29"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FV29"
FT                   /protein_id="ABQ29461.1"
FT                   /translation="MKFLDQAKIYVRSGDGGNGVVAFRREKYIEFGGPDGGNGGRGGDI
FT                   VFEAVENLNTLIDFRYTQHFRARKGGNGAGSDRTGAAAPPVVIKVPVGTQILDDDRETL
FT                   LADLDAPGKRIVLLRGGDGGHGNAMFKTSTNRAPRRADPGWPGEERWVWLRLKLIADAG
FT                   LVGLPNAGKSTFLSVASAARPKIADYPFTTLHPQLGVVRLSMTEEFVLADIPGLIEGAH
FT                   DGAGLGDRFLGHVERCAALIHLIDGAAGDVVDAWRTIRGELEAYGGGLADKPELIVLNK
FT                   MDAMTPHQIAGRRSALERASGCKVMVISAAAHQGVDAVLRETLRMIREQRQ"
FT   gene            271062..272213
FT                   /locus_tag="Acry_0234"
FT   CDS             271062..272213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0234"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="TIGRFAM: glutamate 5-kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; PUA domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29462"
FT                   /db_xref="GOA:A5FV30"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV30"
FT                   /protein_id="ABQ29462.1"
FT                   /translation="MSPGLPDPGSARLLVVKIGSALIVDPDAAAPRTAWLASVAADIAA
FT                   LRARGVGVIVVSSGAIALARRQLGLTQKRLRLEEKQAAASVGQIRLAQAWSEALSAHGL
FT                   VAAQLLLTMDDTEDRRRYLNARATLRTLLELGAVPVINENDSVATGEIRFGDNDRLAGR
FT                   VAEMVEADQLVLLSDIDGLYTADPRRDPAAAHLPVVAAITPEIEAMGGAPPPGYSSGGM
FT                   RTKLVAARIATQAGCAMAIALGGVAHPLASLEAGARCTWFLPQPGGRSARKRWIAGSLA
FT                   PLGRLHVDAGAARAIRRGSSLLPAGVVRVEGRFERGDAVEIAGPDGAALARGLAAYPSE
FT                   DAMLIAGHRTDEIEALLGWRGRDELIHRDDLVLVAGPLPSVSS"
FT   gene            complement(272229..273335)
FT                   /locus_tag="Acry_0235"
FT   CDS             complement(272229..273335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0235"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29463"
FT                   /db_xref="GOA:A5FV31"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV31"
FT                   /protein_id="ABQ29463.1"
FT                   /translation="MTRSAPGNPIAHAAGNLTIVLHGWPPLVTTAILAAAAILVAIVFH
FT                   AMLFRLLPRPLRDRGRATGALVARVRAIVLAFLIVLMLTTVVPQAPLGPGLRFGVLHAL
FT                   SAGLVILIGWAVLLAIDIYTTRQLSHRPDNIQADAIARKHVTQWQVLRRASHVLTIIIT
FT                   TAAALMVFPAVRDYGVSLLASAGAAGLVVGLAARPVLSNLIAGIQIAITQPLRVEDAVV
FT                   INGQWGWVEEITSTYVVVRIWNWQRMVVPLAWLLEQPFQNWTRDSSELIGEVHWSLDYT
FT                   VPMDVLRRKLDEIVHATPLWSGKVVVLQVTHALETTLTLRALVSARNSGEAWDLRCFVR
FT                   EQMITFLQKEYPYALPRRRVDLERTEVA"
FT   gene            complement(273456..273971)
FT                   /locus_tag="Acry_0236"
FT   CDS             complement(273456..273971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29464"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV32"
FT                   /protein_id="ABQ29464.1"
FT                   /translation="MNRSALAIGLATVTLFGASAASAAAPPKPVYIHMNGANEFLERLV
FT                   FVRPGQKVVFVNEDTGAHAILGYSPQTGAASKTFDAPALAGTPGKGHKVHTYSISFRHQ
FT                   GPEWYYCPVHAELAKAPGGVWLPKVRPGVHGFGTPMAGLIIVTTDPALLKDNPATSASK
FT                   ILPGYFGG"
FT   sig_peptide     complement(273900..273971)
FT                   /locus_tag="Acry_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.934 at
FT                   residue 24"
FT   gene            complement(274069..274857)
FT                   /locus_tag="Acry_0237"
FT   CDS             complement(274069..274857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0237"
FT                   /product="Arginyltransferase"
FT                   /EC_number="2.3.2.8"
FT                   /note="PFAM: Arginine-tRNA-protein transferase, N-terminal
FT                   domain protein; Arginine-tRNA-protein transferase,
FT                   C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29465"
FT                   /db_xref="GOA:A5FV33"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017138"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV33"
FT                   /protein_id="ABQ29465.1"
FT                   /translation="MTVPGRPPQFFYATAPLPCPYVAGRTERKVVTELTGADADALHNR
FT                   LSRGGFRRSHNIAYAPVCAGCRSCIPIRIVSDRFRQSRTHRRIIAANAGLRAYEMPPRA
FT                   TAEQFKLFQRYQQARHGEGDMAGMSFYDYRAMVEDTPIETWLVEFRDGADELVGACLTD
FT                   RLADGLSAVYSFFAPDLTRQSLGTRSILWLVERTRELGLPYVYLGYWVPESPKMAYKAR
FT                   FRPAEILLGGTWTELTDSLAAADDPPSWPLHLAPVQQCGP"
FT   gene            complement(274854..275348)
FT                   /locus_tag="Acry_0238"
FT   CDS             complement(274854..275348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0238"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29466"
FT                   /db_xref="GOA:A5FV34"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV34"
FT                   /protein_id="ABQ29466.1"
FT                   /translation="MSQSLPFDAEAARDAWLTRDVWPRRIIAFLVDMVLLAVLSVAVWW
FT                   VIVVLGIATFGLGFLLLHFTWAVPPLYYILWLCSSAAATPGQRLLGLTLRQDDTLEASV
FT                   ALRPSFAQALAWTVLLGVSFMLGMVPFLLVLVTRRRRAGHDLLSGLTVVHTSALGRPAA
FT                   P"
FT   gene            275507..276439
FT                   /locus_tag="Acry_0239"
FT   CDS             275507..276439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0239"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="TIGRFAM: ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29467"
FT                   /db_xref="GOA:A5FV35"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV35"
FT                   /protein_id="ABQ29467.1"
FT                   /translation="MKIVACNSNLPLADAVSKALHLPLTNAIIRRFADMEIHVEIQENV
FT                   RGEDVFVIQSTCFPANDNLMELLITLDALRRSSARRVTAVIPYFGYARQDRKTNPRTPI
FT                   SAKLVANIITEAGANRVLTLDLHAGQIQGFFDIPVDNLYGAPLFARDIQDRFAGRDIMV
FT                   VSPDAGGVARARATASRLACDFAIIDKRRPRAGVSEVMNVIGDVEGRHCIMIDDIVDSG
FT                   GSLCNAAEALIRHGAASASAYVSHGVLSGQALERIGASPIETLTITDSIHLDPARNPPS
FT                   NLQVLTIAPLLAEAMRRISDETSVSSLFD"
FT   gene            276467..277087
FT                   /locus_tag="Acry_0240"
FT   CDS             276467..277087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0240"
FT                   /product="Glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   Glutathione S-transferase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29468"
FT                   /db_xref="GOA:A5FV36"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV36"
FT                   /protein_id="ABQ29468.1"
FT                   /translation="MKLFYAPGACSLGIHVLIEELGLPHEGVLVNLRDGQQFSDDYKAI
FT                   NPKAKVPAIVLDDGTVLTEWIAIANYLAATNPAAQLVPSSPVEAARCNELVAYINGWMH
FT                   PQGFARIFRPERFAPNPEDKEAVREQGRKIFAEGFDLIEPVLADGREWLLGAFSIADAA
FT                   LFYVSFWAEGRQTIPLPPNVSAHYARMKARPAVARAMEQERLS"
FT   gene            277087..277671
FT                   /locus_tag="Acry_0241"
FT   CDS             277087..277671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0241"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29469"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV37"
FT                   /protein_id="ABQ29469.1"
FT                   /translation="MTLPRAPFWFLRHGQTDYNAQGLSQGAIDIPLNETGRAQARAAAP
FT                   LLLGRGIVGIVASPMQRARETAEIVNETLGLPLAFEPDLREVVFGGMEGQPLEPWFGDW
FT                   IEGRLTPPGAESFADITARAGTALRSILARPGPLLLVSHGAFFRAVRGLLGVSLEGRTA
FT                   NAAPILCAPDGEGWRTAMAAELDEAVAPGAM"
FT   gene            277718..278881
FT                   /locus_tag="Acry_0242"
FT   CDS             277718..278881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0242"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29470"
FT                   /db_xref="GOA:A5FV38"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV38"
FT                   /protein_id="ABQ29470.1"
FT                   /translation="MEMGFFAPRHMDIGGGAAARIAVLLGRFGLSRPLIVTDPVMVKLG
FT                   LVRRITDPLEAAGIVCTIFSDTVPEPVDTVVEAGVAIARGGAFDCLIGFGGGSPIDTAK
FT                   AINILLAAAPSARMRDFKVPVAADTAALPLIAVPTTAGTGSEATRFTVITDTETDEKML
FT                   IAGLGALPLAAVVDYELTMSVPPRTTADTGIDAFTHALEAYVSRRANPVSDAYARSAMR
FT                   LIGANLRKVWQTPQDRDAREAMMLGATLAGLAFSNASVALVHGMSRPIGAHFHVPHGMS
FT                   NAMLLPAVTRFSLNAALPRYAESARLAGFARADDADQLAGARLIEALEAINAELEVPTP
FT                   QGFGVARADWDALLPKMAEQALASGSPGNNPAVPDAAEIVKIYEEIF"
FT   gene            complement(278928..280097)
FT                   /locus_tag="Acry_0243"
FT   CDS             complement(278928..280097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0243"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29471"
FT                   /db_xref="GOA:A5FV39"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV39"
FT                   /protein_id="ABQ29471.1"
FT                   /translation="METRHPLSEAPDLGLIKSLDIRGNPHGPLAGLDVVVKDLFDIAGE
FT                   VTAFGNPDWGRHFGPALSHAWIVSQLLEAGARVTGKTTTVELAFGLEGRNTHYGTPLNP
FT                   AAPDRLPGGSSSGSVAMVASGRAHVGVGSDTGGSVRIPASYCGLYGLRPTQGLLSLAGA
FT                   APLAPSFDTPGWFTRDAETMLRVGEALLPPAPPLAAQFLMIPAAFANADPDVVTALEPA
FT                   LARLGPMGEADPVPEGLDRMLAWQNAVRGRETWLTLGGFIETVKPLLDPVTAGRIAATR
FT                   GFTAEAAAEGRVARRAHTARMHALLAGGAVLVIPTSPCPAPPVAAEQAVYEDVRTRTLR
FT                   VGIIAAFAGLPELTIPVGKVNGAPVGLSLIAGPGRDLALLELAADLALA"
FT   gene            280204..281154
FT                   /locus_tag="Acry_0244"
FT   CDS             280204..281154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29472"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV40"
FT                   /protein_id="ABQ29472.1"
FT                   /translation="MNATAITADAATIEAADKAARHWVSPDPGPLKPGSEAHKRAVCAM
FT                   FHETFNPYKPSVIEWPKLDPETLHKITSLPIWDIAVQTEGKARLRMAAYARIIADPDMS
FT                   KTIELNGWEENRHKEVLSKLVEAYDIPLEPEPEYRQPKDPEWAYLVTGYSECVDSFFAF
FT                   GLFELAKRSGFFPAELVETFEPVMQEECRHILLFANWVAWHRARLPLHRRIWFELRVAA
FT                   VWAFLGWERIGIARGMDDGGKDKPKAQDNNFTVTGSKSVSAEDISVPELMRICLEENDR
FT                   RFAGYDRRLLRPTTMPTLVRIALKFMPKPRQKAAA"
FT   gene            281151..282005
FT                   /locus_tag="Acry_0245"
FT   CDS             281151..282005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0245"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29473"
FT                   /db_xref="GOA:A5FV41"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV41"
FT                   /protein_id="ABQ29473.1"
FT                   /translation="MSGGGTAGGNERQIAYWNEVAGPKWIRVQAAMESRLTAVEDRLLE
FT                   RAAPRAGERVLEVGCGTGTTTARLAGLVGEGGHVTAVDVSRPMLEAARARLAGLAQVTL
FT                   MEADAAFATFAAPFDLVTSRFGVMFFEDPAAAFANLRASLVPGGRLVCAAWGPIADNPH
FT                   WSVPLEITVARLGPPKPRRPHAPGPLAFADRDHARTVLTQAGFAEIAIEPERVMLSGRS
FT                   LDDEAEMAGTMGPAGALIDEKEADAETRAALRVAFREALPGYADADAWLPATIHMITAR
FT                   NPA"
FT   gene            complement(282357..284444)
FT                   /locus_tag="Acry_0246"
FT   CDS             complement(282357..284444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0246"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29474"
FT                   /db_xref="GOA:A5FV42"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FV42"
FT                   /protein_id="ABQ29474.1"
FT                   /translation="MSGTSLAKIRNIGITAHIDAGKTTTTERILYYTGVSHKIGEVHDG
FT                   NTTTDYMEQERERGITITSAAVTCEWKDHRINIIDTPGHIDFNIEVNRSLRVLDGAVFI
FT                   IEGVAGVQPQSETNWRLADRYNVPRIIFINKLDRTGADFYRAFDTLKEKLDIVALPLQL
FT                   PIGIEDQFVGVVDLVEMKAIVWEGGELGAKFHDEEIPADMLEKAKEYRQNLLDTALSVD
FT                   DAGMEEYFEKGDVATETLKRAIKTGTISGAFRPVLCGTAFKNKGVQPLLDAVLDYLPSP
FT                   VDIEGIKVAPPEGEEEDPSANRRVIPANPDAPFAGLAFKIINDKYGTLTFVRVYAGTLR
FT                   SGDTVLNTTKGHKERVGRMFQMHADKREEVKEVHAGDIAAFVGLKDTGTGDTLASSDDP
FT                   VVLERMAFPVPVIDISVEPKTKEAVEKMTLALQKLAGEDPSLRLKTDQETGQTILSGMG
FT                   ELHLDIIIDRLRREYGVEANVGAPQVAYRETITREHTETYTHKKQSGGSGQFAEVKIIF
FT                   EPQERNEGILFENKVVGGAVPKEYIPAVEKGIKVQADTGVLAGFPTVDFKYTLVDGKYH
FT                   DVDSSALAFEIAAKACFREGMKKAGPVILEPIMDVEITTPQDHVGDVVGDLNRRRGMIQ
FT                   NQESSGSTVIVRAQVPLKEMFGYISNLRSMTKGRASFTMQFHHYDPVPRNIADEIMTKS
FT                   A"
FT   gene            complement(284643..284924)
FT                   /locus_tag="Acry_0247"
FT   CDS             complement(284643..284924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29475"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV43"
FT                   /protein_id="ABQ29475.1"
FT                   /translation="MPRMMVPPCAVESPIRAAGWPPISTVNAPTTTESGGPTQTAMSPT
FT                   RAAGMPPISTVGAPGPMIGPPTWGTSTSTIGQTCMSVRRAAGCPMANG"
FT   gene            complement(284993..286264)
FT                   /locus_tag="Acry_0248"
FT   CDS             complement(284993..286264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0248"
FT                   /product="penicillin-binding protein 6, Serine peptidase,
FT                   MEROPS family S11"
FT                   /note="PFAM: peptidase S11, D-alanyl-D-alanine
FT                   carboxypeptidase 1; Penicillin-binding protein 5 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29476"
FT                   /db_xref="GOA:A5FV44"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV44"
FT                   /protein_id="ABQ29476.1"
FT                   /translation="MPLAMPTVRTSATMKRRLSLLTLALFTATSYAAGRTPAPGKGAAH
FT                   ATAAATTAPQDAGPAPVAPLAIPGVPMPPTLPQQASYVLMDADTGAVIAAKAPDQPWPP
FT                   ASLTKLMTAYLTYQAVAHGSLKMDQTVPVSVSAWHTGGSRMFISPGMTVTVDQLLHGLI
FT                   IDSGNDAAVALAQAVAGSRSGFVGLMNHEAKALGLKSTHYTNVDGLPNPDLRTTAMDVA
FT                   KLSRDIVRTYPQFLKISVKKHFTFDKIRQRSWNPVLFHDPTVDGLKTGRTKEAGHCIDA
FT                   TALRNGRRLIAVVLGGPSWTVSTHDIEALLDYGYQFYANAKVAVAGKPAGTLKAPLYRT
FT                   TAVAVGPAHSITMTIPALAAKTLKTSVALDPPPAAGVHRGQTVGTITVSAGGKTLATVP
FT                   AVALADDPPAGFVTRMMRKLKAAL"
FT   sig_peptide     complement(286166..286264)
FT                   /locus_tag="Acry_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.952 at
FT                   residue 33"
FT   gene            286395..287153
FT                   /locus_tag="Acry_0249"
FT   CDS             286395..287153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0249"
FT                   /product="signal peptidase I, Serine peptidase, MEROPS
FT                   family S26A"
FT                   /EC_number="3.4.21.89"
FT                   /note="TIGRFAM: signal peptidase I; PFAM: peptidase S24,
FT                   S26A and S26B"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29477"
FT                   /db_xref="GOA:A5FV45"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV45"
FT                   /protein_id="ABQ29477.1"
FT                   /translation="MAQTKDSVAGSIREWVVTLVYVVVIAVFIRSFLFEPFFIPSGSLT
FT                   PTLLPGDFVLVTKWNYGYSRWSFPFGEPDFKGRIFGSLPKQGQIAVFALPRDPSIDYIK
FT                   RVIGEPGDTVQVTDGQLYINGREVPRTPAGTYVETPLDSGEGVPIKVRLYREHLPDGVT
FT                   HLIAKATNRGFANNTPVYHVPPDHLFMMGDNRDFSEDSRYLDAVGYVPLANFVGRARII
FT                   WFSIRLDHPWWEFWYWPVDIRWDRLFTVIH"
FT   gene            287150..287815
FT                   /locus_tag="Acry_0250"
FT   CDS             287150..287815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0250"
FT                   /product="RNAse III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: ribonuclease III; double-stranded RNA binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29478"
FT                   /db_xref="GOA:A5FV46"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV46"
FT                   /protein_id="ABQ29478.1"
FT                   /translation="MSEAAEALLGHRFARPDLLAQALTHRSAVGQGGLGSNERLEFIGD
FT                   RVLGLLIAEWLIERFPHEREGGLGPRLAHLVSRQSLAEIAEHGGIAGLLSVSPGESRRG
FT                   VRNRATVLADALEALIGALYLDGGLEPARLFIRRIFAPRIDGQPSAPPKDPKTALQEYA
FT                   LARGPVLPAYELVERTGPSHAPRFRIRVTVAGRTAEGLAGTKREAEQNAARDLLEQLQ"
FT   gene            287812..288699
FT                   /locus_tag="Acry_0251"
FT   CDS             287812..288699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0251"
FT                   /product="tRNA modification GTPase trmE"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Era; PFAM: GTP-binding protein, HSR1-related; KH,
FT                   type 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29479"
FT                   /db_xref="GOA:A5FV47"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV47"
FT                   /protein_id="ABQ29479.1"
FT                   /translation="MTTRCGYVALLGRPNAGKSTLLNQAIGAKVSIVTPKAQTTRFRIS
FT                   GIVMRGGDQIVLVDTPGIFAPKRRLDRAMVAAAWEGVAGADLACLIVDAAKADPDDLAE
FT                   PIEALAATGRPRWLILNKIDLLPRDKLLPLAETLARQGGFAEVFMISALKRDGVDRLLD
FT                   ALAAAMPEGPHLYPEDELTDQTERMLAAELVREQIFLQLRDEVPYGASVETESFSERKD
FT                   GSVRIDVTVYVARAGHKKIVLGEGGARIKSIGSRARRDLERQLERRVHLFLNVKERPGW
FT                   DEEAARLRALGLDG"
FT   gene            complement(288738..289856)
FT                   /locus_tag="Acry_0252"
FT   CDS             complement(288738..289856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0252"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29480"
FT                   /db_xref="GOA:A5FV48"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV48"
FT                   /protein_id="ABQ29480.1"
FT                   /translation="MDFDFTEEQRLLRDSVGKLFASRYADFEKRKAYAKLPEGFDRAVW
FT                   AEYAEAGLLALPFDEAQGGFGGGPVETMIVMEEIGKALALEPYLAAIVFAGAVLRHGSS
FT                   AAVRDEVIPALAAGETIVAVAHTERSSRHDLEDVTTTAKRDGDHFILEGEKSVVLGGDT
FT                   ADWLIVSARLAGSRRDRDGIGLFLVDAKAEGVSRRGYPMQDLLRGAEISLASVRVPAAR
FT                   QIGDLAVLERARDETIAALCAEAVGAMEALVGLTVDYMKQRKQFGVAISVFQALQHRAV
FT                   DMYVALEQARSLAIFAALSVADDDAEARGKAMALAKAGVGKALHFVGQQAIQLHGGIAM
FT                   TMEYKAGHYFKRLTMIDTMFGNADHHRRRLAA"
FT   gene            complement(289867..291078)
FT                   /locus_tag="Acry_0253"
FT   CDS             complement(289867..291078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0253"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29481"
FT                   /db_xref="GOA:A5FV49"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR017617"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV49"
FT                   /protein_id="ABQ29481.1"
FT                   /translation="MELSFSPEEIAFRDEVRAFIRDNLPGDVQKRLIEGREIGKQDIVD
FT                   WQRKLNAKGWAVPHWPRAWGGQDWSPVQEFILLDELQSAPAPSPLPFNVSMVGPVIATF
FT                   GNDEQKRKFLPATANLDIWWCQGFSEPGAGSDLAGLKTTARREGDHYIINGQKTWTTLA
FT                   QYADWIFVLARTDPGAEKKQQGISFILVDMKTPGITVRPIQLIDGGHEVNEVWFDEVKV
FT                   PAENLVGEENKGWDYAKFLLGNERTGIARVGASKQRLRRIRELATIERAGDARLIDAPW
FT                   FREKLADVEIDLKALEITQLRVLAEARKSGKHGRPDPKSSILKIKGSEIQQATTELLLD
FT                   VVGPLAMPFQGSTDPDDDGNAMPIGPDDAAEAAPTYFNWRKISIYGGSNEIQRNIIAKA
FT                   ILGF"
FT   gene            complement(291181..292884)
FT                   /locus_tag="Acry_0254"
FT   CDS             complement(291181..292884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0254"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29482"
FT                   /db_xref="GOA:A5FV50"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR017618"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV50"
FT                   /protein_id="ABQ29482.1"
FT                   /translation="MSTRPFPWERNYPPGLGWDIDIPAETIPAMIARSVAENAALPALE
FT                   YRDRETGFAELGEAIGEVAAGLASLGHAKGERIALYLPNVPAHPFCFYGALTAGLVVAH
FT                   LSPLDAERELAHKLHDSGARTLVTTNLGAMLGMALKLLDAGHVERIIVADDAAFGEIPG
FT                   MAHPPIPTGDPRVMTLDALRARGRAFAFEPPAIAPDDLALLQYTGGTTGLPKGAMHTHA
FT                   TLRAAVAIYATFFDGQNRFPPGQKFRAICVLPLFHIYALVVLCLLQLSRGSTLLLRLKF
FT                   DAETTLRDIEVKKASYFPGVPTMWIALANVPDLDRRDLSSLRLVGSGGAPLPVEIGQRF
FT                   ERLTGMRLGGGWGMTETASAGTGNLLDGLFKFGSAGMPLPGIKLDVVALDDPSRVLPYG
FT                   ETGEIRIRSPNTFIGYWQNPEETARSFVDGHFLTGDVGYIDEDGMVFLVDRKKDMILSG
FT                   GFNVYPTVIESAIYEHPDVAEVIVVGVPDDYRGQSAKAFITLKPGAAEFTIESLRDFLA
FT                   DKLGKHELPAAVEFREALPKTSVGKFSRKELAAEERERHASARASGAAAP"
FT   gene            complement(292881..294977)
FT                   /locus_tag="Acry_0255"
FT   CDS             complement(292881..294977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0255"
FT                   /product="short chain enoyl-CoA hydratase /
FT                   3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="4.2.1.17"
FT                   /EC_number="1.1.1.35"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29483"
FT                   /db_xref="GOA:A5FV51"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV51"
FT                   /protein_id="ABQ29483.1"
FT                   /translation="MSEQKVGLEIANGVAVISIDNPPVNALGHAVRAGLVEQLAAAEAD
FT                   ASVRAIVLACKGRTFSAGADITEFGKPPRAPGLHEVIERFDNCRKPVIAALFGTTLGGG
FT                   LELALGCHYRVAVESARMGLPEVKLGLLPGAGGTQRLPRLIGPEKAVAAIVSGKMIGAK
FT                   AALADGLIDAIVSDPVQGAIDFAHTVDPAKLVRVRDRSDKIAAAKADPSAFEAAAAEAT
FT                   KRLKGVEAPAACVEAVRNSFTLPFDEGARAEQQAFMRLVVGDQSRAQRHVFFAEREAQK
FT                   IPGIGPEVKGAKIGRAVVIGGGTMGGGIAMNFANAGIPVTIVETDEAALARGLDRVRGT
FT                   YDVSVQRGALPAGTTEKRMALFSGSTDWGVIAEADIVIEAVFEELGLKKEVFARLDGIA
FT                   RPGALLATNTSTLDVDAIAAATKRPGDVLGMHFFSPANVMKLLEIVRGKESSAQSIATA
FT                   IAVGKTLGKVPVVVGNCDGFVGNRMLARRTIECERLMLEGALPQQVDAVVKAFGFPMGP
FT                   FAMGDLAGLDVGWRIRKHRGATAPVSDALCEMGRFGQKTGRGYYVYENGSRVPTPDPEV
FT                   EALISEKAAALGVTRRAISDQEILERMTYPMINEAARILEEGIAIRPSDVDVVWVYGYG
FT                   WPVWRGGPCFHADLVGLKEIAARLEHYATAVGDETLAPCALLRRLADAGQGFAAFAQDA
FT                   KAAS"
FT   gene            complement(295076..296074)
FT                   /locus_tag="Acry_0256"
FT   CDS             complement(295076..296074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0256"
FT                   /product="ABC-type Fe3+ transport system periplasmic
FT                   component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29484"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV52"
FT                   /protein_id="ABQ29484.1"
FT                   /translation="MRRLASLVLACLFGMPFAAHAASLTLYSRLDYAPAVARAFTAKTG
FT                   IAVRVRRPPPTGLADRIEREGAHPRWALAWFAGTPNAVALDARGLLARHLPVPAGLSPR
FT                   AAALIPADGSAIPTGLELGGVVLMSKSAPFTPPLHWHGLLAPARRGLTGMADPTTDDAA
FT                   WGGLASLLATEGWPDGRRFVTALGGAGLHIYATTADTVAALRSGAIQLALVRSAVAFHV
FT                   ASRIDPSLEAVVPAPAVLMPSLIVMPRHMTPALRRAASAFIAFACSPAGQRAALASDDM
FT                   DSAFWPVNATVPPPPGLPDLAALAPRDPAAVAANPLPAIAWFAREMVGPGL"
FT   sig_peptide     complement(296009..296074)
FT                   /locus_tag="Acry_0256"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(296074..297447)
FT                   /locus_tag="Acry_0257"
FT   CDS             complement(296074..297447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0257"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29485"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV53"
FT                   /protein_id="ABQ29485.1"
FT                   /translation="MSAAPQPTAKITVGEVLAEITALERDGRLEDAESLAERAVAASPG
FT                   HPHILHLSGIVAYRRGNIPRAIERIEKSLVLAPEVAIYPRNACEIYRGAGRLDDALAMA
FT                   LRAVELAPEERAAHFNLALIRYERHELDAGIEAADRAIALSPDFAEAHFERAELLLIGG
FT                   RLTEGWESYEWRFKLKQADGMLPKTDKPQWDGSPMPEGRLLLVADQGFGDCIQFGRYIP
FT                   WVAARAPKPVIACGGDLMPLLRQFPEVGRFANSWAAAGEYDAFMPLSGLPRLAGTTIAT
FT                   IPADIPYLRADPRKVEAWRQRLAALVPPGLKRIGLVWAGRPTHKNDRKRTVRLERFAPL
FT                   FARPDIAIVTVQKGDRIDEVGGYFGPAPLVNLGPSIFDFTDTLAILQCLDRLVTIDTSV
FT                   AHLAGASGVPTSIILPYAPDWRWLLDREDTPWYPSLRLFRQEHPSDWSGVVERVAGSL"
FT   gene            complement(297444..299324)
FT                   /locus_tag="Acry_0258"
FT   CDS             complement(297444..299324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0258"
FT                   /product="sulfotransferase"
FT                   /note="PFAM: sulfotransferase; Tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29486"
FT                   /db_xref="GOA:A5FV54"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR026634"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV54"
FT                   /protein_id="ABQ29486.1"
FT                   /translation="MSAASPSPAPRPDPAPCACGSGLRARRCCALDGGGPPDPAHHALV
FT                   APQVEQARAARTAGRNREAERLLLQVLDLAPLHREALRLLYEIRHAERRIPAAIALVAR
FT                   IAALPPETPAAHVQHAQLLIGQGRHAEAEAPARRALLLAPRDPSVHHLLGMIQTETGRP
FT                   TSGERHYRMAEALIEAPNPTLLGNLAWNLRQQGRLDEAAAVYGQALSGPARPVRALAGL
FT                   AQVEAGRGRFDAAEALLAEAGTSAAAPGDRMVAALIALSRLRAGDAEAALDRIAATEAA
FT                   IAPQPLLTTELAMRGRALERLGRHDEAWAAYLAGRDFQRERARRRFDPAPIEARLAGIR
FT                   ETFRADRLAGLPRPAPVANAPVPVFLLGTPRSGSSLLEHLLAQAAEIDPADNRAPLPGL
FT                   GRLLPRLVEGFGGPTLDFPAALEGTVAGEAQDIPAILASRYVALIRAAGIVGPQARFVT
FT                   DRHPELPWLLGLANTLFPGAPVIHVLRHPLDVVLSGFAQDRLYEGNAGVTLASLARLYD
FT                   AQMNAIAHVRGQTTMRYLPVRYEDLVTDTEATLRRVLDFIGLAADPAAMIAAPPRAVPR
FT                   VPAYRAELEPPHRRGVFRHRRFGDVFGEAMPVLAPWIERLGYAATPEGAA"
FT   gene            299456..300412
FT                   /locus_tag="Acry_0259"
FT   CDS             299456..300412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0259"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; protein of unknown function
FT                   DUF125, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29487"
FT                   /db_xref="GOA:A5FV55"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR017040"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV55"
FT                   /protein_id="ABQ29487.1"
FT                   /translation="MRNFSELSDREILALAIGAEEEDGRIYADIAESLRTDYPASAKVF
FT                   SEMAAEESEHRRSLIDLYQQKFGDHIPLIRRQDVRGFLARKPVWQLPTPSINDVRKLAE
FT                   SMEAETQNFYRLAASRTSDTATRKLLGDLAEAEADHERLADRLARENLTEEVRSAEDDT
FT                   ARRNFVLRYVQPGLAGLMDGSVSTLAPVFAAAFASGSPWQAFIVGIAASLGAGISMGFA
FT                   EALSDDGSLTGRGSPLMRGAITGAMTTLGGLGHTLPFLIPNFWTAMVLAFAVVVVELAA
FT                   ISWIRTKYMDTPPLQAALQVALGGAIVFAVGVAIGSS"
FT   gene            300444..301400
FT                   /locus_tag="Acry_0260"
FT   CDS             300444..301400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0260"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29488"
FT                   /db_xref="GOA:A5FV56"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV56"
FT                   /protein_id="ABQ29488.1"
FT                   /translation="MSAAQDLRNRLAIPVIGSPLFIISNPKLVIAQCIAGIVGSFPALN
FT                   ARPASQLDEWLAEITETLAAWDRDHPDRKAAPFAVNQIVHRSNARLEQDLELCVKYRAP
FT                   LVITSLGARPEVNQAVHGYGGIVLHDIINDRFARKAVEKGADGLIAVAAGAGGHAGTLS
FT                   PFALVQEIRTWFQGPLALSGAIATGRAVLAAEAMGADFAYIGSAFIATEEANAASAYKQ
FT                   AIVASGAEDIVYTNLFTGVHGNYLRPSIVAAGLDPDNLPQSDASAMNFHEGAKAKAWKD
FT                   IWGSGQGIGAVDAVVPAGERVARLIAEYRAARAALCG"
FT   gene            complement(301408..302073)
FT                   /locus_tag="Acry_0261"
FT   CDS             complement(301408..302073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0261"
FT                   /product="Glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29489"
FT                   /db_xref="GOA:A5FV57"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV57"
FT                   /protein_id="ABQ29489.1"
FT                   /translation="MIVVHHLEASRSQRVLWLLEELGLEYEVQRYDRDRKTRLAPPSLR
FT                   AVHPLGKSPVITDGGITVAETGAIVEYLIGTYGKGRLIPPEGTDERRRYTYWLHHAEGS
FT                   AMPFLVMKLVFDEMPKQAPFVLKPLMRAIGNKVGDAFLDPNLGANIRFWEDALANSAWF
FT                   AGDALTGADIMMSFPIEAANTRGLLRGNYPRLNAFLAAIHARPAWQRALERGGPYPFA"
FT   gene            complement(302070..302897)
FT                   /locus_tag="Acry_0262"
FT   CDS             complement(302070..302897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0262"
FT                   /product="Glycine cleavage T-protein, C-terminal barrel"
FT                   /note="PFAM: glycine cleavage T protein (aminomethyl
FT                   transferase); Glycine cleavage T-protein, C-terminal
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29490"
FT                   /db_xref="GOA:A5FV58"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV58"
FT                   /protein_id="ABQ29490.1"
FT                   /translation="MPVMTTIAYLPARGVIGIEGPDRVAFLQGLVSNDVTKAEPGRAVW
FT                   SALLTPQGRYLAEFFILTDGESLLLDAPGVAVPDLIRRLSRFRLRSQVALRDRSDEFAV
FT                   HAAWGGAPSAPGAIVAADPRLPAAGHRLLAPAPLAGAADETAYRAHRLALGLPDHDDLE
FT                   PEKTLLMEAGFGDLHGIDWDKGCYMGQELTARTRYRGLVKRRLVPVDAEADLPAAGAIT
FT                   AGEREVGTLRTSLGRRGLALLRLDALDARLSLDGIALTPDIPSWMTLPETATP"
FT   gene            302946..303842
FT                   /locus_tag="Acry_0263"
FT   CDS             302946..303842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0263"
FT                   /product="glycosyl transferase, family 9"
FT                   /note="PFAM: glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29491"
FT                   /db_xref="GOA:A5FV59"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV59"
FT                   /protein_id="ABQ29491.1"
FT                   /translation="MRILFIASSRIGDAVISSGAMERIRHDHPGARLTVACGAASAGVF
FT                   ARLPGLERLIIFEKQRQDRHWLSLWSRLVRDRWEVVVDFRGSALAYTLRAGRRIVVRGG
FT                   RRPGRRYRQIGASCGFDPAPLPVVWTAPQDRAIAAGLLPEGAPVLGLGPTANWDGKIWP
FT                   AGRFVALARALDYRRIAVFGGPGEAEAARAAPVLAALPGAIDLVGRVSVVEAAACLARC
FT                   ALFVGNDSGLMHLAAAAGTPTLGLFGRSRASEYAPAGRCAGFVAAPGLEGEAPMEGLSV
FT                   ESVIAAARELAARVGTA"
FT   gene            303839..304864
FT                   /locus_tag="Acry_0264"
FT   CDS             303839..304864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0264"
FT                   /product="Phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29492"
FT                   /db_xref="GOA:A5FV60"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV60"
FT                   /protein_id="ABQ29492.1"
FT                   /translation="MRVAQLMAGAANGGAELFFERMTLALHEAGEAVLPVIRPDPARMN
FT                   LLRAAGLDPVGLRYGGPLDCLTRPRAGAALRGFGAEVAMAWMSRAAFHAPRGDWALVGR
FT                   LGGYYPLKYFRRCDHLVGNTRDIVRWIGEQGWPRERIAYLPNFVADFAAEAPAAREGLG
FT                   VPAAAPLVLALGRLHEVKGFDDLIRAIEPVAGAHLVIAGEGPERAALEALVAARGLGGR
FT                   VHLAGWRRDVGALLRTADLFVSSSRHEPLGNMVLEAFSAATPVVAVAAEGPREIIRDGV
FT                   DGALVPLGDTQSLSAAIAALLADPARRADLAAAGRARFEAEFAAPVVMATWRDYLAGVR
FT                   R"
FT   gene            304864..306609
FT                   /locus_tag="Acry_0265"
FT   CDS             304864..306609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0265"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); PFAM: glutamine amidotransferase,
FT                   class-II; asparagine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29493"
FT                   /db_xref="GOA:A5FV61"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV61"
FT                   /protein_id="ABQ29493.1"
FT                   /translation="MCGIAGLALKPGARIAPETLAALARALAHRGPDGAGTHVSERAAL
FT                   VHTRLAIVDLATGDQPLFGAGAALIGNGEIYNNRELRAALPLVPFRTGSDCEPPLHLAR
FT                   AEADFVPLLRGMYALAIDDSERGVVTLARDPFGIKPLYRCAADQGTAFASEPQALLAAG
FT                   LARRRIDTARLVELLQLQFTAGTATVFTGIERVPPGALLTLRDGAEAALLDHPPIEPGE
FT                   APRDEDAALVALDAVLAQSVELHQRSDVPYGMFLSGGIDSAAILALMARLNETPVLAFT
FT                   AGFDRATVADERDDAEATARAVGARHERIEITEAMTWRYLPAIVAAMDDPAADYAIIPT
FT                   WFLARHARGSVKVVLSGEGGDEMFAGYGRYRAAARPWPFARPMRARGAFDGLDLLRDRG
FT                   EGWRAGLLRARQAAGGSGLARAQREDVATWLPDDLLLKLDRCLMAHGVEGRTPFLDREV
FT                   ARFAFALPDRLRARRGLGKYLLRKWLEANLPAARPFARKQGFDVPVAAWIAGQGQRLGE
FT                   LVSRAPVIAEVADPARVRDLFGRATDRRAGVACWRLLFLALWHHRHGLGGAVDGDVFEI
FT                   LGERA"
FT   gene            306606..307934
FT                   /locus_tag="Acry_0266"
FT   CDS             306606..307934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0266"
FT                   /product="Dihydropyrimidinase"
FT                   /EC_number="3.5.2.2"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29494"
FT                   /db_xref="GOA:A5FV62"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV62"
FT                   /protein_id="ABQ29494.1"
FT                   /translation="MTERYDLIIENGTLILPWGEATGRIGVRDGRITTLAATGDAAETI
FT                   DARGLHVLPGLIDPHVHFRDSGSGELPAVETMETGTRGAVLGGITAIFDMPNTGTPATG
FT                   QAALAAKRESLAGRAWCDVGLYVGATKDNIGELAALEAESGVCAIKVFAGSSTGNLLVE
FT                   DDASIERVMRAGRRRIAFHSEDEYRLQARRGEFSTGMAYANHAIWRDPECAALGTRRIM
FT                   ALARRTGRPAHILHVSTEEEFAYLRDFRDVASVEVLVNHLTQMAPDAYDRLGAYAVMNP
FT                   PIRDRRHVEAAWRAVADGLVDTIGSDHAPHPRAAKERPWPETAAGLTGVQTLVPVMLDQ
FT                   VAKGRLKLTRLVDLMAAGPARIYGAVGKGRIAAGYDADFTLVDLRRQQRIEAGWLASPC
FT                   GWSPFEGERVTGWPVMTIIRGQVAMRDGAVQGSPAGRSVTFRS"
FT   gene            complement(308460..308536)
FT                   /locus_tag="Acry_R0005"
FT                   /note="tRNA-Pro3"
FT   tRNA            complement(308460..308536)
FT                   /locus_tag="Acry_R0005"
FT                   /product="tRNA-Pro"
FT   gene            complement(308584..309174)
FT                   /locus_tag="Acry_0267"
FT   CDS             complement(308584..309174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0267"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29495"
FT                   /db_xref="GOA:A5FV63"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV63"
FT                   /protein_id="ABQ29495.1"
FT                   /translation="MTDEPHRHESTPDEHGRNRVRKSAEAYRTISEVADELHVPQHVLR
FT                   FWETKFPRIKPLKRGGGRRYYRPDDVLLLQRIADLLYIQGYTIKGVQRLLRESGGLLHD
FT                   EIPPASEEERAASAAERARADIPAPPAPRPDRLPELPIDPAPATSNPGHAPAAMPDADS
FT                   APLERARAATALLRAAMASVLAELEDLRASLDK"
FT   gene            complement(309171..309485)
FT                   /locus_tag="Acry_0268"
FT   CDS             complement(309171..309485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0268"
FT                   /product="integration host factor, alpha subunit"
FT                   /note="TIGRFAM: integration host factor, alpha subunit;
FT                   PFAM: histone family protein DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29496"
FT                   /db_xref="GOA:A5FV64"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV64"
FT                   /protein_id="ABQ29496.1"
FT                   /translation="MSTLTRAGLAESIYAAVGLSRNESAALLEAVLDRMKQALAEGESI
FT                   KISGFGTFSVRQKGRRIGRNPKTGREVPILPRRVLVFRPSQILRDAVDTGQVPSAAGQS
FT                   "
FT   gene            complement(309567..310529)
FT                   /locus_tag="Acry_0269"
FT   CDS             complement(309567..310529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0269"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) synthase
FT                   III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase
FT                   III C terminal domain protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29497"
FT                   /db_xref="GOA:A5FV65"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FV65"
FT                   /protein_id="ABQ29497.1"
FT                   /translation="MQRTVLEGVGSYLPERIVTNHELATRIDTSDAWIRERTGIGQRHI
FT                   AAAHETATFMGAEAARRALAAAGASADSVDAVIVATSTPDQGFPATAVSIQAAIGMTRG
FT                   FAFDLSAACSGFVYGVSVADAMIRAGQCRSALVIGTEVYSRILNWEDRGTCVLFGDGAG
FT                   AVLLRAGTGEDDRGVISTHIHSDGRYGDILFIDGATGQDDRPQHLVMNGREVFRHAVSK
FT                   LAGAVDEALAANDLTQADIDWLVPHQANRRIIDAMGKRLGLAPEQVVVTVDRHANTSAA
FT                   SIPLALDEAVRDGRIRRGHLVLIEALGGGLTWGSALIRF"
FT   gene            complement(310535..311677)
FT                   /locus_tag="Acry_0270"
FT   CDS             complement(310535..311677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0270"
FT                   /product="phosphate:acyl-[acyl carrier protein]
FT                   acyltransferase"
FT                   /note="TIGRFAM: fatty acid/phospholipid synthesis protein
FT                   PlsX; PFAM: fatty acid synthesis plsX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29498"
FT                   /db_xref="GOA:A5FV66"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FV66"
FT                   /protein_id="ABQ29498.1"
FT                   /translation="MPSPPPTPETATASDRTATPAPGMPILAVDAMGGDSAPGMVIAGL
FT                   DIAAERHPNARFEVFGDAVQIDELVRLSKRLRNRVSIRPTTEIIPNELKPTAALRLRDA
FT                   SLRRAIDAVANGEAAGVISAGNTGAMLALAKIVLKTMSGIDRPAMAAIGPSARGDVVML
FT                   DLGANVVCDARNLVEFAVMGELFARTVLGLPHPTIGLLNVGSEEMKGDETLRRAAEALR
FT                   ESPIGPQFRGFIEGHDIAGGTVDVVVTDGFTGNVALKTGEGALRLVGDLLRRVFSANIA
FT                   SRLAYLLARPGLTRLREWLDPRRYNGAVLLGLNGVVVKSHGGADAEGFAHAVDVAMDMI
FT                   VNRFNDRIRDDLGRHADRERLASDAFRATPPASATSVTTG"
FT   gene            complement(311765..311968)
FT                   /locus_tag="Acry_0271"
FT   CDS             complement(311765..311968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0271"
FT                   /product="LSU ribosomal protein L32P"
FT                   /note="TIGRFAM: ribosomal protein L32; PFAM: ribosomal L32p
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29499"
FT                   /db_xref="GOA:A5FV67"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FV67"
FT                   /protein_id="ABQ29499.1"
FT                   /translation="MAVPKRKTSPSRQGMRRSHHALGQQAHAECSNCGELKRPHHVCGH
FT                   CGHYDGREVVAAGKDLKGTVRV"
FT   gene            312113..313225
FT                   /locus_tag="Acry_0272"
FT   CDS             312113..313225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0272"
FT                   /product="SmpA/OmlA domain protein"
FT                   /note="PFAM: SmpA/OmlA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29500"
FT                   /db_xref="GOA:A5FV68"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV68"
FT                   /protein_id="ABQ29500.1"
FT                   /translation="MPVAQSGRRSRASAAKGCASSLAPVPEAAGGSAPGRRGYGSRASA
FT                   SCSTSSAPRSNTVPSATMSSGASGSREPASSGSPPASSRKLVRSAMVCSTGSSETTQLW
FT                   MTWAASSSLASAWSGPMRLMWNLPDSASTAGMPNCRAIAARASASASIVTSCAASPRRA
FT                   RSKCRDSGNGGASVIMKYWRILHDDGSSPIEPGPAATRGSSRVRRLATKLRPLFPLLLL
FT                   PALAGCALFTAQPRYRGTAVTEAQLKQLTPGVSTEADATALLGSPTLRETFHDHDWLYV
FT                   SQVTKPRIGQTLGVEKQQVVVLDFTGNGVLKSIRRVGGKQAVHVAMAGGRTHAPGGHAS
FT                   FLQQLVGGVGHYNPGLGAGSAGGLGGGSGF"
FT   gene            313230..314819
FT                   /locus_tag="Acry_0273"
FT   CDS             313230..314819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0273"
FT                   /product="phosphatase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29501"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV69"
FT                   /protein_id="ABQ29501.1"
FT                   /translation="MIGRRGVMAGSVAALAMAGTARASTSVLGTAEPVTSLPPGSEAPQ
FT                   LNDVVAPGWRRDVLIRWGDAVLPSAPPFRPGEVTLAAASQQFGWDAIIAGLVKMPPADD
FT                   GVRRLLMVVTHPDVEMRMAFPRGRGAATVAGKMQGASVLNLAMQNGRWVVVAGGYQSRR
FT                   ITDGTLCRIAGPAAASVGQTVQGVLAPSIGGVTPWNTVLLPEGHTAGWIRRLAGHAPGF
FT                   GSPTVGAGFGWVVELDAANPMSFPVKRTALGRLPRAGVACGLAADGSAVVFMSEDGPMG
FT                   RLFRFKGAAPAGTGEGALDAGTLAVAVIEHSHIVWHDLPAGLPSLTATASAGRRGSGFD
FT                   APSGMAIAPDGTLYLACRGNPGRGISQIDPLNPRAGNGAGHILAFAPEGGDPGARRFAG
FT                   RVVLLGGDPAHDSSSRYAPGSTAWLRAPSTLDLDGSGRLLIGTDQRGAVTDTADGLFAM
FT                   HPHGGLDLLYSAPVGGAVGGAAADPAGKTLFTVARHPGATRDADFADPATRWPTVRPGM
FT                   PPQTTMVSLAPD"
FT   sig_peptide     313230..313301
FT                   /locus_tag="Acry_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 24"
FT   gene            314881..316359
FT                   /locus_tag="Acry_0274"
FT   CDS             314881..316359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0274"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /note="TIGRFAM: succinic semialdehyde dehydrogenase; PFAM:
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29502"
FT                   /db_xref="GOA:A5FV70"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV70"
FT                   /protein_id="ABQ29502.1"
FT                   /translation="MLNTTGTVRLKDPALLREANYINGEWVQAESGKTLDVLNPATGEL
FT                   VGRVPAMGAAETRRAIEAAGRALAGWRAMLAKERAAILRRLYELMMANQDDLGAIMTAE
FT                   QGKPLAEAKGEIAYAAGFIEWFAEEGKRIYGDTIPQNAPGRRIIVQKQPIGVFAAVTPW
FT                   NFPSAMITRKAGPGWAAGCTGVIRPASQTPFSALALAVLAERAGMPAGVCNIITGPSGP
FT                   MGAELTANPIVRKFSFTGSTEVGAKLLAQCAPTIKKTSMELGGNAPFIVFDDADLDAAV
FT                   KGAIDSKFRNAGQTCVCANRILVQDGVFELFAEKLKVAVEALKVGNGMEPGVTQGPLIN
FT                   REAVEKVEAHIADAVAGGARIVTGGTRHERGGNFFTPTVIADVKHDALIFREETFGPVA
FT                   PLFRFNTEAEAIAMANDTEFGLASYFYARDVGRIFRVAEALEYGIVGINEGLISTEVAP
FT                   FGGVKSSGLGREGSKYGIEDYLEIKYLALGGLGG"
FT   gene            316373..316462
FT                   /locus_tag="Acry_R0006"
FT                   /note="tRNA-Ser1"
FT   tRNA            316373..316462
FT                   /locus_tag="Acry_R0006"
FT                   /product="tRNA-Ser"
FT   gene            316607..317830
FT                   /locus_tag="Acry_0275"
FT   CDS             316607..317830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0275"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29503"
FT                   /db_xref="GOA:A5FV71"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV71"
FT                   /protein_id="ABQ29503.1"
FT                   /translation="MVRVVNKLSPLKVAKLTAPGLYGDGNNLYLQIAPSGAKSWSFRFM
FT                   IRGRAREMGLGPVALMSLAEARMRAIECRRLLLDGIDPIEHRQTQREAKTIRGKTFATC
FT                   AEAYIEAHQAGWSNAKHAGQWRATLATYAYPVFAETPVGAIDLDLVVKALKPIWTDKPE
FT                   TASRLRGRIESILDYATTKGWRQGDNPARWKGLLENVLPAKGRIARVAHHPALKWRDLP
FT                   PFMAELAQQEGVAARALAFTILTASRSGETIGATWSEIDLAAKIWTIPEWRLKKRQGDH
FT                   RVPLTDPVLAILATMRAAAGTPAPAAFVFPGGKTGTGLSNMAMLILLRRMGRENITTHG
FT                   FRSTFRDWAAEATDYRHEVVEAALSHTVSDKVVAAYRRTDFFDRRRDLMVDWARYALSS
FT                   ADSEGSAS"
FT   gene            317827..318465
FT                   /locus_tag="Acry_0276"
FT   CDS             317827..318465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29504"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV72"
FT                   /protein_id="ABQ29504.1"
FT                   /translation="MTRDEDEQAPKPRNRRPRAPRIKTLPESMRDPRHNPDAALAEIRA
FT                   VLKEGGRPLSLDEAKAWLGRVDLRHFEAEIDPQTGAARSPERAECDKDGRLRFREPGEK
FT                   HGPGRLRMRSEQAIEQAEADFARAVNEVEQVSTLLHWQSTAASRSASVRSLQATEIADR
FT                   VCQLYDTLSLPARNRASVITKLLARDGHAITVQRVRQILATHRPRPTRK"
FT   gene            318727..319059
FT                   /locus_tag="Acry_0277"
FT   CDS             318727..319059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0277"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29505"
FT                   /db_xref="GOA:A5FV73"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV73"
FT                   /protein_id="ABQ29505.1"
FT                   /translation="MAGRAAGTEDRRVGYEAAAWGVGLMNAPLIFGQSASPEIDSATKQ
FT                   HSAESASGTQFMTLRDVADILDVSPSTLRRRIAEGALRVHRIGRAIRISQTDLAAFLAA
FT                   SRGAES"
FT   gene            319056..321113
FT                   /locus_tag="Acry_0278"
FT   CDS             319056..321113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0278"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29506"
FT                   /db_xref="GOA:A5FV74"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV74"
FT                   /protein_id="ABQ29506.1"
FT                   /translation="MIAEQLEFTGFGPNTGHRHTQYGEPLPADAVPNERNRMRTHSGER
FT                   RRARVMQDDLFGALCAETSDLASKTGIREPMAAEHSACNDGGGALDEPVDGAIIDPTTI
FT                   SLPANARARVAGDTVVCATPPATFAEALELLAASDTLPAARLKDLRRDVAWIEDHCPRN
FT                   RDGSVAAPLPCDPAALRPILKSLKFDRKKTGPKRFYNIKSSLAAIQRKTGWLPPRAPRR
FT                   PITTTAWASLLGMMSDGDLSRATMRRFAVFCEERNVAPGDVALEHLDAYHDALAATNAK
FT                   APDQTVTTIKSRWNRLCREQESFPGQELPARRNPNTIRDDANGIPPSFMADLNAYIAKL
FT                   RKPGPFEKGFTGPAAKSTVRTRGDILALAPHRLVKRGWPAATLTSLAAILTPTAVEAIL
FT                   TDYWDTNCAESGWTLGAEATAQALAAAARQWGKLPVAELEQVLDICREVRAKHRGFTAK
FT                   KLERLAQFDDPKIERRFLQLPETLWRKALRFAKAGKMKRAADTAKYALALAILFDKPLR
FT                   VADLSILDLALDFARDAKGKITGVKIAYGRASKRAPMVEGALSSQTVRMLETYVTRFRP
FT                   TLLHDESTSLFPGQEAGHLVSKSMATQIRALIGRELGVDVNSHLVRSYVGTVILDEDPR
FT                   AVALAQRVLGHQNATTTLKFYAAQRGRAANRHYAELIERRRRRLRMNVED"
FT   gene            321100..322200
FT                   /locus_tag="Acry_0279"
FT   CDS             321100..322200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0279"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29507"
FT                   /db_xref="GOA:A5FV75"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV75"
FT                   /protein_id="ABQ29507.1"
FT                   /translation="MSRTRSVTTIPPTPRPDAVPGNKEQHRSLPLATWPPEDRARWQRV
FT                   KEKQGLFDRQAILHDLKTPTVRGLEQSVGRFLAYLLHVRAMTPAASIGTLLSPELVNDY
FT                   VGVMRKCLRAGSVHEELRRLRAGLGIMLPGVELGWMNSLPLKPTRAEVLASRKPIDRPD
FT                   AARVLAAAYRAFDALPVMQRDTDTSQAARNALMVAFCDLFGLRLSDLARIRLGEHLRQH
FT                   GSRWRLMFPCGVKNDALLLFDVPPELAQRLETYLGAWRIALLGNRLDHGFLWIARGGKP
FT                   PLEKMIAMGIAKFGRLHLGRSLNSHVFRHAFAVTTVLRNPADADLAAAALGHTSEQMVH
FT                   GTYTRSGDQEISRLWLRKLTRKRRGL"
FT   gene            322246..322575
FT                   /locus_tag="Acry_0280"
FT   CDS             322246..322575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0280"
FT                   /product="Uncharacterized protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29508"
FT                   /db_xref="GOA:A5FV76"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV76"
FT                   /protein_id="ABQ29508.1"
FT                   /translation="MTIALRRPRMPIMNPAKQASAPSSRRDTLNLRIKSDDRGLIDRAA
FT                   ALTGKTKTDFVIDAARRAAEDALLDRTLFLATPDAFDAFRARLDEPPLPNARLQRALKT
FT                   TPPWE"
FT   gene            322577..323068
FT                   /locus_tag="Acry_0281"
FT   CDS             322577..323068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0281"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29509"
FT                   /db_xref="GOA:A5FV77"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV77"
FT                   /protein_id="ABQ29509.1"
FT                   /translation="MALTPPEPLAEHHDISGFNCGIASLDDWLRRRARANQAGGATRTF
FT                   VVTESGRVVAYYAIASGAISPNGTSGRFRRNMPDPIPVAVLARLAIATSAQGQGLGRAL
FT                   FRDATLRILNAAETLGIRGIVVHAISDQAKAFYLALGFEASPLDPMTLMVTLKDVRAAL
FT                   "
FT   gene            complement(323464..324210)
FT                   /locus_tag="Acry_0282"
FT   CDS             complement(323464..324210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0282"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; IstB
FT                   ATP binding N-terminal domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29510"
FT                   /db_xref="GOA:A5FU05"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU05"
FT                   /protein_id="ABQ29510.1"
FT                   /translation="MLNHPTLDQIHQLGLAGMARAFTELHANPETPSLSHAEWLGLLLD
FT                   REITVRRDKRLSTRLRHAKLRHDAAIEDVDYRSARGLDRALFQKLIQGEWIDAHDNLVL
FT                   SGPTGVGKSWLACALGHKACRDDRSVLYQRAPKLFTELALARAEGRHGRMIRTLGTVNL
FT                   LILDDFGLAPLDASARHDLLEIVEDRYGRRATIITSQIPPAHWHELIGDPTYADAILDR
FT                   LLHNAHRIELTGESLRKTRKQTPKTA"
FT   gene            complement(324228..325775)
FT                   /locus_tag="Acry_0283"
FT   CDS             complement(324228..325775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0283"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29511"
FT                   /db_xref="GOA:A5FTS4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS4"
FT                   /protein_id="ABQ29511.1"
FT                   /translation="MPVERIAMRDVREIVRLRMAGLSTRQVGIRVGVAASTVRLTLRRL
FT                   EAAGLDGPGALALSEAALERRLFEGSAGKRPGHRRVDEPDWGRIRRELQRKHVTLSILW
FT                   DEYIAEHPDGYRYSRFCELYRSWEARLPVTMRQTHASGEKLFVDYAGDTVPVVIDRLTG
FT                   ETRAAQIFVAVLGASSFTYAEATWTQTLPDWIEAHNRTLAAIGGVPALLVPDNARVAII
FT                   RACLYDPQVNRTYTDMARHYGTAILPARPRRPRDKAKVEVAVLLAERWLLGKLRNRAFY
FT                   SLAELNAAIAEFCRWLNEERVVRRLGATRRHLLETLDRPALKELPAEPYVLAQWRRRRV
FT                   GIDYHVEIEKHFYSVPYRHARAEVEARFTVRTVEIFLRGERIAVHARGSGNGKHTTIAE
FT                   HMPSSHRRYGDWTIARIHQEAARLGPSVATLCTLILERRPHPEQGFRACIGILRLARSV
FT                   GADRLDAAAERALTIGTLTYGSVKSILDHRLERAAGTASPDPTPIRHPNIRGGGYFH"
FT   gene            325989..326366
FT                   /locus_tag="Acry_0284"
FT   CDS             325989..326366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29512"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV80"
FT                   /protein_id="ABQ29512.1"
FT                   /translation="MGVGAFGKPGAIHIIEACFRRMKQTGLEVRPMYHWSPRRIEAHVR
FT                   LCVLALQIQRSAELRCGLPWARIAHILAGLKAVRYQIAGRTIVQRTKISPEAAEILKNL
FT                   GISKPKKLLTVIEPPQAKAAS"
FT   gene            326433..326975
FT                   /locus_tag="Acry_0285"
FT   CDS             326433..326975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0285"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29513"
FT                   /db_xref="GOA:A5FV81"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV81"
FT                   /protein_id="ABQ29513.1"
FT                   /translation="MNANPGVTERLNLVNRQIKTVLQRIDGLVEQLAGPETEPGQDTEQ
FT                   RDAAILRSLPGVGRIVLATLLAEAHQALQARDYQALRTLTGVAPVMKRSGRSCRVEMRQ
FT                   ACSGRPRTVVYHWARVATQHDARSRSRYAALRGRGHSHGPALRTVADRLLGIACVMLTN
FT                   RTMFDPEKMPTDRPKSA"
FT   gene            complement(327029..328759)
FT                   /locus_tag="Acry_0286"
FT   CDS             complement(327029..328759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29514"
FT                   /db_xref="GOA:A5FV82"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV82"
FT                   /protein_id="ABQ29514.1"
FT                   /translation="MSPLVIANELNHNLLKSFNYHFSVRPSVRTRALGDSMHRITVSFG
FT                   RIRPVASVIIGMTVLLTNAAVVCIIARSLGADINWDLLNYHFYNGYLWAHGKLIQDSLC
FT                   TEQSYLDPRLNFFYYLLIRNFAPLTVNLIIAGFQSLGISAAWLLCFHLLKIYNIRTRLI
FT                   LSSVAAISAIIGPIFWSEIGGTMGDTLLASPIILAIFFSLISQERDRLIYLFFAGLLVG
FT                   FVAGLKFTNMIYAVGFVFAFILTTLYRYKFNIRRLVIVETIFCFSFLSGFVLLYFNIGY
FT                   LLFVTYKNPIFPYFNNIFHSPYIGNYAIRDERWFPQNLIGYITLPFEFVVRHHPKPNQQ
FT                   HIIGMEIPFRTIFPALYFIISPSILLYLYFKKIKNNELYDIFFVLSFFAGSFFVWEEVF
FT                   SYYRYFAAAEMIFPTILLVLLVRWGRLIMHWRHHSMTYVAAALLVATAAAYSLPDSNWG
FT                   REAFSSSYFGASKREFKSYNNALLIVGFRPLGFILPYFPLDDRIIGLPEHLGITQKFQK
FT                   KYLRPLLDYKNIYYLTDAAEIKNDRELPAHYGVTVNYENCSIYKTSIYPVAVCPVQHTP
FT                   "
FT   gene            complement(329312..330535)
FT                   /locus_tag="Acry_0287"
FT   CDS             complement(329312..330535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0287"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29515"
FT                   /db_xref="GOA:A5FV83"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV83"
FT                   /protein_id="ABQ29515.1"
FT                   /translation="MARRRAPAIPDELLDQLLAGGDAAAALNSGDLVNALKKALAERAL
FT                   SAEMDYHLSDEAEAENSRNGYGRKSVSTGTGKIEIAIPRDRAGSFDPQLIAKCQRRFPG
FT                   FDDKIISMYARGMSTREIAEHLREIYGMDASAELISTITDAVLDEVTSWQQRPLDPVYP
FT                   LVFFDAIRVKIRDEGVVRNKAIHIALGVMADGTKVVLGMWIEQNEGAKFWLRVMNELKN
FT                   RGVEDILLAVVDGLKGFPEAITAVFPETIVQTCIVHLLRNSMDFVSYKDRKAVATALKD
FT                   IYRAVDARAAEAALADFEAGPWGQKYPAIGQSWRRVWQEVIPFFGFPGDVRRIIYTTNA
FT                   IEALNSKLRRAIRARGHFPSDEAAAKLLYLILNRSEKEWVMPPREWAMAKAQFAVIFGD
FT                   RFVRALAA"
FT   gene            330620..331225
FT                   /pseudo
FT                   /locus_tag="Acry_0288"
FT   gene            complement(331501..332604)
FT                   /locus_tag="Acry_0289"
FT   CDS             complement(331501..332604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0289"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent enzymes; DegT/DnrJ/EryC1/StrS
FT                   aminotransferase; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29516"
FT                   /db_xref="GOA:A5FV84"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV84"
FT                   /protein_id="ABQ29516.1"
FT                   /translation="MNVDFLPVYRPDLSGNEKLYVNQCLDTTWISSIGDFIDRFEGGFR
FT                   EITGAPYAWCVSNGTVALHLAIHCLDIGPGDEVIVPTFTYIASVNTIAQTGAKPVFVEC
FT                   RSSDWLIDIDDVEAKITPRTKAIMAVHLYGAVCDMPALSALAKSRGLHLIEDCAEALGS
FT                   TYDGKHVGLFGDVGTFSFFGNKTVTTGEGGMVVCKDEALARRLKTVKGQGQSPTQRYWH
FT                   VELGFNYRMTNICAAIGLAQIERLPTILARKRAIGDLYRRLCAERLGNIVSFQKLSANV
FT                   VSSDWLVSLLLPEGTDRTKVMGRMQENGVDTRPVFYCAHQMPMYSNSEHFPVSEAIAAH
FT                   GISLPSYPTLSSADVARVVETLANALV"
FT   gene            complement(332627..333898)
FT                   /locus_tag="Acry_0290"
FT   CDS             complement(332627..333898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0290"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29517"
FT                   /db_xref="GOA:A5FV85"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV85"
FT                   /protein_id="ABQ29517.1"
FT                   /translation="MRILWGTPYNVKSAIARYSRMVTRALVADGHTVEILRLEDKTALD
FT                   HDILDHNLPVHVPYTFDFARLRHDYDVCVINYGDYFPFHAGALDLAAATPAVAVFHDAN
FT                   LDGFLGGARQIHPKLDALLNRWPPPGLTLPEKCTLPKQDLSFFAALASGCVVHGSHYVD
FT                   DVVATCPGPTVQMPLCYPDVGAVPPAPDGSGAFIVTCFGMINPNKQPERILRALAVDPK
FT                   LRTHGRMHFVGAIDEGYRTRLAALAADLGLAAPEFTGWVDDAHLCASLAQAHLVCCLRH
FT                   PMTEGHSASIITALYAARPIVVNDVGSYAEIPDGLVHKIEAGEAPAPLAAVMAEIARDP
FT                   QAAEAAAAGAAAWARVRYSAASYVGGLIPLLEAAIACRPGLEAGRGMARRLTSLGMNFD
FT                   DSETGLPRSFLGCAGRPLMPTMSE"
FT   gene            complement(333910..334947)
FT                   /locus_tag="Acry_0291"
FT   CDS             complement(333910..334947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0291"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29518"
FT                   /db_xref="GOA:A5FV86"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV86"
FT                   /protein_id="ABQ29518.1"
FT                   /translation="MKVIVLNNASPFTWGGAEELADHLVRNLLASGAQAELLRIPFAWN
FT                   PPERLIEQMVMNFSFRLDQADRVIPLKFPAYLIPHRDKVFWLLHQYRQAYDLWDAGQSN
FT                   IPNTPEGSKIRAAISAADTQTFAAATRIYTNSRVTGKRLLDYNGFDSEVLMPPLNDPEI
FT                   FVNQGDEGYLLAAGRVNAGKRQTLLVDALAYLPPSIRMIVAGPPDSPADAQELVRRVAA
FT                   AGLQDRVKLDLRFLSRRELADYVGRARAVAYVPFDEDSVGYVTMEAFQASKPVVTTTDS
FT                   GGLLQIVHDDHTGTVGAPTPRALAEAIAKLMDDPARAAKLGQAGHKEWNGLGITWPHTI
FT                   EKLLT"
FT   gene            complement(334944..335993)
FT                   /locus_tag="Acry_0292"
FT   CDS             complement(334944..335993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0292"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29519"
FT                   /db_xref="GOA:A5FV87"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV87"
FT                   /protein_id="ABQ29519.1"
FT                   /translation="MKIALVSSVEPFVNGGYRNIVNWLVEPLQAAGHQVETIWLPFYDE
FT                   SNPLEQMWAYRLMDLESSCDRIVCFRPPAHLIPHTKKIVWFIHHFRIFYDLWGTPYSPI
FT                   SDTPSTRALRDAVMRMDEAALAEARLTFANSHVVADRLKRFSGVEAKVLFPPVESPECF
FT                   HCQDYGEEIVSVCRFESHKRQHLLAEAMALTRTPVRLRLCGRSQNDSYFASVRSAAGSA
FT                   ADRVTIEARWISEAEKVERLAGALASVYAPFDEDSYGYPTIEAAHASKATITTTDSGGV
FT                   SEFVIDGANGMIVPPTAEALAHAFDTLYADRALARRLGEAARARVAELGINWPSVVAAL
FT                   TAPLPGDAP"
FT   gene            complement(335990..336634)
FT                   /locus_tag="Acry_0293"
FT   CDS             complement(335990..336634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0293"
FT                   /product="Carbonic anhydrase/acetyltransferase isoleucine
FT                   patch superfamily-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29520"
FT                   /db_xref="GOA:A5FV88"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV88"
FT                   /protein_id="ABQ29520.1"
FT                   /translation="MSTLLLVGGGGHAKVVLDIAHAAGFSVVGFLDPDPAAPPIGEVRR
FT                   LGDDATAAALRAQGLTLAFVALGDNRLRRKIGERLRAEGFRLATLVHPSAVVSPSASIG
FT                   EGTVIMPLAVVNAAARIGEYVIVNTGAIVEHDCVLGDGVHVAPRSALGGCCTLGEEVFF
FT                   GLGACARPLSRIGAGAIVGAGAVVVGEIMANIVVVGAPARPLPGVDSEAIL"
FT   gene            complement(336631..337995)
FT                   /locus_tag="Acry_0294"
FT   CDS             complement(336631..337995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0294"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29521"
FT                   /db_xref="GOA:A5FV89"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV89"
FT                   /protein_id="ABQ29521.1"
FT                   /translation="MTPLLRTGRGSAVLSGQVAAALADTLKGDDESAAELTAISHPEAP
FT                   VGVERSRAARLLYRAALAAKPYLRPVLYRVEARISTAVNRAGSVVSLQSEIAALRATVE
FT                   QSDSVARLQSEIAALRATVEQSDSIARLQSEIAALRATVEQSDSIARLQSEIAALRATV
FT                   EQSDSIARLQSEIAALRAHVDLLLQRSIFPIREGMLASRNCYGFLVLPTADLANVGYLS
FT                   NGTLPEQGSRAVLDKLLAPGDVFIDLGANVGLFTLAGARRVGPAGRVHAVEPAPDLVTA
FT                   LRLMTALNQIANCVTIHPFAAGAMESETELFLAHTSGHNSLFAEEEGLAAIKVRLAPLD
FT                   ALIAPGATVSVVKIDVEGAELQALAGMARIISDNPQIVILSEFSPSIIRRVGGTLESWI
FT                   ASVHNMGLDILEIDEAAGTLAPLRAEGLEELVWINLVLHRPEGRARLAPLLPGAA"
FT   sig_peptide     complement(337924..337995)
FT                   /locus_tag="Acry_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.744 at
FT                   residue 24"
FT   gene            339218..341617
FT                   /locus_tag="Acry_0295"
FT   CDS             339218..341617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0295"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29522"
FT                   /db_xref="GOA:A5FV90"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV90"
FT                   /protein_id="ABQ29522.1"
FT                   /translation="MRLSSGVRHTDRVMQLSLMALLLSTSCLIPAAAYAQTVSAGEVSA
FT                   SSALSLPGVTTAPSQKKVFKSGNTTRVLNRKLLEAAGPVAGAAQMLSYAPGVQITGYGN
FT                   TGASKYTVTLNGVQQGWGGFGGFTGDGAIGVTLDGVPVVDPGSDLWQSNMIPQSGMIQS
FT                   VTTTYGPGNAADRWYNNLAGTIEFTPVQPTAKPGGDINLTYGSYGQKNIEFDLRTGNYH
FT                   GWSTVIAGGAGDGNSFRKSPDGFQSPSNDYSIYLKTVKNFSAGNFAFGGYFARSAGYRV
FT                   PVIPTSPIPGVTISGNAGAPLYSQQTSGFYSAPPYNYYEKFDTDALWMVFARENIELDD
FT                   STTLHNLTYYENFTRTHSRLYDFGSVGPQRYEYNNPYTNVIGDKLWLTEKLPFNTLNFG
FT                   GYYIHTLYNSRNNFYNTVLGGNKGVVNAGGKIRSSYFNVDNFAMFLQDDIHPVRALHII
FT                   PGIRFVSFQTTYSDSALQDFAFAPGVGLSTHCVLDGSTATSGTTQATDQGSSCGSHVSR
FT                   NGVEPSISANLQVMPWMALYGSYGEALRTPSVGGGGGLFQKINPTTGYQLELGQYYDIG
FT                   AKFHVENGRFLHHFVAGVDYFHLRYAKQSLSTQLANGNALFASGSSIYQGVNMFADDNP
FT                   LYNLYVFGNASFIDAKYQTYITGGTSYGGRHVPYVPSVNFNIGAYYDIPIGSMLLEPRM
FT                   WYQYTGSQYMFNNNTGAPSNRKMPGYGTLNMSAKLTVPVTLPYVGHKSMDVSLTALNIT
FT                   NNQYNAYEYIGTGGYFNYSGTVPASGFTYAYPGAPFTIYGSVGFHF"
FT   sig_peptide     339218..339325
FT                   /locus_tag="Acry_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 36"
FT   gene            341966..342544
FT                   /locus_tag="Acry_0296"
FT   CDS             341966..342544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0296"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TIGRFAM: TonB family protein; 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29523"
FT                   /db_xref="GOA:A5FV91"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV91"
FT                   /protein_id="ABQ29523.1"
FT                   /translation="MLAPPPKPKPVPPKPLPPPPKPVQPPKPHVPPPPPIPKPPLPVPV
FT                   PKPLPKPVPKPRPKPVVHHRPAPRPKPVAHQVPRPVAPTPPKPQPVPAAVQENALEAYA
FT                   GSVHAAVQGDLKVPEMVKMLHLSGVTELALRIAPSGQLLGVSVIRSSGAPPIDRAALAA
FT                   VRATRFPPFGATMPHHPITVDISIRLRTN"
FT   gene            342711..343733
FT                   /locus_tag="Acry_0297"
FT   CDS             342711..343733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0297"
FT                   /product="ABC-type Fe3+ transport system periplasmic
FT                   component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29524"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV92"
FT                   /protein_id="ABQ29524.1"
FT                   /translation="MRRVIAAGFGVAIIIIAAVLLWPAPARGLVLYAALDYAPAIGKAF
FT                   TKKTGIPVRVIRLSTGALLARITAEGHHPDWDIGWFDGATAAVSLDTAGLLAHGLRPPV
FT                   PLTATGRSMLPPDGAYIPTGFTLAGVFVMNNASTLKPPKTWNDLTAPLYHGVVGMNDPA
FT                   ISGPTYPALAGMLKQAGGWPQGKGFVAALKANGLQVFAKNDATLAALRNGTIKLAIVQS
FT                   SAAVNVARNIDHHLTVIYPRPAYVLPNVIVLPKGLHGRALREAKAFIAFVESPAGQAIR
FT                   KREGEGDSYYWPVTALPAPRHALPPLTTLDLATLDAARWGAREKTVLAWFAHAIDGAGS
FT                   "
FT   sig_peptide     342711..342797
FT                   /locus_tag="Acry_0297"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.706 at
FT                   residue 29"
FT   gene            343759..345315
FT                   /locus_tag="Acry_0298"
FT   CDS             343759..345315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0298"
FT                   /product="ABC-type Fe3+ transport system permease
FT                   component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29525"
FT                   /db_xref="GOA:A5FV93"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV93"
FT                   /protein_id="ABQ29525.1"
FT                   /translation="MRVGAAGLRAAIMAGLIATFFVYPLLRLLVMPFLSGHGAAGDWPA
FT                   FAVSLLLSVGTAIVAAPLGALFALFTTTAAGPVARAATLTLWGLFLTPSYMLTTGWMII
FT                   FSGHALRATLAGQAFFGVGGLLMLYVVKALPFSALVARATLAAADSAPAEAAAIHGVPF
FT                   IPRVRIGLRLLAPAMAVGFAIAVIETMQEFGIPATLGVTSHVPILTYAIYQHLAETLTD
FT                   FAGASILCWRLIAVAAVFGGLAMACRRQGAAIQHGRMRPPARQRPARRRELAFAALTCL
FT                   FALVGIVIPVAALFVRALQPLTASMPHPGAVLRSLGFGMVGATMSLGVAVLTLRLRAAG
FT                   ARRMTAVLDVALVANMAVPGLVLAASYIVAFNNDLLPLYGTRLLLLIGYTAGMAPLALR
FT                   MMQGALDDLDPNLVAAARLHGLPRLTRLVDIEGMLLIRPFTYAYLLVAAAIMFELPVSE
FT                   LLYPPGATPLGVAIVTLDQMSDYAASARLALFGLGAMAGLALLLAAGVALLAAPRRLRP
FT                   A"
FT   gene            345312..346361
FT                   /locus_tag="Acry_0299"
FT   CDS             345312..346361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0299"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29526"
FT                   /db_xref="GOA:A5FV94"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV94"
FT                   /protein_id="ABQ29526.1"
FT                   /translation="MSAALAIDGVAVQRGGRLVVEEASLGLAHGECVVLAGESGSGKTS
FT                   LLRVIGGLDRPARGTIRIGGAVVDDAAATFIRPESRGLGMVFQDFALWPHLSVLENVAV
FT                   VIRDRAGRDRKALALLDRFGVASCAGRLPATLSGGQQQRVGLARALAAAPRLLMLDEPF
FT                   SSLDVETRETLRTELRALIVESGLSALCISHDPADIARLADRVAVLEDRRLTACTTPDA
FT                   MFARPATPYAARLAGLCGGVRVPARGEGSDAAIALGGAQLAIPGGAARLAGAAQALLFW
FT                   PRGALSLAAEGVPATCIGAHFEAGHWQALLRLDGLAAPVPVQCAAPPPRGAVALRVAAD
FT                   RLHLFPFSG"
FT   gene            complement(346362..347585)
FT                   /locus_tag="Acry_0300"
FT   CDS             complement(346362..347585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0300"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29527"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV95"
FT                   /protein_id="ABQ29527.1"
FT                   /translation="MRPFVRRIVIWGVLAAAVGAGIVYSFRPRPVAVDVATVARGMLRV
FT                   TIDDDGETRVRHVYTLQAPLTGDLDRITADPGDPVTAGRTVLARIVPAPPSMLDTRTMA
FT                   EREAAVGAALAAKAQAAAERDRAETTLVFARTERDRARRLLPRRAISQREADDAERAFR
FT                   AAEAGLAAARAALELRDQELAAARARLLPRDAARRAAPAGEVVRVTAPVSGVVLRVIRR
FT                   SAGIVAAGAALLDIGDPHQLEIVIDPLSEDAVRMRQGEAAIVTGWGGSDLHAVIRRIDP
FT                   VGRMKVSALGIEEQRVDVVLDLTDPPARWQALGDGYRVDVHVITFQGDVLRVPLGALVR
FT                   MGDGWAVYVDDRGVARRRAVTVGARGGLEAEIRAGLAPGQRVVLYPGERIRDGTRIAIR
FT                   PAGAEDGS"
FT   sig_peptide     complement(347508..347585)
FT                   /locus_tag="Acry_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.669) with cleavage site probability 0.357 at
FT                   residue 26"
FT   gene            complement(347592..349955)
FT                   /locus_tag="Acry_0301"
FT   CDS             complement(347592..349955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0301"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29528"
FT                   /db_xref="GOA:A5FV96"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV96"
FT                   /protein_id="ABQ29528.1"
FT                   /translation="MSSLDRKLLRDLWRLRLQALAIALVIASGVALMVMALTTTESLEA
FT                   TTSAYYERARFADVFARLKRAPDSLEARIAAIPGVRVVETRIVESGLLDVAGYREPVVA
FT                   TLVSLPKSGPQRLNALVLRAGRLPAPGRLREAVVGEPFAEAHHLRPGDTIGAVLRGRRV
FT                   ALRIVGTALSPEFVYAIPPGGLMPDDRRFGVIWMGRDELAAAFGLKGAFDDVSLALSPG
FT                   QRPQPVIARLDALLARYGGTGAYDRAEQVSNWFLSNEIAQQKNMSRLMPAIFLGVAAFL
FT                   TNMVMARLVATERREIGLLKAFGYGGGAIFWHYAKLVLAIAAGGIVLGAVLGAALGNWN
FT                   TRLYREFFRFPFLLYQPGPRSFAIAAAVSLATSLAGGMGAVGRAARLPPAIAMQPAPPA
FT                   VYRRSRLGPAALGRFLDGPSRMIVRRLLRWPLRAFLASAGLALSVGVLILALQWVDAVN
FT                   ALVETHYERGQRQDATITFNDLRPRGVLDDIRHLPGVLAAEPFRIVPARLARGRAEQRE
FT                   PVIGVPAGARLAPVHDVARGPIDMPADGLVLSRQLAGLLHAGIGDPVRVQLLEGRRAVL
FT                   MVPVVRLFDTYIGKPAYMNLAALNRRMGDGSVLSGVHVTLDEPRRAAFLARLRTLPGIA
FT                   AIQFRRAAIDTFHRTMGETIDIFLGFFIGFASALSVGVIVNAIRIALSERERELATLRV
FT                   LGFSRAEVAYILLGEIELLVWIAIPLGCGAGTLLAWYFGKAFETELFRVPPVIYPSTYG
FT                   TAALIMIATAAIVAAWLRRHLDRLDMIAVLKTRE"
FT   sig_peptide     complement(349845..349955)
FT                   /locus_tag="Acry_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 37"
FT   gene            complement(349962..350714)
FT                   /locus_tag="Acry_0302"
FT   CDS             complement(349962..350714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0302"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29529"
FT                   /db_xref="GOA:A5FV97"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV97"
FT                   /protein_id="ABQ29529.1"
FT                   /translation="MEPVAGGVALPDEERAAPVALVARGLAKIYRMGAVEVPALRDVDL
FT                   TLREGELVVLLGPSGSGKSTLLNILGGLDTPSAGEVLFRGQPIAQGGERGLTRYRRRHV
FT                   GFVFQFYNLIASLTARENVALVTEIAEAPMAPEAALELVGLGDRLDHFPAQLSGGEQQR
FT                   VAIARAIAKSPDLLFCDEPTGALDSRTGILVLEAILKVNGELGTTTALITHNAVIADIA
FT                   DRVLSFADGRIVGTRVNPVRHSPAGLVW"
FT   gene            complement(350817..351140)
FT                   /locus_tag="Acry_0303"
FT   CDS             complement(350817..351140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0303"
FT                   /product="protein of unknown function DUF190"
FT                   /note="PFAM: protein of unknown function DUF190"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29530"
FT                   /db_xref="InterPro:IPR003793"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV98"
FT                   /protein_id="ABQ29530.1"
FT                   /translation="MEEQVTLVRIALSETDHGRRRHLMEDILTRLRDDFDLDGVSVFRG
FT                   IAGMNGQKIIHAADLLHFDVDLPLMIEICCAPDTAISVIDSLADLVPDGHIISWPATRH
FT                   RRA"
FT   gene            complement(351142..351723)
FT                   /locus_tag="Acry_0304"
FT   CDS             complement(351142..351723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0304"
FT                   /product="camphor resistance protein CrcB"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29531"
FT                   /db_xref="GOA:A5FV99"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:A5FV99"
FT                   /protein_id="ABQ29531.1"
FT                   /translation="MRSGRAGDGVRREPPAGLMTPVSIRQPRRDRRARFRHFRSGHGRQ
FT                   ASALPRRHPLDIPDISATTRRRFMIKTLAAIAFFGSLGCWARYGQTIFMQNLFGRGFPV
FT                   AVLSINVLGSFLIGFLFVLTAERVAIDPAIRTGVLTGFLGGYTTFSTFELETLMLVENG
FT                   EIVKSALYVLLSVVLGFIGAVLGVYIARNV"
FT   gene            complement(351774..353018)
FT                   /locus_tag="Acry_0305"
FT   CDS             complement(351774..353018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0305"
FT                   /product="transporter, YbiR family"
FT                   /note="PFAM: Arsenical pump membrane protein; Citrate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29532"
FT                   /db_xref="GOA:A5FVA0"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVA0"
FT                   /protein_id="ABQ29532.1"
FT                   /translation="MHGDLFGSWQPAATVVIFALTYAGVALGRLPFFRLDRAGIAFVGA
FT                   VLMVASGALTLRQAVAAIDFDTIALLLGMMILAAALRRAGFFERITGAVLSRASGTDAL
FT                   LALTVAMAGLLSAVLVNDTVCVVLTPLVLEACRAGRKQPLPYLVALATASNVGSVATIT
FT                   GNPQNMIIGSLSGIGYAAFAGALVPVALLGLPIVFLVIRLLHRAGFEALTAPAASAARR
FT                   RPHGGLIGKSVVLLVLFVIACLGGMRPAEAALVAAALIMLTPGVKSQRLLAGVDWSLLL
FT                   MFAGLFVVVAALQREVIGAAVIGRVAALHPGRPAVLVPLTAILSNLVSNVPAVLVLRPF
FT                   IAHLADPRQAWLIVAMASTLAGNLTLPGSVANLIVAERARAAGVRIGFGDYLKFGLPIT
FT                   VLTIALGTAWLVGIG"
FT   gene            complement(353179..355302)
FT                   /locus_tag="Acry_0306"
FT   CDS             complement(353179..355302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0306"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; protein of unknown
FT                   function DUF214; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29533"
FT                   /db_xref="GOA:A5FVA1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVA1"
FT                   /protein_id="ABQ29533.1"
FT                   /translation="MPGAVPGAVIELRGVSRTYRSGDVEVQALREVDLVIGPGEFVAIM
FT                   GSSGSGKSTLMAILGCLDRPSRGEYRFESVDVARLEEPELARVRSARIGFVFQSFNLLA
FT                   RTSALDNVALPLFYASDGPVKGGSRTARALRALGQMGLAGREGNTPSQLSGGQQQRVAI
FT                   ARALINAPRLLLADEPTGNLDTRTSHEIMETLAALNRERGTTILVVTHEPDIAAYADRV
FT                   LTMRDGRIVGDERREKARGEAAPAVAEAAPDAAPNETPDAAPARRRAGIAWAFGAMIVG
FT                   AAVQALARNRLRSALTMLGVFIGVAALITMVAVGQGANQAIRKQIESLGTNLLVVLPGA
FT                   TTAGGARAGFGSASTITVDDARAILREDPAVSRIGYLIRAAGQVRYASQNWTTAIAGVS
FT                   IDYPAMTNWRVAEGRPIGAQDERNGALVGLIGQTVRQQLFAPGEDPVGATILVKGTPIR
FT                   VIGVLAGKGQTAFGTDQDDIVMLPFSTAEQRVLGTATPSRQDAPLNWAYPAWPNPYGLQ
FT                   LRLTGYVNQLFAQAVSPDAVAEAMEQISGTLSVRHRIQPNGLKDFSVRNLSQIAAAAQG
FT                   SSRIMSLLLAIVASISLLVGGIGIMNILLVSVTERTREIGLRMAIGARRLHVLLQFLAE
FT                   SVFLSVTGGLGGIVLGVALSGGITLFAGWPAPVSLLAVAGGFLFSVAVGVAFGFYPARK
FT                   AARLDPIEALRYE"
FT   gene            complement(355316..356557)
FT                   /locus_tag="Acry_0307"
FT   CDS             complement(355316..356557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0307"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29534"
FT                   /db_xref="GOA:A5FVA2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVA2"
FT                   /protein_id="ABQ29534.1"
FT                   /translation="MTVSPNPPANTQRPPPSAPPEPAAAPRRRRVRRGAVLAALAVGVA
FT                   AAIAIGWRTVGAPPPVHYVTAKVGRGDITRAVTATGTVNPILTVIVGSAVSGIIQDISC
FT                   DYNTIVKLGQICARIDPRPYQAVVDQDRAAVAVDQAQLRKDEASLDYARGNYRRLASLV
FT                   PQRYASENAADSAKATYRQLEAQTALDRAVIRQDEAKLAAAQANLGYTDIVSPVNGIVV
FT                   SRNVTIGQTVAASFQTPTLFLIATDLTRMQVDTNVSEGDIADIRKGEAARFTVLAFPGE
FT                   TFDGTVTQVRQSPQTVQNVVTYDVVIEVDNRDLKLKPGMTASVRIITAARAGVLRVPDQ
FT                   ALRFTPRLAKAAPAGGGARVWVLRQGKPAAVPVVTGLDDDTNTEIVSGGLRDGDEVITG
FT                   ERRARAATPFVPRF"
FT   gene            complement(356674..359730)
FT                   /locus_tag="Acry_0308"
FT   CDS             complement(356674..359730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0308"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29535"
FT                   /db_xref="GOA:A5FVA3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVA3"
FT                   /protein_id="ABQ29535.1"
FT                   /translation="MMGGFAAFLGRQQKAILFLMASLALAGAVGALSLPVGLFPRTSFP
FT                   RVRINIDSGARPAHEMMLQVTQPVEQALRAIPGVRGVRSTTSRGSMQAFIDFDWGTNMR
FT                   AATLEVDAALAQQLPDLPKGTRYVVRRMDPTVFPIIAYALISHSISEAELRTIARYRIV
FT                   PVLERIPGVAKIGVQGGDTPEVHVIVDPAKLAAMHVTLASVEQAVSRSNVLASVGRLAD
FT                   HDSLYLVVQQNTLRTMAQVRRIVVGGGPDGVVRLGQVARVEMGRVPRYDRVSENDHRAV
FT                   TLQVFQQPSGNAVQVDAAVRRALAAYETRLPAGVRLVKWYDQSTLVTAAAGSVRDAIAI
FT                   GVVLAGLVLIGFLRSWRVTLIALLVLPASMATAVLILTLLGMSFNIMTLGGLAAAVGLV
FT                   IDDAIVMIEHVARRAGRAGGIAARGAVLAAAEEFLAPLAGSSLATLIVFVPLAFLSGVT
FT                   GAFFKALSITMASTLVASWLFSAFAVPVLARWLIDFDKWHDPVAGGGARESLLARAHGW
FT                   LLDLVVARPAWLLVALIPFVLAGAYAYAVVPTGFMPRMDEGGFVINYQARPGTSLAEGA
FT                   REIRQVGDILRADPAVATWSTRLGAGLGGDLNEPYQGDIFVQLRPLGQRAPIWTVMDRV
FT                   RRRIIDRVPGIDFDESQLMSDLLGDLVSQPEPIEIELHGDPARLDETAKRVAAAIGRIP
FT                   GVVGVQDGVVIAGDSIDIHVDPAKAAMFGFDPAAVERMVATALRGSVVTALPGQERFTG
FT                   VRLELPRDAFAQTGDLLRLPLAAPSGALVPLGAIATLRTVSGRPEIDRDNLRQIVAVTG
FT                   RISGGGISAAIASVRRVLARPGLLPPGMSYRLGGLYRQQQKAFIGLARVFVAAVLAEFV
FT                   LLLFLYRSFVIAGAIVATALLSSLAVFIGLDLSGVALNITALMGMTMIVGLATEMAIFY
FT                   ISEFRSLAGYQDRREALVVASRNRLRPIAMTTLAAILTLLPLALGIGQGSGMQQPLAIA
FT                   VISGFVVAFPLVLFGLPALLRLVLRGPEP"
FT   sig_peptide     complement(359635..359730)
FT                   /locus_tag="Acry_0308"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.496 at
FT                   residue 32"
FT   gene            complement(359727..360776)
FT                   /locus_tag="Acry_0309"
FT   CDS             complement(359727..360776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0309"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29536"
FT                   /db_xref="GOA:A5FVA4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVA4"
FT                   /protein_id="ABQ29536.1"
FT                   /translation="MTRFFGSGARRLGLLLVAGAGFAGHAALAEGPSVLVTTAPVTQGA
FT                   LERSVTAYGRIAPGAGAARTLATAYAATVTAVEARPGMSVRRGQVIARIETAPATRAAY
FT                   AQAVATRDETLRVLAHTRALLARHLATRTQFAQAEQAARAVLAALDALKREGADRAMAT
FT                   VEAPFAGIVTAISAAPGAALPAGTAIATVVRRAGLVAVVGVDPGDARRLAAGQAALVQV
FT                   LGGAALRGRIDMLAGEVDPRTGLVDATVGLGGAPALVGAMVRARIDTGTVRGVIVPRDA
FT                   ALPAAGRDVIWQVRDGHAVRVVVRVLASARGRSIVAGRIDPALPVVVSGNYQLRPGIAV
FT                   RIARPGQGG"
FT   sig_peptide     complement(360687..360776)
FT                   /locus_tag="Acry_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.933 at
FT                   residue 30"
FT   gene            complement(360781..362142)
FT                   /locus_tag="Acry_0310"
FT   CDS             complement(360781..362142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0310"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29537"
FT                   /db_xref="GOA:A5FVA5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVA5"
FT                   /protein_id="ABQ29537.1"
FT                   /translation="MIRSPLVRLRRLAGLGALLGLSACARFHPAPLALRPSPAASLAAL
FT                   DRALPGGGTIAARGALTPGAYAALAVLNDPALAAGREGVRLASARQFAAGLLPDPQVSG
FT                   GFAALLGGPGIAPSISGGIAQDIAALATRGPRLSAARARTAAAAARFEWQEWQVAAKAE
FT                   TLAIGLWGEQRRLAALARARDALAGLDRASRAAIKQGDLALGAGAAAAASLAGIETARD
FT                   AIARREQADHAALAALLGLAPGAALPVSEPDSAPLPARRVAALVGSLARRRPDLIALRY
FT                   GYRAADADLRAAIRAQFPLVSLAVNGGTDTTRVASLGPTITLDLPLFDGHRGAIAVARA
FT                   SRRQLAAAFRAALDQAAGQAEAAQQALTLLDAEYRRAVRGAAIARRDAAAARRAYAAGL
FT                   IDARAEADLIDAAANRRAEAIDLRARIAAGRVSLRTLLGAGLPVIRSLSASGKD"
FT   sig_peptide     complement(362065..362142)
FT                   /locus_tag="Acry_0310"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.891) with cleavage site probability 0.451 at
FT                   residue 26"
FT   gene            362240..362974
FT                   /locus_tag="Acry_0311"
FT   CDS             362240..362974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0311"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29538"
FT                   /db_xref="GOA:A5FVA6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVA6"
FT                   /protein_id="ABQ29538.1"
FT                   /translation="MILGFVHDRTDAMTQPCLAILLVEDDELTANLVRAALGAEGHLVA
FT                   VAADGRDGLLRAAAGHEGRAWDLLIVDRMLPGLDGLALVRTLRGAGLSMPALFLTALSG
FT                   IDDRVEGLRAGGDDYLVKPFAAAELAARVAALARRGEMRPSGPVLRVEDLELDRLTRAV
FT                   TRAGRRIDLKPREYEVLEYLMRHAGRVVTRTMLLEDVWNFHFDPRTSVVESHVSRLRAK
FT                   LGAGRELLHTVRGAGYRIGDPA"
FT   gene            362971..364380
FT                   /locus_tag="Acry_0312"
FT   CDS             362971..364380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0312"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase, HAMP region domain protein; histidine
FT                   kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29539"
FT                   /db_xref="GOA:A5FVA7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVA7"
FT                   /protein_id="ABQ29539.1"
FT                   /translation="MTRRWPASGQPAILRTSGVRLAALGAAVAAMGAVIVFVVIYYGTL
FT                   GSLRQTLDASVTNEIGEILPQGPATPPAVAAIAIRAALAQRPSRIFYALAGPNGAPLAG
FT                   NLRLPPPAPGWHTLDAPEADAFAPGVTELRVLVVRLRGGASLLVGVDGTMIRRLNDLIR
FT                   RSFLIGFGLTLSLGLAAGIGFGRKALARVNAVSLASREIMAGDLSRRIPLAGTGDEFDR
FT                   LAETVNAMLDRMQHLMENLGAVGNDIAHDLRSPLARLRETLELALRDPDPAAAGAAIAE
FT                   AIAQVDGALALCGAILRLAQIETGARRASFSDIDLTDLLDRLVETYETVAEEADHRLAA
FT                   HVPRGLAIRGDAQLLNQMFANLIENAITHAGSAARIGLVARADPAGVTVRLTDDGPGIA
FT                   PDRRGAALRRFGRLDPARHRPGYGLGLPLSAAIADLHDARFTLDAAAPGADRPGLAVTL
FT                   VFPAGGVPRPG"
FT   sig_peptide     362971..363069
FT                   /locus_tag="Acry_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.887) with cleavage site probability 0.688 at
FT                   residue 33"
FT   gene            complement(364405..365304)
FT                   /locus_tag="Acry_0313"
FT   CDS             complement(364405..365304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0313"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29540"
FT                   /db_xref="GOA:A5FVA8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVA8"
FT                   /protein_id="ABQ29540.1"
FT                   /translation="MPAPEISGMIGAMKDDNRFGAYLRSRRARLDPASLGLAAGRRRTA
FT                   GLRREEVAQRAHISATWYTWLEQGRGGNPSAEVLDRIARALMLTEIEREHLFLLGRGHP
FT                   PEARYRGGDAITPRLQRLLDALPFSPAIVRTATWDVVAWNRAAAAVFTNYAALPAGQRN
FT                   ILRMIFTDPRVRAAQFDWAAMARAVVGAFRVDAARAGADAEVAPLVDELCRASPEFAAM
FT                   WNENEVMPQGDGAKRLRHPVIGPIALEYSSFAVDGRPDLSMIVYNPATPDDAGRVRALL
FT                   ASRADPAGPDAVLDAVDK"
FT   gene            complement(365304..365765)
FT                   /locus_tag="Acry_0314"
FT   CDS             complement(365304..365765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0314"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29541"
FT                   /db_xref="GOA:A5FVA9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVA9"
FT                   /protein_id="ABQ29541.1"
FT                   /translation="MADARLTDEDYEMLASFRFALRKFIAFSEAAARRDGLTPRQHQAL
FT                   LGIRAMQGQGAASVSDLAAFLILQHNSTVELVDRLVAAGFVARATDPEDGRRVRLALTG
FT                   SGEARLAALSQTHLDELEQIGPELRRLLARIQRYRRRVRGATRCGDAGG"
FT   gene            365851..367680
FT                   /locus_tag="Acry_0315"
FT   CDS             365851..367680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0315"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; Cl- channel,
FT                   voltage-gated family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29542"
FT                   /db_xref="GOA:A5FVB0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVB0"
FT                   /protein_id="ABQ29542.1"
FT                   /translation="MSPSPSLPPPVRLGDFTTDRGIFRLIGFGACAGLFGVIAGWILLR
FT                   MIGLINDLAYYGVWSTRMLAPGGAAPGGHPALWTILVPAGGAVLIGLMARYGSEKIRGH
FT                   GIPEAIEAILLGGARLDLRVAILKPISSAISIGTGGPFGAEGPIIMTGGAAASLMAQCF
FT                   TLTDAERKTLLVAGACAGMTAVFGTPVAALLLAVELLLFELKPRSIIPVGVACITAAIL
FT                   RRFCMTPAPLFPYAGGVIVDPLHAFGWLGLGLAAGLGSALLTVLVYAAEDGFETLPIHW
FT                   MWWPVLGGLVVGIGGVFDPAALGVGYPDIARLLAGTLAGGAAIRLVLVKGVIWSVALGS
FT                   GTSGGVLAPLLIIGGALGAVLAPVMPHAAPGFWAVLGMAAMMGGTMRAPLTSTLFAVEL
FT                   TGNHLILLPVLAASMASMAVTVLLMKRSILTEKIARRGHHLTREYSIDPLAVTRIRDIM
FT                   ATEVDTLAADLPVGAAIERFLSHAAAHRAFPVTAPDGLVLGLVSRADILDWIGDEVRRD
FT                   LPLRAMIAGREVTTAAPDEMADTIAVRMLTRNAPRIPVVDAEGRLLGIVSRADLLRVHQ
FT                   RVMLAETRRERFFPFRRRAAAKEAQKPEPLAVP"
FT   gene            367771..368979
FT                   /locus_tag="Acry_0316"
FT   CDS             367771..368979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0316"
FT                   /product="diaminopropionate ammonia-lyase"
FT                   /note="TIGRFAM: diaminopropionate ammonia-lyase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29543"
FT                   /db_xref="GOA:A5FVB1"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR010081"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVB1"
FT                   /protein_id="ABQ29543.1"
FT                   /translation="MLILNPDPAHGAPLDAADAALLGADPADELARYLAHRPDHRPTPL
FT                   IALPCLAARLGVAALHLKDESTRFGLGSFKALGGAYAVVRLVLEEAARRLGRPVGYADM
FT                   AAPEVRRVAATMTFACATDGNHGRSVAQGAAMLGGRCAILVHAGVSPARVAAIAGLGAE
FT                   IIRVDGTYDDSVEEAARLSAARGWTVVSDTSWPGYERIPGLVMQGYVAMVDEALAAMPA
FT                   PPTHVFVQAGVGGLAAAVAGHLAERLGARRPTLVVVEPDRAACVLETARAGRPVRIAAG
FT                   APTVMAMLECYETSLVAWRILARAADAFMTVSEEDAVAAMNRLARPEAGDMAVVAGESG
FT                   GAGLAGLLRVAGDAGARQALGCGAEARILVFNTEGATDTARYRDLVGLDPALVAGAGSA
FT                   PDQ"
FT   gene            complement(368973..369968)
FT                   /locus_tag="Acry_0317"
FT   CDS             complement(368973..369968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0317"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29544"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVB2"
FT                   /protein_id="ABQ29544.1"
FT                   /translation="MKLRMSFASAAAIAAALFCGTAAAAPQHKLGAGLTMYFQMGGSPG
FT                   DASTLPRELGAKAAAKALGVRLISQYSDWQPEKMIEQFRQAIAAGPQCAEIMGHPGNAA
FT                   FAPLVSKAEAQGMVVTAGNVPLPKLEAKYRTNGFGYVGTYLVQGGETTAAAMVKAGHLK
FT                   PGDEALEYGVFAEGIRGESDEGLVMGLKKAGLKVYKLNISNAVNADPALSVPILVAFIE
FT                   RHPKLKAIGTQQGLVTSFIPKALQEAGKKPGQIVVGGIDLAPTTIAGVKSGYIAATLNQ
FT                   QLYMQGFLPVVQCVLTKRFDLEGMNVNTAAGTDDKALLDKIEPLIKKGYY"
FT   sig_peptide     complement(369894..369968)
FT                   /locus_tag="Acry_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(370018..371052)
FT                   /locus_tag="Acry_0318"
FT   CDS             complement(370018..371052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0318"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="PFAM: inner-membrane translocator; 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29545"
FT                   /db_xref="GOA:A5FVB3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR035568"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVB3"
FT                   /protein_id="ABQ29545.1"
FT                   /translation="MSGSDVSTGRPAAPKSSPRWHAHLGAVPIIVVFFALIGIYIGFAP
FT                   EVFLRWPIYNSFLVTIPPMLVLSLGLTLVIAAGEIDLSFPAVIALSGFLFAFCADKLHM
FT                   PWLGLVAAIGGGALVGVINGWLVAALGIPSIIITIGTSFFWSGVATVLSGGLSYALNDL
FT                   TGTVIARVFSGTLLGVPVEALWAVAVAALIWAILNRHRFGEHLLFIGDSREVARVVGIN
FT                   TVRERIKLFTLMGALAGFASFLMTVANLSYFSTQGQGLLLSALAAVFIGGSSVFGGSAT
FT                   VVGSFFGAMIIGMLDAGIVATGVSGFWVEVIVGLVFVAAVVLHTGLGDPARVKALQRRL
FT                   MQRE"
FT   gene            complement(371049..371897)
FT                   /locus_tag="Acry_0319"
FT   CDS             complement(371049..371897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0319"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29546"
FT                   /db_xref="GOA:A5FVB4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVB4"
FT                   /protein_id="ABQ29546.1"
FT                   /translation="MGATGNAIAASGGGTPNEDRRAAGGWSDIVRAEKLCVSFGKVRAL
FT                   DNIDLAIGRNEIVGLIGDNGAGKSTLIKALTGVVRPSSGRLYIRDEAVDLYNYSVRRAH
FT                   SLKFETVYQEKSLGEKQPLWRNFFVGRQIVNRFGFINVREQRRIANEILQRQLGFRGVG
FT                   IDADSTVAKLSGGERQGIAIGRAMHFDSDLIILDEPTTALAISEVQKVLDFVRSIKRSG
FT                   RAAIYIEHNLAHVHALADRLVVLDRGRIVANIRPAEMTLEDLTRFLIDLQHGTPATGGH
FT                   A"
FT   gene            372078..372518
FT                   /locus_tag="Acry_0320"
FT   CDS             372078..372518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0320"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: protein of unknown function DUF861, cupin_3;
FT                   Cupin 2, conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29547"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVB5"
FT                   /protein_id="ABQ29547.1"
FT                   /translation="MNEMPPGITRADEGIGGVVWNVLGQTYTLKQESEHSMAWHAVFPP
FT                   GTFVPPHIHPTQDEFIYMLEGKFDLWLDGQDLSAGPGDLVRMPMNRPHGIFNRSDADVK
FT                   CVFWVAPSRSLRALFERIHNLADPAEVVRIAAEHEVHFLPPG"
FT   gene            372526..373770
FT                   /locus_tag="Acry_0321"
FT   CDS             372526..373770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0321"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /note="PFAM: monooxygenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29548"
FT                   /db_xref="GOA:A5FVB6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVB6"
FT                   /protein_id="ABQ29548.1"
FT                   /translation="MRVLIAGGGIGGVTLALMLHRRGIECQVLEAAPAIRPLGVGINIL
FT                   PHAVRELAALGLLPALDEIGLRTRALSYLNHRGQVIWTETRGLHAGHDVPQFSIHRGKL
FT                   QDMLWRAARERLGEGALRPDARVAAAAEADGAVAVTLTNAAGARETIAGDALIGADGIH
FT                   STLRPLLLGADPPMRWNGIQMWRGALDWPAFGTGDEMIIAGNATAKLVFYPIGQPAANG
FT                   TRLTNWVVYARTGAEGTPPPARESWSRRGAWEEFAPLVAGFALPFVDVGRLARATSEIF
FT                   LYPMCDRDPLERWTRGRITLLGDAAHAMYPVGSNGASQAILDARCLADTLAESADIPAA
FT                   LAAYEAERRPATAAVVRSNRVGGPERVIDLVAARAPDGFARIGDVARPDELEAIVRGYA
FT                   TLAGFAAPQPGASAP"
FT   gene            373767..374582
FT                   /locus_tag="Acry_0322"
FT   CDS             373767..374582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29549"
FT                   /db_xref="GOA:A5FVB7"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVB7"
FT                   /protein_id="ABQ29549.1"
FT                   /translation="MTEPSDPVFQYLAGQMRPGHPALIEAFLREGEAAIAARAPRLDIP
FT                   YGPHERERFDLFAAPGAAATLLYLHAGYWQGRDKAQFRFLAPPFVDASFNVALANYPLC
FT                   PDASLAALTDSVRRAVPAVLRAAGTGGLVAIGHSAGAHLAAELALTDWDGPSPITAVVG
FT                   LSGVYDLDPLRATPLNDRLGLDAAAARAASPVHRVKPRMPPAIFAVGGDETPAFRAQTG
FT                   AMHAAWRAAGNIAREIIVPGADHFSLLRHLADPASPLFAAIAPLAAPRR"
FT   gene            374670..375437
FT                   /locus_tag="Acry_0323"
FT   CDS             374670..375437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0323"
FT                   /product="coenzyme PQQ biosynthesis protein C"
FT                   /EC_number="1.3.3.11"
FT                   /note="TIGRFAM: coenzyme PQQ biosynthesis protein C; PFAM:
FT                   TENA/THI-4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29550"
FT                   /db_xref="GOA:A5FVB8"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR011845"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVB8"
FT                   /protein_id="ABQ29550.1"
FT                   /translation="MMRADLLAEAPPADDGRAPWSHAEFEAKLREAGSAYHIHHPFNVM
FT                   LNTGKATPEQIRMWVANRFYYQIAIPVKDAAILSNCPDREIRRGWIRRLLDHDGFDYEL
FT                   PDGSRLRDEGGIEAWLRLGIATGLAREEMLDLRHLLPGVRFAVDAYVNFARRAPWQEAV
FT                   CSSLTELFAPDIHRQRLATWPGHYPWIESEGLDYFRNRTSQAPRDVVHGLRITLAHFAT
FT                   RPMQERALQILKFKLDILWTMNDEMGRHYGVAA"
FT   gene            375504..376133
FT                   /locus_tag="Acry_0324"
FT   CDS             375504..376133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0324"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29551"
FT                   /db_xref="GOA:A5FVB9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVB9"
FT                   /protein_id="ABQ29551.1"
FT                   /translation="MPSDRPHNLADRVRLRAEALLAAGWGRLTKVTFDWRRSDGRWQTL
FT                   TREVYDVGNGAAILLYDPARRTVVLVRQFRYPAFAESGDGLVLEAIAGKLDAAHPEARI
FT                   IAETEEETGYRIAGIRPVFSAYMSPGALTEKLFFFVARYTPADRVAPGGGCPEEGEDIE
FT                   TVELDIDDALRRIETGEIHDAKAIMLLHYAALHLFPPAAPRQEPSP"
FT   gene            376130..376969
FT                   /locus_tag="Acry_0325"
FT   CDS             376130..376969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0325"
FT                   /product="phenazine biosynthesis protein PhzF family"
FT                   /note="TIGRFAM: phenazine biosynthesis protein PhzF family;
FT                   PFAM: Phenazine biosynthesis PhzC/PhzF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29552"
FT                   /db_xref="GOA:A5FVC0"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVC0"
FT                   /protein_id="ABQ29552.1"
FT                   /translation="MTRPFRLVDVFGTAPFTGNPLAVIADADGLSTAEMQAITRWLNLS
FT                   ETTFLLPPTDPAADYRVRIFSLSRELPFAGHPTLGTAHAWAEAGGVPKWNGVIVQECGA
FT                   GLVTIRRDADRLAFAAPPLLRGGPPDEADIAEVAAVLRIDRAAIVDAAWVDNGPGWICA
FT                   MLASAAEVLAIEPARHHGRPIDIGVVGPHEPGGAAAFEIRALFTNPEGVLVEDPVTGSL
FT                   NASVGQWLFASGRANGAYVAAQGTRLGRAGRVHVEQDAAGQVWVGGAVRTLFAGHAL"
FT   gene            377157..377384
FT                   /locus_tag="Acry_0326"
FT   CDS             377157..377384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0326"
FT                   /product="hydrogenase assembly chaperone hypC/hupF"
FT                   /note="TIGRFAM: hydrogenase assembly chaperone hypC/hupF;
FT                   PFAM: hydrogenase expression/formation protein (HUPF/HYPC)"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29553"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVC1"
FT                   /protein_id="ABQ29553.1"
FT                   /translation="MCLGIPMQVVAIDGFNAVCEAQGVRRTVSLFMLGAGEVAPGDHVM
FT                   VHVGYALRKMTEGEARSAWELLAVLGEAAP"
FT   gene            377398..378492
FT                   /locus_tag="Acry_0327"
FT   CDS             377398..378492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0327"
FT                   /product="hydrogenase formation HypD protein"
FT                   /note="PFAM: hydrogenase formation HypD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29554"
FT                   /db_xref="GOA:A5FVC2"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVC2"
FT                   /protein_id="ABQ29554.1"
FT                   /translation="MSGEAEARLWLGRIRALPPGPPVAIMNVCGGHERSLSMLGLRALL
FT                   PEGVRIIPGPGCPVCVCPEEDLADAIALAMAGGVTLVAFGDMLRVPINAPKGEVASLAA
FT                   ARAAGADVRPIAAPQDAVAIARAAPSRPVVFFVAGFETTTAPVAAMLAEGVPDNLSVLL
FT                   AARLTWPAVAMLLAEEDNALDALVAPGHVATVMGAEEWRFVAERHALPVAVAGFSAESL
FT                   LAAIYSVLRQKREGRAFLDNCYPELVRPEGNPTARRLLDEVMEVTDAAWRGIGVIPRSG
FT                   FALREGWRVHDARARHVIAAPPRRRAGEMPPGCDCASVVLGRRQPDQCRLYGRACTPRH
FT                   PVGPCMVSDEGACHIWWQAGIRAH"
FT   gene            378503..380767
FT                   /locus_tag="Acry_0328"
FT   CDS             378503..380767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0328"
FT                   /product="(NiFe) hydrogenase maturation protein HypF"
FT                   /note="TIGRFAM: [NiFe] hydrogenase maturation protein HypF;
FT                   PFAM: acylphosphatase; SUA5/yciO/yrdC, N-terminal domain;
FT                   zinc finger, HypF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29555"
FT                   /db_xref="GOA:A5FVC3"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVC3"
FT                   /protein_id="ABQ29555.1"
FT                   /translation="MPALRIELGGRVQGVGFRPFVYRLARRHGVSGWVRNGLGTVEILA
FT                   AADPAILDRFTAALLAEAPPTARPGLLGVTPVAEAVEPGFSIRDSAATEGARPAFPPDL
FT                   APCPDCLRELADRSDRRAGYPFINCTQCGPRYSLIRRLPYDRANTAMAGFPLCPACRAE
FT                   YADPLNRRFHAEPVACPDCGPYCRFEAAGAPSAAGEAALAAGLAALRRGLIVAVRGVGG
FT                   YHLLCDAADQAAVAALRHRKSRPDKPFAVLFPDDARTLDSCVAADAAARAALRGPARPI
FT                   LLLPRRPGAPLAPAIAPGFGTIGAMLADSPLHHLLAEGFGAPLVATSANRSGEPMLTDP
FT                   DAAAAALAGIADAFLHHDRPIERPVDDSVLRIIDGAPRILRAGRGLCPIERTLPFRLAE
FT                   PVLALGGHMKSTIALGFADRVVISPHLGDLDDPAALAGLARMAADLQSLYGIAPRRLLV
FT                   DAHPGYASTRWARAEARARGLDIVPVWHHHAHASALAGEMAPGAAPLLVLTWDGVGLGP
FT                   DGTLWGGEALLGRPGAWRRVARFRPFRLQGGDAASRAPWRSAAALCWAAGIDPPAGLLP
FT                   EQGAGIARAAWARDLNCHRTGAAGRLFDAAAALLGLCRVASFEGQGPALLESLADTADD
FT                   ITGPAPGLPLADAADGVIEADWSAALPALLDASVPAARRAAAFHATMAATALAIAETVR
FT                   RRHGVAAIGLAGGVFQNRNLVERLAPALRAAGFATLFGEAIACNDAGLSFGQIIEYGGR
FT                   A"
FT   gene            380764..381780
FT                   /locus_tag="Acry_0329"
FT   CDS             380764..381780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0329"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /note="TIGRFAM: hydrogenase expression/formation protein
FT                   HypE; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29556"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVC4"
FT                   /protein_id="ABQ29556.1"
FT                   /translation="MIEDTHVSLAHGNGGRLMRALIEEVFARHLADPALDTGADAVPVA
FT                   LPAGEIVVTTDGFTVQPLSFPGGDIGALAVHGTVNDLAVAGARPLYLTLAALIEEGLEI
FT                   ARLERIVASLAGAARAAGVRVVAGDTKVLPRGQGGGIYLALTGIGVRPPGCGLGLGRIE
FT                   TGDAVLVSGPVGDHGIAVMLAREEFGLSGDVVSDAASVLPLTAAIAVLPGLRFMRDPTR
FT                   GGLATVAHEIARGAGRAVELDEAAIPVRGTTRAVCDMLGYDPLYLASEGRVVAVAAPAA
FT                   AAAILAAWRALPEGEGAAIIGAIGAAAPADAPVLLRTRIGGARTLPELESDPLPRIC"
FT   gene            complement(381787..382671)
FT                   /locus_tag="Acry_0330"
FT   CDS             complement(381787..382671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0330"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /note="TIGRFAM: hydrogenase accessory protein HypB; PFAM:
FT                   cobalamin synthesis protein, P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29557"
FT                   /db_xref="GOA:A5FVC5"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVC5"
FT                   /protein_id="ABQ29557.1"
FT                   /translation="MCGICGCGDTGEHHHEHEHEHGHGHGHGHDHGHDHGHAAEHAHAA
FT                   GLAPARMVRVEQDIMAANQRHADANRTYFAERGIFVVNLVSSPGSGKTSLLVRTVAALK
FT                   AEMPVAVIEGDQQTEFDAERIRAAGAPAWQINTGKACHLDAHMVGHALEHLPALEGGIL
FT                   FIENVGNLVCPAGFDLGEAHKVVILSVTEGEDKPLKYPHMFHAADLMLVNKIDLLPHVA
FT                   CDMELILAGALRVNPAIGSFAVSAATGEGFGAWLDWLRQGRERARRAQHGAMQARREAL
FT                   RRELASIDATLAG"
FT   gene            complement(382671..383012)
FT                   /locus_tag="Acry_0331"
FT   CDS             complement(382671..383012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0331"
FT                   /product="hydrogenase nickel insertion protein HypA"
FT                   /note="TIGRFAM: hydrogenase nickel insertion protein HypA;
FT                   PFAM: hydrogenase expression/synthesis, HypA"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29558"
FT                   /db_xref="GOA:A5FVC6"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVC6"
FT                   /protein_id="ABQ29558.1"
FT                   /translation="MHEMALCEGLVQALEAQAGAAAFSRVHAVELEIGALAAVECEAMR
FT                   FNFGIVTRGTLAEDARLDIVEVDGRAWCMQCGTTVTLRRFGDPCPHCGSLQLQVLDGKQ
FT                   IRIRQIEVT"
FT   gene            complement(383005..383202)
FT                   /locus_tag="Acry_0332"
FT   CDS             complement(383005..383202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0332"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29559"
FT                   /db_xref="GOA:A5FVC7"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVC7"
FT                   /protein_id="ABQ29559.1"
FT                   /translation="MSGAAELSRYECRICWHVYDPAAGDEVWQIAPGTAFADLPESWHC
FT                   PNCDAERHQFLPLDAEDRDA"
FT   gene            complement(383199..384029)
FT                   /locus_tag="Acry_0333"
FT   CDS             complement(383199..384029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0333"
FT                   /product="HupH hydrogenase expression protein"
FT                   /note="PFAM: HupH hydrogenase expression protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29560"
FT                   /db_xref="InterPro:IPR006894"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVC8"
FT                   /protein_id="ABQ29560.1"
FT                   /translation="MDPFALPARSGTAEAGPDYLALPTEMHVFRAPSLPDDPAARARCR
FT                   AWLQRIGAALEAAASGAAVGQIVLDEASAADCASLDEILLDGEVSALVLGAPEWQIGET
FT                   AYTGLWRLRARDAATGRRLDRLEIGPIPAVVAARAAASWGLMELPAPEAIPPEMVNAPH
FT                   VLAELRARSAAFRPGGAAHVINLGLLPLAEAELTWLVRTLGEGPAIILSGGYGTCRIRS
FT                   TRLAGTWWVQYYNAADALILNTLEIAAVPAVACAAQDDVAESASRVRALEAAYP"
FT   gene            complement(384032..384430)
FT                   /locus_tag="Acry_0334"
FT   CDS             complement(384032..384430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0334"
FT                   /product="hydrogenase-1 expression HyaE"
FT                   /note="PFAM: hydrogenase-1 expression HyaE"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29561"
FT                   /db_xref="InterPro:IPR010893"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVC9"
FT                   /protein_id="ABQ29561.1"
FT                   /translation="MAGSAALARLAAAEGVRELGGDGLEAALAEGTTLVLFTGDPARHR
FT                   EIDDVAVIVPELAKAFAGRFRCAMVDPDRERAAAARFRVVVRPTLVLVHEGAMIGSVAR
FT                   MRSWAEYLEAIGGMLDRIGAPAAAAMEA"
FT   gene            complement(384430..385005)
FT                   /locus_tag="Acry_0335"
FT   CDS             complement(384430..385005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0335"
FT                   /product="Hydrogenase 1 maturation peptidase HyaD, Aspartic
FT                   peptidase, MEROPS family A31"
FT                   /note="TIGRFAM: hydrogenase maturation protease;
FT                   hydrogenase expression/formation protein; PFAM: peptidase
FT                   M52, hydrogen uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29562"
FT                   /db_xref="GOA:A5FVD0"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004419"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVD0"
FT                   /protein_id="ABQ29562.1"
FT                   /translation="MSRGATVLGIGNVLWADEGFGVRAVEALNAGWTCGPEVRLVDGGT
FT                   QGLALLPVVGEAGLLVILDAVDFGLAPGTLMVAADDDVPRYLTAKKLSLHQTSFQDVLA
FT                   LAQISGRAPARMVLVGVQPCDLDTYGGGLSAPVAARIGEAVDLVRAHLAGAGFALAPRA
FT                   AGEEAEPLGPAAVAMTFGGPAAQIAEAS"
FT   gene            complement(385002..385736)
FT                   /locus_tag="Acry_0336"
FT   CDS             complement(385002..385736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0336"
FT                   /product="Ni/Fe-hydrogenase, b-type cytochrome subunit"
FT                   /note="TIGRFAM: Ni/Fe-hydrogenase, b-type cytochrome
FT                   subunit; PFAM: cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29563"
FT                   /db_xref="GOA:A5FVD1"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVD1"
FT                   /protein_id="ABQ29563.1"
FT                   /translation="MTADTQTTPTDLAQGATARRVSAPVYVYELPVRIWHWVMALSIVI
FT                   LSITGFLIADPLWPLQVGQPSQHFLMGDIRTIHFITGDVFAVAMLVRIYWAIVGNRYAR
FT                   EIFAPAVWRRSWRREFARTIRWYLFLERETSKEIGHNPLAQLAMFAMFTLGVLFQIVTG
FT                   FALFGEGTGHGTWAFALFTSWVMPLFGNSQAVHTWHHLAMWYLILFAMVHVYMSVREDI
FT                   MSRQTMISTMINGWRFFKDDRE"
FT   gene            complement(385770..387566)
FT                   /locus_tag="Acry_0337"
FT   CDS             complement(385770..387566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0337"
FT                   /product="nickel-dependent hydrogenase, large subunit"
FT                   /note="PFAM: nickel-dependent hydrogenase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29564"
FT                   /db_xref="GOA:A5FVD2"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVD2"
FT                   /protein_id="ABQ29564.1"
FT                   /translation="MTSVSTPNGFTLDAGGKRMVVDPVTRIEGHMRCEVNLDENNVIRN
FT                   AVSSGTMWRGLEVILKGRDPRDAWAFCERICGVCTGVHALASVRTVEDALGIRIPANAN
FT                   TIRNLITASLWAQDHLVHFYHLHALDWVDVVSALKADPKATSALAQSISPWPNSSPGYF
FT                   RDVQTRLQKFVDSGQLGPFMNGYWGNPAYKLPPEANLMAVSHYLEALDFQREIVKIHTV
FT                   FGGKNPHPNWLVGGMACAINLDGPLAAGAPVNMVQLNLVSSIIDQTIAFIDQVYIPDLK
FT                   AIASFYKTWQYGRGLAGRNVMSYGEFPFEANAWTDRNLMIPRGAIVNGNLAEIHEVDAR
FT                   DPGQIQEFVDHSWYKYPNESVGLHPWSGITDPDFRLGAKTVGTRTDIRQLDESEKYSFI
FT                   KAPRWRGHAMEVGPLSRFTIGYARGMAEFKEPVDRLLKDLGLPFEALFTTLGRTAARGL
FT                   EASWAAHAMRRLHDQLMDNLKAGDLATASTAKWEPASWPAEAKGVGLVEAPRGALGHWI
FT                   HIRNGKIEAYQAVVPTTWNGSPRDPAGNIGAFEAALLNTPLANAEQPLEILRTLHSFDP
FT                   CLACSTHVMAPDGGELVRVQVL"
FT   gene            complement(387563..388684)
FT                   /locus_tag="Acry_0338"
FT   CDS             complement(387563..388684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0338"
FT                   /product="hydrogenase (NiFe) small subunit HydA"
FT                   /EC_number="1.12.99.6"
FT                   /note="TIGRFAM: hydrogenase (NiFe) small subunit HydA;
FT                   PFAM: NADH ubiquinone oxidoreductase, 20 kDa subunit;
FT                   Nickel-iron dehydrogenase small subunit, N-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29565"
FT                   /db_xref="GOA:A5FVD3"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVD3"
FT                   /protein_id="ABQ29565.1"
FT                   /translation="MPDESRTFYELMRAQGTSRRSFLKFCSLTAAALGLDPIYATRIAH
FT                   AMETKPRIPVLWMHGLECTCCSESFIRSGHPLARDVILKMISLDYDDTLMAAAGHQAES
FT                   ILDEIPRKYKGRYILAVEGNPPLNEDGMYCIVGGKPFVEKLKAVAADAMAVIAWGACAS
FT                   WGCVQAARPNPTAATPIDKVITGKPIIKVPGCPPIAEVMTGVITYMVTFGRLPELDARG
FT                   RPLMFYGQRIHDKCYRRPHFDAGEFVEAWDDEGAREGYCLYKMGCRGPTTYNACSTTRW
FT                   NGGVSFPIQSGHGCIGCAEDNFWDNGPFYQRLSHIGAGFGIEATADEVGAVVAGAAGAG
FT                   ILAHAGASVVKHMRGKPPSDDAARHSGDEGDRP"
FT   gene            388837..389232
FT                   /locus_tag="Acry_0339"
FT   CDS             388837..389232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0339"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29566"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVD4"
FT                   /protein_id="ABQ29566.1"
FT                   /translation="MDNRTPDRSPSHLADAAKVFAAIDRQDAAAFASLFANNGMFVFGN
FT                   AAPVIGPAAIRAAVTAFFAAIRELRHDIIDVWHVGDSVITQLTVLYRRRDGSVVSLPAA
FT                   TIWRVSDLGITDYRIYADLAPLVAPSD"
FT   gene            389242..389688
FT                   /locus_tag="Acry_0340"
FT   CDS             389242..389688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0340"
FT                   /product="cyclase/dehydrase"
FT                   /note="PFAM: cyclase/dehydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29567"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVD5"
FT                   /protein_id="ABQ29567.1"
FT                   /translation="MASCRIERRLAIPVAAAYDLIADIESYPRFVPFWLSATILERTAR
FT                   RMTVRQAVSIMGLRMDFVSAATLDPPHRIAIRSASHPFRDFALSWSLREMRPAATLIRA
FT                   ELAVEFDSRPLDAMASRLVPVLLWRVVAAFEREARGRAAHPARR"
FT   gene            complement(389670..391208)
FT                   /locus_tag="Acry_0341"
FT   CDS             complement(389670..391208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0341"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29568"
FT                   /db_xref="GOA:A5FVD6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVD6"
FT                   /protein_id="ABQ29568.1"
FT                   /translation="MDQFGAMRLGGNAERASADQALTAQLFDKARRMVIAGAIDGNPSA
FT                   TPLLCARDGEDLVFAAHRASRLAALLSINPRAQAIVETDDPLFSLLLEVTGFCVELREA
FT                   AARGRVLAALHGGAGPDDAAAREFACYRLRPTRLALVDRMATPRFAWQALPQNRRSDAR
FT                   LALDDLGGWMRLWIRTVRAPFFTAAIVPVLLGGAVARFAMARAGTGADWPWALFLWCIA
FT                   GVLLAAAGTNLINDYGDHETGADEGNEVGGNPFTGGSRAIQLGMVAAWKVLLGSAICFG
FT                   GTVAIGLHINAALAGHALAPTPLLGFGVIGCALGIMYTMGPFRLSYRGLGEVAVPLGFG
FT                   PVIVLGTAYVLAKAMHVPVPWLAGLLAALPVSVFVLLILWINQFQDAPADAAAGKRTWV
FT                   VRLAETAGGDIDFRRPFRAYLALDAAGFGLIALLGLIGRADPALATRYAFLALLPLPLA
FT                   LVAARKGSLWVRRWRAAPGERARLPFELLGVNAITIGVHLATGLLLALAYLLAG"
FT   gene            complement(391239..391916)
FT                   /locus_tag="Acry_0342"
FT   CDS             complement(391239..391916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0342"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29569"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVD7"
FT                   /protein_id="ABQ29569.1"
FT                   /translation="MARTPKHAPLLSLLTAAAAAVPPLPTALAVMAPAGAALAAAPGAT
FT                   ASTTLAQAIARGDTQIAPAGVRALIMAQRRDFTLIDIRAPKEFAAGHIRDARNVPISQL
FT                   AMPQEINRLRRSPQVILYGNATDKAAEAAVMLRASGVMARAMTGGLAAWGQALEAAAAR
FT                   PDQAAMVRALNLCPEIVATPIAPAPAAPEAAPAAPQAAPAAPQAAPKAPAGTAPVNLNG
FT                   MCG"
FT   sig_peptide     complement(391797..391916)
FT                   /locus_tag="Acry_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.894 at
FT                   residue 40"
FT   gene            complement(391933..392970)
FT                   /locus_tag="Acry_0343"
FT   CDS             complement(391933..392970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0343"
FT                   /product="Polysulphide reductase, NrfD"
FT                   /note="PFAM: Polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29570"
FT                   /db_xref="GOA:A5FVD8"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVD8"
FT                   /protein_id="ABQ29570.1"
FT                   /translation="MREEVLASVLANPRVEPHLAIWGWQIATYLFLGGLAGGMMLCSGA
FT                   VILGRRDEDAPFAARRAPLVALVLLAVGLGALFLDLERKINVWRFYTVLHVTSPMSWGS
FT                   WILLLVMPALAVMALGGIDAGFPPLARWLRRLPAIGALAGRVIGLSVAARRAVAAVNVA
FT                   LGIALCVYTGVLLSGFNARPFWHSALLGPLFLVSGMSTGAAVIVLGARTAKERHLFGRI
FT                   DLGLILAEMALIGLFLIDMLNGNALQQAAVALLLGGALTGLFWVGFMALGLALPLLMEA
FT                   ASWRRPIALLAGTASVLVLVGGFLLRDIVVTAGQQTGWRSFHNQFNAALLDRLRHDGEN
FT                   PNGRF"
FT   gene            complement(392998..393540)
FT                   /locus_tag="Acry_0344"
FT   CDS             complement(392998..393540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0344"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29571"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVD9"
FT                   /protein_id="ABQ29571.1"
FT                   /translation="MPHFAMVIDTKTCIGCTDCVDACRMENNVPEGLCYDWVVEITEGR
FT                   YPELKTEFRSERCNHCSNATCVDACPTGASQYWNGSNIVVVDATRCTGCKACIAACPYD
FT                   SRLIMEPQGYIGKCTFCVHRVQYGEDPACVATCPAHAMHFGLLDDPGSAVSRLLATRAH
FT                   YVLAPETGNQPNVFYLR"
FT   gene            complement(393540..395735)
FT                   /locus_tag="Acry_0345"
FT   CDS             complement(393540..395735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0345"
FT                   /product="Nitrate reductase"
FT                   /EC_number="1.7.99.4"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29572"
FT                   /db_xref="GOA:A5FVE0"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVE0"
FT                   /protein_id="ABQ29572.1"
FT                   /translation="MQRRDFIRMSSAVASAALLGPTLAGCSRPAEWQRMMTEAPATETP
FT                   TVCNICFWACAAKVHTRGERLWKITGNPEDAHCEGRLCTRGTGGVGAYYDPNRLVRPLV
FT                   RMGKGADQRFEVASWDNALGLVAERMEKIAREHGPDRLAALVHGPGAAHFSHLVRAFGS
FT                   DSIAEPAFAQCRGPRDTGFFLTFGQGFGSPEQTDMAKARCIVLIGTHIGENLHNSQVRT
FT                   FTDGIRNDATIIVVDPRFSVAAGKANHWLPIRPGTDIALLLAWMNVILAERRYDAGYVA
FT                   RNTVGLEALCAHVAPFTPEWAYGETGIEPALIRETARLMAAAAPATVVHPGRHSTWWGD
FT                   DTQRARAMAILAGLLGIWGREGGYYLPESVALPAYPVPAYPVPKTSWREIALPVFPLAG
FT                   APVTNVILDNAHGADAHYKGLIVYDTNLPMTMPGIRRTLEAAAQSLELIVAVDVQPAEV
FT                   TGYADVVLPECSYLERHDPLRNSGERYPALALRAPALPPRGESKPGWWIAREIGTRLGL
FT                   GRYFPWTDYTEVIDWQLRQVGSSLKELETTGIRAFPRRTPAYFAPGETPRFATPSGKIE
FT                   LFSATLQQAGFDPLPRYTRPEAPPADHFHLNYGRAPQHSFSRTQNNPVLYQLMPENLVW
FT                   IHPTAARRFGIRNGTYVRLVNQDGVVSNKVRVRVTERTRPDSVWLVHGFGHTAPGLSLA
FT                   RGRGADDSALMTRVLYDPIMGGTGMRGNFVTFRKENA"
FT   sig_peptide     complement(395661..395735)
FT                   /locus_tag="Acry_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.477 at
FT                   residue 25"
FT   gene            396026..397027
FT                   /locus_tag="Acry_0346"
FT   CDS             396026..397027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0346"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29573"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVE1"
FT                   /protein_id="ABQ29573.1"
FT                   /translation="MNMQTRTAALATARPAAAIMASLSAAALGIAVLGLAATAPARAAP
FT                   ASSAPPLVDAAWLRAHLHDRGQVILEVYDTATQRPAYEAGHIPGAVFTGFLNDGWRVPR
FT                   DGIPGMLPPPEQIAGVIGHFGIGNATRVIIVPAGRARGDFNAAARVFWTLRMEGADNAS
FT                   ILNGGDRAWFADPADPVARGNVPLRPAVFVPHPTTEYLATMPMVRATLDSHAAQLVDAR
FT                   PPAQFEGRVRAPVDARAGTLPGARNLPFSAVLTADGEGVRPMPELAQALHRAGVERGAP
FT                   SITFCNTGHFASTDWFVLREVLANPRVRLYDGSMSEWSRNPALPMVPGHSAF"
FT   sig_peptide     396026..396157
FT                   /locus_tag="Acry_0346"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.847 at
FT                   residue 44"
FT   gene            397042..397566
FT                   /pseudo
FT                   /locus_tag="Acry_0347"
FT   gene            397563..398132
FT                   /locus_tag="Acry_0348"
FT   CDS             397563..398132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29574"
FT                   /db_xref="GOA:A5FVE2"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVE2"
FT                   /protein_id="ABQ29574.1"
FT                   /translation="MIHLPLGWTGSLSGLLIGLAFGAILEGAGFADPARLTGQLRLVDW
FT                   TVFKVMFTAIIVAGTLLYLFRDLGLLPFGRIFVPSLYLWGTLLGGALIGIGMAVGGYCP
FT                   GTAAVALASGRLDGLVFLLGIGAGTILFNGAYPAIGAWAYARTGKAALTLPQLLHLSPW
FT                   IILPALLALLVAVVRLTAAPAGRASS"
FT   sig_peptide     397563..397631
FT                   /locus_tag="Acry_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.920) with cleavage site probability 0.812 at
FT                   residue 23"
FT   gene            398219..398617
FT                   /pseudo
FT                   /locus_tag="Acry_0349"
FT   gene            complement(398724..399719)
FT                   /locus_tag="Acry_0350"
FT   CDS             complement(398724..399719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0350"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="PFAM: high-affinity nickel-transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29575"
FT                   /db_xref="GOA:A5FVE3"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVE3"
FT                   /protein_id="ABQ29575.1"
FT                   /translation="MAAKRQAEPGADASARRVLWGLGAANVAAWIWAAAAFGGAPRLLG
FT                   MAGLAWLFGLRHAMDADHIAAIDNAVRRLAGRGRAASLAGLFFSLGHSSVVVLLAAAVS
FT                   FGAGALRGHLDAVTRDGAWIGTIVSVGFLALIAGANLVALRAETRGGAAPGGVLSWLAR
FT                   PLFRLVRRSRDMYAIGFLFGLGFDTATEIGLLALSAAGTAHGIAAWRLMALPALFTAGM
FT                   SLVDTADSALMTRAYGWALRDGRARRRYNVTLTAVSAAIAVVVGGAELLGLAGDGFGTG
FT                   AARVAAMLDAHWSGLGMIITLMLAGLWLAAIRRGRAGRIAERASSAAPPG"
FT   gene            399822..400451
FT                   /locus_tag="Acry_0351"
FT   CDS             399822..400451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29576"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVE4"
FT                   /protein_id="ABQ29576.1"
FT                   /translation="MPPAETACPPPGFHVPVPFMDVAARFAALIETLCGAVAARGAKGA
FT                   FGAANGALVVLLWSRLRRAVRRFAILAAGAPPPRRRASRPRHRAARTPAVALPRRAAWL
FT                   LAPVPEASAVAGRLRDLLETPEARALIASEPRAGRLLRPLCRALGLRLPACLRLPPRSR
FT                   PAVAPAKARAAAPTTATPRPAPAPRLSPRRPVRPGPLHTRAPPVPS"
FT   gene            complement(400570..401250)
FT                   /locus_tag="Acry_0352"
FT   CDS             complement(400570..401250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29577"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVE5"
FT                   /protein_id="ABQ29577.1"
FT                   /translation="MRRLALAGIVLAPLALSACATEAPAPTTFARLDYSYLPPITLKVA
FT                   SIRIRDDYRPGPDAAKMIDLAPEPPARVLERMAHERLVANGSPGSASFVIRQASLHQVG
FT                   DTLVGTMTVDLNVRTSNGQRVGYAEATVSRSETAPTNESPDRMRAALYDLTKTMMSSMN
FT                   VELQYQIQRSLPDWLAYSPAGEVGGMAAPHYSPDQGISAQPLPNPDAGQNGPASGTSLG
FT                   GSND"
FT   sig_peptide     complement(401188..401250)
FT                   /locus_tag="Acry_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.841 at
FT                   residue 21"
FT   gene            complement(401247..402245)
FT                   /locus_tag="Acry_0353"
FT   CDS             complement(401247..402245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0353"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29578"
FT                   /db_xref="GOA:A5FVE6"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVE6"
FT                   /protein_id="ABQ29578.1"
FT                   /translation="MAKRAQCLYLTAMTELPPFLDRTRPDVPDIAVPRGVTPFFLPNQP
FT                   VRGRLVRLGPLADALLTRHDHAPDVRALLGQALALVASLATALKFTGSFSLQAKGDGAV
FT                   PLLLADCTDGGALRGYARLSDEIALPEEATARAMMGDGYLAFTVDQGPDMERHQGIVSL
FT                   EGESLADMAHHYFETSEQLPCQIHLAAAETPAGWRAAALVIERIAGAGGIDPAVSEAEQ
FT                   EEAWRTAKILAATITDEELLDDTLPPERVLYRLFHGEGVAVDRPRPLAYGCRCSRARLS
FT                   DVLGGFSGDDLDHMTIDGDITMTCEFCNVDFRFPRGEIAAAASAGEPGGAS"
FT   gene            402354..403814
FT                   /locus_tag="Acry_0354"
FT   CDS             402354..403814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0354"
FT                   /product="D-beta-D-heptose 1-phosphate adenylyltransferase
FT                   / D-alpha,beta-D-heptose 7-phosphate 1-kinase"
FT                   /EC_number="2.7.7.-"
FT                   /EC_number="2.7.1.-"
FT                   /note="TIGRFAM: cytidyltransferase-related domain; rfaE
FT                   bifunctional protein; PFAM: cytidylyltransferase; PfkB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29579"
FT                   /db_xref="GOA:A5FVE7"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FVE7"
FT                   /protein_id="ABQ29579.1"
FT                   /translation="MAEHDDGDLIAAIRGLARANVLVVGDLMLDRYAYGRVERISPEAP
FT                   VPILTVTREIAMPGGAGNVVRNLTALDAAAAFVSVVGDDQEGSDLTALIGGQPNVEPWL
FT                   LVETGRATTVKTRYIAAGQHLIRADRELVMPLTDKLGERLLKIASDAMAATSVTVLSDY
FT                   RKGVLAPTIARNLIASARSIGRTVIVDPKGADWSHYAEADVITPNRRELAEAVGRDLPD
FT                   EAAIVGAAREVIGRFGFGAVLCTRSEDGMSLVTVDTVRHYPAEAAEVYDVSGAGDTVVA
FT                   VLAAGLASGLPLEIAARLSNIAGGLVVGKVGTAVARPDDLVDAVKPASGALRKVVTRQA
FT                   AAEAAERWRQRGWRIGFTNGCFDLLHPGHVHLLEQARAGCDRLVVGLNADSSVRRLKGA
FT                   TRPVQPEAARAAVLASLASVDLVVIFEEDTPLDLLSAIRPDVLVKGADYTHDTVVGARE
FT                   VESWGGRVMLAELLPGHSTTATVTRLRS"
FT   gene            403995..404867
FT                   /locus_tag="Acry_0355"
FT   CDS             403995..404867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0355"
FT                   /product="Polyphosphate:AMP phosphotransferase"
FT                   /EC_number="2.7.4.-"
FT                   /note="PFAM: protein of unknown function DUF344"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29580"
FT                   /db_xref="GOA:A5FVE8"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVE8"
FT                   /protein_id="ABQ29580.1"
FT                   /translation="MAVNSRQFRIHPSVPVDLSSWPTAIDPLFDSKHDYRAELDDHIKR
FT                   LSEMQQLLYASNRHAVLIIFQAMDAAGKDGAIKHVMSGVNPQGCQVFSFRHPSAMELQH
FT                   DFLWRTTRNLPERGRIGIFNRSYYEEVLIARVHPEILANEGVPEPPSGVGSIWEHRYRS
FT                   INDLERHLSGNGTKIVKIFLHISKEEQLRRLIARIDDPSKNWKFSTADVEERKFWNDYM
FT                   AAYQDCLNATSTVEAPWYAVPADDKRNARLIISNILLETMQELDMNYPEVSSKRKKELA
FT                   RIREDLAKS"
FT   gene            complement(404875..405597)
FT                   /locus_tag="Acry_0356"
FT   CDS             complement(404875..405597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0356"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29581"
FT                   /db_xref="GOA:A5FVE9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVE9"
FT                   /protein_id="ABQ29581.1"
FT                   /translation="MSLLEIADLKVNYGQIEALKGVSLRVETREIVAILGANGAGKTTL
FT                   MRTISGLLTPRGGSIVFEGTDITRLGADRIVRLGIAQSPEGRRVFGTLSVMENLRLGAF
FT                   TRPAGEVAGSLDFVLQMFPRLAERRGQLAGTMSGGEQQMLAIGRALMAKPRLLLLDEPS
FT                   LGLAPIIVQGIFRTLREIANSGVTILIVEQNARSALKLADRGYVLEVGRFVIEDDAKTL
FT                   LTSPEVQAAYLGGERRKA"
FT   gene            complement(405594..406379)
FT                   /locus_tag="Acry_0357"
FT   CDS             complement(405594..406379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0357"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29582"
FT                   /db_xref="GOA:A5FVF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVF0"
FT                   /protein_id="ABQ29582.1"
FT                   /translation="MSALLELHGVGIRFGGLRAVDRLSFTVDKGQIVALIGPNGAGKTT
FT                   VFNMITGVYRPTEGSIRFEGQDITARRPHLVAAAGIMRTFQTIRLFPEMSVLENVRAGC
FT                   HLRVRQQWWQGLLSLPSQRREEAELAERAHEILRRLDLDRFAHDRAVSLPYGVQRRVEL
FT                   ARTLAADPKMIILDEPAAGLNDNESAALSETIFGIRDSGITVLLVEHDMNVVMSVADKI
FT                   VVINFGQKIAEGGPDDIRNDAQVIEAYLGRDDDEEEGVS"
FT   gene            complement(406376..407302)
FT                   /locus_tag="Acry_0358"
FT   CDS             complement(406376..407302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0358"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29583"
FT                   /db_xref="GOA:A5FVF1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR035568"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVF1"
FT                   /protein_id="ABQ29583.1"
FT                   /translation="MSASASRNTGIAVWILGLFLPVVLNSAWVSVAAIFAIYGIVALSE
FT                   DIILGRAGMFDMGHAVYFGIGAYVTAILNVTFDWPIFLTIPFAILLAAAFGALLAAPLI
FT                   RLRGDYLLVASIGFNAIFVLAMQNNLFGLTGGSDGITGIGVPSLFGLPIESQSAMYWLD
FT                   WVVLGIVLVLMRNLDGSEFGRALRYLKQDELAATTIGVNPRKVKTLAFAIGAGLAGLAG
FT                   TLFAVQLSTVSPSSFKFTESVTLFAIVIVGGQGSIPGVLLGTALMFVLPQVFRDFAQYR
FT                   YLVFGFAMILVMVLRPQGLWPRRGARA"
FT   sig_peptide     complement(407222..407302)
FT                   /locus_tag="Acry_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.746) with cleavage site probability 0.515 at
FT                   residue 27"
FT   gene            complement(407302..408204)
FT                   /locus_tag="Acry_0359"
FT   CDS             complement(407302..408204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0359"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29584"
FT                   /db_xref="GOA:A5FVF2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR035568"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVF2"
FT                   /protein_id="ABQ29584.1"
FT                   /translation="MGTFIQQVFNGLTVGGIYALIALGYTMVYGVMRLINFAHGDLCIL
FT                   GAFIGLTFLTSLGGAGHPGAALLILAFVAAIVVVAVAGVVLELAAYRPLRKADRLAAVV
FT                   SALGASLLIENGIMLIWSPQVSVFPSGLLPTTTYHIAGASISFVQVMIIIVSFLLMAAL
FT                   YLFVNHTRFGTAIRAAAIDQDAARLMGINVNRVIASVFVIGPALGAVGGLFIGVYYREV
FT                   YFTMGWTYGLYAFIAAILGGIGNIPGAMLGGILLGLFNAFAAGYISSSWQDAITFALLI
FT                   GILLVRPSGLLGERVAEKV"
FT   gene            complement(408236..409381)
FT                   /locus_tag="Acry_0360"
FT   CDS             complement(408236..409381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0360"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor;
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29585"
FT                   /db_xref="GOA:A5FVF3"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVF3"
FT                   /protein_id="ABQ29585.1"
FT                   /translation="MIRKMGIGLAAAVALAAPYGIAHAASGPIKIGVQAPITGAYADEG
FT                   QGIEKAVKLLADQQNAKGGLLGRKIEVKVCDDEGKASQAAICARQLVNDGVIAVIGSYT
FT                   SGAALAAEPIYARSNVIQTSDGTSNKLLSRGYKTWFGNAAPNSAEAKFTAKYLIDVRHF
FT                   KRIAVLTDHSSFATGLADAVIKNIKADHGKVIDKAFITAGSQNFTPVLTKLKALKPDAI
FT                   YFSGYYSDGGLIKAQMAQLGITATFVGGDANQNVAFGKIAGSAAKGAIIVNVPGPEQLP
FT                   YPTAKAFVAAYKAKYHQSPPSVFTLTNADGMRAVMQAIEQTKSVKPAKLEHYLHTMKSF
FT                   DGLTGQFRWNDKGERVGSPFTAFEVQADGSYKIVYPAPKAG"
FT   sig_peptide     complement(409307..409381)
FT                   /locus_tag="Acry_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 25"
FT   gene            409792..409866
FT                   /locus_tag="Acry_R0007"
FT                   /note="tRNA-Gly1"
FT   tRNA            409792..409866
FT                   /locus_tag="Acry_R0007"
FT                   /product="tRNA-Gly"
FT   gene            complement(410062..412545)
FT                   /locus_tag="Acry_0361"
FT   CDS             complement(410062..412545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0361"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29586"
FT                   /db_xref="GOA:A5FVF4"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVF4"
FT                   /protein_id="ABQ29586.1"
FT                   /translation="MKFTLSWLKTHLDTDASLDAIAETLSAIGLEVESIADRGASLAPF
FT                   RIARVIEATQHPNADRLRVCRVDPGDGTEVSVVCGAPNARTGMRAVFAPPGSFVPGTGI
FT                   TLKVGEIRGVPSAGMLVSERELGLGDSHDGIIDLPDDAPVGTPYARWAGLDDPVIEIGV
FT                   TPNRGDAFAVRGVARDLAAAGLGTLKPWAPPPIAAAGASSIAWQNAYPEACPWVLGRTV
FT                   RGVRNGESPDWLKRRLESVGLRPINALVDITNFFTLDLGRPLHVFDVGKIAGDALTLRR
FT                   GAGESFRGLHGRDVTATADDCVIADAAGAQSLAGIVGGEATGCDETTRDVFIECALFDR
FT                   VRIALTGQRTGIHSDARQRFERGIDFALLPAALDAATAMVIELCGGTASEITEAGAKPD
FT                   WHRTATMRFERLASFGHSTVTPDRAADILDRLGFTGVARDAASITVAVPSWRNDIAAAD
FT                   LPGGSALDQHGGLAAATAEAARLGARTIEPEVDLIEEVLRIDGLDRIEPVSLPGAAPVP
FT                   SASLTPRQARTVRARRVLAARGMAECVTFSFLDRATAGRFGGTPATLALKNPIAADLDQ
FT                   MRPTPLATIALAAARNAARGHGDLALFEIGPAYRDVSPDGQDLVAAGLRAGRTPLSWVE
FT                   PARPADLWDAKADAIAVLGELGVPLDAVTVTADAPAHYHPGRSGTLRQGPKTRLGWFGA
FT                   LHPSLCAALDLPEGSVAFELDLGAIADPKRRRKAVPSLPQFQPLRRDFAFIADATVTAE
FT                   AVLRAAKGAERTLIANVALFDRYAGEKLPEGKVSLAVAVTLQPREASLTDAEIEAVSAK
FT                   IVAAVAKATGATLRG"
FT   gene            complement(412542..413666)
FT                   /locus_tag="Acry_0362"
FT   CDS             complement(412542..413666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0362"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, alpha
FT                   subunit; PFAM: phenylalanyl-tRNA synthetase, class IIc;
FT                   aminoacyl tRNA synthetase, class II domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29587"
FT                   /db_xref="GOA:A5FVF5"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVF5"
FT                   /protein_id="ABQ29587.1"
FT                   /translation="MRRVCLTFRPLHAPCAAMSDDLPTIESQARTAIAAAGDPAALDAV
FT                   RIALLGKTGQVTALLKTLGSLTPDERKRVGAEVNALKTAISAALDARRAVLEAEALAAR
FT                   LAAERIDVTLPGRPDRAGTIHPISRTMEELTALFGAMGFGVKEGPDIEDDWHNFGALNI
FT                   PSHHPARAMMDTFYLDAAAGSRPVVLRTHTSPLQIRTMLAETPPIRVIVPGRTYRSDHD
FT                   ATHSPMFHQCEGLVIDRGITLAHLKGCLIDFLRAFFERPDLKARFRSSYFPFTEPSMEV
FT                   DIAWDRKSGEIGGGSDWLEILGAGMIHPNVLANCGLDPREFQGFAFGMGVERITMLKHG
FT                   IPDLRTFYESDVRWLAHYGTSPLAPVTLHEGDAR"
FT   gene            414505..415008
FT                   /locus_tag="Acry_0363"
FT   CDS             414505..415008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0363"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29588"
FT                   /db_xref="GOA:A5FVF6"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVF6"
FT                   /protein_id="ABQ29588.1"
FT                   /translation="MNIKALGALAAVALLAACSNAPKTTAMATGSGATAAQSGPAPGSE
FT                   QQLVADVGDRAFFGFNKSNLTGADKATLDRQASWLAKYPNVDVLIAGNADPRGTEAYNL
FT                   ALGARRAHAARDYLVAKGVAASRIQTVSYGKSCLVSPGNTEQDYAQDRVAITSVQGFNP
FT                   QHCH"
FT   sig_peptide     414505..414585
FT                   /locus_tag="Acry_0363"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.522 at
FT                   residue 27"
FT   gene            415177..416094
FT                   /locus_tag="Acry_0364"
FT   CDS             415177..416094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0364"
FT                   /product="Uncharacterized protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29589"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVF7"
FT                   /protein_id="ABQ29589.1"
FT                   /translation="MRRPMLKTLYAAGVAVAILLPAAARAQMITSREGIALENQILELK
FT                   HQIRTMQTGGGNGSSVLGAPAPSAPERSGQAPSSDLVASLLDRVHTLNGEVQDLRGRVD
FT                   TLEHEVATQHDEIKQEIGNLKFQLEQGGKPGFQTPANAAEGAPPAAPSSAQEPHTLGTL
FT                   PREPARPTPETAAPARAEASLGAARAALSHHDYRAAEADAHAVIAKQGKQAGHGEASLI
FT                   LAQSLFHQGRHQEAAIAFDDAYNADRAGPHAPDALLGLANSLTAIHQNQEACDTLDSLT
FT                   SQFSSPSPSLKARVEAARRRAACH"
FT   sig_peptide     415177..415257
FT                   /locus_tag="Acry_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 27"
FT   gene            416136..417308
FT                   /locus_tag="Acry_0365"
FT   CDS             416136..417308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0365"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29590"
FT                   /db_xref="GOA:A5FVF8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVF8"
FT                   /protein_id="ABQ29590.1"
FT                   /translation="MMAALGPFGAAPRVAVGVSGGADSMALTLLAASWARERGGDCLGL
FT                   IADHGLRPESADEASLTGRRLAALGIGYRILRLQLGPGPALQARARDARHASLAAAARG
FT                   AGIVHLLLGHHAGDQDELRAMRAARGPRGLAGMAGFAARDDIVILRPLLGTDPAVLREF
FT                   LSGRGIGWVEDPSNADARFERVRVRATRRQAALVPPSLDADRRAAAERDVAETLARNVS
FT                   LRPEGWAIVRAASLPVEALAVLFRVLGGAAYPPARAALERLTPALRPATLGGVRIMAAG
FT                   RHGPGWLLVREAAACAPPVAAVRGAVWDGRFRVCDVPPGARTIGALGDSAAEIGRRSGL
FT                   PGALRRTLPAFFGGDGVLSVPHLAGGPASAVVFAPQGPAAAAPFEPVPCG"
FT   gene            417498..419423
FT                   /locus_tag="Acry_0366"
FT   CDS             417498..419423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0366"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /note="TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase, central domain protein;
FT                   peptidase M41, FtsH extracellular; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29591"
FT                   /db_xref="GOA:A5FVF9"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVF9"
FT                   /protein_id="ABQ29591.1"
FT                   /translation="MNNLGRNLLVWVIIALFFVLLFNMFQPTTAESNHGTQVAYSTFVS
FT                   EVNAGKVDHVTIRGHDITGALKSGSTFETYAPDDPGLVNTLISKKVSVVAKPLNPPENP
FT                   LLHYLVSWAPMILLVGVWIYFMRQMQGGGGRAMGFGKSRARLLTEKQGRVTFEDVAGIE
FT                   EAKGELQEIVDFLRDPQKFQRLGGKIPKGVLLVGPPGTGKTLLARAIAGEANVPFFTIS
FT                   GSDFVEMFVGVGASRVRDMFEQGKKNAPCIIFIDEIDAVGRHRGAGLGGGNDEREQTLN
FT                   QMLVEMDGFESNEGVILIAATNRPDVLDPALLRPGRFDRQVVVPNPDVNGRERILKVHM
FT                   RKVPLAADVDPKVIARGTPGFSGADLANLVNEAALLAARMGKRVVAMAEFEYAKDKVMM
FT                   GAERRSMVMSEDEKKMTAYHEAGHALCSISQKHCDPVHKATIIPRGRALGMVMSLPEGD
FT                   RYSMSKAKLLSELVKAMGGRAAEEIIFGPDNVSNGASGDIKQATDITRRMITEWGMSDK
FT                   LGMIAYGDNGQELFLGHSVTQHKNVSEATAQEIDREIKLVIDHAYSEARRILTERLDDL
FT                   HRLAKGLLEYETLNGDEIQIVLRGEPVVRQVVDEPAPDSRRASVPTAQKPEVPKSGGLG
FT                   PLPAPG"
FT   sig_peptide     417498..417590
FT                   /locus_tag="Acry_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.845 at
FT                   residue 31"
FT   gene            419546..420424
FT                   /locus_tag="Acry_0367"
FT   CDS             419546..420424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0367"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29592"
FT                   /db_xref="GOA:A5FVG0"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVG0"
FT                   /protein_id="ABQ29592.1"
FT                   /translation="MSLKIGVIGLGRMGAAMAARLIERGHQVCGWNRTAARAEAIQGLA
FT                   AKASPAEVAMSADYVIVMLLDETASRAAYHGEGGLLSANLQQALVIDMSTLKPADMQAN
FT                   AEAVTAHGGRFVACPVGGTVGPARSGKLLGLAGGDAATIDAAKPVLDELCDRMERFDTP
FT                   QAAAAMKLAVNLPLLAAFQALGEAALITRDYGISPERLLGIIGKSSGGAPAFATRSAAI
FT                   ITEMGGTRSESVGFSLEAVEKDLRLMDEAGDAAGFNLKLVESVRRAAHDAVREGWGDRD
FT                   LAALAAFNLRA"
FT   sig_peptide     419546..419602
FT                   /locus_tag="Acry_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.817) with cleavage site probability 0.813 at
FT                   residue 19"
FT   gene            complement(420428..421189)
FT                   /locus_tag="Acry_0368"
FT   CDS             complement(420428..421189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0368"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29593"
FT                   /db_xref="GOA:A5FVG1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVG1"
FT                   /protein_id="ABQ29593.1"
FT                   /translation="MTETPPILERHGAIARLRLNRPALRNRLGADDLAVLLGHCATLAA
FT                   DDSVRVVVFEAAGPVFSAGFDLDALSRGDTGDAEDGPGGIGRVGTALAALPQPVIARLH
FT                   GNLYGGAVDLALACDFRIGVTGMELLMPAARIGLHYYRSGLARAVERIGPDATRLLFVS
FT                   AQTIDAATLLRIGYLTQLAAADGLDAAIDALAARLEANAPLAVRGMKAAIAGLAAGTLD
FT                   GESFAAGLDAAHRDPAFIEAMGALRAKKRGG"
FT   gene            421480..423633
FT                   /locus_tag="Acry_0369"
FT   CDS             421480..423633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0369"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="PFAM: 3' exoribonuclease; RNA binding S1 domain
FT                   protein; KH, type 1, domain protein; SMART: KH domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29594"
FT                   /db_xref="GOA:A5FVG2"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FVG2"
FT                   /protein_id="ABQ29594.1"
FT                   /translation="MMFDKYFRKELDWGGRKLILETGKVARQADGAVVASYGDTVVLAT
FT                   VVGARSVKPGQDFFPLTVNYQEKFYAAGRIPGGFFKREGRPTERETLTSRLIDRPIRPL
FT                   FPHGFRNEVQVIVNVLSHDLENEPDIVSLVAASAALTLSGIPFFGPVGAARIGYIDGEY
FT                   ILNPTSAQIAESRLDLVLAGTEEGVLMVESEAHELSEETMLGAVTFGHAAFQPVIQAII
FT                   ELAEHAAKDPWPLVEESDEEKALAARVDELAREGLRAAYAEREKTARHEKIGAVKAAVL
FT                   ETLAAEERSVEKAKGMFKELEADIVRNAILDNGIRIDGRDTRTVRPILAEVGVLPRTHG
FT                   SALFTRGETQALVVATLGTAQDEQIVDAIEGEYRERFLLHYNFPPFSVGETGRVGSPGR
FT                   REVGHGKLAWRAIHPLLPGKDKFPYTLRVVSEITESNGSSSMATVCGTSLALMDAGVPL
FT                   PRPVAGIAMGLIKEDKGFAVLSDILGDEDHLGDMDFKVAGTEAGVTSLQMDIKITSITP
FT                   EIMKIALDQAKDGRLHILGEMSKALTGAREGVSANAPRITVINVPKDKIRDVIGTGGKV
FT                   IREIVEYSGCKIDIEDDGTIKIAATSDEQAQKAIDRIRSLTSEPEVGQIYTGKVVKIAD
FT                   FGAFVNFFGARDGLVHISELAQGRVARTGDVVKVGDTVKVKMIGLDDRGKVKLSMRVVD
FT                   QATGADISDQVGAKGGRREDAAE"
FT   gene            complement(423764..424978)
FT                   /locus_tag="Acry_0370"
FT   CDS             complement(423764..424978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0370"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29595"
FT                   /db_xref="GOA:A5FVG3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVG3"
FT                   /protein_id="ABQ29595.1"
FT                   /translation="MAPDTKTTTVTAAADSPFRNLLLFAGILLIAVNLRAALASVSPLL
FT                   TPIGAALGLGPLGLTVLATIPVVCFAALAPVSIMLQRRIGLEAAMMTVLVLLAAGLLIR
FT                   VLGGAAALFAGTVMGGAAIAMGNVLLPGLVKRDFPTRVGLVTGCYTTVMTTIASVAAAV
FT                   SVPVADATPFAWRGALGLWAVPAIVAAAVWAPQLAHGAHRLSHTPTSGAFRKLARSPLA
FT                   WAVTMFMGLQSLGFYSILSWLPAILHAHGINPTMAGIMLSTTTLVAIPAALVTPSLATR
FT                   SRDQRLLLASLLAIVSVGYVGLMLAPAAAPWVWVVFIGIGQGACFPLALTLMVLRTGGP
FT                   AEAMALSAFSQMVGYAVSIAGPLGLGVIHTLSGHWWPSVAFLVILQAPTLGFGLAAARP
FT                   RTIRF"
FT   sig_peptide     complement(424859..424978)
FT                   /locus_tag="Acry_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.669) with cleavage site probability 0.378 at
FT                   residue 40"
FT   gene            complement(425010..425651)
FT                   /locus_tag="Acry_0371"
FT   CDS             complement(425010..425651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29596"
FT                   /db_xref="GOA:A5FVG4"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVG4"
FT                   /protein_id="ABQ29596.1"
FT                   /translation="MTASPVVDFEGLAATETSADPFPHLVMRGFVRPERLTSVVADLPP
FT                   LGARGSFPIESVRLGPNAAQLMDEMKGERMRQIIAGKFGLDLDGAPVMLTLRGRTDARD
FT                   GKIHCDSIAKRVTILLYLNPASEAWARQDGCLRLLRGPDDLEDYAVEVPPVDGTLLVFP
FT                   NGPTTWHGHRTYVGKRFTVQMNYMTTDAKARYEMRRHRVSALVKRLLPAA"
FT   gene            425746..426147
FT                   /locus_tag="Acry_0372"
FT   CDS             425746..426147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0372"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29597"
FT                   /db_xref="GOA:A5FVG5"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVG5"
FT                   /protein_id="ABQ29597.1"
FT                   /translation="MQRGISDLGMLAGRLALALLYVQAGWSKVVHWPGIVHLLTHLDAP
FT                   APTLGAVIAVVCELGAGGLVMLGLRTRPAAIVLILFTIAANWLAHRFWLMQGQAAAAAE
FT                   IQFFLDLAICGGLLLLASAGPGRFSLDRR"
FT   sig_peptide     425746..425820
FT                   /locus_tag="Acry_0372"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.605) with cleavage site probability 0.595 at
FT                   residue 25"
FT   gene            complement(426210..426413)
FT                   /locus_tag="Acry_0373"
FT   CDS             complement(426210..426413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0373"
FT                   /product="SSU ribosomal protein S21P"
FT                   /note="PFAM: ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29598"
FT                   /db_xref="GOA:A5FVG6"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FVG6"
FT                   /protein_id="ABQ29598.1"
FT                   /translation="MQVLVRDNNVDQALKALKKKLQREGVFREMKLRRHYEKPSERRAR
FT                   EAAEAVRRARKMERKRIEREGF"
FT   gene            426557..427186
FT                   /locus_tag="Acry_0374"
FT   CDS             426557..427186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0374"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="TIGRFAM: peptide deformylase; PFAM: formylmethionine
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29599"
FT                   /db_xref="GOA:A5FVG7"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVG7"
FT                   /protein_id="ABQ29599.1"
FT                   /translation="MPTVLSGLASAIPLCDPAELRHVSGMALLKLARLGHPVLFAKAEP
FT                   VADPAAPEIARLLHDMAETLADAGGVGLAAPQVHVPLRLFIYRVPESRAGGGEHDGPRG
FT                   LSAVINPELVLHPGEPVEDWEGCLSIPGMSALVPRAARLTLRAIDATGAPFSREAAGFH
FT                   ARVIQHEADHLDGILYPQRLRDPRLMGFNEEVARFRDEIARAAGEL"
FT   gene            427186..427842
FT                   /locus_tag="Acry_0375"
FT   CDS             427186..427842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0375"
FT                   /product="rpsU-divergently transcribed protein"
FT                   /note="TIGRFAM: rpsU-divergently transcribed protein; PFAM:
FT                   COQ9 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29600"
FT                   /db_xref="GOA:A5FVG8"
FT                   /db_xref="InterPro:IPR012762"
FT                   /db_xref="InterPro:IPR013718"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVG8"
FT                   /protein_id="ABQ29600.1"
FT                   /translation="MNETAMTGEDEVRADDDALLRALVEEVPFDGWTRTALRRALARLG
FT                   RDPDEAELLFEGGAPAMIEAWTALVDRDMEDAAGTIAETRLATRVRALILLRLDRVAPH
FT                   REAIRRALAILALPRNAALAARITGRTVDAIWHAAGDRSADFSWYTKRAILAAVYSTTL
FT                   LYWLRDASENGEDTRAFLDRRLAGVALITRTRKRIESRLAGLRRGPMRAGPSPSA"
FT   gene            complement(427811..429001)
FT                   /locus_tag="Acry_0376"
FT   CDS             complement(427811..429001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0376"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase /
FT                   2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; PFAM: monooxygenase,
FT                   FAD-binding; FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29601"
FT                   /db_xref="GOA:A5FVG9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVG9"
FT                   /protein_id="ABQ29601.1"
FT                   /translation="MTNDTADVAIIGAGPVGAALALRLAAGGQRVVLVDRAALPPMEHP
FT                   DFDGRAYAIAYGSRDLLDRAGLWDRLPFPPCPIERIRVSDGKPGRPPSPLFLDFDHRDV
FT                   GDEPFGWIVEARSLRMAINRALADSAVILHAPATARVTRDADGATVAIADGPSYRVNLV
FT                   VAADGRGSTLRAEAGIAVTRYPYRQSAVVCAVEHERPHHNVALEHFLPGGPFAQLPMSD
FT                   ADGAHLSAIVFTESHANAARLAAMDDPRFTIEVARRLGAHLGRIRLVGRRWTYPLSALH
FT                   AHRYHATRLVLVGDSAHGVHPIAGQGLNLGLQDGIALAELIDAAADPGSPHLLARYQRI
FT                   RRPANIAMLAATDALDRLFSTDLPPVRLARDIGLAAVNRMPRLKRRFMRTAMGLRA"
FT   gene            429269..430570
FT                   /locus_tag="Acry_0377"
FT   CDS             429269..430570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0377"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29602"
FT                   /db_xref="GOA:A5FVH0"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVH0"
FT                   /protein_id="ABQ29602.1"
FT                   /translation="MKRRLLIGSMGTFLGIMGWNAAAFADTAPKLDSGDTAWMLTSSVL
FT                   VLMMTVPGLALYYGGLLRRKNILAMLMQCFFATALISVLWVVIGYSLAFTKGNPFIGGL
FT                   SQVMLMGDGTGTLSGTIPETVFCMFQCTFAIITPVLILGGPADRLKFSSAMVFLGVWLI
FT                   AVYAPIAHMVWGPGGFLGGQGVLDFAGGTVVHINSATAGLIAAIMVGKRTGYGSVNMAP
FT                   ADLGYTLVGASLLWVGWFGFNAGSALTSGGQAGYAMINTHLATAAAVLSWTLVEWMIKG
FT                   KPSLLGAVSGAVAGLVAITPACGFVPVGGALVIGLVAGVVCFWGVTGFKRMFGYDDALD
FT                   VWGVHGLGGIAGALLTGVFAVKSIGGTNGLLAGNPHQMVLQAEGIVVTLLYSGIVSYVI
FT                   LKIIDVTMGLRVSPDAEREGLDISEHGEVLQHGY"
FT   sig_peptide     429269..429346
FT                   /locus_tag="Acry_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 26"
FT   gene            430694..433123
FT                   /locus_tag="Acry_0378"
FT   CDS             430694..433123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0378"
FT                   /product="DNA translocase FtsK"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29603"
FT                   /db_xref="GOA:A5FVH1"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVH1"
FT                   /protein_id="ABQ29603.1"
FT                   /translation="MSATTESRQFLSPALKARFVRHLAELGALCAVLAGLTVLVSLVSY
FT                   HAGDPSLDTASSLPPQNLAGRFGAILADLLLQGFGVAGALPALVLLAWGFVLVNRGEIT
FT                   RWRLRALAALLAMPCLASMFGVFHALNAAFAPAWPVAAGPGGAIGALLGGYGAVVAHSA
FT                   LGVIGRVLLLGLSALIGIAVSAFAFGLTSGEWRLAGRRAAAAAAASAKHGQRAVRGAGN
FT                   MSVWLREIVASPPMSDPPAADDRSALAIPRAPDEAMDPYADEAGPATMRRDDLVAQPAA
FT                   SASAPRLTRTAPTRKAPPRQERLPLPDSLWRLPPLELLKQAPPHAATGPNTESLQANAR
FT                   LLETVLGDYGVQGRIVEIRPGPVVTLYELEPAPGIRSARVIGLADDIARSLSVLAVRIA
FT                   TVQGRNVIGIEVPNARRETVFLSELLESADWNATTGRLGLALGKDIGGKPVIADLARMP
FT                   HLLIAGTTGSGKSVGVNAMILSLLYRLSPEECRLILIDPKMLELSVYEGIPHLLAPVVT
FT                   EPAKAVAALKWVVREMERRYRAMSGLSVRNIAGYNERVNEALARGEVVTRRVQTGFDSE
FT                   TGRPIFEDQPLALEPLPLIVVVIDEMADLMMVAGKEIEAAVQRLAQMARAAGIHVIMAT
FT                   QRPSVDVITGTIKANFPTRISFQVISKFDSRTILGEQGAEQLLGMGDMLYMAGGGRITR
FT                   VHGPFVSDREVEDVVAYLREQGEPDYVEAVTEAVEDDAPAMPGLAAAEGGEGGLYQQAV
FT                   ALVAREGKASTSFIQRHLQIGYNRAAKLIEQMEKEGVVGPANHVGKREVLIAGDRD"
FT   sig_peptide     430694..430837
FT                   /locus_tag="Acry_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.660) with cleavage site probability 0.656 at
FT                   residue 48"
FT   gene            433104..433514
FT                   /locus_tag="Acry_0379"
FT   CDS             433104..433514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29604"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVH2"
FT                   /protein_id="ABQ29604.1"
FT                   /translation="MPATATERLPPALIVHDAEHVARALAPGRPVTLLSPPGFALYAGC
FT                   LWWRSLLASERFTGPALLDCADAAGRALEALRIGLRGLVLDPATPAFPRIAALADEYRV
FT                   TLLDAPPPALDLGNRIGPAALAAWLDAADNPA"
FT   gene            433567..434481
FT                   /locus_tag="Acry_0380"
FT   CDS             433567..434481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0380"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29605"
FT                   /db_xref="GOA:A5FVH3"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVH3"
FT                   /protein_id="ABQ29605.1"
FT                   /translation="MRVTQRVRKILSWYESDNPGTKANLARILMQGKLGGTGKMVILPV
FT                   DQGFEHGPARSFASNPTAYDPQYHFQLALDAGLSAYAAPLGMIEAGADSFAGSIPTILK
FT                   LNSSNSLATEKDQAVTGSVSDALRLGCSAIGFTIYPGSEHQFAMMEEFRELAEEAKAAG
FT                   LAVVLWSYPRGPMLDKKAETAIDICAYAAHMAALLGAHIIKVKPPTEHIGLDAARKAYE
FT                   KVDVSTLAKRIEHVVQSCFNGRRLVVFSGGEATDSASLIETVRALNEGGASGSIIGRNA
FT                   FTRPRDEALALLSQIVGIYQGKA"
FT   gene            434478..435098
FT                   /locus_tag="Acry_0381"
FT   CDS             434478..435098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0381"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /note="TIGRFAM: thiamine-phosphate pyrophosphorylase; PFAM:
FT                   thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29606"
FT                   /db_xref="GOA:A5FVH4"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVH4"
FT                   /protein_id="ABQ29606.1"
FT                   /translation="MTELYLITPPRLGPDFADALAAALDAGPVACVQLRLKEAGADEMR
FT                   RAIDALRPVAQSRGVAFLLNDDPRLAVETGCDGAHLGQDDLAAHGGLARVRRVLDGLSL
FT                   GITCHDSRHLAMEAAEQGADYVAFGAFYPTGTKEPKARADVEILRWWSELMEVPCVAIG
FT                   GITPGNAAPLVEAGADFLAVVGAVWQHPDGPAAGVRAFRAELA"
FT   gene            435182..437716
FT                   /locus_tag="Acry_0382"
FT   CDS             435182..437716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0382"
FT                   /product="Capsular polysaccharide biosynthesis protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29607"
FT                   /db_xref="GOA:A5FVH5"
FT                   /db_xref="InterPro:IPR007657"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVH5"
FT                   /protein_id="ABQ29607.1"
FT                   /translation="MSEPIVPIWRELLAEFDGAADPQPFLDRLIQEAFRRPGEFELHLM
FT                   LAERMFARGRDARGLAINGYVLACGDPHFRFRAHLQRADHFRRHGAFRKAEADIEAARA
FT                   IDPGSHWPVLAMAENLAQEGRVGERGDYIRAEYEGLRPESRAEIARHYAGWAAFDHFDW
FT                   TRASPGWQPRRPGRVPALERAGMILLVKDEEDIIGQNLSHHYALGFRAFCVLNNMSTDN
FT                   TREIVSRFRDSHDDCFVLLVDDPVRGHYQADKMRVYAETLQRHAEIAGLRLDWLFFIDA
FT                   DEFIASDTSRPSSEQLSALERRLNDPDTRVMVMHWIHAASPQVLEEFGSEDDPFEKINV
FT                   MRYRLLPLVPKVAYRVGFDYSLKNGNHFIEKLNDSLDSVVPVGCDDWYIYHFSLRSLSH
FT                   VRKKIINGGRAFVGTRGLNDHGQHWRERYALFQKYGDRIISEVLEEHVRFVPSLHPPRI
FT                   DSPEKRLPTRRVSSDIEPIDIKRAVNEISGIEAIEIAKAYTCERPEPAFVKGPVTSDIM
FT                   NDFRRERSVWPISVYKISDVEIHGPWFNAGIILVSQRHRFRIDEIYQPAGEQPQDICLE
FT                   KSLHELQFENKRFLEINEDCVLLATNGHNIYGHWLVDFLPKIYLLDYIGIDVSKIKFLM
FT                   PSDVGHWAIDLMNLVGIKKENLIIYDQNEIVPLCRSLFVPTLLRMSGRTSPLFLNATEF
FT                   INKRIDKNIQTKSDVSNTFLYFDREQEFTWRKIDGHDKIIKLFNDLNFHIVRPEKLSIS
FT                   EQIRLVRGAKVIAGQHGSALHSTIFCQDPVFAVVLHENRRNWFAGLQAGIGEYLGHQTG
FT                   YIFGETSSHENIFSTRFEASDIRMGVDFARMA"
FT   gene            437884..439887
FT                   /locus_tag="Acry_0383"
FT   CDS             437884..439887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0383"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29608"
FT                   /db_xref="GOA:A5FVH6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVH6"
FT                   /protein_id="ABQ29608.1"
FT                   /translation="MIRPRICLSMIVRNEAPVIRRCLASVLPLIDHWAICDTGSTDGTQ
FT                   DIIRSFFEEHAVPGELRESPWRDFAHNRNEALELARPHGDYVLIIDADDALELPPGFAR
FT                   PELAADGYTFDIHDVNIAYRRIQIVRSALPWRWRGVLHEFLHCDAPASEEHLPIVMRRN
FT                   HDGARRRDPSTYARDASILEAAIFVEEDPWLRARYVFYHAQSLRDMGEQERAMIAYLMR
FT                   AEMGFWQEEVYWSLYQAALMMERLGRDEETVLAAYRRAAAAAPHRIEALFAASRYCFAK
FT                   GRNEEGFRIAENGIGKPAPEGGLFVETWIHDYGLLDQYAANGYWAGHYPESFNAALEVL
FT                   ASGKVPAHELPRLARNFRALLDKVRPASAPDYGRLGQESYPDQHALKPKRLLRSGTTTA
FT                   PRVLIAILAKQKEEFLPLYLDCIEALDYPKSSIVLYIRTNNNTDRTEEILREWIARVGH
FT                   SYAAVEFDPSDVDERVEQFGAHEWNAIRFRVLGRIRNESLRKTREHGCDWYFVADIDNF
FT                   IRRCTLRELVATGLPIVAPLLRDAEPSSYYSNLHAEIDDNGYFRDCAQYELIMSRRIQG
FT                   LIEVPLVHCTYAVRADVIEHLNYDDGSGRHEYVVLSDSARKASIPQYFDNRQVYGYITF
FT                   SKNPDQYDENSAARAERNMWAVRKFMSEDRHG"
FT   gene            440129..440512
FT                   /locus_tag="Acry_0384"
FT   CDS             440129..440512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29609"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVH7"
FT                   /protein_id="ABQ29609.1"
FT                   /translation="MRSNKSMIRTTAAALAIGLGLAAFGGTALADPGYQAQGGWHRQGQ
FT                   QQGWQQPRRQNNWQRHGWQNRGNYQHSRYHGGWGNNGWQHQRWGHPHYDREGYHVMGTQ
FT                   GYYAPPALSFSINLPLAGGQYGH"
FT   sig_peptide     440129..440221
FT                   /locus_tag="Acry_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 31"
FT   gene            440686..441333
FT                   /locus_tag="Acry_0385"
FT   CDS             440686..441333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29610"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVH8"
FT                   /protein_id="ABQ29610.1"
FT                   /translation="MTSRFLPIFRRGYEAGARRRAGAGLLLLAMSTAPGFAATPRLLPD
FT                   RDASAIYQVSQPGKPEQTWRIRFDAAAGLVRATSLSGTPMPMTALLDLHSGRAQLVLPQ
FT                   MHALVNVPGLSGAMGQVMAMRGAHFTPLGTATIAGYRCTRYLVLRRNASGTACLTPDGF
FT                   ALAASGSDPHGRVSVQALSLHIGPQPAGDFEPPMGYSEVTLPPQMLASLLGQ"
FT   sig_peptide     440686..440799
FT                   /locus_tag="Acry_0385"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 38"
FT   gene            441407..442804
FT                   /locus_tag="Acry_0386"
FT   CDS             441407..442804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0386"
FT                   /product="Fucolectin tachylectin-4 pentraxin-1"
FT                   /note="SMART: Fucolectin tachylectin-4 pentraxin-1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29611"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR006585"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVH9"
FT                   /protein_id="ABQ29611.1"
FT                   /translation="MSKYRFSIVACARWEENYIQEWVLYYKNLDFDHIYLYCNDDCPYT
FT                   LLEKLSPFLIGQNPFVTFYHHKKIGQQFDMYLHFIINHINETEYVSFFDIDEFLWLSNG
FT                   RNISEFINDINVKCDRIVDVIYFNWLFFGNNGNQTRPPGLVLENYYRRESGFSNFMTKH
FT                   ITRSEKIKNKYIEKGAMTDFWHYWNGVKNFKDFDIVNALGEDARSYYSDIEQTKINISD
FT                   NKYFDNIIKNAVLCHFAFKSKEDFLLRARRSVSDVFAQQADHEKAYYDGRADAMLAHMN
FT                   AVDDYRFRYYWKSFYFRVCNKTEIDLRNYESGSLISNHCRAIQSTTSEWSCVRDLEQDA
FT                   SGALNGVIDGRAKFHTDLEDAPWWRVDLGVVHGIREVRLFNRMDQPAVAERANRIAIDI
FT                   GFDPEHFIEVFRRESDEPFGGVDGNPLVFAPSIPIPGRFVRVRLLERNYLHLDQVEVYG
FT                   DVLAQFG"
FT   gene            complement(442929..444344)
FT                   /locus_tag="Acry_0387"
FT   CDS             complement(442929..444344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0387"
FT                   /product="glycosyltransferase sugar-binding region
FT                   containing DXD motif"
FT                   /note="PFAM: glycosyltransferase sugar-binding region
FT                   containing DXD motif"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29612"
FT                   /db_xref="GOA:A5FVI0"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVI0"
FT                   /protein_id="ABQ29612.1"
FT                   /translation="MKNLIFVTGLAADFGGKPFNFAHYMAIHSAMAVNPGFNTLVYYQY
FT                   EPTGPYWDLIKPFVTTVETTAPSEIFGNPVTHFAHKADVIRLQALIEHGGVYLDMDTIC
FT                   QRSFEPILCGKTVLGIESAQPGIAQWDSNAAIGLCNATMIAPPGAEFLKIWLDQYRSFD
FT                   GTKWNEHSVILPVRLARQYPDLVRVEPPESFFWPIYHEEGLKSLFVDDGAFPHAYSIHL
FT                   WESLSWRYLSQLDYDQVTRIDTAYNRIARRFIHDDAEHLQAIAAAERTARLRQSRATFE
FT                   SIYANNVWGGGSGSGSKPETTEDYRRFLQSFLRDNAIRSVIDFGCGDWGFTHLIDWSGI
FT                   EYHGYDLVTSVIDANNQRYSTPDIHFSLFEDVSKLPQVDLVICKDVFQHLSNDKVAYFL
FT                   DHLRSKARLLLVTNDLEPARDLNQDIDDGGWRALRPDQAPFNVPSVIVLSWEIGAGQGA
FT                   HRKATFLISGSTT"
FT   gene            444903..447623
FT                   /locus_tag="Acry_0388"
FT   CDS             444903..447623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0388"
FT                   /product="RNAse E"
FT                   /EC_number="3.1.4.-"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29613"
FT                   /db_xref="GOA:A5FVI1"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR028878"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVI1"
FT                   /protein_id="ABQ29613.1"
FT                   /translation="MTKTMLIDASHAEETRVVVLDNNRLDDFDIEAADRKQIKGNIYLA
FT                   KVIRVEPSLQAAFVEYGGNRHGFLAFAEIHPDYYQIPVADRQKLLELEAEEARRRVEAE
FT                   DAEDEQEAALAAPRPPRVTEIAIGDAPPDAEGQVDAEAAAAPAEVGEAEADSGPEASGA
FT                   GAGEDRAGEGAEATATPPEQVGGDDGVDGAEEAQERRRLRALRSYKIQEVIHRRQIMLV
FT                   QVVKEERGSKGAALTTYISLAGRFSVLMPNSPNGGGVSRKITSLADRRRLKEAIAELEI
FT                   PQGMGMIVRTAGANRPKPEIKRDCEYLLRLWDDIRERTLASIAPALVYEEASLIKRTIR
FT                   DVYTRDVDQVLIEGEDGFRSARDFMRMLMPTHVKKVQQWTERQPLFAKHNVEQMLDQMF
FT                   QPTVQLKSGGYLVINQTEALVAIDVNSGRATRERNIEDTALRTNLEAAEEVARQLRLRD
FT                   LAGLIVVDFIDMETRKHNAMVERRLKDALKNDRARIQVGSISHFGLLEMSRQRLRPSLA
FT                   ETMLIACPHCQGVGHVRSTASTALAVLRAIEDEAARQAAELLVHLTPDVALYIFNHKRA
FT                   QIAATEARFGMKVVFVADGTVPATFKIEKVKAHAARPQETPAPTFRAPAETEEVEAEQQ
FT                   GDEVATEDAAGNAGKAADEVERRRRRRRRRRGGRREDLVSAPTGEQPEIAGIPAEFESR
FT                   MNDVLPTAARADAAEAPAPEVTMEPAVAETAPAVPEPAKEPKVVETSPAATEAAPSLAG
FT                   EVPAPEAEAETKPKRRAPTGPRSPTTRRRRAAASQAAEPEVQQPVFTDIADIFEAAEQA
FT                   EALAPKPRRTRRPKARPMEAETAVADAPATTEAVAEVSAAPQDGSASAGNVAGAEAPVA
FT                   NEGQAAPGAAVQPVLIGASETPTAARKRGWWKRPA"
FT   gene            447741..448073
FT                   /locus_tag="Acry_0389"
FT   CDS             447741..448073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29614"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVI2"
FT                   /protein_id="ABQ29614.1"
FT                   /translation="MGCGGVSRHRARLCLENFATPEGVPVVDVTGVLKMGKTSRGVARQ
FT                   YAGSAGKIANGRVGMLAAYVSAHAMPLSIGLSICRSVGAAILQGLPQPAFLTLSLSSRS
FT                   PPWRST"
FT   gene            448095..448457
FT                   /locus_tag="Acry_0390"
FT   CDS             448095..448457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0390"
FT                   /product="Transposase-like protein"
FT                   /note="FOG: Transposase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29615"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVI3"
FT                   /protein_id="ABQ29615.1"
FT                   /translation="MFHSRVAADAVCCVGDIEGTNGARLHDRAWCGHANPDAEDHDETK
FT                   TDLWARGLLMRRNISDGDLAFLPIWCSVGASIQVPGCLEGHPWAIKTTSRPRRTNSALT
FT                   TTRPGPGTSGIATSRS"
FT   gene            complement(448749..449999)
FT                   /locus_tag="Acry_0391"
FT   CDS             complement(448749..449999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0391"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; Ion transport protein;
FT                   Ion transport 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29616"
FT                   /db_xref="GOA:A5FVI4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVI4"
FT                   /protein_id="ABQ29616.1"
FT                   /translation="MRRALSLVARQTRLLSNRWYRRLRMDLWFPHVPLALAVGVAGALA
FT                   ILPTIQKFAAQYLHLDLANLVSAIHPISGNIPGLILNGVPNVVVGALQILIALGLLGRS
FT                   RIAWLSAIGIALAQLLLTVHLGAATRLDGETIYILVLLASLLLARNHFSRSSLAAGTLF
FT                   AVASVLVLMVYGVLGSLLLGAGFSPPITNLPAAVYFVIVTMSTVGYGDILPKSEDARLF
FT                   VVSLIVLGLTVFATALTAVIGPVLQNRINRTIGPRRQKMKRVNHFIISGHGVLARNTAR
FT                   ELHHRGEAVVFITETEDAGFSDAETVIGDPTDLDTLRKAGGEHARAILALSDDDSENAF
FT                   VILAVRELGTDAKKVAAVSTRKNLERVRRVHPDMILAAPVFGGEVLAMALTEQKIDGDW
FT                   LLSRFLDVRPHDADGTS"
FT   gene            complement(450087..450326)
FT                   /locus_tag="Acry_0392"
FT   CDS             complement(450087..450326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0392"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29617"
FT                   /db_xref="GOA:A5FVI5"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVI5"
FT                   /protein_id="ABQ29617.1"
FT                   /translation="MKVLVAVKLKAGVLDPQGKAIGHALEGLGYNDVNDVRVGKLIELD
FT                   LAETDREKARDAADSMARRLLANTVIESFEITIP"
FT   gene            complement(450323..451087)
FT                   /locus_tag="Acry_0393"
FT   CDS             complement(450323..451087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0393"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29618"
FT                   /db_xref="GOA:A5FVI6"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FVI6"
FT                   /protein_id="ABQ29618.1"
FT                   /translation="MARRRQLYEGKAKILFEGPEPGTLVQYFKDDATAFNAQKKGVITG
FT                   KGVLNNRISEFLMQRLGEIGIPTHFVRRLNMREQLVREVEIIPIEVVIRNVAAGSMSTR
FT                   LGIPEGTRLPRSIIEYYYKNDALNDPMVSEDHITAFGWASTQDMDDIVHLSLRINDFLT
FT                   GLFLGVGIVLVDFKIEFGRLWENDDMRIVLADEISPDNCRLWDAKTNEKMDKDRFRRDL
FT                   GRVEEAYQEVAKRLGILPEAGTRDMKGPETMQ"
FT   gene            complement(451217..451738)
FT                   /locus_tag="Acry_0394"
FT   CDS             complement(451217..451738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0394"
FT                   /product="H+-transporting two-sector ATPase, B/B' subunit"
FT                   /note="PFAM: H+-transporting two-sector ATPase, B/B'
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29619"
FT                   /db_xref="GOA:A5FVI7"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FVI7"
FT                   /protein_id="ABQ29619.1"
FT                   /translation="MEYEALTGTLWDKGTFWVTVAVLIFLAFFGRKIVGAITTMLDQRS
FT                   AAIQHELDEASRLRAEAEAMLKDAESRREAALAQAKDMLAMAGREAERLAADLLAEAEA
FT                   SARRREQMARERISAAEAAAIAEVRDAAAALAARAAEQILKETIDEAHDRGLIDQAIGG
FT                   LPAALRQKAA"
FT   gene            complement(451745..452314)
FT                   /locus_tag="Acry_0395"
FT   CDS             complement(451745..452314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0395"
FT                   /product="H+-transporting two-sector ATPase, B/B' subunit"
FT                   /note="PFAM: H+-transporting two-sector ATPase, B/B'
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29620"
FT                   /db_xref="GOA:A5FVI8"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FVI8"
FT                   /protein_id="ABQ29620.1"
FT                   /translation="MRRTTILLAATALGLTPAIAMAEGKMPQMDFSNPLTGAQVVWMAV
FT                   IMVVLYFVLARWALPRIGGVIENRHNRIATDLETARRAKAEAEHAVRELNLAIQNARES
FT                   SQGAIAEAVNAAKERARAQTAALNDRLSAQIASAEAEIDSARRTAVGALAPIARDVASS
FT                   LLQRLIGEAVEPGRIEQAVSALSTQG"
FT   sig_peptide     complement(452246..452314)
FT                   /locus_tag="Acry_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 23"
FT   gene            complement(452340..452573)
FT                   /locus_tag="Acry_0396"
FT   CDS             complement(452340..452573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0396"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /note="PFAM: H+-transporting two-sector ATPase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29621"
FT                   /db_xref="GOA:A5FVI9"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVI9"
FT                   /protein_id="ABQ29621.1"
FT                   /translation="MAIDTLLLARDVGAGLATIGVAGAGVGIGNLFGAFVGAVGRNPAA
FT                   RDKMFRDVLLGFALTEAVALYALVIALIILFA"
FT   gene            complement(452646..453401)
FT                   /locus_tag="Acry_0397"
FT   CDS             complement(452646..453401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0397"
FT                   /product="ATP synthase F0 subcomplex A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+-transporting two-sector ATPase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29622"
FT                   /db_xref="GOA:A5FVJ0"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FVJ0"
FT                   /protein_id="ABQ29622.1"
FT                   /translation="MAQESGINALGQFQLTTGFGAFGKAIEFTNSNEMMLLAAVIVTSL
FT                   FVVALRQRALVPGRMQGLAEISYEFVHNMVLDTIGEEGKRFFPFVFTLFAFILIGNILG
FT                   LFPYFFAFTSHIAITGALALFVFALSTLVGFWYHGIGFLKFFSPPGVPGWLLPLLIPIE
FT                   IVSFLSRPISLSVRLFANITAGHVMWEVFAGFMLMLVSGLGAVGVVAAIIPLGLNIALT
FT                   ALEFLVAFLQAYVFAILTCLYLHDAIHMH"
FT   gene            453511..453813
FT                   /locus_tag="Acry_0398"
FT   CDS             453511..453813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29623"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVJ1"
FT                   /protein_id="ABQ29623.1"
FT                   /translation="MKKTIQSIADRDSHDQRRHHFGAQPRCDAERIGPLVLLRALSGGL
FT                   VEPGAAARSGKALIEIAPIIWPLSRFVTHFHTLTPADRRQRLLPTLPFQVNISRA"
FT   gene            complement(453817..457314)
FT                   /locus_tag="Acry_0399"
FT   CDS             complement(453817..457314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0399"
FT                   /product="condensin subunit Smc"
FT                   /note="TIGRFAM: chromosome segregation protein SMC; PFAM:
FT                   SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29624"
FT                   /db_xref="GOA:A5FVJ2"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVJ2"
FT                   /protein_id="ABQ29624.1"
FT                   /translation="MPARFARLRISGFKSFADPTTIDILPGLTGIIGPNGCGKSNVVDA
FT                   LRWAMGEASAKSLRGGEMEDVIFAGTMARAARNLAEVSITLTDTAGLAPVPFQNEPELQ
FT                   VSRKIERGSGSSYRINGREVRARDVATLFADLASGARNSAMISQGRVSALVNARPDERR
FT                   ALLEEAAGITGLHARRHEAELKLRAAEQNLLRADDLRAQQEARLAELRKQARQANRYRN
FT                   ISGLIRDAEAEYLAIERELAERRRRAARAQFAEAEAAVGHAEKLRDDVLGRETSQNDAL
FT                   PALRAREADTRTRLERARILAEQIDAEIARLEAARREAEARVATLRKDHAGAERIARDA
FT                   EAAAIRLEAERSQLAADHELAPARIEQARREAEAASAALAQCEAATQQATEAAARAQAQ
FT                   RQAMETRLTQARGTAGQADRRAREAEAAHATAQAALVSPERLAAAEATREAAERAVAAA
FT                   ETTYAEAQNRVQGAETRRTEAHAAAIRARSAATEADAAAARLKAETDALKALLAQKFGR
FT                   DPDPVLDRIKVPAGLETALGAALGAELSAGEQASAARHWRSLPAIASDAALPRIGETIT
FT                   APDALRRALDHILLLPDGEDGEALQATLRPGQILVSIEGGVWRWDGFVVRPGAPTEAAV
FT                   RLAQRNRLDQLDVEFARARQSAEATRAALQEAEAAERDARHAEDEARTARRAAESAIDR
FT                   TRKDLRTTAETASRLAAEAERLAAREAAAAETRARIEAEAGEARAALAAIEAEFATLDD
FT                   AQAFRDALDRARSALSESRRRDSEATQALQRLQTEADARARRLDTIIREQSDWAERARD
FT                   ANDRRTDLGARLHEAEASLETLGADGGARERRAEAGAELEAAESDHHAAARDLASAEEA
FT                   ARRNSAAARAAEQDLARAREARIGAESAVREADHAWGTVAEKMLERLGVDPALPAVADP
FT                   SPDAAEKARKRFERLTRERDEMGPVNLRADIEVGEIETRLAAIDRDREEITSAIAKLRG
FT                   SIGHLNREGRERLSAVFTEIDRHFQALFTRMFGGGRAHLALTGSDDPLEAGLEIFAEPP
FT                   GKKLATLSLLSGGEQALTALSLIFAVFRCNPAPLSVLDEVDAPLDDANVERFCRLLEDI
FT                   SQDTGTRFIVVTHHHHTMARMDRLYGVTMQERGISRVLSVDLGTAAAMVEPAGAIAAE"
FT   gene            complement(457322..457951)
FT                   /locus_tag="Acry_0400"
FT   CDS             complement(457322..457951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0400"
FT                   /product="Protein-disulfide isomerase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29625"
FT                   /db_xref="GOA:A5FVJ3"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVJ3"
FT                   /protein_id="ABQ29625.1"
FT                   /translation="MDRRSLLGMVGGLATAGSLGIAFPAAAAETKTDSPYSIRSLGNPN
FT                   APVTVYEYFSLNCPHCAEFATHALPKVIESYVKPGKVYYVFKDFPLNEDALWAAQIARA
FT                   LPAKAYYPFISELFRTQDEWAYAPGLKTPKDYQNALFRYAALAGMDRTTFDAAIANKKL
FT                   RAFVLNELNDAEKTYKVNSTPTFIINGRKREGAVSFDTFSSWLKAA"
FT   sig_peptide     complement(457868..457951)
FT                   /locus_tag="Acry_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.973 at
FT                   residue 28"
FT   gene            458153..458668
FT                   /locus_tag="Acry_0401"
FT   CDS             458153..458668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0401"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="TIGRFAM: adenine phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29626"
FT                   /db_xref="GOA:A5FVJ4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FVJ4"
FT                   /protein_id="ABQ29626.1"
FT                   /translation="MNLKDHIRGIPDFPKPGILFYDISTLIRHADAWQVAMGRLAKVVR
FT                   AHHPDLLAGVESRGFILAAPLALKLGCGFIMLRKRGKLPGATVGYDYDLEYGQDRIEIQ
FT                   ADAVQPGQRVVVVDDLLATGGTMAAGIKLLRKVGAEVPAAAALIELAFLKGRDRLDVPF
FT                   EALVSYDQ"
FT   gene            458693..459766
FT                   /locus_tag="Acry_0402"
FT   CDS             458693..459766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29627"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVJ5"
FT                   /protein_id="ABQ29627.1"
FT                   /translation="MKRRAALGALGTIIAGSALPFARASDLPTPANAIFADTFGGSYRI
FT                   VVGGLPGGQADRWGRAIALGLEKILSPRTPLRIETVGGQDGVTGANRLQTLMVSDGHTA
FT                   ALLPGESSIAFLTGDPRVHFRPGEWIPILAGLSSGVIVLRGGAGRLAQAAPVRLAAAAP
FT                   ESPDLAAILAFERLGVPISPIFGLRGTTAVARAFGLGEVDAVMLTGEDIPADLASLQAE
FT                   GGAAICSLGTVDQAGRTVRDPRFANVPTVAELAGIRHAKALSPPLERAFQGVAAASRLD
FT                   FIMVLPHLTPAASVALWRQAALGAIQGSALQSAATASAISLTVNGAAVALAPIAASPEA
FT                   LLALRQFLFTRFGWRPS"
FT   sig_peptide     458693..458767
FT                   /locus_tag="Acry_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.872 at
FT                   residue 25"
FT   gene            459796..461196
FT                   /locus_tag="Acry_0403"
FT   CDS             459796..461196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0403"
FT                   /product="DNA replication and repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29628"
FT                   /db_xref="GOA:A5FVJ6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVJ6"
FT                   /protein_id="ABQ29628.1"
FT                   /translation="MAKSATRFVCNECGAVAPKWAGRCEACGAWNTLEPQAVVPTGTGR
FT                   KAAVQAGRGIDFVGLAGETPPPPRIPLGIEEFDRVLGGGMVPASAILVGGDPGIGKSTL
FT                   LLQAAARLAASGRRVLYVSGEESVAQIRLRAERLDLKTAPVNLASATVLADILGSLRAE
FT                   RDAALVVIDSIQTIWDETVESAPGTVSQVRANAFALIQAAKTQGFALMLVGHVTKEGAL
FT                   AGPRVLEHMVDVVLHFEGDRGHQFRILRGAKNRFGATDEIGVFEMTGRGLAEVANPSAL
FT                   FLAERHGNVTGSAVFAGLEGSRPVLMEVQALLSANGAGSARRSVIGWDQGRLSMLLAVL
FT                   DARCGLKLGGHDVYLNVAGGLRVSEPAADLAVAAALISAASGVPADPETVFFGEIGLSG
FT                   ELRQVAQVELRLKEAAKLGFGRAALPRRVAGGTRRLSAPEGMVLAEYGHLSDLVAAMGA
FT                   VTGNGEEA"
FT   gene            461196..461759
FT                   /locus_tag="Acry_0404"
FT   CDS             461196..461759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0404"
FT                   /product="Colicin V production protein"
FT                   /note="PFAM: Colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29629"
FT                   /db_xref="GOA:A5FVJ7"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVJ7"
FT                   /protein_id="ABQ29629.1"
FT                   /translation="MTWADGIAIGVVLLSGLLALARGFVREVLGIGAWIGAGLAAFVSY
FT                   PLVEPQITGIVGNPKLVLPVSIGIVFIVVLIVLSILSAWLGSMVRDSVLSGVDRTLGLA
FT                   FGLVRGAVIVCLAYIALSIFLQPSEWPSAIRRAKFLTYAENGSAFLVAFLPAAYRPHVD
FT                   RIGPAAAPAAAPVSSAAGGTGPSQ"
FT   sig_peptide     461196..461261
FT                   /locus_tag="Acry_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.733) with cleavage site probability 0.722 at
FT                   residue 22"
FT   gene            461840..463321
FT                   /locus_tag="Acry_0405"
FT   CDS             461840..463321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0405"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase, class-II;
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29630"
FT                   /db_xref="GOA:A5FVJ8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVJ8"
FT                   /protein_id="ABQ29630.1"
FT                   /translation="MTQSENPVIRDDDDKLHEECGVVGVWNVTDAAAITALGLHALQHR
FT                   GQEATGIVTHDGVRFHAHKGIGLVGDNYGDAKVMAGLPGTRAIGHNRYATTGATLLRNV
FT                   QPLFAEFEFGGLAVGHNGNLTNAHTLKRALVRRGCLFQSTTDSEVFVHLIAISLYATVL
FT                   DRLIDALKQVQGAYSLVALTNDMLIGVRDPLGVRPLILGRTHGADGSGPGWVLASESCA
FT                   LEMVGAEFVRDIEPGEIVAIDRGGVRSLKPFVPQKPRFCVFEYIYFARPDSIVDGMSVY
FT                   AARKRIGSELAQESPVEADLIVPVPDSGVPAAMGYAERSGIPFELGIIRNHYVGRTFIE
FT                   PTDQIRHLGVRLKHSANRPALEGKRVVLVDDSIVRGTTSKKIVEMVRAAGAREVHMRIS
FT                   SPPTTHSCFYGIDTPERGKLLAARNSEAEMAALIGVDSLAFISIDGLYRALGHQGRDAA
FT                   DPAYCDACFSGDYPIPLTDHAEPRDAQLSLLAELA"
FT   gene            463346..464023
FT                   /locus_tag="Acry_0406"
FT   CDS             463346..464023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0406"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29631"
FT                   /db_xref="GOA:A5FVJ9"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVJ9"
FT                   /protein_id="ABQ29631.1"
FT                   /translation="MTLVDQIRAIMSAMKTRMPTAGEALPGRATPMPIPEFHYVSGARL
FT                   AEPYPPGSEVAIFGLGCFWGAERKFWQAPGVLVTAVGYAGGFTPNPTYEEVCSGRTGHA
FT                   EVVLVVFDPRAISYQNLLKLFWENHDPTQGMRQGGDIGTQYRSAIYALSDEQLRLAELS
FT                   RDAYQNVLSEAGFGRITTEILPAPTFFFAEAYHQQYLAKNPDGYCGLGGTGVTCPAGVM
FT                   PAD"
FT   gene            complement(464083..464340)
FT                   /locus_tag="Acry_0407"
FT   CDS             complement(464083..464340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0407"
FT                   /product="protein of unknown function DUF1150"
FT                   /note="PFAM: protein of unknown function DUF1150"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29632"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVK0"
FT                   /protein_id="ABQ29632.1"
FT                   /translation="MNIKTHDGIAEDAPFQAFLDPHQITEAQLAELGLEEIAYVRPIMT
FT                   PNGPAFGVFAANGVPMAVAADNSVARAAIVQHELAPVSVH"
FT   gene            complement(464342..464845)
FT                   /locus_tag="Acry_0408"
FT   CDS             complement(464342..464845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0408"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29633"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVK1"
FT                   /protein_id="ABQ29633.1"
FT                   /translation="MTTRVFTSPLFLGFDHLEQVIERAAKTSSEGYPPYNIEQLSSTSL
FT                   RITIAVAGFTMDDLQITQEDNQLVIRGRQNDDMQGRIFLHRGIAARQFQRAFVLAEGIE
FT                   VKGAWLDNGLLHIDLARPLPEAKIRTIAIKKGAGGQNGASSARTLDSDAVASRIVGREL
FT                   QEGS"
FT   gene            464962..465528
FT                   /locus_tag="Acry_0409"
FT   CDS             464962..465528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0409"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="TIGRFAM: peptide deformylase; PFAM: formylmethionine
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29634"
FT                   /db_xref="GOA:A5FVK2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVK2"
FT                   /protein_id="ABQ29634.1"
FT                   /translation="MPAMSATTDIADAGIPEILIVPDKRLRMKARRVVGADRDDVAELV
FT                   PRMFAAMYRAPGIGLAAPQIGVSLRLVVMDLAPDDQKQPMVMINPEITARSEELVSREE
FT                   GCLSLPGQYAEVIRPGQISVAFEDEDGKKRTIDADGLLAACIQHEIDHLDGVLFVDHLS
FT                   ALKRNMILRKLAKDLREKAARKPAR"
FT   gene            465528..466433
FT                   /locus_tag="Acry_0410"
FT   CDS             465528..466433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0410"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29635"
FT                   /db_xref="GOA:A5FVK3"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FVK3"
FT                   /protein_id="ABQ29635.1"
FT                   /translation="MRLAFMGSPGFAVPALRALHAAGHDIVAVYCQPPRPVGRGHRIHK
FT                   CPVHEAAEALGLTVRTPERLRRDDAERAYFRALDLDAAVVAAYGQILPADMLVAPRRGC
FT                   INIHASLLPRWRGAAPIHAAILAGDAQTGVTIMQMDEGLDTGATLLAEAVPIGPEDTMV
FT                   DLLDRLADLGAALVIKVLDGNFPPVPQPEGGVTYAPKLSKADAEIDWSASAAVILRRIR
FT                   AFRPWPGTETRLDGEALKIIRAEPAAGQGEPGTVLDDRLAIACGDAAIRPTLVQRAGRA
FT                   AMQAEAFLRGHPVAIGTRLG"
FT   sig_peptide     465528..465593
FT                   /locus_tag="Acry_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.612) with cleavage site probability 0.546 at
FT                   residue 22"
FT   gene            466430..467197
FT                   /locus_tag="Acry_0411"
FT   CDS             466430..467197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0411"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29636"
FT                   /db_xref="GOA:A5FVK4"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FVK4"
FT                   /protein_id="ABQ29636.1"
FT                   /translation="MRRWALRLEYDGRGFVGWQRQENGLSVQEVLETAASRLCGGDVPD
FT                   SVVAGRTDAGVHAAGQVAALELPDRLDARAVREALNFHMKPHAVAVIEAAPAPSAAWSP
FT                   RFSAIGRAYRYLILNRSARPALRDGFVWHVKAPLDAPAMHEAAQSLLGRHDFTSFRASS
FT                   CQANSPLRTLDRLDVRRDGETVVIEAEARSFLHHQVRNMVGTLKLVGEGRWRVGRVAEA
FT                   LAARDRSAAGPTAPPDGLVLVAVRYEVDPFPRN"
FT   gene            467406..467840
FT                   /locus_tag="Acry_0412"
FT   CDS             467406..467840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0412"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /note="TIGRFAM: translation initiation factor IF-3; PFAM:
FT                   initiation factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29637"
FT                   /db_xref="GOA:A5FVK5"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVK5"
FT                   /protein_id="ABQ29637.1"
FT                   /translation="MLGVMSTREAQRRAGEVGLDLVEISPNADPPVCKLLDYGKFKYEQ
FT                   QKKKNEARKKQKVIEIKEIKVRPNIDENDYQVKLRAMKSFIGDGDKVKVTLRFRGREMA
FT                   HQELGVKVLERIRLDMETDTKVEQMPKMENRQMIMVLSPR"
FT   gene            467857..468513
FT                   /locus_tag="Acry_0413"
FT   CDS             467857..468513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29638"
FT                   /db_xref="GOA:A5FVK6"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVK6"
FT                   /protein_id="ABQ29638.1"
FT                   /translation="MLGFVTGLTAEAALLRGVRARVVVGGGTPDGALHAARTLAQDKAV
FT                   SALISFGLAGGLDPGLAAGTLLVPRKVLGSQKATYSCELRLTEMFGGATVDALIGGGSV
FT                   AVTPEHKRVLFASTGAAAIDLESAAVARVAAEYGLDFAVLRAIADPARRRLPPAALVAL
FT                   GPDGRISIEQVLKSVFRRPAQIPDLIALGREAAAARRTLQRALEFYRSRVNTTGT"
FT   gene            complement(468480..469283)
FT                   /locus_tag="Acry_0414"
FT   CDS             complement(468480..469283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0414"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /note="TIGRFAM: exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29639"
FT                   /db_xref="GOA:A5FVK7"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVK7"
FT                   /protein_id="ABQ29639.1"
FT                   /translation="MTALTVATWNINSVRLRRDLLHSLMDQAAPDIVCLQETKVPDDLF
FT                   PEDLGTALGLPHVLKRGMKGYNGVAILSRLPLTAVEDTPDWCMKSDCRHIAARIDTGTD
FT                   PLVLHNFYVPAGGDIPDRAENPKYGHKLDFIAEARDHFAMNRPHRTMLVGDLNIAPLEN
FT                   DVWSHKQLLNVVSHTPPETEGLNAWRTEGFIDAIRHFVPDDQKLFTWWSYRNRDWRASN
FT                   RGRRLDHIWVSTDLIGNLARHAILQDARDWERGSDHVPVVLTLDL"
FT   gene            complement(469280..469963)
FT                   /locus_tag="Acry_0415"
FT   CDS             complement(469280..469963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0415"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29640"
FT                   /db_xref="GOA:A5FVK8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVK8"
FT                   /protein_id="ABQ29640.1"
FT                   /translation="MSEFVIAPPAIPAVPVAGGGLFPVRRIFCVGRNYAAHTREMGGDP
FT                   NREPPFFFTKPADAIALGDSVPFPSATQNLHHEMELVVALGAGGRDIPSDAALAHIYGY
FT                   AAGVDLTRRDLQDEAKSLRRPWDMSKGFDLSAPISLIVPAAQIGHPAAGRISLAVNGEQ
FT                   RQNGDLSDMIWPVADIISFLSSLVELKPGDLIYTGTPDGVGQIQPGDRVYGVIDGVGEL
FT                   EFTLA"
FT   gene            complement(469992..470786)
FT                   /locus_tag="Acry_0416"
FT   CDS             complement(469992..470786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0416"
FT                   /product="gamma-glutamyl-gamma-aminobutyrate hydrolase"
FT                   /note="PFAM: peptidase C26"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29641"
FT                   /db_xref="GOA:A5FVK9"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVK9"
FT                   /protein_id="ABQ29641.1"
FT                   /translation="MLTRRSGFARKSSMISRSSKLIGISCCRKLFGVFGMLNHAASDTY
FT                   VRAVDLVIGGVPVLIPANGDRSHVNTLLDRLDGLILTGSRSNVAAVFYGGPPQPPDDAP
FT                   EDPERDRVTLPLVRGAVARGLPVLAICRGLQELNVALGGTLHQRLQDLPGRIDHSTPMQ
FT                   PHAPVRTGKAHHVTLRSGGRLARIVESNLLSVNSLHNQGIDRLAPGLLVEARATDGTIE
FT                   AVTGTGPGYLVGVQWHPEYDFEHDAASRRIFESFGAAVNKAV"
FT   gene            complement(470842..471462)
FT                   /locus_tag="Acry_0417"
FT   CDS             complement(470842..471462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0417"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /note="PFAM: outer membrane lipoprotein carrier protein
FT                   LolA"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29642"
FT                   /db_xref="GOA:A5FVL0"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVL0"
FT                   /protein_id="ABQ29642.1"
FT                   /translation="MIARRALLGIAATCVAASFSPAWSAPLSSGHTQQVLGKVLDYLNS
FT                   LKTVTARFMQVGPDGSVRTGTAIVQRPGKMRFEYDKPDPQLLVAGFGLLVYHDPQLDQT
FT                   TNIPLSSTPLGILLAKHITFGGDVKLLRVSTPPGEIQVTLTRAGREAQGHITLVFSTNP
FT                   IELRQWRLTDAQDRVTQVSLYDLKPAAPFPDKTFEFVPGYNTN"
FT   sig_peptide     complement(471388..471462)
FT                   /locus_tag="Acry_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 25"
FT   gene            complement(471481..471870)
FT                   /locus_tag="Acry_0418"
FT   CDS             complement(471481..471870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0418"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29643"
FT                   /db_xref="GOA:A5FVL1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVL1"
FT                   /protein_id="ABQ29643.1"
FT                   /translation="MGQQMNSEELVGVLRDTIVALVRREGVDLSARQLGVFLTCYLNDD
FT                   AHTVRGLASELNVSKPAITRALDRLSDLDLARRKVDPSDRRSVLVQRTTKGSAFLREIR
FT                   SVMTEVTSDGRSRPEQTSRRSVAAN"
FT   gene            complement(472090..473325)
FT                   /locus_tag="Acry_0419"
FT   CDS             complement(472090..473325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0419"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17, leucyl aminopeptidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29644"
FT                   /db_xref="GOA:A5FVL2"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVL2"
FT                   /protein_id="ABQ29644.1"
FT                   /translation="MVLLHGPNGCSGALLGLGDRPTQATFGDLHTKLPPGAEWSLLPGD
FT                   YDPGQAWLGIALGTYRFERFRRPRPPLPRISVDHAPDRARHLASAICFARDLINTPANH
FT                   LGPSDLADAGTTLAERYGAAVRRIRGAELEDGYPAVHAVGAGSERPPEVLQFNWGSDSS
FT                   HPLISLCGKGVCFDSGGYDLKPSAAMLRMKKDMGGAAITLGVAQAVMALNLPVRLDVRI
FT                   GCVENSVSGHAMRPLDIIRTRAGLNVEVGNTDAEGRLVLADLLADAADAKPHWLIDFAT
FT                   LTGAARVALGPDLPALFSNDDALANGLLAAGTAADDPLWRLPLWQGYESWLDSPTADLN
FT                   SVASKPFAGAIIAALFLRRFVPSGTPWAHIDTYAWNDSTRAGKPEGGEAQALHATFGAI
FT                   EALASVSTTKRP"
FT   gene            473917..475779
FT                   /locus_tag="Acry_0420"
FT   CDS             473917..475779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0420"
FT                   /product="Excinuclease ABC subunit C"
FT                   /note="TIGRFAM: excinuclease ABC, C subunit; PFAM:
FT                   Excinuclease ABC, C subunit domain protein; excinuclease
FT                   ABC, C subunit domain protein; UvrB/UvrC protein; SMART:
FT                   Helix-hairpin-helix DNA-binding, class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29645"
FT                   /db_xref="GOA:A5FVL3"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVL3"
FT                   /protein_id="ABQ29645.1"
FT                   /translation="MISGALVSMPAAPGVYRMLDLSGNALYVGKARSLKKRVTTYTQIA
FT                   RLPERLRRMVSETSTVEIITTHTEAEALLLEANLIKRLKPKYNILLRDDKSYPWLVITE
FT                   DGEFPQLAKHRGAQVRKGRYWGPFASAWSVNQTIQALQRVFLLRTCPDTVFANRTRPCL
FT                   LFQIKRCSAPCVGRIDAEAYGALVRQASDFLSGRAGTVQHDLAAAMAAAADVMEYERAA
FT                   AIRDRIRGLAHIRGGDVINPESVGDADVIAIHQAAGQSCLQVFFIRGGRNYGNRSFFPT
FT                   QAQGATPGDVLGAFIAQFYDDKTPPPLILLSNTVPQADLLKDALGLKAGYKVELAVPQR
FT                   GEKRHVVEHAATNAREALERKLAESAGQEKLLAATAALFGLEGNPERIEVYDNSHIMGT
FT                   NAYGVMIVAGPEGFIKPAYRRFSIKGPITPGDDFAMMREVLTRRFVRATAEDSSREDGT
FT                   WPDLVVIDGGAGQLSAARAVLDELGVSDVPLVAIAKGPDRDAGREWFHLPDRSPFQLPP
FT                   RDPVLYFLQRLRDEAHRYAITTHRASRSRKITTSELDGIPGIGSARKKALLNHFGSARG
FT                   VRQAGLKDLEAVSGINRTTARLIYGYFNPDARFDDLPAGGIRKD"
FT   gene            475876..478092
FT                   /locus_tag="Acry_0421"
FT   CDS             475876..478092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29646"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVL4"
FT                   /protein_id="ABQ29646.1"
FT                   /translation="MSDTISGTVLSGVTLSSAQYADPVAIEGIIDVAGGNALVAPLTWT
FT                   IDVTGTIAASDDGGVLLLAGGQIDNHGLVTAASDAVLSTSGRAFDIQNEASGTLASASG
FT                   DAVKLSGGVTGSTLLNAGLISAGNAGIGLQIGAAVAVNEAGGVIEGGAAGVVLGNVASF
FT                   DNFGTVGGSTGILVPIGQNYVDIVQGGLVSASSGPAISFTGGAVMTVTDTLTVLPGATF
FT                   DGAAIGGQVADLVFGGTTEGTFVNPTQEFVQFNTISIAAGATWDLAGISTISSSFRNDG
FT                   TLLVQAGDAIDFGAAVSGSGVIDLAGGFVDFANTVAAGTTIDFNAPGSFMQFNQSHPFS
FT                   GTVEGFTPGDTIDITGFGASQQLSGTVAGNVLTLNNGLAPLYVTFATAPGPLAVVAIGG
FT                   TNPKTFEVVVPCFRHGTRLLTPSGLRPVETLSEGDEVITLRGEVRQIAWRGRRRIDCRR
FT                   HPVPESVLPVLIEKDAFGVGQPCRDLYLSPDHAIWIDGSLVEIKRLINGLSIRQVTVPT
FT                   VTYYHVELESHDVVLAEMLPAETYLDCGNRFQFEDGDATISLFPDFGALARDPGRLYAP
FT                   VVDGGPDLARIRAGLQYRVASRGIRQKAGNFQVVADGKTVAPVWSADRHRIYRLPPAPC
FT                   DLKLLSTASRPAELDPASEDWRWLGIAICDAVLDGDPVDIAAPFFGRGFHGPEHAGDGW
FT                   FRWTDGTATMDAAGARELAFTVRAVAPVWEVPAPSCGVSVRHRA"
FT   sig_peptide     475876..475941
FT                   /locus_tag="Acry_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.973 at
FT                   residue 22"
FT   gene            complement(478022..478957)
FT                   /locus_tag="Acry_0422"
FT   CDS             complement(478022..478957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29647"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVL5"
FT                   /protein_id="ABQ29647.1"
FT                   /translation="MRRRLLVALPLLLAGCGTLPQPLLGKPGAMGARLAVPPPPVLIVP
FT                   PPPDALLGNRAADAYAHDLAKALVDRNVPSIVRPARPYDWQLEATARTANATVIPGFRI
FT                   IGPGHKEYGHLTGAEVSGAAWAAGDPATLRQAADAAAPGLVKQLSAINAAVQQSNPASL
FT                   ENRPPRVRLIRVTGAPGDGNHALKLDVSRDLPKLGVVMVDHTADADFLIDGVVKVSPAN
FT                   KDGKPGESDLVELDWTVRNRRGGFIGKVSQLHDLKPSEMTPYWGDVAAAAASQAALGLR
FT                   QVIRNATLKHDALPKHRKTEPAPPTPAQQP"
FT   sig_peptide     complement(478880..478957)
FT                   /locus_tag="Acry_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            complement(478954..479697)
FT                   /locus_tag="Acry_0423"
FT   CDS             complement(478954..479697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0423"
FT                   /product="protein of unknown function DUF152"
FT                   /note="PFAM: protein of unknown function DUF152"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29648"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVL6"
FT                   /protein_id="ABQ29648.1"
FT                   /translation="MISFVTASLDVPHGFFTRAGGVSPGPYASLNCGRSGQDDPANVAE
FT                   NRARAVMAIGGHRDRLAGLRQVHGAVAVTSPDPEGPFHEADAMVTDQPGLALGIITADC
FT                   APVLFSSTDGRIVGAAHAGWRGAAAGVLEQTAALMRRMGASKIVAAIGPCIHRESYEVG
FT                   LDMRTAVLASGAESECFFSAGRPGHWHFDLPGYCAARLAMVGIDAAILPHDTLSDETAF
FT                   FSHRRRTLRGEGAGGHQISIIMVRS"
FT   gene            complement(479694..480668)
FT                   /locus_tag="Acry_0424"
FT   CDS             complement(479694..480668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0424"
FT                   /product="protein of unknown function DUF185"
FT                   /note="PFAM: protein of unknown function DUF185"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29649"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVL7"
FT                   /protein_id="ABQ29649.1"
FT                   /translation="MIERLDAFMARANAAYYASRDPFVDFVTAPEISQVFGELLGLWAA
FT                   MAWSMLGSPAPFALVEAGPGRGHLMTDALRAAKRAMPAFVEAADIHLIETSPRLIGLLK
FT                   DRLPQAMFHADLSTIPDQSIILLANEFLDALPIRQFVRRGPAWRERYVADGAFVEASAE
FT                   TALPDAPEGTVIERNETAEAFVAALASRISRRGGSALLIDYGHDGGATGESLQAIMDGQ
FT                   PADPLAEPGRRDLTAHVDFSRLAMAARNAGAEIRGPAAQGAFLAALGIHERTAQLGHHA
FT                   GQDDALRLLAATRRLTSPEAMGSLFRVMAICPRGMEPLPGFGA"
FT   gene            complement(480665..481495)
FT                   /locus_tag="Acry_0425"
FT   CDS             complement(480665..481495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0425"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="PFAM: prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29650"
FT                   /db_xref="GOA:A5FVL8"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FVL8"
FT                   /protein_id="ABQ29650.1"
FT                   /translation="MKNVYVWPHFDPILVRFGPFAIHYYALAYITALVLGWRLMRRLVR
FT                   EAPVVATHEQVDDFLSWATLGVVLGGRLGYILFYQPVYFLDHLNRTYAVWDGGMSFHGG
FT                   MLGVAVAILIYCRRHGIDPWRFGDRVAVPVPIGLFLGRIANFVNGELWGRPAPAWFPFR
FT                   MIYPESGSDVPRYPSELIEATLEGLVLFIVLLIASRNERIRSQPGYLGGMFVMGYGIAR
FT                   TTAECFRQPDWFLGYLMFGLTMGQLLSIPMIVIGATMIWRAKYVARRQGALATA"
FT   gene            complement(481492..482472)
FT                   /locus_tag="Acry_0426"
FT   CDS             complement(481492..482472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0426"
FT                   /product="ADP-glyceromanno-heptose 6-epimerase precursor"
FT                   /EC_number="5.1.3.20"
FT                   /note="TIGRFAM: ADP-L-glycero-D-manno-heptose-6-epimerase;
FT                   PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29651"
FT                   /db_xref="GOA:A5FVL9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVL9"
FT                   /protein_id="ABQ29651.1"
FT                   /translation="MILVTGGAGFIGSNLHAALHERDLNVVIVDKLRTTGKWRNLRAHP
FT                   PAMIVEPRELGDFLASQPPLDAVIHLGAISETTAIDGDLVWQSNVALSQMLWRWCAAQR
FT                   LPFIYASSASTYGDGSAGFDDDNDLAALRRLRPLNLYGWSKHAFDLWVAGECAAGRPRP
FT                   PQWAGLKFFNVYGPNEYHKGRMISVVKVKFDEVASGSPARLFRSDRADIADGQQSRDFI
FT                   WVDDVVAAILFLLDHPEVSGLFNLGTGTARSYVDLARAVCSACGVGERIEFVPMPESLV
FT                   GQYQSFTEARMDRLRAAGFDRPFTPLEQGVEAYIRNFLSRPDQYR"
FT   gene            482532..482885
FT                   /locus_tag="Acry_0427"
FT   CDS             482532..482885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0427"
FT                   /product="protein of unknown function DUF526"
FT                   /note="PFAM: protein of unknown function DUF526"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29652"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVM0"
FT                   /protein_id="ABQ29652.1"
FT                   /translation="MTERPRFFDDLAGLAGGALSAASGLRDEISALVRARVDEAIRRLD
FT                   LVRREEFDAVMELAARARAESEALASRVAHLEDMVIPAAPRPVGPDAGADGVAEAPATD
FT                   PLAVPDQDGNTPI"
FT   gene            complement(482861..483454)
FT                   /locus_tag="Acry_0428"
FT   CDS             complement(482861..483454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0428"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29653"
FT                   /db_xref="GOA:A5FVM1"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVM1"
FT                   /protein_id="ABQ29653.1"
FT                   /translation="MRVILASTSVTRQSMLKAAGVLADTESSGVDEAPIKHAGTLAGQS
FT                   AAVVAARLAREKALAVSARHPDAVVIGADQMLDCEGAWFDKPADREEAAQTLLRLSGRT
FT                   HRLETSIACVRDGEVTWFHGEAPRLTMRPLSDAFITAYLAAEGEAALHSVGAYRLEGPG
FT                   IQLFERIEGDFFTILGLPLLPLLGYLRQIGVLPS"
FT   gene            complement(483455..484462)
FT                   /locus_tag="Acry_0429"
FT   CDS             complement(483455..484462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0429"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29654"
FT                   /db_xref="GOA:A5FVM2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014182"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVM2"
FT                   /protein_id="ABQ29654.1"
FT                   /translation="MKAVAFTHSLPVTADEALIDIEAPDPVLRTHDVLVEVRAVSVNPV
FT                   DTKIRRRNEPLGEPRILGFDAAGIVRSVGPGVTRFGIGDEVFYAGSVDRQGSNAQFHAV
FT                   DERIIARKPRSLSFAEAAALPLTTLTAWEMLFDRFSIPRDRVHHDTLLIVGGAGGVGSM
FT                   AIQLACQLTGLVVVATASRPETINWCSSLGAHHVINHHHPLAHQLETCEVSAPSYIFCT
FT                   NHVERHWRELCHVLAPEGRIGLIESTGPLDMNEIFNKSASVHTEYMFARSLHQTTQMIE
FT                   QHHILQSVSRLVDQGVLRTTMTENYGPITAANLRRAHAAVESGTTRGKIVLEGF"
FT   gene            complement(484504..485229)
FT                   /locus_tag="Acry_0430"
FT   CDS             complement(484504..485229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0430"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29655"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVM3"
FT                   /protein_id="ABQ29655.1"
FT                   /translation="MPVVPFDVEPHDGAEPVVIGGLQTSILWRRSARARRIALRIDPQG
FT                   GRIVITLPPRGSRKAGLALLRGHEIWVAERLAALPAPVIIADGNEIPIFGRPHRIIHDP
FT                   SLRGGAIIEQAAIRIGGHPEFLARRVRDALHDLALRELSAQARDKAAHVGARPAAIRVK
FT                   DTRTRWGSCAANGTLMFSWRLIMAPSFVQDYVVAHEAAHLRHMNHGPDFWRLAEMLTPH
FT                   RVAATSWLAAEGPGLLRIS"
FT   gene            complement(485238..485714)
FT                   /locus_tag="Acry_0431"
FT   CDS             complement(485238..485714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0431"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29656"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="InterPro:IPR008228"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVM4"
FT                   /protein_id="ABQ29656.1"
FT                   /translation="MSKAGNAPFWRTKRLEEMTPSEWESLCDGCGRCCLHKLRDEETNE
FT                   LAFTNVSCRLLDTATGRCRNYENRLREVPDCSALTPELVTAIDWLPPSCAYRLIAEGKD
FT                   LPDWHPLLTGDPESTFRAGASVAGRVRSETSVHHLEDHIVNWPACWPRARCHAG"
FT   gene            complement(485753..486481)
FT                   /locus_tag="Acry_0432"
FT   CDS             complement(485753..486481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0432"
FT                   /product="protein of unknown function DUF500"
FT                   /note="PFAM: protein of unknown function DUF500"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29657"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVM5"
FT                   /protein_id="ABQ29657.1"
FT                   /translation="MMKHNDVVRGVARGTTRVGIAALLLAIPLASCASDAGTPNAAQEL
FT                   VDRSTLTIETMLGSGTASAGQATQLLRNAKAVVVCPRIFKAGFFVGGEGGSCVLVSRAA
FT                   GGSWSDPAFYTMGSGSFGLQIGAQDAEVIMLLMNNTALNAFLNSQFKIGADAGVSVATL
FT                   GAGIGGSSGTALGADIVTFAKSRGLYGGISLSGSVFSNDAALDQQYYGQTVGPRQIVVN
FT                   MTVNNAGANPLRAMLAKYGG"
FT   sig_peptide     complement(486380..486481)
FT                   /locus_tag="Acry_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.523 at
FT                   residue 34"
FT   gene            complement(486539..487219)
FT                   /locus_tag="Acry_0433"
FT   CDS             complement(486539..487219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0433"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29658"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVM6"
FT                   /protein_id="ABQ29658.1"
FT                   /translation="MARWSRSANDPSPAPPRMTELDMKPTTFWLIRHATVTPDALALLY
FT                   GQMDVPICGERRLRDTPRYAALASSLPRPAHWVVTPLSRTRLTAEAIMAAGYGPVVPQV
FT                   EETLIEQDFGIWQGMNMSEFNRRGSPHPFWPVGGDEQPPEGESFAQLRARVGAGLDRLG
FT                   DAHRGKDVVAVSHGGAIRAAVAHALDLTAHQALSLAIENLSVTRIEHHGHAWRVVTVNE
FT                   QISI"
FT   gene            complement(487191..487991)
FT                   /locus_tag="Acry_0434"
FT   CDS             complement(487191..487991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0434"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29659"
FT                   /db_xref="GOA:A5FVM7"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVM7"
FT                   /protein_id="ABQ29659.1"
FT                   /translation="MIAALRRIWGLMYRHFCLYRRSWPRLLELAYWPTLELLIWGFTAK
FT                   FVVQGHADLPVRAAGALIGGVLLWEVALRAQMGVTISFLEEIWSRNLGHVFVSPLRPRE
FT                   MVFALLGVSVMRSLAGLAPAAVIAFLLYDFNVFTFGPALILFMLNLFLMGWWLALGVIS
FT                   LLFRYGASAEALAWTLAFGLTPVACVFYPASILPGWLRPVADALPAAHIFAGMRSALYR
FT                   HVTDFSQLGIAFGLNGIWMAAAAMIFAAQFRAARRNGALVTIGE"
FT   gene            complement(487988..488725)
FT                   /locus_tag="Acry_0435"
FT   CDS             complement(487988..488725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0435"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29660"
FT                   /db_xref="GOA:A5FVM8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVM8"
FT                   /protein_id="ABQ29660.1"
FT                   /translation="MDTINVENLTKSFGAVRAVEGVSFRVAPGTTCGLLGGNGAGKTTT
FT                   ISMLLGILAPDAGAIRVLGHDMARDRFAALARMNYSSPYVALPMRLTVEENLRVYGHLY
FT                   NVPQLERRIRELARDFDLEALLRRKAGALSAGQKTRVALAKALINRPALILLDEPTASL
FT                   DPDTADYVRTGLERYRDETGAAILLASHNMAEVERLCAEVLMMKGGRIVDRGTPAGLIA
FT                   RYGRGDLEQVFLAIARGTESRAS"
FT   gene            complement(488748..489401)
FT                   /locus_tag="Acry_0436"
FT   CDS             complement(488748..489401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0436"
FT                   /product="methionine biosynthesis protein MetW"
FT                   /note="TIGRFAM: methionine biosynthesis protein MetW; PFAM:
FT                   Methionine biosynthesis MetW protein; Methyltransferase
FT                   type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29661"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVM9"
FT                   /protein_id="ABQ29661.1"
FT                   /translation="MSQQAPVRFVGKNMRVDLELIAEMIPPGSRVLDIGCGDGALIDLL
FT                   ARTRRCDARGIEIDMAEVTRAVAHGLPVMQGDADADLIHYPDAAFDYVVLSRTLQAVEQ
FT                   PREVLRQMLRVGTRAIVSFPNFGHWSLRWQLFSTGRMPMTTTWNRMWYETPNIHPCTIR
FT                   DFFDLCATEHYQVEQWLAADEAGRRAPWRRFPLLANLFGEQGLFVLRREPAAED"
FT   gene            complement(489398..490543)
FT                   /locus_tag="Acry_0437"
FT   CDS             complement(489398..490543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0437"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="TIGRFAM: homoserine O-acetyltransferase; PFAM:
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29662"
FT                   /db_xref="GOA:A5FVN0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FVN0"
FT                   /protein_id="ABQ29662.1"
FT                   /translation="MDQSPFPDIAHQTASFSDGLVLDCGTTLQRLEVAYRTYGSLNAEK
FT                   SNAILICHALTGDQYVAEPHPLTGKPGWWNALVGAGKPVDTDRFFVICANVLGGCMGST
FT                   GPRSRRDHGADEPWSIDFPAITVQDMVRAQKKLVDWLGIERLFAVVGGSMGGMQVLAWA
FT                   SLFPDRVFAAVPIATAPYHSAQNIAFHEVGRQAIYTDPDFHGGHYRTHGVIPARGLAVA
FT                   RMTAHITYLSEAALTRKFGRRLQRQNALAAPVFGERFAVESYLEHQGSSFVRRFDANSY
FT                   LVITRAMDYFDLAADHGGSLSAAFRGTKTRFLLVSFSSDWLFPTAESRAMARALNQVAA
FT                   NVSFVEIVSDKGHDAFLLDEPDFHRTVAGFISGAAEAAGLQ"
FT   gene            490649..491536
FT                   /locus_tag="Acry_0438"
FT   CDS             490649..491536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0438"
FT                   /product="chorismate mutase"
FT                   /note="TIGRFAM: chorismate mutase; PFAM: Chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29663"
FT                   /db_xref="GOA:A5FVN1"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR020822"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVN1"
FT                   /protein_id="ABQ29663.1"
FT                   /translation="MSETPPSPTPNDTAPETLARLRAEIDALDDRIHDMLMQRAEIIER
FT                   VASQGGKRGVPIRPGREAAILRRLLDRHQGSLPQHTIVRIWRELFSGALMIEGGLVIAV
FT                   ADGVQAELLAVAREHFGPLTAMRRHRTPSQALADVTGAAAHAAVLPLPSDEDDDQAAWW
FT                   VGLMHGGPPRLSIVAKLPFWGRRGEGVPQADAYVVSSFVPDASGNDRSLIGIEIVPDTS
FT                   TARIVGMLRDAGFDVGSLLLRRVTRREVGYALADVEGYVPREDARLGTLAGFLAPPVVL
FT                   GSYAAPVGASGPSR"
FT   gene            491533..492627
FT                   /locus_tag="Acry_0439"
FT   CDS             491533..492627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0439"
FT                   /product="histidinol phosphate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.9"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29664"
FT                   /db_xref="GOA:A5FVN2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FVN2"
FT                   /protein_id="ABQ29664.1"
FT                   /translation="MSGLPTARPAVFSVPPYVGGESRLDGVNRVIKLSSNEGAFGPPPG
FT                   AIAALTEVAAIAHRYPDGGATSLRAAIGRRFCLDPARIVCGNGSDDLIALLIQSYGGPG
FT                   TELVMSRHGFLIYEIAARLAGMNVRKAPERNLTADIDAMLAEVTPATRLVFLANPNNPT
FT                   GSLVPASDVSRLRAELPPDVLLVLDAAYAEYVERADYDPGVELVDSGQNTVMTRTFSKM
FT                   FGLGGVRLGWAYAPLAIVDVLNRTRMPFNVSGPAAAAGIAALAEPGWVERCRNHNTRAR
FT                   TELAARIERAGFRVWPSEANFLLADLETADRAAAADTHLRSRGIIVRQVAAYGLPQCLR
FT                   ITIGTDEECSTVADALDDFGQNHG"
FT   gene            492602..493507
FT                   /locus_tag="Acry_0440"
FT   CDS             492602..493507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0440"
FT                   /product="Prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="PFAM: Prephenate dehydrogenase; NADP oxidoreductase,
FT                   coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29665"
FT                   /db_xref="GOA:A5FVN3"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVN3"
FT                   /protein_id="ABQ29665.1"
FT                   /translation="MISAKTMAEPLFNRLALLGIGLIGSSIARVARERGDLARTIVANA
FT                   RTQATLDRVMELGIADECEIDPARAVQGADCVIFCAPVGAYAALAEAIGPHLAPGAIVS
FT                   DVGSTKQSVIRDIGPHLPEGVHFVPAHPMAGTEFSGPDAGFAGLFKGRWCLLTPVPGTD
FT                   QDAISRMRTFWERCGAMVSVMDAAHHDRVVAIVSHLPHLIAFTICGTADDLADETRQEV
FT                   LQFAASGFRDFTRIAASDPTMWRDVFLNNREALLEMLARFTEDAQAMARAVRWGDAAYI
FT                   EDKVLRGRKIRQALIDINQA"
FT   sig_peptide     492602..492694
FT                   /locus_tag="Acry_0440"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.658) with cleavage site probability 0.310 at
FT                   residue 31"
FT   gene            493583..494518
FT                   /locus_tag="Acry_0441"
FT   CDS             493583..494518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0441"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /note="TIGRFAM: tRNA pseudouridine synthase B; PFAM:
FT                   pseudouridylate synthase TruB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29666"
FT                   /db_xref="GOA:A5FVN4"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVN4"
FT                   /protein_id="ABQ29666.1"
FT                   /translation="MAPNQTRQKRGRIIDGWIVLDKPPGITSAHAVARIKRLLQAAKVG
FT                   HGGTLDPLATGVLPIALGRATKMVPYVMDGTKRYRFTLRFGEARDTDDADGAVVMTSDF
FT                   RPETSDIDAALVAFRGTIMQVPPAFSAIKVDGERAYDLARAGLPPELPPRPAQIDRFDL
FT                   IDRPDPDHAIFEVESGKGVYMRSLARDLARAVNTVGHIAALRRLSVGPFAETGSTTLDK
FT                   IADSGDSLARDPDFLLPVETALDDIPALALTEAEAAALRNGQALSLVQFMGRIPLACDP
FT                   DGGLARLMAGRRFVALGRLTDGQLKPERVL"
FT   gene            494542..494811
FT                   /locus_tag="Acry_0442"
FT   CDS             494542..494811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0442"
FT                   /product="SSU ribosomal protein S15P"
FT                   /note="PFAM: ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29667"
FT                   /db_xref="GOA:A5FVN5"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FVN5"
FT                   /protein_id="ABQ29667.1"
FT                   /translation="MSITPDRRQELIGEYANKANDTGSPEVQVALLTERIVNLTEHLKT
FT                   HAKDFHSRRGLLMLVGRRRRLLDYVKRQDVKRYEALIGRLGLRR"
FT   gene            494952..495722
FT                   /locus_tag="Acry_0443"
FT   CDS             494952..495722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0443"
FT                   /product="protein of unknown function UPF0005"
FT                   /note="PFAM: protein of unknown function UPF0005"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29668"
FT                   /db_xref="GOA:A5FVN6"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVN6"
FT                   /protein_id="ABQ29668.1"
FT                   /translation="MAMGPDMRSYRSATVAAGAGVLDEGLRAYMLRVYNWMASGLLLTA
FT                   IVSYAISHTGLINAFYPLVATPGGAMIREPGILAYISIFAPLAFMLVMSFGVNKLSTTQ
FT                   AQALFWAFCGLMGASLTNIFLVYTGQSILTTFFVTAGTFAAMSIYGYTTRTDLTKFGSF
FT                   LVMGVIGLLIAMVVNIFLHSPAMQFAISAIGVLVFTGLAAYDTQRIKADYVQYGYRFGA
FT                   GMAAKRSVYDALQLYLNFINLFLFLLQFMGNRRN"
FT   gene            complement(495815..496114)
FT                   /locus_tag="Acry_0444"
FT   CDS             complement(495815..496114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0444"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29669"
FT                   /db_xref="GOA:A5FVN7"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVN7"
FT                   /protein_id="ABQ29669.1"
FT                   /translation="MRMSADHSPVRLAQTVTICNARGLHARAAAKLVTLAEKFSASVEV
FT                   SRDGQSVSAQSIMGLMMLGAGLGSTIEITAEGWDAKEALAAVVELVEAGFYENG"
FT   gene            complement(496105..496527)
FT                   /locus_tag="Acry_0445"
FT   CDS             complement(496105..496527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0445"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29670"
FT                   /db_xref="GOA:A5FVN8"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVN8"
FT                   /protein_id="ABQ29670.1"
FT                   /translation="MIGMVLVSHGKLGVALREALEHVVGPQRNIATVSVEADADIETQR
FT                   KEIADRVADVDTGDGVVVLTDMFGGTPCNLSMSMLERDDVEVIAGVNLPMLVKLAKVRG
FT                   SHSLADAVHCAEEAGRKYIACGSEILHPVTPKRACG"
FT   gene            complement(496524..497435)
FT                   /locus_tag="Acry_0446"
FT   CDS             complement(496524..497435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0446"
FT                   /product="uncharacterized P-loop ATPase protein UPF0042"
FT                   /note="PFAM: uncharacterised P-loop ATPase protein UPF0042"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29671"
FT                   /db_xref="GOA:A5FVN9"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FVN9"
FT                   /protein_id="ABQ29671.1"
FT                   /translation="MSARMVIVTGLSGAGRNSVLRALEDIGYEAVDNPPLRIVETLVRG
FT                   DKPLAVGVDARTRDFSAEDVLSTIDRLQTRGCVRPELIFITASPEALQRRFSETRRRHP
FT                   LALAGTVSEGIETEQALTRTLRNAADWVIDTSELSLAGLRQIIDQRFGLGGPGMSITLV
FT                   SFGYPSGLPQEADLVLDTRFLRNPHYIPDLRDRTGLDPQVRDYIRQDPDFPEFFERVSG
FT                   LTDYLLPRFVREGKKYVMIAFGCTGGKHRSVSLVEMLGSRLRNADWNVLIEHRSLGSRS
FT                   VGGAWKAMPGAHQGAPMPGVQK"
FT   gene            complement(497432..497854)
FT                   /locus_tag="Acry_0447"
FT   CDS             complement(497432..497854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0447"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29672"
FT                   /db_xref="GOA:A5FVP0"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVP0"
FT                   /protein_id="ABQ29672.1"
FT                   /translation="MLLHGSCAALGDDAVLLLGPPGSGKSDLLLKLIDRGFNLVADDQV
FT                   QVAGDQVSAPDTLAGMIELRGIGLFGVPAVRQATLKLVVQLCGIEERLPKPRTNDILNA
FT                   PEITINPHSCSAPIRIHWALDALGGRRMQYCGSFVE"
FT   gene            complement(498015..498281)
FT                   /locus_tag="Acry_0448"
FT   CDS             complement(498015..498281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29673"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVP1"
FT                   /protein_id="ABQ29673.1"
FT                   /translation="MRTMKPIKKARHEAGMAIPTDWARPPATSAVCNLGSLKHLCISVA
FT                   ATLRRMHVCIRIAAGSDRKQKESLNSPHTGLLALKFFHIFGLY"
FT   gene            complement(498269..498586)
FT                   /locus_tag="Acry_0449"
FT   CDS             complement(498269..498586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29674"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVP2"
FT                   /protein_id="ABQ29674.1"
FT                   /translation="MATAARHGERPGSRRNQAIGCDEVCAALMEYPRFAGPIMTLPRPD
FT                   AGRRKEILLGWIHSPGRRRASPSLAIARPATMSNDPPRKRRAIFTGMASRPAVTKRQCE
FT                   R"
FT   gene            498917..499600
FT                   /locus_tag="Acry_0450"
FT   CDS             498917..499600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0450"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29675"
FT                   /db_xref="GOA:A5FVP3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVP3"
FT                   /protein_id="ABQ29675.1"
FT                   /translation="MRILVVEDDKDVGGFVVKGLREAGHTVEHADNGRDGLFMAASENF
FT                   DAIILDRMLPGGIDGLRLLETLRAQDNVTPVLFLSALGEVDDRVKGLKAGGDDYLTKPF
FT                   AFAELLARVEAMARRGKGEGPATRLNVGDLEMDLLSRGVKRAGQKIDLQPREFRLLEYL
FT                   MRHAGQVVTRTMLLEGVWDYHFDPQTNVIDVHISRLRQKIDKPFDTPLLHTVRNAGYML
FT                   RVEEP"
FT   gene            499610..501076
FT                   /locus_tag="Acry_0451"
FT   CDS             499610..501076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0451"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase, HAMP region domain protein; histidine
FT                   kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29676"
FT                   /db_xref="GOA:A5FVP4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVP4"
FT                   /protein_id="ABQ29676.1"
FT                   /translation="MSSGASDTEELRGLPQRHVRHNRLLRSAGVRFAIFYALVFGISAI
FT                   VLAGSLYYSTIGLLGRQTHEAIRVDARSLAAHFEAGGLTGLVLTLDSRISEDINDHAIY
FT                   LLVDPLGNRIAGNMSRWPQGINTAHVWYQVPLERGGRKSTALMRYYELPGGFQLLVGRD
FT                   VSTRAQLRRILRDGLLWALAAMAFLGVLGAIVIRGLFKRSLADISGITRAIARGDLTRR
FT                   VRRSGNGDEFDELAETINDMLDRIAKLMDGVREVSNSIAHDLRTPITRARARLEDAAAH
FT                   ARTTEELQSAVERATLDLDGIVNVFQALLRIAEIEAGARRSAFRDVDLAPVLDDLAEFF
FT                   DALAEERGILIVRDWPKSIPIFGDRDMLQQAVSNLLDNAIKFSRETDRVVIAAHAGGGH
FT                   VEIQIADHGPGIPEADLSRATERFYRAEAARSTPGSGLGLALVSAIAQLHGGSLLLENN
FT                   EPGLRARLILSQRDNAPPQSPRQEAASSMA"
FT   gene            501161..502564
FT                   /locus_tag="Acry_0452"
FT   CDS             501161..502564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0452"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29677"
FT                   /db_xref="GOA:A5FVP5"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVP5"
FT                   /protein_id="ABQ29677.1"
FT                   /translation="MKRGGGCGAQSVRVISSSSIASGEDETMTDTTSAAAPSSWSARLT
FT                   PAHWRVLTAAFFGWVFDGYETYALITVIGPAMVALLPAPERGHIHAAAGLAIAITLLGW
FT                   AAGGTVGGIAADYVGRKRMLLISVVGYSLFTGLTAFSTSVGMLVAFRFLTGLFLGSEWS
FT                   TGNSLLAETWPNEARPKGAGFLQSGFGFGAFLAAAVWYLLRPLGPDAWRAMFLVGVLPG
FT                   FLVLFLRRRIDDSEAWARAVREKRWAVTENSGRLSQSARPFTLFQLFADPEGRRRTVLA
FT                   CLMSISTTMGWWGIATWIPGFVGGFAAHHGLHGPYWASVAGLVYTAGAVVGYLVSGFLA
FT                   DWMGRRRYLVFLFVGGLVMTPAVYLWSHSLATLLFASWLNGFWTLGAFSWYAIYLPELF
FT                   ATNVRGTASAFVFNASRFIAFLGPLMAGELIGALGGLAHVALAFSVIYVIGLIVAPFMP
FT                   ETKGQPLPQ"
FT   gene            complement(502580..505459)
FT                   /locus_tag="Acry_0453"
FT   CDS             complement(502580..505459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0453"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain; PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; Autotransporter beta- domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29678"
FT                   /db_xref="GOA:A5FVP6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034061"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVP6"
FT                   /protein_id="ABQ29678.1"
FT                   /translation="MKISRRFSLLAATALSLSACSGGGGGGGGTASSSLPAPSSVSTPT
FT                   SPTSTPLLSTLQTLINLGTAQTWTYPAYNQYVPTTVVTAIQEGATGTGVSIGILDTGAN
FT                   TGVQALQGRVAWFNSYLAQGNNTLNQNNIASANDPYGHGSIVTALLGGATQGTYDNTQG
FT                   PVNFFAGGVAPDATLYVAQTCDATGACTLYGKTYQDLMANGVHLFNQSLAENASSFSTA
FT                   SAAIQASQQIGALFAPFGTGNLYVWAAGNNPQSPNDISVEAEAPAYTNSLQPQWISAVN
FT                   VDINSLGQVSGLDPTSNACGITAQWCIAAPGYDQVPIVAGTSFNTGFAVGTSFSAPIIT
FT                   GVAALIWQKFPWFTPANVSDTLLTTATPLGSAPAPNTTYGWGLVNAAAAINGPAQFAFG
FT                   TFTANIGSDQGTFSNNIGGSGGLVVDGTTGTLTLTGNDGYAGGTTINGGNLALTGSLGS
FT                   AVTINGGSFGGSGTVNGSVTNAGGTLVSQAAAGSSGLTINGNYATGSGSSTAIAIGNPL
FT                   TVSGKAQLNGTFKVLAPPQTYLPQSIETFIRAGSIQGAFSNQTYGAGVYYTVSNLQYGA
FT                   QDLTATVTRSNVAQVAAAMPGATPVAVAAASGVQGALQQINTWSAGEAAANPTFLNAVA
FT                   AVLSARTAQQAQASLISLSGEIYPTLRTITIDEDMSISRAIAGHAAEHQAGPTTSVWVR
FT                   YLGTFGSFRETGTDAAHYNDNGVVVGLDTPIAPDFTAGVAFAHDQANASLNGFGGRFRS
FT                   DLDTATAYARLGGAAGPYLTGQVSYGWMNGRVDRSVLLGYQTAPVSSEPTGTIGGLAAE
FT                   AGYRIGAWTPYVRLGAVHLYEHAVSETGGLGFGLAMPAVDQTDGYVTTGLRGRTVLDLF
FT                   GHAILASGRLAWQHRLGGSSNSQGAFEATPAATFNLSGQNMPVNVLRAGFQLSGRLDRA
FT                   WSWNAGVSVNYAPSGMNAEAVNVGLKARF"
FT   sig_peptide     complement(505394..505459)
FT                   /locus_tag="Acry_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.362 at
FT                   residue 22"
FT   gene            506111..506678
FT                   /pseudo
FT                   /locus_tag="Acry_0454"
FT   gene            complement(506710..507366)
FT                   /locus_tag="Acry_0455"
FT   CDS             complement(506710..507366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0455"
FT                   /product="protein of unknown function DUF1345"
FT                   /note="PFAM: protein of unknown function DUF1345"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29679"
FT                   /db_xref="GOA:A5FVP7"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVP7"
FT                   /protein_id="ABQ29679.1"
FT                   /translation="MTPRPLAVRIARGHPRLFTGLLCGALVFLLLSGDLAPTLRVVIGW
FT                   DIAVAVYVALAMLHFSRADHTRIGADAARQEEGEWTIFGLSLAGALMSFTAIVIFAARG
FT                   KGTTAHTPYVALAAATLVASWLMTQITFTYRYAHEYYAATDSGPEGGLAFPGGEAPDYL
FT                   DFVYFSFVLGMTFQVSDVNILSRKMRRLATLQGVIGYLFNTVVLALAINIAAGLF"
FT   gene            complement(507432..509075)
FT                   /locus_tag="Acry_0456"
FT   CDS             complement(507432..509075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0456"
FT                   /product="FGGY-family pentulose kinase"
FT                   /note="TIGRFAM: FGGY-family pentulose kinase; PFAM:
FT                   carbohydrate kinase, FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29680"
FT                   /db_xref="GOA:A5FVP8"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006003"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVP8"
FT                   /protein_id="ABQ29680.1"
FT                   /translation="MSHPANHIVIGVDVGTGSARAGVFGLDGTMRGSAVRAIRAWRPRP
FT                   DFIQQSSTDIWAAVSDAVRCAMAEAGSGLVVRGIGFDATCSLVVLDEAGAPLPVEPDGD
FT                   PAQDVILWADHRAQAEADEINAGGYEVLRYVGGRISLEMETPKLLWLKRHAPQSWAAAR
FT                   HVFDLPDFLTYRATGAASRSLCSTVCKWTYLGHEERWDEAYFRAIGLGELADEGFTRIG
FT                   TTILPIATPVGGGLSAEAAAAFGLAPGIPVGTSAIDAHAGGIGVIGAALDGMAPDAAAL
FT                   GRRVALIGGTSSCHMAVAPEPRFVPGVWGPYHAAMIPGMWLNEGGQSATGSLIDHMVTT
FT                   HAAYPALAAAAKAEGVSIYERLNALVGRMAAEAGSAAALTEGLHVFPDFHGNRSPRADA
FT                   TLRGMISGLPLSADEADCARLYLATLQALAYGTRHIIETMNANGYAIDTIMATGGGTKN
FT                   PLFLREHADATGCRIVLPAEPEAVLLGSAILGAVAGGVYPDLPAGMAAMSRAGAMIAPE
FT                   AANAGFHARKYAVFRRMHDDQMAYRALMRS"
FT   gene            complement(509103..510044)
FT                   /locus_tag="Acry_0457"
FT   CDS             complement(509103..510044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0457"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29681"
FT                   /db_xref="GOA:A5FVP9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVP9"
FT                   /protein_id="ABQ29681.1"
FT                   /translation="MTGMIVTMGEILVDILAEEKGQGFHEPGRLLGPFPGGAPATFIAQ
FT                   AARLGAGAGIISCIGDDDFGWLCVDRLRREGADVSAVRIEPDQVTASAFVRYREDGDRD
FT                   FLFNLKRSAAGRITIDAAARAMLAQCAHFHIMGSSLFSFHIIDEMKKAIELAKANGAVI
FT                   SFDPNIRKEMLMIPEMRAGLEFMLGYTDIFMPSGPEILLPTEAKSERAAVEELLDLGVR
FT                   MVVIKRSRKGVSFRSRDEQFDLPAFPVEEIDPTGAGDCFGAAFVTCLLQGMGTRRALDY
FT                   ARAAGALAVSRKGGMEGVADFATLDAFIAAAG"
FT   gene            complement(510041..510940)
FT                   /locus_tag="Acry_0458"
FT   CDS             complement(510041..510940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0458"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein, DeoR; Helix-turn-helix,
FT                   type 11 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29682"
FT                   /db_xref="GOA:A5FVQ0"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVQ0"
FT                   /protein_id="ABQ29682.1"
FT                   /translation="MLLASIADGQPGNIDVTLGAKSAVLQRRLKIADWIRQYGQMRVDE
FT                   LSTALKVSEVTIRGDLTYLEEQGLIVRSFGKAIAAKSGAPRDRPAGAPLTKALLVPMLR
FT                   RAQALIGPDQTVLIGPGPLATQAIPWLAEIPGVSVVLTSTEAIPLARTCLDARIYLLGG
FT                   EITAESGMIEGAGALRMLDHFALGWSILEADALSADSALLVAAKPAERLAEAAIRRSTR
FT                   SIVLIGNPALSLERRTAQLGLTGISDLILPGMPSNRLRDILLGAGFRPVETDGGTEAHF
FT                   SSHPAHSRSGARAFGEAS"
FT   gene            511322..512632
FT                   /locus_tag="Acry_0459"
FT   CDS             511322..512632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0459"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29683"
FT                   /db_xref="GOA:A5FVQ1"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVQ1"
FT                   /protein_id="ABQ29683.1"
FT                   /translation="MKRQIRIAVGGLALGCLGITAAHATTLTIATVNNPDMLQMQKLSP
FT                   QFTKETGIKLNWVVLPENTLRQRVTTDIATNSGNFDIVTVGSYEVPIWGKAGWLAPIKN
FT                   LPASYDVKDLFPSVRNGLSYKGTLYALPFYAESSATYYRKDLFKAAGLTMPAHPTYTEI
FT                   EKFAAKINDPSKGIYGICLRGLPGWGENMAYFTTLVNTFGGRWFNMKWQPRIDSPAWKK
FT                   AANFYVNLEKKYGPPNVTSNGFTENLALFSQGKCGMWIDSTVAAGTLWDPKTSKVANEV
FT                   GMVSAPVAVTPHGAHWLWAWALAMPKTTRHKADDMKFLEWATSKAYLKLVGKTFGWVQV
FT                   PPGTRISTYDNPDYTKAAPFASKVKEAILSADPNNPTLKKVPYTGVQFVAIPQFEGIGT
FT                   EVGQQIAAALAGQKSVDAALAQAQKATARTMKEAGYH"
FT   sig_peptide     511322..511396
FT                   /locus_tag="Acry_0459"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            512705..513616
FT                   /locus_tag="Acry_0460"
FT   CDS             512705..513616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0460"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29684"
FT                   /db_xref="GOA:A5FVQ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVQ2"
FT                   /protein_id="ABQ29684.1"
FT                   /translation="MIQPTSGTITPGRSGATQRRQVRTLPLLLPAVILLLLWSILPLLQ
FT                   TILYSFQHYNLMEPPSAYNGGLNYTYLFTDSSTWTAIWNSVVLVAGTLVASIVFGTIIA
FT                   LLLNNDFPGRNIARLMAIAPFFVMSPVAALIWKNLLLDPVSGLAGWLMTLVGFKPIAWF
FT                   SVYPMVSIVIIYSWRWIPFATLILLTALQSLDTDQLEAARMDGAKGLARLRYIVLPHLG
FT                   RPISIVVMLESIFMLSAFAVIYTTTNGGPGHATTTLTYMIFIRALNDFSIGSASAAGVF
FT                   AIVLANILAFFLIRAVSRTLQA"
FT   gene            513627..514448
FT                   /locus_tag="Acry_0461"
FT   CDS             513627..514448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0461"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29685"
FT                   /db_xref="GOA:A5FVQ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVQ3"
FT                   /protein_id="ABQ29685.1"
FT                   /translation="MKPSLSSRVVLAILAWAAAFIMFFPILWMLVTAFKTEGQAIAIPP
FT                   LLIFTPTLKSFFDATQNAGYLLFALNSVIVSVGSTVLAIAIAFPAAYALAFFPGKRTEF
FT                   TLMWMLSTKMLPAVGVLMPIYLFLKNVHLLDTRLGLVGIDTLMNLPIVVWMLYSFFKDI
FT                   PHEILEAARVDGVGPRQQMIHLLLPLAGPGVASTALLSVILAWNEAFWSINVTASHAGT
FT                   LAAYIARFSAPEGLFWAKLSAASVLAVAPILVFGSLTQRRLVRGLTFGAVK"
FT   sig_peptide     513627..513734
FT                   /locus_tag="Acry_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.559 at
FT                   residue 36"
FT   gene            514458..515555
FT                   /locus_tag="Acry_0462"
FT   CDS             514458..515555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0462"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29686"
FT                   /db_xref="GOA:A5FVQ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVQ4"
FT                   /protein_id="ABQ29686.1"
FT                   /translation="MAKLLLEKVEKRYEGFHAIKGVDLSIDDREFVVFVGPSGCGKTTL
FT                   LRMIAGLEEITGGDFSIDGVRANDIPPDKRGLAMVFQTYALYPHMTVAENMGFALKMAK
FT                   VPKAEIEKKVAHAAEMLQLDKVLARRPKALSGGQRQRVAIGRAIVRNPKGFLFDEPLSN
FT                   LDAALRVQMRTELVKLNKQLETTMIYVTHDQVEAMTMADRIVVLNGGIVEQVGSPLELY
FT                   HNPANLFVAGFIGSPKMNLLEGEIAARDDAGADVKLDDGGTIRVEAANIAAAPGLRVTL
FT                   GTRPEHTALAADGEIGGTADFVEHLGNETLVYVKRPGEKQMIVKADDLAGVRMGDPVRM
FT                   KPQSARAVLFGPDGKALLRREFHLH"
FT   gene            515592..516365
FT                   /locus_tag="Acry_0463"
FT   CDS             515592..516365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0463"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29687"
FT                   /db_xref="GOA:A5FVQ5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVQ5"
FT                   /protein_id="ABQ29687.1"
FT                   /translation="MYLEKYDLKGRNAVVTGGGRAIGLACSTALAEAGAHVVIADRDAN
FT                   VCEEGKAELARLGYSADAIVLDVTDPDAVNAAADSLNAKFGAIDILVNNAGIARSGVAA
FT                   EDVTDEHWLDVINVNLNGVFWCARAFGRAMLARQRGVIVNTGSMSGFISNKPQKQSFYN
FT                   ASKAAVHHLTRSLAGEWADRGVRVNAVAPTYIDTPLTRFGMEDPELNRIWLDMTPMHRV
FT                   GQPHEIASVVLFLASDASSLMTGSIVLADGGYTVW"
FT   sig_peptide     515592..515687
FT                   /locus_tag="Acry_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.610) with cleavage site probability 0.608 at
FT                   residue 32"
FT   gene            516373..517146
FT                   /locus_tag="Acry_0464"
FT   CDS             516373..517146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0464"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29688"
FT                   /db_xref="GOA:A5FVQ6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVQ6"
FT                   /protein_id="ABQ29688.1"
FT                   /translation="MSGRLQGKYAAITGGAGGIGRAMAAGYIAEGATVCIADRSLEAAA
FT                   AAACELGPQAHACALDVAEMASIAAFTDFTAARGGLDILVNNAAVFDLAPIADITEASY
FT                   DRLFAVNVKGLLFTLQAVARQMIANGRRGRIINMASQAGRRGEALVGVYCATKAAVISL
FT                   TQSAGLDLIRHGIRVNAISPGVVDTPMWQEVDALFAKYESLPVGEKKRQVGLAVPYGRM
FT                   GRPDDLVGAAIFLASDEAEYVVAQTLNVDGGNCMN"
FT   sig_peptide     516373..516447
FT                   /locus_tag="Acry_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.958 at
FT                   residue 25"
FT   gene            517227..518726
FT                   /locus_tag="Acry_0465"
FT   CDS             517227..518726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0465"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="TIGRFAM: glucose-6-phosphate 1-dehydrogenase; PFAM:
FT                   glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29689"
FT                   /db_xref="GOA:A5FVQ7"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVQ7"
FT                   /protein_id="ABQ29689.1"
FT                   /translation="MNFSQPIIDPFDYVVFGGTGDLARRKLLPALYLRDLDGQLPETSR
FT                   IVGSARTDMTGEGFRELVEASLREFIADKLDPEVLARFLARLHYVSVDAKAARGWPELA
FT                   TLLSDEPRQIRVFYLATAPELYGPIADNIHAHGLQTPETRIVLEKPIGHDLASARAIND
FT                   RVGAVFEERNIFRIDHYLGKETVQNLLVLRFANSLFEPVWNHNGIDHVQITVAETVGVE
FT                   DRGGYYDHTGALRDMIQNHLMQLLCLVAMEPPATLDREEVRDEKIKVLKSLAPISRDDI
FT                   ATKSVRGQYRAGAIKGGPVKSYAEEKDIAPGSTTETFAALKVEVRNWRWAGVPFYLRTG
FT                   KRMPEKVSEIVIQFKPVPYWIFPTGSDHAMPNRLVIRVQPDEHIRLHLWTKEPGPGGLR
FT                   LRNAPLNLSFAETFKNNHMPDAYERLLMDVVRGNATLFMRRDEVEAAWEWTESILDAWK
FT                   SAGDRPKLYTAGTWGPSEAVAMIVRDGRTWFDEQAGYGAGD"
FT   gene            518769..520583
FT                   /locus_tag="Acry_0466"
FT   CDS             518769..520583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0466"
FT                   /product="6-phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydratase; PFAM:
FT                   dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29690"
FT                   /db_xref="GOA:A5FVQ8"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVQ8"
FT                   /protein_id="ABQ29690.1"
FT                   /translation="MVQDAIARVTDRIRARSEAGRAAYLARTGALISRGVHRSAVGCAN
FT                   LAHALAGCAKAEQDDLKRDDKPNIGIVTSYNDMLSAHQPFGRFPDLIKHAVREAGGIAQ
FT                   VAGGVPAMCDGVTQGREGMELSLFSRDVIAMAAAIALSHDVFDGALLLGVCDKIVPGLV
FT                   IAALSFGHLPAIFVPAGPMPSGISNTEKSRVRQLYAEGKVGREELLESEIGAYHSPGTC
FT                   TFYGTANSNQMLMEIMGLHLPGASFVNPNTELRDALTGAAAKRILEITARGNEFTPVGQ
FT                   MVDERTVVNGMIGLLATGGSTNHTIHLVAMARAAGIAITWQDFSDLSEHIPLLTRIYPN
FT                   GSADVNHFQAAGGMPVLIGALLDAGLLHGDARTVWSPDGLQAYRDQPVLEEKVLRWKPA
FT                   PAASLNRDILRDATEPFSKDGGLRIMHGNLGQAVTKISAVKPEHRVVVAPARVFRSQEA
FT                   MQEAFKAGELHRDFVAIVTHQGPKANGMPELHKLTPPLGVLQDLGFKVGLVTDGRMSGA
FT                   SGKVPSAIHVTPESACGGALAKVRDGDMIRLDCEAGILEVQVDQAEFAARPLPEVDLSA
FT                   HHHGIGRDLFGAFRAAVAGADLGASVFA"
FT   gene            520580..521215
FT                   /locus_tag="Acry_0467"
FT   CDS             520580..521215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0467"
FT                   /product="2-keto-3-deoxy-phosphogluconate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29691"
FT                   /db_xref="GOA:A5FVQ9"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVQ9"
FT                   /protein_id="ABQ29691.1"
FT                   /translation="MNRQDGLDALLAVSPVIPVLTIDNAADAVPLARALIEGGVGVVEV
FT                   TLRTKAAMEAIAAMAEAVPEMVVGAGTVLTPSQYREVEEAGAKFVVSPGSSPAVHAAAA
FT                   KSRVPFLPGAATPTEVLHLLEAGFRYQKFFPAEQAGGIPMLKAIGAPIHEVTFCPTGGI
FT                   TPTTAPDYLALANVICVGGSWLTPAAALRAGDWAGIAKLAAQAAALKR"
FT   gene            521272..522615
FT                   /locus_tag="Acry_0468"
FT   CDS             521272..522615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0468"
FT                   /product="sugar transporter"
FT                   /EC_number="1.3.1.74"
FT                   /note="TIGRFAM: sugar transporter; PFAM: General substrate
FT                   transporter; major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29692"
FT                   /db_xref="GOA:A5FVR0"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVR0"
FT                   /protein_id="ABQ29692.1"
FT                   /translation="MNFTVIAIIAGLGGLLFGYDTGVISGALLFIRHVFHLGPAMQGVV
FT                   VAIALGAAAVGAAVAGTLSDKFGRRPVLLVTAAVFVLGALLSAAAWSVAILLAGRVLVG
FT                   GAIGVASMLTPLYLSEMSPRDKRGAVVTINQAYITIGIVVSYGVGYLFSHGGDGWRWML
FT                   ALGALPGVILFAGMLVLPESPRWLAGKGHREAARKSLAFLRGGHDVESELRDLRQDLAR
FT                   EGRATAPWSVLLEPRARMPLIVGIGLAVFQQITGINTVIYFAPTIFQKAGLSSASVSIL
FT                   ATAGVGLVNVVMTFVAMRLLDSAGRRRLLLVGLSGMLVTLLAVAGGFMAGMQGGLAWVT
FT                   VISVAAYVAFFAIGLGPVFWLLIAEIFPLAVRGRGMSLATIANWAFNMLVSITFLDLVH
FT                   GLGRGPTFLIYAAMTLITLVFTWFLVPETKGRSLEQIEAALEGEGRLA"
FT   gene            complement(522623..523897)
FT                   /locus_tag="Acry_0469"
FT   CDS             complement(522623..523897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0469"
FT                   /product="transporter, UIT6 family"
FT                   /note="9.B.53"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29693"
FT                   /db_xref="GOA:A5FVR1"
FT                   /db_xref="InterPro:IPR031566"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVR1"
FT                   /protein_id="ABQ29693.1"
FT                   /translation="MHPQVNELAALAPFFGTLASFALLPGAAPRIWHRYMVRISLFWVG
FT                   LGLVLGAEAAGPAAALTQLWHSGLVDFLPFIAVLMALYTLGGGVLIAGGPWGRPGGNLL
FT                   LLAAGTLLASAMGTIAASLLLIHPLLSANAARREVRHLVLAFIFVVANAGGALTPLGDP
FT                   PLLIGFLRGVPFFWPLFNLAGPMLVVVLPVLALTFAIDWRLARREPVRPAERIRVRGGA
FT                   NLAMLGIFIAVLTVAGIVPGPEIAIGPASLPAGQIAITLTAIVFVAASERVTPRAIRAR
FT                   NQFAWAPMREIAILFFAIFATIPPVLRTVTAAGLPQSAAGWFWASGLSSAFLDSGPTYL
FT                   MFFEAAGGNAAQLIAPPATLLTSFAAGSVLFGGLTYLGNAPNLMIRAIAARRGVRMPGF
FT                   FGYMLAASAVLLPLFALTTLIFFAG"
FT   sig_peptide     complement(523814..523897)
FT                   /locus_tag="Acry_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.737) with cleavage site probability 0.377 at
FT                   residue 28"
FT   gene            524010..524651
FT                   /locus_tag="Acry_0470"
FT   CDS             524010..524651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0470"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: cyclase/dehydrase; carbon monoxide
FT                   dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29694"
FT                   /db_xref="GOA:A5FVR2"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVR2"
FT                   /protein_id="ABQ29694.1"
FT                   /translation="MEMSGERLIAAPREAVWAALNDPEVLKACIQGCESIEKLSDTEMT
FT                   ATVAAKIGPISARFNGKVTLADLDPPNAYTISGEGQGGVAGFAKGGAKVQLADAEGGTK
FT                   LTYQVSAQIGGKMAQLGARLIDSVAKSYAESFFTKFSERLAPAPEAATAPAPTPTKETT
FT                   SMAEHAHDHAHPAHGEDRSNPVIAGLPLGIWVPIIISAVVVALVISKFLG"
FT   gene            524648..525550
FT                   /locus_tag="Acry_0471"
FT   CDS             524648..525550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0471"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29695"
FT                   /db_xref="GOA:A5FVR3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVR3"
FT                   /protein_id="ABQ29695.1"
FT                   /translation="MTETSLPRTVAETAELLARGNYVADRALATSVHLALAMGRPLFLE
FT                   GEPGTGKTEIAKVLAEQLGRRLVRLQCYDGLDLAAAAYEWDHARQLMEIRLAESGGASR
FT                   ASLRETLYSAEFLLRRPLLSAIDPGLPPAVLLIDELDRADEPFEAFLLELLGDFQITIP
FT                   ELGTIAASTRPVVVITSNRTREVHDAIRRRCLYQWVDYPDAARERAILAARAPGVPAKL
FT                   SAQVVEFVQRIRTTDIFKLPGVAETIDWASALAALDEVELAPAAVEDTLGALLKYQDDI
FT                   AKIRGETAARLTGEAIQAA"
FT   gene            525547..526758
FT                   /locus_tag="Acry_0472"
FT   CDS             525547..526758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0472"
FT                   /product="VWA containing CoxE family protein"
FT                   /note="PFAM: VWA containing CoxE family protein; SMART: von
FT                   Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29696"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVR4"
FT                   /protein_id="ABQ29696.1"
FT                   /translation="MSASDTGRLAPNVMHFARLLRRAGLPVGPGEVIAAAEALTHVDIT
FT                   DRRVMRAALQAVMLRRHEHALLFDQAFSVFWRNPDAAKFAQMLAAMDGRAPREEKAAAG
FT                   ARRLAEAMQAAKSREQEPRPDERREVDALLSASGQERLESLDFEAMSAEEIAAAKAEIA
FT                   RLTLPLDERRTRRFRLAARGCRVDLKRTLRDSMRHSGEVFDIARRVPLTRPPPLVVLCD
FT                   ISGSMARYAQILLHFLHAVANERDRVTTFLFGTRLTNISRQLARRDPEEAFEQVAGAVP
FT                   DWSGGTRIGEALGQFNRLWARRVLAQGAVVLLVTDGLDREGAVGLADNMARLHRSSRRL
FT                   IWLNPLLRYDGFAPKSQGARAMLPYVDEFRPVHNLASLRSLVQALSGEAPPRLQAAALW
FT                   ETRQ"
FT   gene            526755..527087
FT                   /locus_tag="Acry_0473"
FT   CDS             526755..527087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0473"
FT                   /product="predicted sulfurylase small subunit,
FT                   molybdopterin cytosine dinucleotide biosynthesis"
FT                   /note="PFAM: protein of unknown function DUF182"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29697"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVR5"
FT                   /protein_id="ABQ29697.1"
FT                   /translation="MSDTASDAEDILGIAAAWHEEGEQVAIATVTSTWGSSPRRVGSRM
FT                   AVTASGRIAGSVSGGCIEGAVAEAAQRSIETGTPQRLDYGVTDERAWEVGLACGGKVSV
FT                   FVEKLS"
FT   gene            527084..527770
FT                   /locus_tag="Acry_0474"
FT   CDS             527084..527770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0474"
FT                   /product="predicted sulfurylase large subunit,
FT                   molybdopterin cytosine dinucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29698"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVR6"
FT                   /protein_id="ABQ29698.1"
FT                   /translation="MKAAHLAALREAAAARRPIAFATNLATGAAFILPDEAAPTALAAE
FT                   AASMLAADRSGTVTIGDDAWFIESRNPSPRLLVIGAVHIAQALVPFALASGFAVTVVDP
FT                   RRAFATADRFPGVAIATDWPDEALDRLGLDSRTAVVTLTHDPKLDDPALRRALAADPFY
FT                   VGALGSRKTHAARLDRLRAAGVDDAALARIRAPVGLDIGAVTAPEIALSIIAEIVAARR
FT                   GRLAAP"
FT   gene            527767..529386
FT                   /locus_tag="Acry_0475"
FT   CDS             527767..529386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0475"
FT                   /product="molybdenum cofactor cytidylyltransferase /
FT                   molybdopterin molybdochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29699"
FT                   /db_xref="GOA:A5FVR7"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR012184"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVR7"
FT                   /protein_id="ABQ29699.1"
FT                   /translation="MIFGAAPLAADLAGAILAHSLKTRDRVIHKGAVLDDALIAALRAA
FT                   GHAEVTVARLEPGDVPEEDAARRLGAHFAGPGLRVAAPVHGRVNVFAETRGLFRLDAAA
FT                   IAALNGLDEAIALGTLPDATPVAPGDMLATLKIVPFAVPGAVMARAASLLGQGAPLRIE
FT                   AFRPLRTGLVLSRLPQLKDAAIRNTIEATRQRVAARGGALLDPIETPHETAPIRAAIDA
FT                   LLAQGADLVLIAGASAVTDRADVAPAAITAAGGRIDRFGMPVDPGNLLCFGRIGAVPAI
FT                   VLPGCARSPRLNGIDFVLDRVFAGEPLDDALIASMGIGGLLKDFAPRPEPRVPRATRRT
FT                   APKIAVIVLAAGRSSRAAPQNKLLARLQDGRALVAATVDHALAARAALVLVVTGHQDDA
FT                   VREALSGRPVRFVHAAAFASGMAASLAAGINALPADTAAALICLGDMPLVDATVIDRMI
FT                   AAYDPDEGRAIVVPTHRGRRGNPILWDRSFFPEIAALTGDAGARHILARHVDRIAEVEM
FT                   PDDAVLRDFDTRDALAELKDRP"
FT   gene            529383..530342
FT                   /locus_tag="Acry_0476"
FT   CDS             529383..530342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0476"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29700"
FT                   /db_xref="GOA:A5FVR8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVR8"
FT                   /protein_id="ABQ29700.1"
FT                   /translation="MKPGLTISRVLPAPVEARAAEGFAARFLAQDGAFDAAAFLAALDG
FT                   AAAALITPADRLDAAAIARIPATLRVLATFSVGTDHIDLDAAKSRGLAVVNTPDVLSFA
FT                   TAELALTLMLAAARRAGEGERIVRARAWPGWTPTYLLGTSLQGKTLGILGMGRIGQALA
FT                   RMAQGLSMRVVYHNRRRLPPEQEGGAAFIADEADFLSAADVLSIHLPGGAATLHWLNAA
FT                   RIARLKPGAIVVNTGRGTTIDDEALAAALASGHLGAAGLDVFPAEPAVPEVYLGLENVV
FT                   LLPHLGSATRETRTAMGMLALDGIEEVLAGRSPANLVA"
FT   gene            complement(530343..531626)
FT                   /locus_tag="Acry_0477"
FT   CDS             complement(530343..531626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0477"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="TIGRFAM: phenylacetate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29701"
FT                   /db_xref="GOA:A5FVR9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVR9"
FT                   /protein_id="ABQ29701.1"
FT                   /translation="MERDVEFASRDEVVALQTRRLREALRHAYERVPFYRSAFDAAGVR
FT                   PEDLQRPEDLARFPFTVKDDLRQTYPFGMFAVPRGEVLRLHASSGTTGRPIVVGYTRAD
FT                   LDVWAGLVARSIRAAGGRAGMMVHVAYGYGLFTGGLGAHAGAERLGCTVVPASGGMTER
FT                   QVQLIADFGPEIIMVTPSYALAILDEFRRQGRDPRATALQYGIFGAEPWTNAMRAEIES
FT                   AFGIEATDIYGLSELMGPGVAQECVETKDGLHLWEDHFYPEIIDPATGAVLPDGKTGEL
FT                   VLTALSHEAMPIIRYRTRDLTRLLPGTARPGMRRMEKIGGRADDMIILRGVNLFPSQIE
FT                   ELLLANEWGSGHFVIELTRPQRLDEMTVRAECRPEHWDGAGLAGEAAAFAHHIKATIGV
FT                   TAHVVIEPPGTLERSVGKAKRVRDLRPK"
FT   gene            complement(531631..532092)
FT                   /locus_tag="Acry_0478"
FT   CDS             complement(531631..532092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0478"
FT                   /product="phenylacetic acid degradation protein PaaD"
FT                   /note="TIGRFAM: phenylacetic acid degradation protein PaaD;
FT                   PFAM: thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29702"
FT                   /db_xref="GOA:A5FVS0"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR011973"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVS0"
FT                   /protein_id="ABQ29702.1"
FT                   /translation="MTEEHQPPPPESADNIARHVGQAMFEVDRATRSLGIELDEIGPGF
FT                   ATLSLRLGAAMANGHGTAHGGLIFTLADSAFAFACNSHGERAVAAHCSITFLAPARPGE
FT                   RLIATAREVVRRGRNGIYDVSVSNDDGIVAAFRGQSRTIGGSWLDDNGR"
FT   gene            complement(532266..533063)
FT                   /locus_tag="Acry_0479"
FT   CDS             complement(532266..533063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0479"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29703"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVS1"
FT                   /protein_id="ABQ29703.1"
FT                   /translation="MSATGNRTRQMRAAVLALAAASLAGCAAPQRMGANEPTLGANTLN
FT                   VARTALAGNRPDLALHVANAVLKVDPGNDEARLVHGDAAYLLGDCRTASADYRAVLKAA
FT                   PHTAGAEIGLGRCALRTNGRGAVAAFRQAAGDDPHNAVAFNDLGVALAKRGAFGAAVPA
FT                   FRKALALRPSFAAARANLGLATALEGQPGAGAAIIAPLAQGAQASAPERANYAAALAMA
FT                   GDEASAQRVLSADMPAAEARDMVAQLARITTVPHAGQPPHAAN"
FT   sig_peptide     complement(532980..533063)
FT                   /locus_tag="Acry_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.541 at
FT                   residue 28"
FT   gene            complement(533060..533413)
FT                   /locus_tag="Acry_0480"
FT   CDS             complement(533060..533413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29704"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVS2"
FT                   /protein_id="ABQ29704.1"
FT                   /translation="MRKSRLIVLVTLAGAAALLAGCASNDPFAQPGNWHENNAPMHNIA
FT                   VELVNPHDLVGGHGDASFTGPIAETAVGKALKSSSSSSTSGAAGSAGGGGTSLGGAGGG
FT                   LAASSGGMGGSGQ"
FT   sig_peptide     complement(533324..533413)
FT                   /locus_tag="Acry_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.525 at
FT                   residue 30"
FT   gene            complement(533419..534894)
FT                   /locus_tag="Acry_0481"
FT   CDS             complement(533419..534894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0481"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29705"
FT                   /db_xref="GOA:A5FVS3"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVS3"
FT                   /protein_id="ABQ29705.1"
FT                   /translation="MLPSRAARPGMRRTGTAPTQSGTPSPRRLIPALLAAAFGAALVPA
FT                   AASPARHATMRPAEAARARGLTIEQGSGRLITLKGSAANVFVADPGVVAVRPASAHTLF
FT                   VFGTAPGFTTVAVTDAQGHAVATLHVAVTPKTYPAAAIRAGATRSAPGARLSISSAANG
FT                   VVVRGNVPTPVQDYQIMQQAHLIAGTGAKVVNQTEVRLPQQVALKVRIAQMSRTITQQL
FT                   GINWQSAGNGISVGKFLFGFSALDVLNGSSPATPAAGSYNAGLSVGGGAIDSVLDALNS
FT                   DNLAHILAEPTLTALSGQSASFIDGGSFPVPVPGQNGQVTVQYKKFGVQLKFRPVVLDN
FT                   GSIILHVQPTVSSPTTQNAFQIAVAGTSIVVPSLSTQSASTTVVIGSGQTLAIAGLLSN
FT                   SSNQTDKSVPGLGDMPVLGAAFRDDNYNRQEQELVILVTPYLVKPVNNAGQLMTPDEGW
FT                   SPPNQIQRIVLHRDSGGARREIVLPGQAGFILR"
FT   sig_peptide     complement(534751..534894)
FT                   /locus_tag="Acry_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.614 at
FT                   residue 48"
FT   gene            535148..536386
FT                   /locus_tag="Acry_0482"
FT   CDS             535148..536386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0482"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor;
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29706"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVS4"
FT                   /protein_id="ABQ29706.1"
FT                   /translation="MSGKKAALAAVIAGAAVAVAAPAAQAASPIVVGITSEIGTIPGKA
FT                   IANGAVLAAEQINAAGGINGRPLKLVIEDDHLSTTDAIRSFQRMVRQDHAVAIVGTFVS
FT                   EVALALEPWAARLHEPYLITGAAANELSEYVHKDFKAHQYIFHAYMPAAYLAQAVCDAT
FT                   KDTLVDQFHMKTAVVMSEDAAWTKPLDAGYDACLPKIGVKVLDNIRFAPNTSDFTPIYQ
FT                   KIEKLNPNVIIAGWAHVGVQPTVQWAQQKVPIALAGINAQAGSSVFWKATNGATEGVIT
FT                   GSTSAPGVAITPKTLPFTDAYQKKFGYSPAYSAYSTYDAVYALADALKRAKSTKALAIV
FT                   HALEKTNMVGTQGRIAFQGAKSKFAHALKYGPDYVTGVAIQWQDGQQKCVWPLKLANAK
FT                   VVFPSFVKLPPKS"
FT   sig_peptide     535148..535228
FT                   /locus_tag="Acry_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 27"
FT   gene            536464..537339
FT                   /locus_tag="Acry_0483"
FT   CDS             536464..537339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0483"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29707"
FT                   /db_xref="GOA:A5FVS5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR035568"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVS5"
FT                   /protein_id="ABQ29707.1"
FT                   /translation="MLAIQILIDGFAISTLYALGALGFTLIFGVSGVLNLAHGGLMVIA
FT                   AMIAWYVGTSIGLGPYVGAAAGLAVCLVAALVTYGGIVRPIENSRAVPAHERELFVLTA
FT                   TLLWGVMIQEALSYAFTNSPITVQPLIAGTVSILGVRTPINEIFIAAVAWAVMGALWLL
FT                   VNRTRIGRRLLAASINPRALTLLGFELDQIYLFVWVIYGLLAGIAGVLLGSFLGSGSGY
FT                   VPGLTGSAFTIVVLGGLGSVSGTLIAAYIVGYIETLTAYLVSPSLREVPALILLVVVIY
FT                   MRPQGLLGRR"
FT   gene            537339..538259
FT                   /locus_tag="Acry_0484"
FT   CDS             537339..538259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0484"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29708"
FT                   /db_xref="GOA:A5FVS6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR035568"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVS6"
FT                   /protein_id="ABQ29708.1"
FT                   /translation="MSTIPKSRLVALAVFLIVLALFPLGANGYILGVLTTAFYFAVFAM
FT                   SWDLLFGYAGEVNFGPTFLIGLGAYGAGMSNALLGLPVPLAVVVGAIVAVAGGVALAIP
FT                   ALRLSGPYLGLITLVSVLLLQQAIVIFAGVTGGEIGLSVPDVLSISSAVNYEYALAFML
FT                   VSGLILFLISRSSLGMILQAAGQDQVAAAALGFNATRHKILAFAVSALFSGLAGAFLVF
FT                   YLGTASVSAVVDISIGVRVIIAAVLGGRRTIIGGAIGSVFLIVAGELLRPIGQLSTFVV
FT                   ALIALVVIVLFPDGLLGLLPHRRGA"
FT   sig_peptide     537339..537425
FT                   /locus_tag="Acry_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.850 at
FT                   residue 29"
FT   gene            538256..539728
FT                   /locus_tag="Acry_0485"
FT   CDS             538256..539728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0485"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29709"
FT                   /db_xref="GOA:A5FVS7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVS7"
FT                   /protein_id="ABQ29709.1"
FT                   /translation="MNSTTPRLAVSGLHKRFGGLIAVKSLDFNLYPGEILGLIGPNGSG
FT                   KSTVMQMIMGVVRPTAGQILLDGEDIAGRPTYDIARAGVGIVFQHSRPLRLQTVLENIL
FT                   LGLLPDSLSRLRPPPGAIDTARRIGEECGLGDVLDRLPATLPFADLRRMELAKAIARDP
FT                   RVVLVDEPFAGLTSTEVHDFSALIRRFRDQGRAVMLVDHNVKSIASLADRVLALYLGEK
FT                   IAEGSSEQVMRDETVRRVYLGGGIETHERPEAEIAAHKVLLQVKDVSVFYGKAQALENV
FT                   SLTVHEGEFVSIVGLNGAGKTSLFNAISGLVPFRGAISWDGATRGRESAAEIARAGIVQ
FT                   CPETRELFGRLSVAENLELAGQRLPPGERSSRLDWLHELFPILRVRGTQEARTLSGGEQ
FT                   QMLAIARSLMLKPRLLVLDEPTLGLAPVILGQLSEALSRLRETTDITVLLGEQNVTFAL
FT                   PHADRIYVIEHGRIIWDGTPTRFAAEAGTGYL"
FT   gene            539888..540493
FT                   /locus_tag="Acry_0486"
FT   CDS             539888..540493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29710"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVS8"
FT                   /protein_id="ABQ29710.1"
FT                   /translation="MFEYFSGKVTRSVGVAAGAAFGVALAVSSMMQPARAGGPLPYDGP
FT                   APPPNVSVAFLYNQFASASTFYTANGTKLGNTHIQTDVPVLRFVHTFSPIDGMPWGVQV
FT                   IAPYVSFLGNQEVGGGSVSHQSGFAEPQLSAFLYPVNHPSQDETVVLAYFFSPPSGSYN
FT                   PSIALNASTNNWVNNFGSSTSQVEWKTSSMALMGAPSR"
FT   sig_peptide     539888..539998
FT                   /locus_tag="Acry_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.969 at
FT                   residue 37"
FT   gene            complement(540439..541692)
FT                   /locus_tag="Acry_0487"
FT   CDS             complement(540439..541692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0487"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29711"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTD8"
FT                   /protein_id="ABQ29711.1"
FT                   /translation="MASSDIFTLGLGLTPPWRVVDQRLETDYQPHELHLAVAADPGARF
FT                   PCPTCGRLCKPHDWKELSWRHLNFFQHACIIEARVPRTDCPEHGVLRIAVPWARPDSGF
FT                   TLLFEQAALALMREMPVAAAARIIGVTDQRLWRILRYYVGRAIERLDLSGVEAIALDET
FT                   AAKRGHSYVTVFIDLDAAERPVLFVTPGKGKECMTAFRAFLAEHGGEARRIAEVVCDMS
FT                   AAFLAAAAESFPQASVTVDWFHVVQIFTTAVEQVRRAEAHQHNLPKGVRWATLKRPENL
FT                   TMAQRQALDQLENSGFATAEAYRAKEMLRWVRLAATPQAARWRLTNFLNHVTARLDDPD
FT                   HLLDPVRQAVDTVRRNAKRIIRRWKSGHSNARLEALNGLFQAARARARGYRNTATFACI
FT                   IYLLGAPINAMLDVFHST"
FT   gene            541973..542452
FT                   /locus_tag="Acry_0488"
FT   CDS             541973..542452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29712"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVT0"
FT                   /protein_id="ABQ29712.1"
FT                   /translation="MVVTPLSGTAEVPLAASRRHNFEIGYMHKVFGQAKGKRLDLEVWA
FT                   DGYFYGNTNVQTGVHLKTDPAAQFIVYAPYYFHPQTDAYVGLSFEKTFGGKISEVNPLG
FT                   TFDTGSRNNFTRIGVIAGSFLSPTIFAQAQLATDVQARGGAKNDIFFQVQVGKVF"
FT   gene            complement(542505..543035)
FT                   /locus_tag="Acry_0489"
FT   CDS             complement(542505..543035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29713"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVT1"
FT                   /protein_id="ABQ29713.1"
FT                   /translation="MNPVFRYAALAAMLALAGCSSTARAPESAALGPADLAFITSAYQL
FT                   VQFDIDACSFVRKGPIEPAAMPAVDKVCADAATYKPQLRALAAQEGVTLPNTLPFDLKE
FT                   KLVSLSYHPEPNLTVEFLRDEISSHESAIAVFQGELREGRNAAFRQKAQEALPVLERNL
FT                   AMLRAALPTGTAE"
FT   sig_peptide     complement(542964..543035)
FT                   /locus_tag="Acry_0489"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.557 at
FT                   residue 24"
FT   gene            543623..545851
FT                   /locus_tag="Acry_0490"
FT   CDS             543623..545851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0490"
FT                   /product="periplasmic sensor diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; CHASE4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29714"
FT                   /db_xref="GOA:A5FVT2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR007892"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVT2"
FT                   /protein_id="ABQ29714.1"
FT                   /translation="MLQRKDNRTSLAFVLTRAVPALLLTLAAGGLAFLLLAWAAHQSDR
FT                   VSFQRQERLVALVVSQLRSQVAHDQESSTVWDTAVEKVRADDTHWIDDNLGTWMHSYFG
FT                   FDGAYVLNPENRPIYAFANGRMTSPAAYDAIRGQVAPLVHALRHDMRDGHATGQGGKFL
FT                   SPGIADLAVVSGHPAVISVKPIVSDTGKIRQAPGTEYLHVAVRFLDGSFARRLTRDYLF
FT                   NGLHFAWTPAHGPGAAAYPVDDNAGKRIGYFIWRPYRPGTAVLSRAMPILGGLLALALL
FT                   TVAGFLAVVRSRSLRLQASEVRIHHLAFHDPLTGLPNRTFFNESADAALAALSGTSIAL
FT                   LFLDLDRFKQVNDTLGHPAGDTLIREFGARLRALVREEDMVARVGGDEFTVMLAGVAGR
FT                   EDVEKLCARIVESVRTPFDLNGNRVFVGLSIGVALAPDHGTDRIDLLRKADIALYSAKS
FT                   TGRGRFAFFDPVMDDALRLRREIEADLRAALQESGEIVPYYQPIHAAAGHTITGFEALL
FT                   RWRHPALGWISPDLFIPIAEEAGLIEMMGERVLREACTAAVNWPNRTIAVNASGPELAN
FT                   PGYAERVAAILRVTGLPPQRLEIEITETAANGQIGTAAENLASLRAMGVRIAIDDFGTG
FT                   FSSLARLQQLRVDRVKIDRSFIHGFGDQDSDEVIVRAIIELAHARGLRVTAEGVETLEQ
FT                   REGLARIGCDDLQGFIFSKARPAPEIDRLVEADDAPANDMPAPRGRTA"
FT   sig_peptide     543623..543742
FT                   /locus_tag="Acry_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.913 at
FT                   residue 40"
FT   gene            complement(546365..546796)
FT                   /locus_tag="Acry_0491"
FT   CDS             complement(546365..546796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29715"
FT                   /db_xref="GOA:A5FVT3"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVT3"
FT                   /protein_id="ABQ29715.1"
FT                   /translation="MSRVGLACRKRGSLARVHHAAARLCRQWRPHVLPDRRCAGLSASA
FT                   PTSATTAGTAAPARAASRPVAARCGASANADLVVRHVAVAVTVEIAVLIGILQFVLIAQ
FT                   PVLILVLRPGRAAEGNQAGSQAGQPGGAGDDAPAGHDFR"
FT   gene            complement(547074..547769)
FT                   /locus_tag="Acry_0492"
FT   CDS             complement(547074..547769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0492"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29716"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVT4"
FT                   /protein_id="ABQ29716.1"
FT                   /translation="MSPPPFRILFAVYPGMTQLDFTGPHQFFIRAPGCEVIVASRDGGD
FT                   VPSDGLVFARTARLADVPGCDLLCVPGGTNALDAALDDGFISELRRLAADARYITSVCT
FT                   GSLILGAAGLLRGRRAACHWAWRDLLKPFGAIPDDGRVVRDGNVITGGGVTAGIDFALV
FT                   VLAEIAGPQVAQTLQLGFEYAPAPPFEAGRPEHAPPDILAVCRQGLARLAATREAQTRE
FT                   AASRLATQH"
FT   gene            547848..548795
FT                   /locus_tag="Acry_0493"
FT   CDS             547848..548795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0493"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29717"
FT                   /db_xref="GOA:A5FVT5"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVT5"
FT                   /protein_id="ABQ29717.1"
FT                   /translation="MARHIGILIYQDFQILDASGPITAFEIAARHQADVYRLAILSASG
FT                   GPVRSSSGAVLGSEPASAAGALDTLIVTGGRGCRRAMECPEIRAFVVAQARGARRLCSV
FT                   CSGAFLLAAAGVLDGRRVTTHWRRTEELARLFPRLLVEPDAIHIRDGAIWTSAGITAGI
FT                   DLSLALIAGDLGEAVARRVAQEMVVYYRRPGGQSQFSALIEMGGGDGRFAGLLGWMRDH
FT                   LDARLTVEVLAERAAMSPRHFSRAFSRSVGMSPARAVERLRLETARERVEHSSMPIEAI
FT                   AGMVGFHDPERMRRAFLRAFGQPPQALRRSAQAQ"
FT   gene            complement(548900..549682)
FT                   /locus_tag="Acry_0494"
FT   CDS             complement(548900..549682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0494"
FT                   /product="3-hydroxybutyrate dehydrogenase"
FT                   /note="TIGRFAM: 3-hydroxybutyrate dehydrogenase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29718"
FT                   /db_xref="GOA:A5FVT6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVT6"
FT                   /protein_id="ABQ29718.1"
FT                   /translation="MARFDGKVGIITGAASGIGRAIAEQFAREGGHAVIADLDLDAARK
FT                   TASAIATFGPAPLAVAMDVTNEQQVEDGVAAAAERFGRIDVLVSNAGIQIVRPLAEFPF
FT                   SDWKKLLSIHLDGAFLTTRACLKYMYAQKSGSVVYIGSVHSKEASKLKAPYVTAKHGLI
FT                   GLCKVLAKEGAEHNVRANVVCPGFVRTPLVEKQIPEQAKELGISEDDVVRNVMLKDTVD
FT                   GEFTTVEDVAAAVLHFAGFPSNALTGQSMVVSHGWFMQ"
FT   gene            complement(549723..550460)
FT                   /locus_tag="Acry_0495"
FT   CDS             complement(549723..550460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0495"
FT                   /product="Acetoacetate decarboxylase"
FT                   /EC_number="4.1.1.4"
FT                   /note="PFAM: Acetoacetate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29719"
FT                   /db_xref="GOA:A5FVT7"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="InterPro:IPR023653"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FVT7"
FT                   /protein_id="ABQ29719.1"
FT                   /translation="MDAATIRETAFAMPLTSPGFPKGPYRFVNREYMIITYRTDRAALE
FT                   KIVPEPLELADDVVKYEFIRMPDSTGFGDYTESGQVIPVRYKGKPGVYVHSMFLNDHPP
FT                   IAGGREIWGFPKKLARPVLEVEIDTLVGTLDYGRIRVATGTMGYKHHTLDHDPVLSSMH
FT                   EPNFLLKIIPHVDGSPRICELVRYHMSDIVLKGAWTGPAALALYPHALAPVADLPVREV
FT                   VAASHILADMTLDLGEVVHDYLA"
FT   gene            complement(550478..551626)
FT                   /locus_tag="Acry_0496"
FT   CDS             complement(550478..551626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0496"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29720"
FT                   /db_xref="GOA:A5FVT8"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021095"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVT8"
FT                   /protein_id="ABQ29720.1"
FT                   /translation="MSVTNKRRSRQPSAATPACATGLRNVLLLQGGGALGAYQAGAYEA
FT                   LAEHAYDPDWIIGVSIGAINASLIVGNPPERRLERLREFWKRVTTPRPGFIPPALSLHV
FT                   AAEKKLGALNAVLFGQPGFFRPRHPVDFITENPLSFYDTAHLRQTLEELVDFDLINSGT
FT                   TRLAVGAVQIRTGNMIYFDNAECRITPQHIMASGALPPGFPPVEIDGEAYWDGGLVSNT
FT                   PLEYMMRCEPRENSLVFQVDLFPARGPMPKTLDGVAEREKDIRYSSRTRYGTDAEKRRQ
FT                   DLRRRVCAFLEKLPPELRDDPIAKHLQEFSCPAQIDVVHLIYRPEHPQGADKDVQFDRT
FT                   TATERWRHGHEDASRALSAAPWREPHPHELGMRTFDIAKTES"
FT   gene            complement(552015..553919)
FT                   /locus_tag="Acry_0497"
FT   CDS             complement(552015..553919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0497"
FT                   /product="peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   Penicillin-binding protein, dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29721"
FT                   /db_xref="GOA:A5FVT9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVT9"
FT                   /protein_id="ABQ29721.1"
FT                   /translation="MRPATIIEPCLGTGRGARQTARMNAQRDKKQRAVFTRRAMIIGGS
FT                   QVALFSALTARLYEMEIVDHSRYSRLARKNAVSERLIAPERGLITDRNGIILAGNRQQW
FT                   QALFLMTAASDPAATIARLERIVSLSPADRARLAKLATGPIHFLPILVKKDLGWDEMAR
FT                   LEVHRPSLPGLIIDRGFRRFYPLGPLTAHPVGYVVRPDSADAGREPVLALPGVRVGGSG
FT                   IEKSANAALFGSPGIVEDEVDAGGAVVRVITRRPAREGHAVGLTLDAGLQRTAAGALNG
FT                   RPGAAVLIDTSTGDLLAMASAPSFDPTWFDDGVPDHVWRRWTSKAAHHPLTDRATGGLY
FT                   APGSSFKPTVALAALEAGAITGDTRFFCSGHMKIGNRIFYCWLRSGHGSMDVASALQQS
FT                   CDIFFYHVAMRTGIDRMAAMARHLGLTGREALALPNVAEGFIPTRRWAKQRQIDWTKGD
FT                   TAVQGIGQGYTVLTPLALAVMAARIGTGRAVRPRIIRTVGAVERTHPAATTLSLSDRHL
FT                   ALVRQGMAEVVNTPLGTAWGARLALRGARMAGKTGTAQVIGESAEMEAENYNDAELPWQ
FT                   DRPNALFVGYAPLDRPRFAAAVVIEHGTLLGPVKIARDLFAAALSRRRLAYGDESRPA"
FT   gene            554127..555041
FT                   /locus_tag="Acry_0498"
FT   CDS             554127..555041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29722"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVU0"
FT                   /protein_id="ABQ29722.1"
FT                   /translation="MSLYVDRGPARANRTVPPAFTEETRHEAEAQCPVDAHPGRRARAG
FT                   AAACDGGEGGERDRSRRGQSLRTAESVRAAIRRDERADEFGQPLRSAEPLRAAEIGVSP
FT                   RRRARAGYAAAAQIAAWARAGTSAPARLPGTAEGFAEWAQYPQPEALDPVSGWRFFYHA
FT                   HAVRERLRAEHGHFHIFTPGPAGGMGFTHLIGISVDVQGLPIRLFTTNRWVTDEAWQPA
FT                   AAIGRRVLRPRLAGASPGDVACWLENLVVLFAPDIVALLYARDARMGSGIGPGDRRFED
FT                   RRLRIPSQTRVSLAAALRRLAAA"
FT   gene            555343..556515
FT                   /locus_tag="Acry_0499"
FT   CDS             555343..556515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0499"
FT                   /product="protein of unknown function DUF395, YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395, YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29723"
FT                   /db_xref="GOA:A5FVU1"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVU1"
FT                   /protein_id="ABQ29723.1"
FT                   /translation="MSQIAATGPRPPRALLAAASVLIVGLLAMTMPATGGRLPALVLIG
FT                   AAMGMTLAHGSYGFAYGWRALVLRRDGSGAMANLLMLAAATVLFAPILARGAVFGHGVA
FT                   GAIAPAGVPVAVGSFLFGVGMQMSGACASGCLYASGGGNLRTLLALLFFCAGAFIATFE
FT                   LPWWLSLPSLGAVSFGGMIGWGPGATLQIVAFGGLALILRRFAPPASPMMRAWLPKGSA
FT                   WFRGPWPLPFAALMLAGLNWLTLLIAGHPWSIVWGFTLWGAKGASLLGWVPPAHGFWSW
FT                   PFPHAALSHGILADETSVMNISIVLGALLASAIGGRFSLTTKFEPLPLLSAALGGLAMG
FT                   YGARLAFGCNIGSLFSGIASTSLHGWEWLVFALLGTPVGIALRRRFGLPD"
FT   sig_peptide     555343..555450
FT                   /locus_tag="Acry_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.766 at
FT                   residue 36"
FT   gene            556574..557515
FT                   /locus_tag="Acry_0500"
FT   CDS             556574..557515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0500"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29724"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVU2"
FT                   /protein_id="ABQ29724.1"
FT                   /translation="MKLSVIPAFGLAAAVLGGTAFAAKPVPPLVSADWVAAHACKPGVV
FT                   MLDVRNPIGGGNVQTYMHGHVPCAVYSNYSQNGLWRKDVDGAPGMVPPVAELETLIGGL
FT                   GIGNRTRVVIYTAGTSATDMASAARVFWTFKYLGDNNISILNGGYAGYVGRGSTPAHPV
FT                   QAGFVKPVETRFVAHVRPRLLATEAEVERAMKAHVPLVDDRPSAQYLGVNLAPVDTRPG
FT                   TIPGARNLPESWLTVNDGGVFRTPADLAGLYKAAGVPMAGRQINFCNTAHWAALGWFAS
FT                   YELLGNKQAKLYTGSMSQWSRNAALPVERQVR"
FT   sig_peptide     556574..556642
FT                   /locus_tag="Acry_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(557574..558581)
FT                   /locus_tag="Acry_0501"
FT   CDS             complement(557574..558581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0501"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29725"
FT                   /db_xref="GOA:A5FVU3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVU3"
FT                   /protein_id="ABQ29725.1"
FT                   /translation="MATMEDVAHKAGVSVSTVSHVINGTRKVRPATVEAVRDAIRKTGY
FT                   VPNSLAQALAGASTKTIGVAISALTNHYFAETVRVIESECARRGLMIFLADTHDDPDQE
FT                   LRVIKALHQRRVDGIILAPTAGTDRRALDYLKGKGIPSVLVDRIVRGEFDQVGVENTVA
FT                   CRELISHLIGHGHRRIGFVAGAPGISTSIERLEGYRDALHQAGIPFDPTLVCCGESANE
FT                   PARRAVRELLRLDPRPTAIVASNNLMMIGAMHALRDAGIEVPAGMALVGFDDFDWAELF
FT                   NPRLTVLAQPLEDIAMKAVELLTRRIARPDDQFEIVRLTPELRIRNSCGCQDQR"
FT   gene            complement(558708..560198)
FT                   /locus_tag="Acry_0502"
FT   CDS             complement(558708..560198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0502"
FT                   /product="xylulokinase"
FT                   /note="TIGRFAM: xylulokinase; PFAM: carbohydrate kinase,
FT                   FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29726"
FT                   /db_xref="GOA:A5FVU4"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVU4"
FT                   /protein_id="ABQ29726.1"
FT                   /translation="MRSFASPLSLGIDLGTSGVKAVLLTSSGAVIGTMSAAVPTSHPHP
FT                   GWAEQDPEDWWIACMTALRELRRQYPEAYEAVRSIGLSGQMHGAVLLDRHNRSIRPVIL
FT                   WNDARSTAEAAFLAENHPSFIEATGSLPMAGLTAPKLLWLHGHEIESFRKIDCLLSPKD
FT                   YLRLRLTGERVTDMSDAAGTLFLDVHRRSWFEPMIAATHLEPRQFPRLCEGTAATGTLT
FT                   RSAAGELGLDSKVVVAGGSADNPASAVGIGASHPGDSFVTLGTSAAVVSITDRPLARIA
FT                   GGVHGFCHALPERWYAMGAILCGANSLRWVSKLLSMPSEQALLDRVAAELPLERPVPPT
FT                   TPLFLPYLSGERTPHNDPNVRGGFMNVGIETAAPSFGYAVLEGVAFALRDAMGSVEESG
FT                   SDIRHCSLVGGGAKSDYWGQLLANVLGRELHTLEGSELGAGIGAAKLGFAALGIDEPVN
FT                   MSLPVRKTFEPQADRREDLDDRYRKFRTLYPAARSLCT"
FT   gene            560555..561550
FT                   /locus_tag="Acry_0503"
FT   CDS             560555..561550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0503"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29727"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVU5"
FT                   /protein_id="ABQ29727.1"
FT                   /translation="MKLAKRLSIVGMAIAGTIGLAGPHAEAAQTCAKPKYVIGMSLMTL
FT                   TNPYFETMAKTAAKDAAADCAKLIYYGGNMSEAQQLNQVEAFIQRHVNAIMFAPADAAA
FT                   ASSAVLAANHAHIPVFTIDTNVDMKTLKRAGGHIVEFVQSNNVQLGENAAKEVIAYDKS
FT                   ALHGAPVKLGWIDYPFATSVQDRDKGFKKIIDGDKNIHVVSRLNGKGTTPGGLSATAAM
FT                   LSAHPDVNVIFDINAPSGLGAMDAIRAANKVGKVAVIGLSGSQQAVQAICQNSVYKAGA
FT                   LQSPAVESKIEVANIIKYLDGDKNIPKLVLTKTYTVSKANCHEMMKIAYP"
FT   sig_peptide     560555..560638
FT                   /locus_tag="Acry_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.487 at
FT                   residue 28"
FT   gene            561556..563052
FT                   /locus_tag="Acry_0504"
FT   CDS             561556..563052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0504"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29728"
FT                   /db_xref="GOA:A5FVU6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVU6"
FT                   /protein_id="ABQ29728.1"
FT                   /translation="MSTGQAGSLALSGIVKRYDSAPVVRGVSFSLRAGEVTALLGHNGA
FT                   GKSTALKILGGAEQPSGGHILLDGEAVTLTTPRIAEAHGIAVVWQELRIIEKLTVTQNF
FT                   FLNREKRRGPFTDRTAMNEHVRRALATYGLAADPDMAAGALSPADRQMLEIIIALDKGG
FT                   RFLLLDEPTSALNASEITRLLDTVRRLAAGGTSIAIVTHKLGEALAVADHVVVMKDGDV
FT                   VLDAERADLSEADLAYYITGHRRDATPLAEVSPRTAFGGTTLLDIKTLSSGNCRSASLE
FT                   INAGRVVGLYGVAGAGQVELLEVLFGVRPMQGGEIRLAGEPYVPTTPRAALAKGFGFLT
FT                   DDRKANGFIPDMTIGKNIVLASIDRFSRGIWFDDAAVAEQARTMAARLAIRSPLGTSVR
FT                   RLSGGNQQKVIFAKWVTARSRILLLAEPTKGVDIGAKAEIHALIRELAAAGDTLLVCSS
FT                   EIEEILEVSDVIYVFRHGICEGTGIPRAEAEARSILAQSL"
FT   gene            563078..564088
FT                   /locus_tag="Acry_0505"
FT   CDS             563078..564088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0505"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="PFAM: inner-membrane translocator; 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29729"
FT                   /db_xref="GOA:A5FVU7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR035568"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVU7"
FT                   /protein_id="ABQ29729.1"
FT                   /translation="MAKQDTSTTASPQRKGLRLPPETGIFVILALIMAGMEVLTGNFLT
FT                   IGNISTLLVNTITIGLLAVSETFVLLIGGIDLSVGAIQALSGVTAAVVINHTPLGWPGA
FT                   ILGGILAGALIGFINGSITHYINVPAFITTFATLGVAASIPLIVTQANPIPIFSNTFNA
FT                   LGQGYVLKIIPIGVLVMLVVAAAAHVVLSRTAFGVKVYAVGGNRHSAWLAGVNIARIEI
FT                   LCFTLSGTIAGLAGVILAARLASGYPTAGSGASLFDGIASAVVGGVSLFGGSGSVAGAL
FT                   LGAIVIGTLTEGMDVLDLNTYWQPLVIGIVILLAVMLDTWKTGLLRTLMRRLRRA"
FT   gene            564220..564489
FT                   /locus_tag="Acry_0506"
FT   CDS             564220..564489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0506"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29730"
FT                   /db_xref="GOA:A5FVU8"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVU8"
FT                   /protein_id="ABQ29730.1"
FT                   /translation="MSKAFITDVIQNSTGITGVAANRAATDVIEAIVKELKKKGKFTLP
FT                   SFGTFTVRKTKARKGVNPRSGEPIKVKAGKTVRFKSSPTLKTRV"
FT   gene            complement(564596..565492)
FT                   /locus_tag="Acry_0507"
FT   CDS             complement(564596..565492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0507"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29731"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVU9"
FT                   /protein_id="ABQ29731.1"
FT                   /translation="MGQLRRILVTGAGGFVGRHLMPELGRRFPWAELVSFRADITDPAA
FT                   TETSVRDVRPDACVHLAGIAAIPEAREHPRRAFAVNLDGTLNLARALLAHAPGCQLIHA
FT                   GSADCYGASFRSGQALDESAPLAPLNTYAASKAAADLTLGAMAAESGLRVLRFRPFNHV
FT                   GPGQSEAFALASFAAQLRRIARGDAAPVLHVGNLDAERDFLHVNDVVRAYALALGRSDD
FT                   LPNGTIFNIASGIPRRMRDMVEAMIVSLGIHVSVEIDPTRLRPSDIPRAVGDASRAENL
FT                   LGWHPDHGIEEIVRSVL"
FT   gene            complement(565706..566689)
FT                   /locus_tag="Acry_0508"
FT   CDS             complement(565706..566689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0508"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; dTDP-4-dehydrorhamnose
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29732"
FT                   /db_xref="GOA:A5FVV0"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVV0"
FT                   /protein_id="ABQ29732.1"
FT                   /translation="MKTALVTGITGQDGAYLSQLLLGKGYEVFGVIRRSSHRGVEDHRL
FT                   RWLGIADKVTLLDGDLADLSSLVRIVKDVRPDEVYNLAAQSFVASSWRQPILTANITAV
FT                   GVTNILEAIRAEQPEARFYQASSSEMYGLIQEPMQSEATPFYPRSPYAVAKLYGHWITV
FT                   NYRESFGMHASSGILFNHESPLRGVEFVTRKVTDGVARIKLGLAGELRLGNVDAKRDWG
FT                   HARDYVKAMWLMLQQDKPDDYVVATGRTTTVRDMCRIAFDHAGLDMERHLVIDPAFYRP
FT                   AEVDVLLGNPAKAEQKLGWRPETTLEQMIIEMVDADLERLRRTTPG"
FT   gene            complement(566768..569014)
FT                   /locus_tag="Acry_0509"
FT   CDS             complement(566768..569014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0509"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase,
FT                   molybdopterin binding protein"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead; aldehyde oxidase and xanthine
FT                   dehydrogenase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29733"
FT                   /db_xref="GOA:A5FVV1"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVV1"
FT                   /protein_id="ABQ29733.1"
FT                   /translation="MSETSIRFGSNAGQSVTRRDGIAKVTGAATFAADNHPEGVLHAVY
FT                   VPATIARGRVIRLDTVAAKAHPGVVEVFTPENRPALAGDPDAKPFLFAFRTEVLQSAEI
FT                   RYANQPIALVVAETVEAATEAARLVVPHYEALPPRLGLDGDAPYKPESGNFGRPAETVF
FT                   GDVAAGHAAARHAVDLTYETPAQYHNAMETHAIVATWDGDRLALDVPSQAIVMSRGAYG
FT                   YYFGIPAENVTIRSPYLGGGFGSKAVINGPALLAILAARALRRPVKLMLRREQMFGPVG
FT                   HRGATRQRLRIGTDDDGRMTALDHESLAVTSTFDDFIEGAADASLGLYATEALRSTQYA
FT                   VRADIGTPGPMRAPGIASGSAALECALDEMAEAAGLDPLEFRLRNYAEVEPGTGRPYSS
FT                   KALRECYRQGAERFGWAGRPLAPRQMTDDRGLLVGWGMGTALFHAPMFAAEARATLRPD
FT                   GTGLVETAAADMGQGAWTALAQIAADGLGLPLDRIEFRAGSSDLPDGGIAGGSGHTATA
FT                   GGALHAAGSDAVRRLGEIAVADPASPLFGANAGVIARDGRLFARDDDSRSESYVEIIAR
FT                   AGGAAVQGTGSAARPPEAAERHAMYSHGAVFAEVKIDPALFQIRVTRLVGAFAAGRIIN
FT                   PHLATSQLMGGMIWGLSFALHEEARHDRRTGRIVNADFAGYHIPVNADVAGLDVITVHE
FT                   EDPHVNPLGIKGVGEIGITGTVGAIGNAIWHATGTRVRRFPIRIADLLAGSQSM"
FT   gene            complement(569007..570050)
FT                   /locus_tag="Acry_0510"
FT   CDS             complement(569007..570050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0510"
FT                   /product="molybdopterin dehydrogenase, FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29734"
FT                   /db_xref="GOA:A5FVV2"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVV2"
FT                   /protein_id="ABQ29734.1"
FT                   /translation="MTPFAYLRPATLDEAIGAWEPGAAYLAGGTNLVDLMKTGTLRPAK
FT                   LIDLARLPGLDAIETLEDGSVRVGALVRNADLAHDITFAAQFPMVAEALLSGASGQLRN
FT                   AATVGGNLLQHPRCAYFQDPLSACNRRAPGSGCDARDGDNAALAVMGWSEACIATSASD
FT                   FCVPLAALDAVVETAGPAGAREIPFAELHRLPGDSPERATALGPGELIVALRLPAAASA
FT                   FRAHARYLKLRERTSFAFALVSAAAALRLDRGRIAEARLALGAVAAKPWRSREAEAMLA
FT                   GAAPAPELFARAAAVALSGATPSGANAHKIELARRTAARALALAAAGTPARMPALPASP
FT                   FGDLAHV"
FT   gene            complement(570047..570544)
FT                   /locus_tag="Acry_0511"
FT   CDS             complement(570047..570544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0511"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29735"
FT                   /db_xref="GOA:A5FVV3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVV3"
FT                   /protein_id="ABQ29735.1"
FT                   /translation="MLHPIHLTLNGICRDLTLDDPRITLLDLLRERMALPGTKKGCDRG
FT                   QCGACTVLVDGRRINSCLVLAVTLDGAEITTIEGLAEGGRLHPVQAAFIEHDGFQCGYC
FT                   TPGQIMSALGLITEGHAGDDPERIREGMSGNLCRCGAYHGITEAVQDATRRMADTSAGD
FT                   AA"
FT   gene            570685..571290
FT                   /locus_tag="Acry_0512"
FT   CDS             570685..571290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0512"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29736"
FT                   /db_xref="GOA:A5FVV4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVV4"
FT                   /protein_id="ABQ29736.1"
FT                   /translation="MGEFGTMQIAGRKPRSDAQRNRERLVAAAKEILGQGGPEASLEAV
FT                   ARRAGLGIGTLYRHFATRESLFLAVYASEVAQATETATELESAGDGLEALRAWIHGMVG
FT                   LVETKRGLIGALSVAMTEEARAQYSEVSAPLIVAMERLVARAQADGSVRADVTTQEIMS
FT                   TVFALCYARQPDPGWKVQVLRIIDIFVDGLRPPMARGG"
FT   gene            571423..572100
FT                   /locus_tag="Acry_0513"
FT   CDS             571423..572100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0513"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29737"
FT                   /db_xref="GOA:A5FVV5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVV5"
FT                   /protein_id="ABQ29737.1"
FT                   /translation="MIPREPVFLFDLDGTLVDSVYQHVLAWKDALDAEDIDLAVWRIHR
FT                   KIGMSGGLFTNQLLRETGLEISPERIERLRRGHAESYRRYGKRIRPLPGARALLDHLTG
FT                   SGVPWAIATSGRMETAAVNLEALQVDPEQAAVITRDQVNHAKPNPDLFLAAAERLGAAI
FT                   EAAVVVGDSIWDMLAAARCKALGVGLLSGGYGAHELREAGAIRVYEDPADLLRHIDEIG
FT                   GRR"
FT   gene            572146..573054
FT                   /locus_tag="Acry_0514"
FT   CDS             572146..573054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0514"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29738"
FT                   /db_xref="GOA:A5FVV6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVV6"
FT                   /protein_id="ABQ29738.1"
FT                   /translation="MILTEGGVPENEPGSTVRLHDGRALGYLDVGAAEGPPVFHFHGHG
FT                   SSRLEALVLADAARSAGLRILAFDRPGIGRSAPRPGDRLLDWPADILEAADLLGIGRFA
FT                   VQGMSAGGPYALACARACPARITVCSLVSALPPPAIARRSGPLKRRLAWWIASLFPRYL
FT                   RRRLRQFRPDGIPTREMITARLMRMAHWLGGEDLALMRNPAMLDLMARTMTETALQGGA
FT                   ANRTEIERLARPWGFRIGDVPVPVLLWHGGEDRILPVEAARLMAGRLRQCAATYYDGEG
FT                   HFSVLVNRSHDLMCALRAHAR"
FT   gene            complement(573123..573737)
FT                   /locus_tag="Acry_0515"
FT   CDS             complement(573123..573737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0515"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29739"
FT                   /db_xref="GOA:A5FVV7"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVV7"
FT                   /protein_id="ABQ29739.1"
FT                   /translation="MGAIILCTAGLAACAAKAPQASLAMPPPAEPPTQALPALTVAKRL
FT                   STMPPVAVPAVLRPPLDLSGRNETGKASYYARRFAGRRTADGQRFNPHAPMAASKTLPL
FT                   GTVAKVVNLSNGTSTTVTVADRGPNVESRMLDVSPEVAIRLGMIREGVARVLVEPITIP
FT                   EPDGKVKLGAGAAHASKAQIAAAIGTSRRVMRQDGIRVADR"
FT   sig_peptide     complement(573663..573737)
FT                   /locus_tag="Acry_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.802 at
FT                   residue 25"
FT   gene            complement(573903..574433)
FT                   /locus_tag="Acry_0516"
FT   CDS             complement(573903..574433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0516"
FT                   /product="protein of unknown function DUF1130"
FT                   /note="PFAM: protein of unknown function DUF1130"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29740"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="InterPro:IPR014519"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVV8"
FT                   /protein_id="ABQ29740.1"
FT                   /translation="MTGLGVRLRRAGVYTPPMDTDELATIGYEKCGFDDFVRCLREAGV
FT                   RQVIDVRDLPLSRRAGFSKRQLAAGLDAAGIGYHHLRALGTPAAGREANRRRRWDEFWR
FT                   IVDDRLATPEAAFALAEAAELASAKPSCLLCYEAAVCQCHRLRVGERLSASHGFRLRHL
FT                   LVHGAVGHTPPSR"
FT   gene            574618..575442
FT                   /locus_tag="Acry_0517"
FT   CDS             574618..575442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0517"
FT                   /product="sulfotransferase"
FT                   /note="PFAM: sulfotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29741"
FT                   /db_xref="GOA:A5FVV9"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVV9"
FT                   /protein_id="ABQ29741.1"
FT                   /translation="MGRIIWLASYPKSGNTWLRAFLQNYILDEGRPQDINRLTLLSTGE
FT                   SGASLYRPFMAEPDATLSAEAAARLRPAVHRAIAGADPQRVFVKTHNANVDHAGTPLVT
FT                   AGVTDRAIYLVRDPRDVAVSYAHHLGVSHDALIDLMTDDRAVSGDNVHKVTEFVGSWNR
FT                   HVESWTAHPAWPTMVLRYEDLLADPADGFGDVIRFLGAEPDPPRLARAIRHSAFDVLAA
FT                   QERERGFVERPGAAALFFRNGRAGQWRDVLSDRQSRAVEHAQAPQMRRFAYL"
FT   gene            575575..575970
FT                   /locus_tag="Acry_0518"
FT   CDS             575575..575970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29742"
FT                   /db_xref="GOA:A5FVW0"
FT                   /db_xref="InterPro:IPR021218"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVW0"
FT                   /protein_id="ABQ29742.1"
FT                   /translation="MREILVLADAILAVHVIVILFNVTGLVVIPVGARLGWRVIRVAWL
FT                   RLLHLALLAVVAGQAVAGRACILTIWQQDLAGGAGTVHPLIMQWVDRLIYWNLPMWFFQ
FT                   ILYCAVFLYVVALTVYVPFWGTATRNR"
FT   gene            complement(576040..576570)
FT                   /locus_tag="Acry_0519"
FT   CDS             complement(576040..576570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0519"
FT                   /product="flavin reductase domain protein, FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29743"
FT                   /db_xref="GOA:A5FVW1"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVW1"
FT                   /protein_id="ABQ29743.1"
FT                   /translation="MRDLPLARVYQFIEPGPVVLLTTAERGHLNVMTMSWHMMVEFEPP
FT                   LIACIVGEGDYSFAALRRTGECVIAIPAAELASTVVGIGNCSGRDVDKFARFGLTARPA
FT                   RLVTAPLIAECFVNLECRGIDMRLVRRYDMFVLEVIKGWIDPARRNARTLHHRGFGRFA
FT                   VDGETISFRSRMR"
FT   gene            complement(576780..578690)
FT                   /locus_tag="Acry_0520"
FT   CDS             complement(576780..578690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0520"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; Cache, type 2 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29744"
FT                   /db_xref="GOA:A5FVW2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVW2"
FT                   /protein_id="ABQ29744.1"
FT                   /translation="MLKKLSIRYQFAMLGAFGVAITVAAVALNLFDSYQMELHSKEAQA
FT                   RALVASAVTSTETYVHLADQGVITKQKAQSLALKALGAARFDHGNYFFVYDRHGVALAN
FT                   PKKSVIGKNLENVKDPYGHYVIRPLMQAAASGHPIFHEYYWPKAGSSTPQPKISYMAEV
FT                   PGWHWMIGSGLYISDLRTNFWNGVLRFAAIFIPVLFAFLLLMIYMQKNIANILKRMTSV
FT                   MKALSTGDSSVDVPFTDRTDEIGGMASAVEIFKSAGIEKARLENDATAAARQRETERAR
FT                   TEAERAAAAQQLATVVDSLAHGLEELSAGRLTFRLTAAFAAEYEQLRTDFNGAMQRLQD
FT                   AMRVVATNASAIRSGSGEISSAADDLARRTEQQAATLEETAAALDEITTTVRNTADAAV
FT                   HARNIVDTAKQDAEHGGSVVSQAVRAMGEIENSSKQIGNIIGVIDEIAFQTNLLALNAG
FT                   VEAARAGEAGRGFAVVASEVRALAQRSADAAKEIKTLISASNQQVVAGVDLVDETGKAL
FT                   ERIVRQIAELNDSVAKIAASAQEQSTGLVQVNTAVSQMDQATQQNAAMVEESTAASHSL
FT                   VQEAEQLTQLIGRFDLGTSPAPASPGRLPVTPPRPAAKPAPFAAPKRHLEGADAGDWED
FT                   F"
FT   sig_peptide     complement(578607..578690)
FT                   /locus_tag="Acry_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.732 at
FT                   residue 28"
FT   gene            578771..579094
FT                   /locus_tag="Acry_0521"
FT   CDS             578771..579094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29745"
FT                   /db_xref="GOA:A5FVW3"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVW3"
FT                   /protein_id="ABQ29745.1"
FT                   /translation="MSVLVPEPAAVSGAESPVPAVLSSAQRGAVKCFYGRIYNLFSIYE
FT                   HLLHLLEKYLLGRRSSANIFRINAINIGWCAMWISLGSNFVVIVSFPMYHDVRGIRHHR
FT                   EVD"
FT   gene            579253..582597
FT                   /locus_tag="Acry_0522"
FT   CDS             579253..582597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0522"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; EAL domain protein;
FT                   GAF domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; SMART: PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29746"
FT                   /db_xref="GOA:A5FVW4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVW4"
FT                   /protein_id="ABQ29746.1"
FT                   /translation="MTMRAGACLLSPAKAGEARLPSDDTETRRLAALGRYDIVGTPAEE
FT                   SFDRFARLAAHGLDMPIATVSFADASRHWLKAKVGTDLECMPRGTVFCEHTIGTDSPLV
FT                   VPDAREDERFRDNPLVADFPHIRFYAGAPIITPDGYRIGSMCVLSPEPRAEFDASSRKF
FT                   LTELAQSVMTELELRRLNREQAKVSADLAFWNRLSEAIADAANFDAALDHALACCAERA
FT                   GAAICFLVAFHPAYRMLEYVKSHIAQDSDLADFDMTPWFAGHPVDTISFGAALVEGRMY
FT                   DSGPMMDADPGPAYPRLRELVRAGIRRQVVHPFDLADRRFGLVLDFRSPAIAEETHGLI
FT                   LEFVARLTPLLLGRLREDALERANRALRTIHEATEAFAHATTAQAVFDAACRLAVETGG
FT                   YNTCWVGLAQHDPEKSVSLAASAGRGTGYVAQLRLSWADVPNGRGPAGTAIRERRISRW
FT                   RDIAVDPRFEPWRHKALASGFRSCISLPFGGAGIPAAGALTLYSSDPMAFGEEERDLLV
FT                   ELTANMTKALQAFTTRQERDDALMAHSMSERRIDRLLAATGVVLYALALHGDEAVLVDM
FT                   SENIVDMLGYATGNIRGLDWWRNHVHPEDLPQAALGVPRTVESGQFVHRYRIRHQNGGY
FT                   RWIHDEKTLQRDAAGNPVGIVGVWIDITERREAEEQIYRLAHIDPLTELPNRRLLNERL
FT                   REVLIEARRTGVQGALLFIDLDRFKTINDMLGHSAGDSALRQAAQRLRQAVRAADTIAR
FT                   VGGDEFVVLIADAGSTVADAADHAATIARKMIDALTARPISIGEREYHLGASIGFTMFP
FT                   KPDDTIDTLIREADTAMYQAKAGEADVVMFRQSMHLSIVARHAIEDEIRSALKAGRFEI
FT                   WLQDQVELGGKPVGAEVLLRLRDRDGRIAVPSEFIGIAESSGLIVPLGRWLLREACALL
FT                   ARAHRDRPDWRLSVNVSPRQFRDPAFVTDVIAALDISGVPADRLTLEITENLLIRDTFE
FT                   IARIMGILADRGVRFSVDDFGTGYSSLHYLRQLPIHEIKIDRGFIGQVPDDASSVAIVE
FT                   AILAMARRLDLDVVAEGVETPEHVAFLKARGCPRMQGYFFACPIPVSEWLERSAHTPDA
FT                   GVANARR"
FT   gene            582788..583468
FT                   /locus_tag="Acry_0523"
FT   CDS             582788..583468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29747"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVW5"
FT                   /protein_id="ABQ29747.1"
FT                   /translation="MIPRRIHQFWLIDLLRARRRRFGGGSPWEEGMQEELRANHLEWSL
FT                   HHPGFEVKLWSLDELLSLCRVGGFTWVAQVLTADAPVPLQLDLIRFFLLEQLGGIWADL
FT                   TVRPVGPMPAALLAAEFVAIGVDGGAPVFDQRFLAARPGLECFMRATDKVMRGGFDEAR
FT                   RMSGQDALAAAFAASRRPVAACLLSEQDTWGSLLERRSLDRDADWLPDPMATLEVNAAR
FT                   PTPA"
FT   gene            complement(583488..584078)
FT                   /locus_tag="Acry_0524"
FT   CDS             complement(583488..584078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29748"
FT                   /db_xref="GOA:A5FVW6"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVW6"
FT                   /protein_id="ABQ29748.1"
FT                   /translation="MIPTASAPPSIAQTRRPRTRSAPLGLALLLAAGLGACTNPYDPGQ
FT                   RALGGAALGAGTGAAIGALAGGGRGAATGALIGGAIGAVGGAATTPPPPSPYEAGYPPA
FT                   APASWSPEMVWLPSPGVYVALGYNYPLFFYSGLYYYLYSGRWYVGSSYSGPWRIHAAPP
FT                   PLRRFHSGYWNSYQMRARNYYHNNPGWRHFRPR"
FT   sig_peptide     complement(583968..584078)
FT                   /locus_tag="Acry_0524"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.781 at
FT                   residue 37"
FT   gene            complement(584260..585471)
FT                   /locus_tag="Acry_0525"
FT   CDS             complement(584260..585471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29749"
FT                   /db_xref="InterPro:IPR011486"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVW7"
FT                   /protein_id="ABQ29749.1"
FT                   /translation="MSLDHSRTPGRRNRARLIAASFGAAISLCALQSAQAFNGPSAIKI
FT                   DGGPLGPLQLSGGADGYMYALSGTGNSTSGGLLGTDKSTGAEFMNGQIEVQKTSGLVQF
FT                   TIQVGSNNSLTLGTKPTATSVQTFSTGPLYAGYITLAPTKNFSISVGQIGSLEGYESGI
FT                   DWNNANVLTTDLFYVENSQSRGVSATYTMGPVSASVTFGDGFDTGVFNFLQGLVTYSFN
FT                   DNNALSVFGATNLGHTGLLANTYGSATTPYNQSTVGSYGANYINSTMIGGYYSYTHGNL
FT                   NLVPEVQYVYAKPDQKVGISKFTSNFGAALFADYAFGKSPYSLGGWVEYFSSNGPGFWF
FT                   LNPGAQGYGLSVTPTWQNKNLFVRGDLGLLHLTKISNNGSTGYGANGTGRNQATFVVEA
FT                   GVLF"
FT   sig_peptide     complement(585361..585471)
FT                   /locus_tag="Acry_0525"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.859 at
FT                   residue 37"
FT   gene            complement(585656..588436)
FT                   /locus_tag="Acry_0526"
FT   CDS             complement(585656..588436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0526"
FT                   /product="helicase c2"
FT                   /note="SMART: helicase c2"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29750"
FT                   /db_xref="GOA:A5FVW8"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVW8"
FT                   /protein_id="ABQ29750.1"
FT                   /translation="MDTPSRLILPAAPSLVTAHGRAALLDPDGELRHLTVAEARAALRD
FT                   LPPPLVVHEAATLQRLDLSIPVLDLLDLFAFVMPAVTAAPTPSGLARALDFDPPATIEA
FT                   AAALLPDIAIALLGRLDQSASLPMNRRAAGLAALMGEAGWPWAKPVAAALGQPAARPDR
FT                   AALRLGMILPEWQEEAPRPPPSSYPVPQDAARGRLADLLGGGAEQRPAQSDYASAATAA
FT                   FAPPAAEGVPHCVLAEAGTGTGKTLGYLAPASLWAERNQGSVWISTYTRHLQRQIEQES
FT                   ARLEPDPARRRRRVVLRKGRENYLCLLNFEDAAAGARGYNLVALGLIARWALASSDHDI
FT                   AGGDLPGWFAELFGSGLLPQIADRRGECIHSACPHWKRCTIEHVIRRARGADLVIANHA
FT                   LVMAQAVWGGLDDSSVPTRYVFDEGHHLFDAADSAFAAELSGASMAELRRWLLGAEGGR
FT                   SRARGLARRLEDLVAADERLAAPLDALRAAARVLPGATMLARLGEPTAALDQIGPGAAE
FT                   AFLTALAAQARARATAAERESNLDIEADLYPAEPELAAAASDLARDLARLEAPLTSLRE
FT                   RLAARLDEEAGTIDSTERQRIEAAIRSLKRRALDPVASWRRMLAAVNEAPPEPGERPFH
FT                   VLFIRQGRDIALLSHLLDPTEAFADAVASRAHGLLITSATLRDRTTAMDDVEQDAEWQR
FT                   AESRTGATHLAAPAIRAAFASPFDYPAQTRIFIVRDNLRETPEALASAFRALFLASGGG
FT                   ALGLFTAIARLRAVHARIAPALDAANIPLFAQHVDAMNNATLVDSFRAEQNACLLGTDA
FT                   MRDGVDIPGNALRLVVFERTPWPRPDILHRVRRTHLSHGDPKTYDDAIVRLRLRQGFGR
FT                   LIRRAGDRGVFVLLDRAFPSRLESAFPTGVTVSRQGLAETVAAVREFFAADRASA"
FT   gene            complement(588484..589119)
FT                   /locus_tag="Acry_0527"
FT   CDS             complement(588484..589119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0527"
FT                   /product="Uracil-DNA glycosylase superfamily"
FT                   /note="PFAM: Uracil-DNA glycosylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29751"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVW9"
FT                   /protein_id="ABQ29751.1"
FT                   /translation="MSAQPARDCALCPRLSGFRAANHAKFPGWFNAPVPCFGPENARLL
FT                   VVGLAPGLRGANRTGRPFTGDFAGHLLYATLIKYGLAIGVYAERPDDGLELRDCRIINA
FT                   VRCVPPENRPLPAEIAACNGFLARDIAAMTQLRGILALGGIAHQATLRAFGLKQSHAKF
FT                   SHGAMTELPGGIVLADSFHVSRLNTNTGRLTAAMFEAVVGALLARIAA"
FT   gene            complement(589126..589698)
FT                   /locus_tag="Acry_0528"
FT   CDS             complement(589126..589698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0528"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29752"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVX0"
FT                   /protein_id="ABQ29752.1"
FT                   /translation="MRLLPQEKTALFIDGANLYAASRALGFDVDYRRLLDFFDRVNLVR
FT                   AYYYSALLDTEEYSPLKPLTDWLAYNGYTLVTKPAKEFTDGAGRRRVKGNMDIELAIDM
FT                   LEMAPHIDHAILFSGDSDFRRLVEAVQRRGVRVSVISTIKTSPPMIADELRRQSDQFVD
FT                   LADIANEFTRRQTEPRPRMQRAEATQD"
FT   gene            589890..590306
FT                   /locus_tag="Acry_0529"
FT   CDS             589890..590306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0529"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29753"
FT                   /db_xref="GOA:A5FVX1"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVX1"
FT                   /protein_id="ABQ29753.1"
FT                   /translation="MQKIETIHLEAVSSWYRTRPVPPDPTQPDFCNGVVRFSGAPDPVA
FT                   LLEALHEIEARFGRVRSVPNAARTLDLDLIDVNGMVRETGSPILPHPRAHLRTFVLRPL
FT                   LDVAPDWVHPLLLRPARELFSALPERAEGEIRLW"
FT   gene            590409..590819
FT                   /locus_tag="Acry_0530"
FT   CDS             590409..590819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0530"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number="2.7.7.6"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, omega subunit;
FT                   PFAM: RNA polymerase Rpb6"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29754"
FT                   /db_xref="GOA:A5FVX2"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FVX2"
FT                   /protein_id="ABQ29754.1"
FT                   /translation="MARVTVEDCIEQIPNRFELVLLAAQRARNLSRGASITIDRDNDKN
FT                   PVVALREIADSTVDFGGLEQDLVKSLSRVPDPEPADEEVQDLIPTDQNIFGLQDVSAEE
FT                   EAAAMAAESEEMTSEDIAAAIEAELGGGRPRR"
FT   gene            590857..593106
FT                   /locus_tag="Acry_0531"
FT   CDS             590857..593106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0531"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="TIGRFAM: RelA/SpoT family protein; PFAM: TGS domain
FT                   protein; metal-dependent phosphohydrolase, HD sub domain;
FT                   RelA/SpoT domain protein; SMART: metal-dependent
FT                   phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29755"
FT                   /db_xref="GOA:A5FVX3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVX3"
FT                   /protein_id="ABQ29755.1"
FT                   /translation="MGVNHPLLAPEGLAGTAVTHEALKPLISRINGYDTKVDIALIDDA
FT                   YGVASEAHAGQTRENGDPYITHPLAVADILADYRLDARSIVTALLHDVIEDTKVTLPAL
FT                   QGRFGAEVAGLVDGVTKLTRLELQSDRTKQAENFRKLVLAMSKDIRVLLVKLADRLHNM
FT                   RTIHFVRSPERRARIARETMEIYAPLAERIGMDRVKVELQNRAFAVLDPEAYDSIQARL
FT                   NFLRGQGADVIDEVRAELGRILKEAGVEVIDISGREKSIYSIWEKMQRRNVAFEQLSDI
FT                   MAFRIIVPTREQCYVALGAIHAAFPVIAGRFKDYISTPKANMYQSLHTGVTLRHPRNQK
FT                   IELQIRTPEMHAIAENGVAAHWLYKQGEASAADVKQFRWVQDLLEILENSSAPDEFLEN
FT                   TKLELYQDQVFCFTPKGQLIQLPRGATAVDFAYAVHSQIGDTCVGARINGRLMPLRYEL
FT                   QNGDQVEILTARGGTPSPSWERFVVTGKARSRVRRFIAGQLREQNRDQGKAALAKAFRQ
FT                   DGVDGSEKVLEVALKALKQASLDDLYVAVGTGNLAARDVVQAAYPDLRESRAPRMVPGM
FT                   LARAPRPPARGTGLPITGLISGMEVHYAGCCHPLPGDKIVGIIATGKGVTIHTRDCLTL
FT                   ETFANTPERFIDVDWDYAQIGPGKEGTRDGNGRERPFTGRISVIASNAPATLANIANAV
FT                   AKQDGAIANLKIIHRQQDFFECLMDVEVRDLRHLSQVIAGLRAAGGVAQVDRART"
FT   gene            593152..593556
FT                   /locus_tag="Acry_0532"
FT   CDS             593152..593556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0532"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /EC_number="2.7.8.7"
FT                   /note="TIGRFAM: holo-acyl-carrier-protein synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29756"
FT                   /db_xref="GOA:A5FVX4"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FVX4"
FT                   /protein_id="ABQ29756.1"
FT                   /translation="MIIGIGSDLCDIRRVERTLERFGERFIQRVFTETERRRAARRPAQ
FT                   FAATLAKRFAAKEACAKALGTGFRRGVFMSDLGVVNLPSGQPTLALTGGAAERLAALTP
FT                   PGRSAFVHLSLTDEYPYAYAHVIIEARDGA"
FT   gene            593561..594649
FT                   /locus_tag="Acry_0533"
FT   CDS             593561..594649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0533"
FT                   /product="23S rRNA m(5)U-1939 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: (Uracil-5)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29757"
FT                   /db_xref="GOA:A5FVX5"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVX5"
FT                   /protein_id="ABQ29757.1"
FT                   /translation="MTAPATVVPVCRHFGVCGGCSAQDVAPAALAEAKHARLAAALARA
FT                   GFADPHPAPVVSIPMGTRRRADFAVARVAGAVRLGFHETRSRTVVDIAECPLLRPELEA
FT                   LIDPLRALLARLQGLRKSADVRVNLLDAGADVSVALDGEATAADRARLVAFAQEHDLPR
FT                   ISLGAEPVLIRRPPTLDCAGLVVLPPPAAFLQPSFEGEAAIRAAVLAGLPPKLTRKSRI
FT                   VELYAGIGTLTGALAAHARVHAVEGSAPALAALDEAARTGGQAGRIDTERRDLARRPVT
FT                   AKELAGAACVVLDPPFDGAGPQIAPLVEAKVQRIVYVSCNPEALAREAAPFARAGYRLL
FT                   ASTPIDQFPGSDHLESVVVLGL"
FT   gene            594890..596464
FT                   /locus_tag="Acry_0534"
FT   CDS             594890..596464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0534"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29758"
FT                   /db_xref="GOA:A5FVX6"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVX6"
FT                   /protein_id="ABQ29758.1"
FT                   /translation="MTIHHPNFGAVPDDRVFIFDTTLRDGEQSPGFSMNLDEKLRMAEA
FT                   LAELGVDVIEAGFPIASQGDFESVRRIAETIKGPVIAGLARSGRDDIVRAGEAVKPAER
FT                   KRIHTFISTSPLHMKYKLRMEPDAVLEAVVRSVTLARDYTDDVEWSAEDGSRTEPDFLC
FT                   RCVEAAIRSGATTINIPDTVGYAVPEDIARIFTMLRERVPGADAVIFSTHNHNDLGLAV
FT                   ANTIAAIKAGARQIECTINGIGERAGNAALEEIVMAIRTRHDAVPYRNNIDTPRILRTS
FT                   KLLATITGFDVQPNKAIVGRNAFAHESGIHQDGVLKNAATYEIMTPESVGWQKTSLVLG
FT                   KHSGRAAFRDKLRALGYGEVGDNALNDAFRRFKDLADRKKLVYDEDIAALFDETVLRDQ
FT                   SRIRFVALEVWAGSKAKPRARLELEVDGEMKVHESHGDGPVDATFNAIRAICPHEAELK
FT                   LFTVGAVTEGTDAQAKCGVRLEENGKSVDGQGSDTDTIVAAARAYVHALNKLIVKRERK
FT                   EPAALTA"
FT   gene            complement(596575..597471)
FT                   /locus_tag="Acry_0535"
FT   CDS             complement(596575..597471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0535"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29759"
FT                   /db_xref="GOA:A5FVX7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVX7"
FT                   /protein_id="ABQ29759.1"
FT                   /translation="MSGFFEGFSESTADLGDGRHFRLRSGGSGPPLVMLHGMPQTHCMW
FT                   HRIAPALAARFTVICPDITGYGNSYKPAASADHEAYSKRRMAQDIVDLAAHLGIGRFAL
FT                   VGHDRGARVSHRLALDHPDRISRLALLDIIPTIEHFERTDMRFAMGYYHWFFLAQPAPL
FT                   PEDLINRDAGYWLLSQTARHKTARAVFDEAAMADYRRAMADPATVTAICEDYRAAATID
FT                   LEHDRESRARRERIAAPLKVLWGSRGLVGALYDPLEIWRGYASGPVEGQAIESGHFLAE
FT                   EAPEATLAALQEFLADG"
FT   gene            597678..599195
FT                   /locus_tag="Acry_0536"
FT   CDS             597678..599195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29760"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVX8"
FT                   /protein_id="ABQ29760.1"
FT                   /translation="MHLRRRRRHERSRHAHPVIAERDNDQRARRQTRRRPHHAGGRLHR
FT                   RRRKREPRDRRRPDRQRGGERPRPPPQRGGQRQPGEGQAEPHIAHLERLVAERRAQRQQ
FT                   AERRCREPRREQCPVIPPERPPPVVKDEDQQPGQPHPQHRRNRHCEGGRHLAGQGAEQR
FT                   AGLVPRQRAQRRGEAKRWKLPPPRPRLGEKKPQPRRQERRPAQRRRQPHSPLPPRHPGQ
FT                   PETHRNRGKAGEVIAETRGPQQRAGAKPGAGAAAARRVDRQQRPRHRAERRQREIPRHD
FT                   AGIGEAVEQRRDRDREGRADAHPQGDPPEQRQRAQRLHDREQPQPEQPDPERVAPERQQ
FT                   PEIQRRMHIAPPQARRNRAEPRMAAIERPRRAGAEGQGGPVRPRMPGNEEDGIELVILA
FT                   AAAPRDRDEQDRGAAQRGRKAGRAHGFSSGLTPNSNHRLLFLATRSEHVPQPEPARRQH
FT                   QRRHPQQRAARKPRMRNAGEGVEPLGAAGHRLGHQPARKPGQRHAMS"
FT   gene            complement(599010..600269)
FT                   /locus_tag="Acry_0537"
FT   CDS             complement(599010..600269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0537"
FT                   /product="gamma-glutamylputrescine oxidase"
FT                   /note="PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29761"
FT                   /db_xref="GOA:A5FVX9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVX9"
FT                   /protein_id="ABQ29761.1"
FT                   /translation="MALSNYYETTARYDATTAPLEGDLRCDVAIIGAGMTGCSAALHLA
FT                   ERGYRVVVLEGERIGFGASGRNGGQVLPGFAADLGKLRRLAGDSVAKALWEMSIEAVDL
FT                   VHAQIARFAMPCDPRRGYLHVAVKDRQVGELEAWQRELEALGLEGFRLLRGAALQERLR
FT                   SPRYLAGLLDPVAGHIHPLNYTLGLAHAAMAAGAVIHTGTRVASITSGDEVVLKTARGS
FT                   VRAGHLLICGNAYLGTLVRPIAGYVMPVGTYIVATEARADVRDLIPHDEAVADLNFVLD
FT                   YFRRSADDRMLFGGRVSYSTLPPPNLGAAMLARAKRAFPQLADARAEHVWGGNVAITRN
FT                   RLPHFGRLGRNVLFAQGFSGHGVALTGLAGRLMAEAVAGRAERFDTFTRIPHARFPGGP
FT                   LLRMPTLVLATSWFRLRDML"
FT   gene            complement(600275..601615)
FT                   /locus_tag="Acry_0538"
FT   CDS             complement(600275..601615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0538"
FT                   /product="Glutamate--putrescine ligase"
FT                   /EC_number="6.3.1.11"
FT                   /note="PFAM: glutamine synthetase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29762"
FT                   /db_xref="GOA:A5FVY0"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVY0"
FT                   /protein_id="ABQ29762.1"
FT                   /translation="MTDLAEWFNEHRITEVECLVPDITGIPRGKIMPAQKFLRGGAPRL
FT                   PESIFIQSVTGEYPEDPEDTLTDPAIIDINLIPDPATVRLVPWAHEPTAQIIHDCQYSN
FT                   GRPVTIAPRQVLRHVLELYKERGWQPVLAPELEFYLVGRNTDPDYPLVPPVGRSGRQET
FT                   GRQSYSIDAVNEFDPLFEEMYDFCEMQELDLDTLIHEEGAAQVEINFLHGDPLNRADQV
FT                   FLFKRTVREVALRHDMYATFMAKPMGQEPGSAMHVHQSVVDLETGRNLFADQDGRPSQL
FT                   FLSFIAGLQKYIPAIMPIFAPNVNSYRRLTRFSNAPINLQWGHDNRTCGLRVPYGEAGA
FT                   MRVENRVPGADANPYLAFAASLACGYLGMMEGLTPTPAFRGSAYSQPYSLPRELSHALE
FT                   MMEQARPLIDILGQKLVEVFVAVKRLEYETYLRVISSWEREHLLLNV"
FT   gene            complement(601751..602827)
FT                   /locus_tag="Acry_0539"
FT   CDS             complement(601751..602827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0539"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29763"
FT                   /db_xref="GOA:A5FVY1"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVY1"
FT                   /protein_id="ABQ29763.1"
FT                   /translation="MKGLMGKIAGGALAALIAIGGGAPAAHAAGKTLYLFNWQDYIGKG
FT                   LIKKFEAYCGCNVVQTYYDSNSELDAKLRAGGDSQYDVVVPSSYYIPQLVQQGLIRKLD
FT                   KSKLPNFKNLLPRFQNVSYDPHDTHVVPYQWGTIVIGYNKDKIKNPPESWAALFDPKYN
FT                   ASYPFSMMKGSGRDLIGAACAYLGEGFACKTKAAWIKAAKLIEKQVKRPNFSGFVDGDP
FT                   TMQQLKKGVVAIGMTWSGSVAQCYADKTCLNIGWILPKEGSEAWVDNMAIPTHAPNPEL
FT                   AYKFINFILGAKEGAELSNFNMYPSPNAASEPYLDKAIKQPLVTPTAAQMKRLSFLPAL
FT                   TPAQAKEFGAIWTAVRQH"
FT   sig_peptide     complement(602741..602827)
FT                   /locus_tag="Acry_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            complement(602900..603742)
FT                   /locus_tag="Acry_0540"
FT   CDS             complement(602900..603742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0540"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29764"
FT                   /db_xref="GOA:A5FVY2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVY2"
FT                   /protein_id="ABQ29764.1"
FT                   /translation="MMAISMGKSTRRSLLAMSLPVYLLLYAPLLLIAIFSFAPPPLAKG
FT                   QTFYWYADLLHSPEVIAAFRRSLTLAIGSSILGTALGTLMGFGLYRYRDRNATGIASAL
FT                   PSLIIYTPIIMPSLVFGISELIFFSFIHSATGFLAAGLLTMGIAHVTFEAPFVALVVFA
FT                   RLSGLDPNMFEASHDLYADARQSFLHLTVPVIRPAIIGGFLLAFTLSIDDFTISFFTAG
FT                   PGSTTLPIYIYSAVARKGVSPDINALATLMIATVIGTGLLQYMFTRNRARKLVARPGD"
FT   sig_peptide     complement(603611..603742)
FT                   /locus_tag="Acry_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.985 at
FT                   residue 44"
FT   gene            complement(603750..604682)
FT                   /locus_tag="Acry_0541"
FT   CDS             complement(603750..604682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0541"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29765"
FT                   /db_xref="GOA:A5FVY3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVY3"
FT                   /protein_id="ABQ29765.1"
FT                   /translation="MSATTADARRGSAARAERLGRALRLWVTAGPGLTWIVLFLVLPSA
FT                   ILLGIGFFTSGSYGGPELPLTLQPLREVAGYSILGWSSGNITVLVRSLIQAMSAGVLTV
FT                   LFAYPVVFYIVTRPPAARPLLLLFIVLPSWTNQVVRTYAWMELLGPESALSHLVQSLGL
FT                   LQPHLGLFPGVLAMQIGLTYNYLPYMVVPLYAAAEKLDWALVEAGRDLYASGPRLFWNT
FT                   VFPQTLPGLLSGIILVVIPAFGDYVVPTLLGGGKSMMIGSLIASQFLETPNWPYGAALT
FT                   IFMLVFTCAGLLAFRVLSKRLGGAEESMM"
FT   gene            complement(604679..605812)
FT                   /locus_tag="Acry_0542"
FT   CDS             complement(604679..605812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0542"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="TIGRFAM: spermidine/putrescine ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related; TOBE domain
FT                   protein; Transport-associated OB domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29766"
FT                   /db_xref="GOA:A5FVY4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVY4"
FT                   /protein_id="ABQ29766.1"
FT                   /translation="MAGPVVSAAMKPHDAASEPAVADRRGQIVLEDISRVFAADVVAVD
FT                   RINLVIHRGEFFTLLGPSGCGKTTLLRMIAGFETPDSGRILVSGREMQAVPAHRRPVNT
FT                   VFQSYALFPHLTVAENIAFGLRMRGVAKAERRERTRRIMELLQIDAFANRNPAQLSGGQ
FT                   RQRVALARALVNEPEVVLLDEPLSALDAKLRAELQVELMRMQKRLGMTFIFVTHDQHEA
FT                   LVMSDRIGVMQRGRLLQVGPVLDVYERPSSVFVAEFLGLSNIWPVTALPGGLIDTPLGP
FT                   LAIGNPDPASGTAMIRPEKIWMYSESGAPTGRPNMVAGVVREAIYMGASTQYRVELENG
FT                   APLLVYDTNNQAAERSWRPGEAVTCELKPENIVLIGS"
FT   gene            606176..607291
FT                   /locus_tag="Acry_0543"
FT   CDS             606176..607291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0543"
FT                   /product="L-alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="TIGRFAM: alanine dehydrogenase; PFAM: alanine
FT                   dehydrogenase/PNT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29767"
FT                   /db_xref="GOA:A5FVY5"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVY5"
FT                   /protein_id="ABQ29767.1"
FT                   /translation="MLIGVPREIKNNEFRVGLTPASVRELHANGHRVLVETGAGEGIGM
FT                   DDAAYVRAGAAIAADAATVFAEAEMIVKVKEPQPEECRRLRPGQILFTYLHLAPDPEQA
FT                   KLLMQSGAIAIAYETVTDAQGRLPLLAPMSEVAGRMAVQVGAVSLQKAAGGFGVLLAGV
FT                   PGVPPAHVVVLGGGVVGTNAARIALGMGADVTILDKSIARLAQLDDLYGPRLKTMFSTT
FT                   EALEQTVFNADLVIGAVLVPGASAPKLVTRDMLGHMRRGAVLVDVAIDQGGCFETSKPT
FT                   THDNPTYVVDGVVHYCVANMPGAVPRTSTFALAQATLPYALRLAGQGWREALRADPHLR
FT                   AGLNVANGRIVHPAVAAALGHDLLPVEQVLA"
FT   gene            607294..607905
FT                   /locus_tag="Acry_0544"
FT   CDS             607294..607905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0544"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2,
FT                   conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29768"
FT                   /db_xref="GOA:A5FVY6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVY6"
FT                   /protein_id="ABQ29768.1"
FT                   /translation="MDADAPEPPDPPDPSDPATAADAGVGARLRRMRQIFGLTQRELAR
FT                   RAGVTNGAISLIEQGRVSPSISSLKKILDGIPMSLAEFFTLDLTAPEDVFFTAADLTEI
FT                   AFDERISFRMVGRRLKDRALQMLHETYSPGADTGEAMLRHEGEEAGVIIRGRIVVTVGD
FT                   QERTLGAGEAYYFRSRIPHRFRNPFDEVCEVISANTPPSF"
FT   gene            608158..609534
FT                   /locus_tag="Acry_0545"
FT   CDS             608158..609534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0545"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29769"
FT                   /db_xref="GOA:A5FVY7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVY7"
FT                   /protein_id="ABQ29769.1"
FT                   /translation="MSDQTIAFDWQAADAAHHLHPFSDHKSLHEGRVRIITGGDGVWLT
FT                   DDQGRRVLDAMAGLWCVAAGYGREELVEASAAQMRALPFYNTFFKTSTRPVIALAERLA
FT                   AMAPGDLNHAFFACSGSEAVDTALRMARTYWITRGKPAKRIVIGREYGYHGSTTLGAAA
FT                   GGMKDMHRQGAALPDFAHIMPPYWYGRGSQMDPAEFGVHAARALEAKIAELGADNIAAF
FT                   IGEPIQGAGGVIIPPATYWPEIQRICRENDILLIADEVICGFGRTGRMFGCETFGIQPD
FT                   MMTLAKAITSGYAPLSAVMVGDRVAEVLINETGEFYHGFTYSGHPVSCAVALANLDIIE
FT                   REDLAARAAASGEILRERLHAALDDLPIVGEIRGVGLIGAIELTADRRTRRPFEKTGRV
FT                   GTICRDHCFANDLVMRAVRDTMVFAPPLIIGEAEIDDMVARARRAITATMDEVRGEMAV
FT                   "
FT   gene            609536..610897
FT                   /locus_tag="Acry_0546"
FT   CDS             609536..610897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0546"
FT                   /product="glutamate--putrescine ligase"
FT                   /note="PFAM: glutamine synthetase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29770"
FT                   /db_xref="GOA:A5FVY8"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVY8"
FT                   /protein_id="ABQ29770.1"
FT                   /translation="MDAMAASADRRALLADCELIEAFIIDVNGVPRGKWLQRDRADALF
FT                   TGGVALPRSAYLLDIWGRDIVEGGIAFDTGDPDGKCFAVPHSVAIMPWAEGRAAQALLT
FT                   MQEPDGSLFYADPRGVLSRVIDRLAARGLTAAVGIELEFYLLDPNRTGGQRVAPRGADE
FT                   SHWRGWQTDTLGLWEIHDYEPVLRDLLRAADAQSIALDTLISENGPGQFEVTLHYAADA
FT                   LRMADDAVLFKRSVKHIARKHGLAATFMAKPFGNWAGSGMHVHVSLLDRAGRNVFTGDA
FT                   ARAAPALYHALGGLVAAMPDTMLTFAPHANSYRRFAPGTHAPVFGDWGHDNRMSSIRVI
FT                   NADPAAARIEHRVAGADCNPYLVLAALLGAMDKGIGEGADPGEETFGDKVAATAPRLPI
FT                   AWSQATERFASSPLTRAIFGESFQSIFAACKRQEIAEFRRRISDVEYDAYLKNA"
FT   gene            complement(610910..611998)
FT                   /locus_tag="Acry_0547"
FT   CDS             complement(610910..611998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0547"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29771"
FT                   /db_xref="GOA:A5FVY9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVY9"
FT                   /protein_id="ABQ29771.1"
FT                   /translation="METVIPRKLRPDGRGTRLDPPNRFETVRQDAFDDGWGTLDEAPPP
FT                   PATVLIRDATKSVISRNDSPDLGFDRGLNPYRGCEHGCIYCYARPTHAWIGMSPGLDFE
FT                   TKLVFKPEAATLLERELSRKGYQAAPIVLGSNTDPYQPVERQLRLTRAVLEVLERFGHP
FT                   VSIVTKSAGVLRDVDILGRMAARNLARVHLSVTTLDARLARAMEPRAAAPGRRLDAITG
FT                   LKAAGIPVGVLAAPMIPGVNDAELERILEASAKAGASCASAILLRLPHELGALFEDWLK
FT                   RTMPDRAAHVLSLIRQTRGGALNDAAFGSRFRGTGAYAALLRARFHRAARQFGLSDAPP
FT                   PLDCGQFAKPPAKAASAQLSLF"
FT   gene            complement(612087..613529)
FT                   /locus_tag="Acry_0548"
FT   CDS             complement(612087..613529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0548"
FT                   /product="mannose-6-phosphate isomerase, type 2"
FT                   /EC_number="5.3.1.8"
FT                   /note="TIGRFAM: mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; PFAM:
FT                   mannose-6-phosphate isomerase, type II; Nucleotidyl
FT                   transferase; Cupin 2, conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29772"
FT                   /db_xref="GOA:A5FVZ0"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVZ0"
FT                   /protein_id="ABQ29772.1"
FT                   /translation="MPDQTQARDAGIVPVILAGGTGTRLWPVSRKSYPKQFWPLISSRT
FT                   MLQETASRAQGELFAAPIVVANDEHRFIVAEQLRGSGHTGARILLEPVGRNSAPAIAAA
FT                   AFLVAEGDPDQVMWIMAADASIADAAALGQALGIAAAAAREGHIVTFGMRPSVAETGYG
FT                   YIEQGEALAGHHGAFRIARFVEKPDAATAATLIADGRHYWNSGMFVATARTMLSEMERL
FT                   APEVARSVRAAFDTRRPDLDFIRLDAEAFRGSPEISIDYAIAEKTDRAVVVPASLGWSD
FT                   VGSWSAIWEIAEKDAAGNAALGDAVIEDSTGCYVRSDGAVTAVLGLENTVVVTTPDAVL
FT                   VAHRDKAQNVKRVVDALKRLKRPEAEDHNRVYRPWGFYESLIQGDRFQVKRIVVMPGAK
FT                   LSLQKHFHRAEHWVVVAGSALVTRDEETLLVRENESIYLPLGCVHRMENPGKIPLTLIE
FT                   VQSGSYLGEDDIVRFEDTYGRS"
FT   gene            613615..614403
FT                   /locus_tag="Acry_0549"
FT   CDS             613615..614403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0549"
FT                   /product="Uncharacterized protein putative amidase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29773"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVZ1"
FT                   /protein_id="ABQ29773.1"
FT                   /translation="MEKTGLDDLTSAELRALLPRRPLVLLPLGSQEDQGAHAPMGDFRL
FT                   AAALAGRIARAATEAGTLTLAAPALPFGAADHFGAVPGGLALAPATFRAVLADLIADLR
FT                   RTGLDRIVILNGHGGNAPLVHEVTLSIRRAGGPIIPSFYLWKVARRLMERRIGPAAGRF
FT                   GHGAEPLASITLALRPDAARPDLAVKPAPGARLLGCPVIGFGTIGFEDVEIDAPAEYPE
FT                   IAPSSATADATGADPALGAAVIADLIALAVRFCAHVASLT"
FT   gene            614400..615323
FT                   /locus_tag="Acry_0550"
FT   CDS             614400..615323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29774"
FT                   /db_xref="GOA:A5FVZ2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVZ2"
FT                   /protein_id="ABQ29774.1"
FT                   /translation="MSVVPAWIPITIAAALFQVWRTALQARLRGALSAPAAGFVRFVYA
FT                   LPADILLLGAALFLLRRSLPAIPPAFVLDCLAGGVAQIFGTMLLIMAFGHRNFVVGTAY
FT                   AKTEAAQLVIFSVLVLGVRIPPEAIVGIMLAVAGVLALSFAGQKFSAADLLRASAQPAA
FT                   LCGLGSGFSFAVTAILLRNATLTLGADTPVLLKALLTLTVTNALQTLAQGGFMALRNRA
FT                   ELAKCFTLWHRAAPVGVLSAFGSGCWFAGFALTNVALVRGLGQIEILFTLAVGHFFLRE
FT                   RTKRGEITGLVLVGLGVVLIAAAGIG"
FT   gene            complement(615354..616049)
FT                   /locus_tag="Acry_0551"
FT   CDS             complement(615354..616049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0551"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29775"
FT                   /db_xref="GOA:A5FVZ3"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVZ3"
FT                   /protein_id="ABQ29775.1"
FT                   /translation="MTVALIVAAGRGHRLGGPIPKQYRLLDGVPILRRTAEALRRHASM
FT                   RAVFVVINPADRALYDEAMSGLGLPEPVAGGASRQESVRNGLEAIASVAPERVLIHDGV
FT                   RPFVAPDVIGAVIGALDRVPGAVVGVPVTDTLKRCSGAIVTGTVDRADLWRAQTPQGFR
FT                   YDAILGAHRLAQTAHRGRDFTDDCAVAELAGLAIEMVPGSEENFKITTEADLLRAEALL
FT                   RERARALAG"
FT   gene            616305..617255
FT                   /locus_tag="Acry_0552"
FT   CDS             616305..617255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0552"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="PFAM: UDP-3-0-acyl N-acetylglucosamine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29776"
FT                   /db_xref="GOA:A5FVZ4"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVZ4"
FT                   /protein_id="ABQ29776.1"
FT                   /translation="MMYAAAQFHGHVAPGQDVPVPRRGLRAAISCRGVGLHGGQEVNLR
FT                   FAAAEPGSGIRFRRTDLGVTIPARHDLVADTRLCTVLADPARPEARIGTVEHVMAALAG
FT                   LGIDDALVEVDGPEIPILDGSAAEFVFLLNCSGIVETGLPRDIIEIRRPVRVSDGSAFA
FT                   ELRPAAQGEYGFSAALQIDFPARAIGRQALSLEITPESFAAELARARTFTMKQDIDRLR
FT                   EAGLALGGTLANAVVVDGDEVINPEGLRSPDEFVRHKLLDVVGDLALAGAAIRGRFVGA
FT                   RTGHRLNNLLLRALFADRANYRFAGVAEPDLAAVA"
FT   gene            complement(617296..618939)
FT                   /locus_tag="Acry_0553"
FT   CDS             complement(617296..618939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0553"
FT                   /product="ABC transporter, transmembrane region, type 1"
FT                   /note="TIGRFAM: ABC transporter, transmembrane region, type
FT                   1; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29777"
FT                   /db_xref="GOA:A5FVZ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVZ5"
FT                   /protein_id="ABQ29777.1"
FT                   /translation="MTDSVLAPLLRVILIWRRQAPAIVFGALVALASLAAGIALMAAAG
FT                   HYIAAAALGITLAVPVALEVTGVARVVLRYLERLTTHDATFRALAALRLWFYRGLARSA
FT                   AGGLGFRRSGDVLARLVNDIEALDGVLLRLLIPLLGAAMLVPALLVAVGRDDDTAAALV
FT                   LVLFAVVAFVMPWRAMLAARAAAADETEAGGALRVSVLDTLTGLREIKVYEAEGRMLAG
FT                   VQWQESRLFRAERDLAARGGALQGLAFLATQAALLAVLLIHGANPVAVVVAVFVVVAAF
FT                   EVVGGMPRAGVTAGRASAAASRVLQAAEAEPRVRDPARPAPMPGSNALAFEHVAFRWTP
FT                   EGQAVFEDLSLDIPAGSRIAVLGPSGAGKSTLAALALKLVSPDEGQIRLGGTDIATLRS
FT                   ADVRRRIAWLSQTTHLFADTIRNNLLIGRDDADDDALWAALEAARIADMVRALPDGLEA
FT                   WVGEQGSQFSGGQGRRLALARTLLSPAPILILDEPCSGLDLETERAFLATLNNTLEGRT
FT                   VLMITHRLTGVERLDRVYRLQNGRLTPAAR"
FT   sig_peptide     complement(618832..618939)
FT                   /locus_tag="Acry_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.290 at
FT                   residue 36"
FT   gene            complement(618939..620654)
FT                   /locus_tag="Acry_0554"
FT   CDS             complement(618939..620654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0554"
FT                   /product="ABC transporter, transmembrane region, type 1"
FT                   /note="TIGRFAM: ABC transporter, transmembrane region, type
FT                   1; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29778"
FT                   /db_xref="GOA:A5FVZ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVZ6"
FT                   /protein_id="ABQ29778.1"
FT                   /translation="MKWANCLYVASMARQSSPAKQWIRQEIRLGGRRARLAIGLGVASV
FT                   LVAIGQIACAAGLLAAAIAPGRLPTALLGLGFVTAALVRAALIVGQEHEASRLGIAARR
FT                   RLRSDTLGRLMSAGPGLLRGRHSAELSIIVVDRIEAMNGLHGRWLPAARLAAIGPALVA
FT                   LAAAIADWRSGVILACAGLLVPMFMAITGIGTGVAARRQFTAMTRLQTRFLDRVRGIAT
FT                   IVLAGRAETEAAALGRAADELRLRTMRILRVAFLNATALDLLAAAALVGIAIRFAGPLL
FT                   AGQTALAPTALFCVLLVPEFFAPFRAFSAVYQDRMTAQTAAEDLVGLPEPAVAAVPPDA
FT                   IRNVPAQGITIAFEGVGFAWDQERGPVLRDLSFQLPAGETMMLVGPSGSGKSTIIELLL
FT                   GYIRPQSGRITLNGAPIETIVPTALARMTALISQRPVLFAGTIEENIRLGRPEASEAEL
FT                   LEAVRLARVNEFAERLPEGLATRIGEGGYGLSGGQAQRIAIARAFLKDASLLLLDEPTA
FT                   QLDPATEREVVESLKRLAIGRTVVLASHAAFAHEFSGRKLDLGAAQTARLEGVA"
FT   gene            620823..621659
FT                   /locus_tag="Acry_0555"
FT   CDS             620823..621659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0555"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="TIGRFAM: pantoate--beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29779"
FT                   /db_xref="GOA:A5FVZ7"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FVZ7"
FT                   /protein_id="ABQ29779.1"
FT                   /translation="MQIVRNVPDLRAARAALTDGGRARLALVPTMGALHEGHLSLVRAA
FT                   REAGHVVAASIFVNPTQFGPNEDFTRYPRDPERDCALLAEAGCALAWLPEVSTMYPPGD
FT                   ATSVEVAGLSVVLEGAVRPGHYRGVATVVVKLLGQVRPDAAYFGEKDWQQVQVIRRVAA
FT                   DLFLPVEIVVGPTLREKDGLAMSSRNRYLDPADRARAPLLHQVLRRVRAALRDGEPAAA
FT                   ALAAGRRALAEGGFIVDYLELVDAGTLAPLTAPDDGARLLAAARLGTTRLLDTVAV"
FT   gene            621759..622676
FT                   /locus_tag="Acry_0556"
FT   CDS             621759..622676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0556"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29780"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVZ8"
FT                   /protein_id="ABQ29780.1"
FT                   /translation="MEQRRLSLPQSPDLQPSSGLMPVQSRRPVAGRTESERRERASLRR
FT                   LEAGEQRKRAARLAEALRNDSFVLRYLPRLDLASPGDGFVSAELWLGLPNRRRGLMPVA
FT                   PLLRGIDRAPLRHEMLCHTLRIAAEELACGPPRWQISVPMSGHALADGLIGEVALQTLD
FT                   PLGIEPHRIDILIDEAELVIGGDLLQQQIASLREAGIGVTLEGFGNAFGGLALLSRLPF
FT                   TGLKLDRRLAHALVNDPAGPDVVLIRAAIDIARRYDVLVSIDGIETETELQKARELGIG
FT                   QAQGPWVGPALPADVMRARLRLNG"
FT   gene            622728..623060
FT                   /locus_tag="Acry_0557"
FT   CDS             622728..623060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29781"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR021660"
FT                   /db_xref="UniProtKB/TrEMBL:A5FVZ9"
FT                   /protein_id="ABQ29781.1"
FT                   /translation="MTVVPHSARPSAPATPDEAGRAIRATLADRRPGASICPTDAARQI
FT                   AAARGETAPDAWRRHLAAVRRAAGDLARRGEIIILRKGRAVDPDAMRGVIRLRLPGVEA
FT                   ETTEET"
FT   gene            623060..623542
FT                   /locus_tag="Acry_0558"
FT   CDS             623060..623542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29782"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW00"
FT                   /protein_id="ABQ29782.1"
FT                   /translation="MAVGILPLLLSLIFPACGKAGAAGVKPPGFVDFTHLTLPSSPNKA
FT                   LAAPAGFIPKPAFDTPRYALPPAALYALVARVAGAEPRTYTLDAFPDRLQQAWVARTPA
FT                   ANFPDVVIAQIRPDPAGGSDLILYSHSIYGYSDFGTNAARLQRWLSAIGRAAEAHP"
FT   sig_peptide     623060..623128
FT                   /locus_tag="Acry_0558"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.950 at
FT                   residue 23"
FT   gene            623539..625305
FT                   /locus_tag="Acry_0559"
FT   CDS             623539..625305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0559"
FT                   /product="ABC transporter domain protein"
FT                   /note="PFAM: ABC transporter related; SbmABacA family
FT                   protein; ABC transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29783"
FT                   /db_xref="GOA:A5FW01"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW01"
FT                   /protein_id="ABQ29783.1"
FT                   /translation="MKFLRAVGAALADAWRLAKPYFSSEERWAALALLGTIIALNLISV
FT                   YLNVLFSYWYKIFYNALQAKDAAGFWQSIFTYKMIKGYPWFVPGFTEIATFNILVGVYA
FT                   FYLQQMLEIRWRRWITENFVTDWLGNRAHYQLSLKAEAGSPLDNPDQRIADDLRSFVSN
FT                   NLSLGISFISNIVNLLSFIFVLWFLVPPLHLLGLVIPGYLVWIAIIYSLVGTYLTHVIG
FT                   WKLIPLSFQQQQVDADFRFNLIRVRENTEQIALYGGEAEEGVGLKQRFHAIYLNWWKIM
FT                   KRTKALNFFTIGFSQVAIIFPILIAAPGYFSGLFTLGLLLQINNIFGNVQGSFSWFVSS
FT                   YPQLVGWRATVQRLDGFERAVKLAHAHRPDHVAVAADAALHAEDLTVSLPDGRELFAGA
FT                   NLAIERGEPVVITGPSGTGKSTLFRALAGIWPFGRGRVSRPSGTAMFLPQKPYFPLGSL
FT                   KRAVAYPQQEYDVDDEAVRAALDDVGLGGLGLRLEHVDNWSLRMSGGEQQRLALARVLV
FT                   AKPDWLFLDEALSALDEEAAASLFAMLRARLPATQIVSIAHHDSVIRLHPRRLRVRRGE
FT                   GGHARVDEAETA"
FT   gene            625321..626247
FT                   /locus_tag="Acry_0560"
FT   CDS             625321..626247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0560"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29784"
FT                   /db_xref="GOA:A5FW02"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW02"
FT                   /protein_id="ABQ29784.1"
FT                   /translation="MNERMPSPRPMALFGHRGARGLLPENTLEGFASIAALDLTGAEFD
FT                   VGLTADGVAVVHHDPRLNPDIARDADGAWLAPDAAPLLRERTLADLGSFDVGRLRPGSD
FT                   YAARYPEQTPADGARIPTLDAVIAALSGRDLLIEVKTFPDRPGLTAPPERIAQAVIACL
FT                   NRHDALDRAVLFAFDWRVLRAAAAAAPALRRCCLTEPETVSAGPLWLDGCDLGAFGGNL
FT                   PRAVAATGAVCWAPFHATLEEDDVREAHALGLAVLPWTVNAPEAFDRMIRLGVDGMISD
FT                   RPDLARAAIGRAGLQVAGPGFVAAMAR"
FT   gene            627119..628165
FT                   /locus_tag="Acry_0561"
FT   CDS             627119..628165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0561"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29785"
FT                   /db_xref="GOA:A5FW03"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW03"
FT                   /protein_id="ABQ29785.1"
FT                   /translation="MNELKERSENRPAVSRATPVDGSRRSRRPFIILVLVLLGLAGASL
FT                   VYWWRTRDFASTTDAEIDGSIHQIAPRISGQVVAVLVKDNQHVVRGQLLVRLDDGTQKV
FT                   ALDRAEAERAQAQAQLGAREADLAEARANVEVADATLFRAKRDEARYAKVDPRAVTPTT
FT                   RDAIAADLRAAVARTDAARQQVKAAQAAVAAADAAVKAAGVAVENARLELGYTEIRAPV
FT                   SGWVAKKTVRTGNVVGAGTAMMAVVGDHVWVTANYKETELGAIRPGQSVNVYVDAVPGV
FT                   AFHARVASIQHGTGSIFSLLPAENATGNYVKVVQRVPVRIEFDDSRISRYLLAPGMSVE
FT                   PYIRIRGK"
FT   gene            628162..629712
FT                   /locus_tag="Acry_0562"
FT   CDS             628162..629712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0562"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29786"
FT                   /db_xref="GOA:A5FW04"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW04"
FT                   /protein_id="ABQ29786.1"
FT                   /translation="MSLLYASRPNTPRSAAGLYNPWLIVAMVALAPFMEVLDTTIANVA
FT                   LTHIAGSLAVSPDESTWVLTSYLVSNSIILPITGWLQDVVGRKRLFLICVALFTASSVF
FT                   CAVSTSLTMLIVARVLQGLGGGGLQPITQSMYADSFPAEKRAQVFAVFGLVIIVAPATG
FT                   PILGGWLTDHLSWHWVFLINLPIGLIAFTLIAIFVDEPELLVRERAARLAGGLRFDWLG
FT                   LLLVAVGFGALQIFLDKFSIDDGFGSFFIRSLFAVWAVSLSTLVVWEWGHPEPVVNVRL
FT                   FAHRNFAISCLVMFVIGFILLSTTQLLPQLTQTLMGYSSETAGFALALGGLATIGLMPL
FT                   AGVVTGRIIPARVLLVGGLVETGIALIFQSHLAPNASFYTISIDRVLQVIALPFLFIPI
FT                   SALSYVGLPPARNGDASAIINQVRNIGGSIGISFVTTLLAWRTQFHHARLAESVTPYAS
FT                   LHGQTLSQIGAAVQHQAAFMSYLDLFHILGLMALLVWPVVLLLSTPSSPAAEGVVYEI"
FT   gene            629702..631261
FT                   /locus_tag="Acry_0563"
FT   CDS             629702..631261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0563"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29787"
FT                   /db_xref="GOA:A5FW05"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW05"
FT                   /protein_id="ABQ29787.1"
FT                   /translation="MRSEVFAPRLRRRALMGTAMLAAMALGGCELGPNFHAPRTRTAAS
FT                   FLANRPALTSPDTVSQGKVDLAWWQSFDDPALTTLEHEAIARNLDVKAATERLAEAEAQ
FT                   AQIEGAALYPNLNFSGSYTREKPSNKGVFTALSGGGSTSTSTNAGSTASGSSTSIGGGG
FT                   LPGSELQPFNLFQYGFSSVFDFDLWGKNRRAVEASLAAVQASRDARRAVLLNTEAEVAH
FT                   DYINLRAQQAVLAITRRNLASAEHIANLTRQREQAGLANALDVADAQAQAESVRAQIPT
FT                   LRTAIAADINQLSLLLGEGPEALRAQLVTAKPIPPVPPVVPIGLPSQLLQRRPDIREAT
FT                   ARLHQATAEIGVATASFFPDISLAGSVSLQALQFSNLNQLSAVTYAIGPQITMPLFEGG
FT                   RLRGELHLRKAQQREAAVNYAKTVLTAFHQVDNALTAYDEEQKTQAALQADVTQTRRAL
FT                   SLAQERYREGLIDYLQVLTAQQSELAAEQAQAQSQAKISTDLVSLYQALGGGWEQNEPA
FT                   AG"
FT   sig_peptide     629702..629788
FT                   /locus_tag="Acry_0563"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.919) with cleavage site probability 0.640 at
FT                   residue 29"
FT   gene            complement(631266..632279)
FT                   /locus_tag="Acry_0564"
FT   CDS             complement(631266..632279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0564"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29788"
FT                   /db_xref="GOA:A5FW06"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW06"
FT                   /protein_id="ABQ29788.1"
FT                   /translation="MGMMESIPFSVLDLAPVPDGATPGDALRNSIDLARHAEALGFNRY
FT                   WLAEHHNMPGIASAATSVVIAHVAQATTRIRIGSGGVMLPNHAPLVIAEQFGTLAALHP
FT                   GRIDLGLGRAPGTDPRTAHALRRNMEGTEARFIEDVIELQSYFQPAAAEQRVRAVPGEG
FT                   LDVPLWLLGSSTFSAELAAALGLPFAFAAHFAPDLLGAALTLYRTRFQPSARLAKPHAM
FT                   ICVTVCAAPDDGEAEFLFTSQQRAFVNLRRGQPGLLPRPAPLDGFWSERERAGVEHALA
FT                   YAMVGGPARVAAKLAGFVAEFRPDELMIACQIHDHAARRRSYDIVREIRGGLSKAA"
FT   gene            complement(632365..633594)
FT                   /locus_tag="Acry_0565"
FT   CDS             complement(632365..633594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0565"
FT                   /product="isocitrate dehydrogenase (NADP)"
FT                   /EC_number="1.1.1.42"
FT                   /note="TIGRFAM: isocitrate dehydrogenase, NADP-dependent;
FT                   PFAM: isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29789"
FT                   /db_xref="GOA:A5FW07"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW07"
FT                   /protein_id="ABQ29789.1"
FT                   /translation="MAKIKVKNPIVEMDGDEMTRIIWGFIKDKLILPYLDVDLKYYDLG
FT                   IENRDATDDKVTVDSALATKEYGVAVKCATITPDEARVKEFNLKQMWRSPNGTIRNILD
FT                   GTIFREPIICANVPRLVPHWSQPIVIGRHAYGDIYRAAETKIPGPGKVQLSYIPADGSK
FT                   PLILDVHDFKGPGVALGIHNTKASIEGFARASFNYGLARNYPVYLSTKNTILKAYDGMF
FT                   KDVFQEIFDAEFKAEFDKRGLTYEHRLIDDMVASALKWNGGYIWACKNYDGDVESDIVA
FT                   QGFGSLGLMTSVLMSPDGKTVESEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLA
FT                   YRGKFDETPEVTEFAETLERVCVETVESGFMTKDLALLISKDQPWMTTQDFLAKLDENL
FT                   QAAMAKRQAA"
FT   gene            633710..634438
FT                   /locus_tag="Acry_0566"
FT   CDS             633710..634438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0566"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29790"
FT                   /db_xref="GOA:A5FW08"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW08"
FT                   /protein_id="ABQ29790.1"
FT                   /translation="MTSGLGHATDWDRDAALTAARILLEIRAVNFRPEEPYTFTSGWKA
FT                   PVYIDCRKIIYFPRARAKICELGVEKLYRHVGFETIEAVAGGETAGIPYAAWMADRMGL
FT                   PMAYVRKKPKGFGRNAQIEGDVPEGRNTLLVEDLTTDGGSKIHFANALREAGAICNHVF
FT                   VVFYYGVFPGSLNTLAEMGMSLHHLCTWWDVLEACRGGDYFPEATLAGVRKFLEDPVAW
FT                   SAKHGGVASAEEAAAFKASK"
FT   gene            634908..636041
FT                   /locus_tag="Acry_0567"
FT   CDS             634908..636041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0567"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29791"
FT                   /db_xref="GOA:A5FW09"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW09"
FT                   /protein_id="ABQ29791.1"
FT                   /translation="MTESTAFYRERRAPLPPFSAILGTDQAERLAIGLTLISMALYLFC
FT                   LVAEWIGVSLNLVDATQSLWLTIVALGGEVAFYVLLRSGISRRWPDPTLSLPQMVFAIT
FT                   LLGAAYLINPQVRGELLMLAALVLEFGAFQLPPRRCRDLGWFAVAVFGVAMAIGATVSP
FT                   DRFDPRIEVFQFALMLAFLPVIAGIAGKLSQMRLDQKQQRRQLRDALKQVQILATRDEL
FT                   TGLPNRRHALELIERETARACRSGAPLCVAILDLDHFKRINDTFGHGVGDEVLRTFGRE
FT                   GRLVLRADNIFARWGGEEFILVMPDSTLIDAQTIVRRLREHMASPECWASCLRARTTFS
FT                   AGIAEFLVGETLDETFIRADAALYEAKKLGRDLTMTA"
FT   gene            complement(636115..638898)
FT                   /locus_tag="Acry_0568"
FT   CDS             complement(636115..638898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0568"
FT                   /product="glycoside hydrolase, family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase, family 3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29792"
FT                   /db_xref="GOA:A5FW10"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018905"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW10"
FT                   /protein_id="ABQ29792.1"
FT                   /translation="MRRMPLAALLSLSAILAVRAAHAAPQAAGCAWRNDHLSTARRTAL
FT                   LLHALTPGDETDLIAGAGTHEPYVFYTRGLKRFCIPPMGLEDGPAGVGDKLGGVTALPA
FT                   GVALAATWDPSLARRYGAVIGAEQKAKGTAVDLGPTVNIDRDPRWGRSFESLSEDPYLA
FT                   ARIGVAEIRGIQSTGVMAQVKHFAVYNQETYRNTPEDDVIVSPRALHEIYLPAFRAAVR
FT                   RAHVASIMCGYATIGGHESCGDKALLTGVLRADWGFRGFVTSDYQAIHATADAAAGADM
FT                   EQPFATYFGARLTQAVAAGKLARSVPETMTRHILAEMFRFRLFDHPPQGSTTAIVATRA
FT                   DRLAATRIAEAGTVLLKNDGNVLPLDPGHGGTIAVIGPAASIQPVYAGGGSANVVPMQP
FT                   VPPLAGIDHAPGMTRHVDYVAGLPADKALTPIPPSALSGPFRPTPLHGSFQAVLTAPET
FT                   GTYVLGITNPCHCYAPTDLSLDGRELLSDPGTPPVSTYSAAVQLRKGERYRLGVTGAAS
FT                   RLTWATPSTLRPDIARAVAAARRAAVAIVVVADDTESEAADRPDLDLPSAQNRLIEAVS
FT                   SANPHTVVVIDAGAPVAMPWLGKVAAVVDAWYPGETNGTALAAILFGKADPGGHLPVTF
FT                   PAHLADMPTAPVARFPGTGGRVDYSEGIDVGYRWYSAHHVRPLFPFGFGLSYTHFAFSD
FT                   LKVVSGPGDGTRPVVVSALVTNAGKVAGSDVAQLYLRFPRSAGEAPLKLVGFRRVRLAP
FT                   GQSKRLRFTVTPRQTWWWHGSGWTASPGTYRLYLGDAADDAHLAQRVSFPMPQTVGARN
FT                   VLVEAPEQAIPGQPVKVKVSLSAGGEATLRHVRLRLDAPAGWRVSAIGSAAGEGIQPGE
FT                   AVRATFTVTPPGWAAAGTYALRAVAQLGARHCTRGADAGCVTATRDSGAMITLAAR"
FT   sig_peptide     complement(638827..638898)
FT                   /locus_tag="Acry_0568"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            complement(638908..641184)
FT                   /locus_tag="Acry_0569"
FT   CDS             complement(638908..641184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0569"
FT                   /product="Cellulose synthase (UDP-forming)"
FT                   /EC_number="2.4.1.12"
FT                   /note="PFAM: glycosyl transferase, family 2; type IV pilus
FT                   assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29793"
FT                   /db_xref="GOA:A5FW11"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR003919"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW11"
FT                   /protein_id="ABQ29793.1"
FT                   /translation="MMRHLPALTNGLTFIVAAAVGFVLIAATLLPTTGPLPDIEQGVVF
FT                   GLLLILYNLDGGCRSRRKRPIVRISISALTILLTCRYLDWRLTDTLPFGFGTINIALGI
FT                   LLVLAELHGIGSAIMGQIINVLPLDRTPQHFTLDPASCPTVDILIPTYNEDPEIVETTV
FT                   IAATQIDYPASRFRVYILDDGGTDAKRAKPGAAGREAARRAETLREIARKFGAIYLTRP
FT                   ENVHAKAGNINHALGQIDGELILVLDCDHVPTRDFLSRTVGFFQADPKLFLLQTPHNFV
FT                   TPDPIERNLSTFEVMPAENELFYHVMQPGLDFWGAAFFCGSAAVLRRHVLDEIGGISGK
FT                   SITEDAETTVKAMCRGYRTAFYNRPMVSGLQPETFSGFILQRVRWAQGMMQIFMLDNVW
FT                   LKSGLTFMQRLLFTNFAFYWLFPISRSILLLMPPLFLFFGFNVAATTPRQLLVYALPYY
FT                   LAALVNSQYFYGRVRWPFISQVYETAQTVFLSAALVSVLRRPRAPKFKVTPKGEMLDKD
FT                   FISGLSWPFYWLFALACASLGIGLWRIVTQPQLRWALIFVVFWVVLDMIALLGVIGALA
FT                   ERRQTRTMPRIGCKGPAWMHRDGGGWVEAALHDLGRGGAGLVLAAGTEGPQPGDRVRLH
FT                   VPGLRGGLPAVVRHRKDGARNSIIGLQYVSDGVAEARAAVDRAFGDSELLVRNAALRHR
FT                   GTSIAYAFGFLFAIGLRGTARHFRILARDAAITLRVSRQRRALLASSRQAEENGGQKAR
FT                   LAPLS"
FT   sig_peptide     complement(641104..641184)
FT                   /locus_tag="Acry_0569"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.922 at
FT                   residue 27"
FT   gene            complement(641181..642311)
FT                   /locus_tag="Acry_0570"
FT   CDS             complement(641181..642311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0570"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="PFAM: glycoside hydrolase, family 8"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29794"
FT                   /db_xref="GOA:A5FW12"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW12"
FT                   /protein_id="ABQ29794.1"
FT                   /translation="MTDMARRNFLGLLGAAALTGGPVMMARELWQSSWRGYRHGFIDGQ
FT                   GRVIDYSANKGFSTSEGQSYGMFLSLVAGDRATFRRILNWTNTNMAGGRLGEVLAAWKW
FT                   GLHGGKWGVIGANSAADADAWMAYSLLEAARIWKDHNLGAEGHKLATRIADDESVAING
FT                   FGRVLIPGASDFPDTPPVIVDPSYTPLFLARGIARATNLPKWQAIAATLPRLMTTICRN
FT                   GFAPDWAWAPQAPASPPAGLPETGTGSFDAIRCYLWAGLTAPETEGSATVLASLKGMAR
FT                   YLATHRAPPQSVDLASQATHGTGGIGFSAALLPYLAALGRHRLLHQQLGRVLAQRETSG
FT                   LFGQPADYYSENLILFGLGGLSGSIRFDKQGGLITS"
FT   gene            complement(642316..643050)
FT                   /locus_tag="Acry_0571"
FT   CDS             complement(642316..643050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29795"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW13"
FT                   /protein_id="ABQ29795.1"
FT                   /translation="MKSASLRRTARRATRAGIVTCISTIAITATARAAPHTNLFIAGGQ
FT                   YANSSQSAYLGAILPLPGGTLGKGFFVSPFAGWNRYTFQKNGQSFTGSEPSASVAIGHA
FT                   WDEPDFNLSLSVAGGYSNTTVTPYAPKGSFHGGQWFAEPEIYAQLKLPAGATATVNGGY
FT                   LTGMRSYWSSAYLLVPVSPSIAIGPEADFGGGINYRSRTFALRVADKLTSSLDVDLSAG
FT                   ATTNLPGPYHPYVALNLSVPFR"
FT   sig_peptide     complement(642949..643050)
FT                   /locus_tag="Acry_0571"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.925 at
FT                   residue 34"
FT   gene            complement(643047..645353)
FT                   /locus_tag="Acry_0572"
FT   CDS             complement(643047..645353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29796"
FT                   /db_xref="GOA:A5FW14"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW14"
FT                   /protein_id="ABQ29796.1"
FT                   /translation="MDGHSKDPQSRHMPCPDRPGHGLPARFQPARWAAGLALALPLCCQ
FT                   PAQARLEHRQSEVRSGAGIPATAISHPLAWYDRDRAPIVLKGRSASGDITFQVADHREV
FT                   SAAELHLLGTNSASLIGGASQLLVLLNGSPLKQIPLDGSSPTIDRTIGIPPGDLRDGTN
FT                   QLTLSVTQKAAQGCEAFDDPALWTRISPKSQLSMSYRRDSVPLTLASLKSSFMSWQPDT
FT                   SHIFVLYDPALARAPEPIMAIARSVARADAMRAVSFVARPLDRVGKAVAQTSAATVIIL
FT                   KLENGAAAGSGLDAATLSIARNPVGGVVMTIAAETPRALTGAARLIGRPGTVWPNEQSA
FT                   VIRVPAATGHAQSPHAPAASPTDISFRATGLPTQTEHGRSSQFAPVTFWNPNWDSHAIL
FT                   YLHMAYSAGGGAGSMIQALVNGKMVNTIPLTNPDGGTYPDYKLLVPQDALKVGRNRLVL
FT                   KPVFQMQHAAASACVANDFGHNLAVTVFSDSHLTIIGGAPVDKDDLAAMTTGVYPLRTI
FT                   AIASPSPAAISAAATLGAKLAQVTPDQPLNLVLEPHPAAKPGVLVVGAVSRLPEQLLSA
FT                   SGISLVGGSPAVKEPSGRTPHVPDAADLDDVTAWLGRIFGNRAESAPTGKTGHGQAADA
FT                   TVQGFGNAAIMAVADAPAVPDAPGRLAPAIVLTAKSDAGLAQAMGKLVHTATWRQISGQ
FT                   AIVVAPAKSELQVLPAENVPIGPSARLGFLATRNPLTTVLAVLGTLVILILLVRTFVTL
FT                   RRRRLHPSVKGVDER"
FT   gene            646186..646458
FT                   /locus_tag="Acry_0573"
FT   CDS             646186..646458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29797"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW15"
FT                   /protein_id="ABQ29797.1"
FT                   /translation="MKRRPMLNFSARSPMPPSCFASTMRRSPASARSRVAPGSSRPMSI
FT                   ITTIITTITIIRPGNDAEMNSGNAGHRSQGRPVAPIAASVAAFGQ"
FT   sig_peptide     646186..646251
FT                   /locus_tag="Acry_0573"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.915) with cleavage site probability 0.745 at
FT                   residue 22"
FT   gene            complement(646486..647238)
FT                   /locus_tag="Acry_0574"
FT   CDS             complement(646486..647238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0574"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: transcriptional regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29798"
FT                   /db_xref="GOA:A5FW16"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW16"
FT                   /protein_id="ABQ29798.1"
FT                   /translation="MRLLIFGKTFDRHDSLNSFIKSKLAVIDETADVDEAVDLSHHYEY
FT                   EAVVMRVFDTYRIEFDLIRRLRKSGFRAPIVAVANTLAESARLHILEAGVDDLIVGAPS
FT                   YEETFLRIQNHIRRNRGFQDSSLSVGNIEVNMNAKKVFVGAREVAVTKKEYQIIELLAL
FT                   RKGCVLSKEAILDHLYGGLDEPNAKIIDVFICKIRKKLLAADGQDVLVTNWGRGYMMAD
FT                   QRPQNMVQTVTAPGIQARIKTTASLAVA"
FT   gene            complement(647467..647802)
FT                   /locus_tag="Acry_0575"
FT   CDS             complement(647467..647802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29799"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW17"
FT                   /protein_id="ABQ29799.1"
FT                   /translation="MRLQRDNAALQAIGSPDRIRMLALSRRWRTASDPDGPENAPDETG
FT                   PTMPDRSLLAAADTDAATSPPCGRGLVGRRRARGAWEIRISPVMSSRFMPERWLSFQNF
FT                   RIERKIS"
FT   gene            complement(647763..648470)
FT                   /locus_tag="Acry_0576"
FT   CDS             complement(647763..648470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0576"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein,
FT                   Crp"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29800"
FT                   /db_xref="GOA:A5FW18"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW18"
FT                   /protein_id="ABQ29800.1"
FT                   /translation="MLHVAAEPSRSTIANWSAAGEPGFRAGALEAGASLFIEGETVDKI
FT                   YDLVSGIVRLSKMLPDGRRQILGFLFPGEIFTPSGFAISHGGCATCSADAVTAVEVVTH
FT                   RLSSFDGLLASRPELTRSLLATAAKSLFMAQQQMLLLGRMSATERLVWFLLRMAEQQDV
FT                   EAGEPIRLPMSRVDIADYLGLTMETVSRVFRWLRERNIIALKGATEIRIVDPGRARQIA
FT                   DCACSATMPRCRQ"
FT   gene            648663..649385
FT                   /locus_tag="Acry_0577"
FT   CDS             648663..649385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0577"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29801"
FT                   /db_xref="GOA:A5FW19"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW19"
FT                   /protein_id="ABQ29801.1"
FT                   /translation="MDAGTILIVDDDPQIRTMLRRYLAGEGYGTREADSEAGTHAALLG
FT                   GDVTLVLLDLMLGGEDGLALARAIRARSDVPIIMLTGKDDVIDRVAGLEAGADDYIAKP
FT                   FHLREVLARIRALKRRMTGRGTPEPAEPDPPEAVIRFDGHALDPLGRTLRGRDGADIPL
FT                   TTAEFELLAVFLRHAGRVLDRDQLLNLLKGRDFEAFDRLVDTQVMRLRRKIEQDPGQPQ
FT                   LIKTVRGAGYVFAGKLER"
FT   gene            complement(649401..651299)
FT                   /locus_tag="Acry_0578"
FT   CDS             complement(649401..651299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0578"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region, ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29802"
FT                   /db_xref="GOA:A5FW20"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW20"
FT                   /protein_id="ABQ29802.1"
FT                   /translation="MTPEPEAPDAPLAFARSFEAALIGKSLDGIITSWSEGAENLFGYR
FT                   ADEIIGRSIHVLAPPGREAEMDELLARTARGETFDQFETIRRRKDGTLVRVLLTLNPVH
FT                   DTEGCIVGISKIARDITEHRSTEARLRSILDTAPDAIVVIDPRGTVRSFSQAAERMFGY
FT                   AAEEVVGRNVSMLMAEPHAAAHDGYLARYLETGERRIIGIGREVEARRADGSTFPIELA
FT                   VGEVDLPETRLFTGFIRDASKRKRLENDLAQAQKMEAVGQLTGGLAHDFNNLLAVISGN
FT                   LEMLESHVAGGEAAELLAEARLATERGAELAARLLAFGRRQTLRPLAIDVNELVGKMAP
FT                   LFRRTLGSPVMIETRLAAGLPRTMADPGQIETALLNLALNARDAMPKGGRLVIETGLLH
FT                   VDADYAAQQAETLPGDYVVLAVTDSGIGMSAETRGRAFEPFFTTKAVGEGSGLGLSMVY
FT                   GFVKQSGGHVQIYSEPGLGTTVRLFLPAIRAEMPAADDEAAPSPPPGRAIVLVVEDDPA
FT                   VRRVAERRLARLGYSTIDAATGAAGIAALEAHPEIAVLFTDIVLAGGMSGLDLAIAARA
FT                   ARPELPVLFTSGYGDPIVLKGRALPAGAIWLQKPYAEAALANALAALLRPVRDEGV"
FT   gene            651580..652041
FT                   /locus_tag="Acry_0579"
FT   CDS             651580..652041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0579"
FT                   /product="membrane-flanked domain protein"
FT                   /note="PFAM: membrane-flanked domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29803"
FT                   /db_xref="GOA:A5FW21"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW21"
FT                   /protein_id="ABQ29803.1"
FT                   /translation="MSYIEQVLLPDETVMSWTHLHWFVYLRGIVTMVLAFALIIAGGLA
FT                   GGRPSTYLHVAAAAAFLLGCWLLLVAWLRRMSTELAVTDRRVIHKSGILGRTTHEMSLE
FT                   KVESVEVRQSIAGRLFNYGTVIVRGTGSTWEPFPRIADPLAFRSSITAA"
FT   gene            complement(652232..653053)
FT                   /locus_tag="Acry_0580"
FT   CDS             complement(652232..653053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29804"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW22"
FT                   /protein_id="ABQ29804.1"
FT                   /translation="MKARGGVTLLCLVVLLAGCARPPVRAAIRPPAPERAADAAFRAEV
FT                   AAAAAELAREVPRASVPAPAAAAQWIAAARRGLAAAGVGVTRSQLIVVVDRNPRVQRLC
FT                   IVAARPAGAWDVVGCDAVSTGQAGRRGYFITPVGVFAHTTGILDYRALGTFNENHIRGL
FT                   GLKGMRVWDFGWRVAEKGWRSDGETGEIRLLVHATDPDYLEPRLGQTASQGCVRISAAM
FT                   NRFLDRHGVLDAEQEAASRDDARIAATLPADRAPSPLAGELLVVIDSTEGA"
FT   sig_peptide     complement(652973..653053)
FT                   /locus_tag="Acry_0580"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            653209..654663
FT                   /locus_tag="Acry_0581"
FT   CDS             653209..654663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0581"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: helix-turn-helix domain protein; protein of
FT                   unknown function DUF955"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29805"
FT                   /db_xref="GOA:A5FW23"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW23"
FT                   /protein_id="ABQ29805.1"
FT                   /translation="MTEPEDRPLREPKLFAGARIRQIREQRGLQQRDIARRLGLSPSYM
FT                   NQIENDRRPVPPRLAAPLCDLLGIPLAELSGDDEVRRAGDLLEAALDPALGPGRLTFTE
FT                   ARAAVRDTPELARRFIALYAAYRAQQARLARDPALGRDEPGPLPPYDEVRDWVQSERNY
FT                   FHEIDLAAERLAAHIHATLGPDSAALERHLAAGHRIEVVPSANLLPDGILWQIDRRNRR
FT                   LLIAEEMRLETRRFSLAHVIGLLSHGRLISRLIERAKVSSDAARGIARVALANYFAGAL
FT                   IMPYAAFLAEAEAERYDIQRLQIRFQASFEQVCHRLSTLQRPGAQGIPFFFLKTDTAGN
FT                   VLKRSSATRFRFDRFGGPCPLWNVYQAFSQPGKISVQLAQPPGETTYISIARTVGGGGT
FT                   SYLSRPRAVAVGLGCEIQYAPRIVYAAGLDLDRPGAIDPIGPGCRSCPRVACRHRAMPP
FT                   IDGTIDVGTAERGVVPYRVSRPPPGA"
FT   gene            654707..655846
FT                   /locus_tag="Acry_0582"
FT   CDS             654707..655846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0582"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29806"
FT                   /db_xref="GOA:A5FW24"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW24"
FT                   /protein_id="ABQ29806.1"
FT                   /translation="MTIPGSPVNPAAPLRIESLRLTDFRSYARLDWQPGGMVVALAGPN
FT                   GAGKTNLLEAVSLLAPGRGLRGARLAELARRAPGASGGWAVAARIDGPEGRFAIGTGIE
FT                   AGQGERRRLLLDGEPAAAARVAARFSCLWLTPQMDRLFTEGASARRRFLDRLVLALEPG
FT                   HASEVAAFEAASANRNRLIEAGGYDPLWLATIEDSMARHAAALTAARLHVIERLNALLA
FT                   AGAADPFPAARLSLDCPIGAELAHRPALAVEEWLRGRYAATRAEPVAALSPQRADLGLE
FT                   HASSGLAAALASTGQQRAMLVAIVLAHAALVAISRGAAPVLLLDEPFVHLDAAHRSALG
FT                   EALHRGGAQVFCTATERDQLAALGDAAIWTVGEGALRHA"
FT   gene            complement(655896..656825)
FT                   /locus_tag="Acry_0583"
FT   CDS             complement(655896..656825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0583"
FT                   /product="FMN adenylyltransferase / riboflavin kinase"
FT                   /EC_number="2.7.7.2"
FT                   /EC_number="2.7.1.26"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibF; PFAM:
FT                   Riboflavin kinase / FAD synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29807"
FT                   /db_xref="GOA:A5FW25"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW25"
FT                   /protein_id="ABQ29807.1"
FT                   /translation="MIRVFHDWSGIPPEARGASVALGNFDGMHRGHVEVLRAAHAARPD
FT                   APRAALTFAPHPREFFRPDDPPFRLMLEAERAAALEAEGIEILYELTFDRAFSLLSAEA
FT                   FIEEVLDRGIGAAHLACGADFAFGHRRGGDVAMLRAAAEARGIGLSIVPHLDDAEGPIS
FT                   SSRIRRLLQDGYPERAAALLGRPHAIRGVVAHGDARGRTIGFPTANVALGRHLEPARGV
FT                   YAVTVRLADGRMVKGVANIGRRPTVAEGAISRLEAHLFDFSGDLYGQEITVSLHRFIRD
FT                   ERRFASFDELRAQIAADADEARRLLATV"
FT   gene            complement(656822..657364)
FT                   /locus_tag="Acry_0584"
FT   CDS             complement(656822..657364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0584"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29808"
FT                   /db_xref="GOA:A5FW26"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW26"
FT                   /protein_id="ABQ29808.1"
FT                   /translation="MPRRGLDPAPRSGALCAAIRSTATGVPMPSCVPFDQLEPGQTASL
FT                   GKTITEADILLFSAVSMDTNPVHLNQELADETLFKGRVAHGMLCGSLISAVLGTVLPGL
FT                   GTIYLTQSMRFRAPVRIGDTVTAEVEVASLDHEKKRATMRTRCFVRGKVVIEGEAVVIP
FT                   PTEAVVAVAQNEKRAAE"
FT   gene            complement(657345..658277)
FT                   /locus_tag="Acry_0585"
FT   CDS             complement(657345..658277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0585"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29809"
FT                   /db_xref="GOA:A5FW27"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW27"
FT                   /protein_id="ABQ29809.1"
FT                   /translation="MTMTEPRIAVLLPCHNEAAAIGAVVRAFRTALPGADIYVFDNNST
FT                   DDTAAIARGAGAIVRREALQGKGHVVRRMFRDIQADLYVMADGDDTYDAALAPAMIELA
FT                   RRGPYDLVNCVRRETDAAAYRGGHRLGNRLLTGAVRAIFGDRVEDMLSGYKVLSRRFVK
FT                   SFPVLATGFDIETELAVHALELALPIAHVEGDYRPRPAGSESKLRTWRDGWRILRLILR
FT                   LLRHERPLAFFGALGGAAFLVAAVLIAPVIATYLRTGLVPRLPTAVLATGIVLAGALSL
FT                   TTGIILDTVTRGRRETRLLAYLRHAAPGP"
FT   gene            658402..659577
FT                   /locus_tag="Acry_0586"
FT   CDS             658402..659577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29810"
FT                   /db_xref="GOA:A5FW28"
FT                   /db_xref="InterPro:IPR018666"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW28"
FT                   /protein_id="ABQ29810.1"
FT                   /translation="MRRLVRFLSLVVVLAALGWLGLWWYAESRLALAVDQAAARLHAAG
FT                   WTVSHGAVTRGTSPFVADVRVADLRLTPPVADGPAPTLEIPAVDLVVHPAAPLTLDLGF
FT                   ATVWRMALEGGPSFTLRFGSIAADDRFDLADLLHHAPDPLRAGAFHATDLRVDSENTNF
FT                   TLVSIAAIDASGTRNPDAGPDSMAATLHESLRGLALSPLFVTLGNLPFGGKLTALSVDL
FT                   ALFGPAAALPARLTLPPGARWLAPGAAANLPALWRQLGPALHRWAQGGGHGTYDFGLTV
FT                   GPLDAHGTGSFGFDAGTQPKGRLHLVADGLGAALGALSTHYPSLTGDISALTTAAAPYF
FT                   TRGPKGGQRLAVDFVLAHGAVSANGTKLTTVPPLVWPASPQAVPGKAAPKG"
FT   sig_peptide     658402..658503
FT                   /locus_tag="Acry_0586"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.912 at
FT                   residue 34"
FT   gene            659583..661058
FT                   /locus_tag="Acry_0587"
FT   CDS             659583..661058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0587"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29811"
FT                   /db_xref="GOA:A5FW29"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW29"
FT                   /protein_id="ABQ29811.1"
FT                   /translation="MDTEPEDEAATLSPSQMRLTALIVATALFMQNLDGTIVATALPAM
FT                   AKSFHADPLHMSLALTSYLLSLAIFIPASGWFADRFGSRTVFRAAILVFTIGSILCGLS
FT                   QSLGQLIAARIFQGLGGAMMVPVGRLLLLKSVRRRDMIAATSWLTMPALLGPIIGPPLG
FT                   GFIVTYLSWRWTFDINVPIGLIGIVAVTLHVREVKDAEHAGRLDIAGLVWSGLAMALLM
FT                   SGFETIGRGLIPLGWSLGCFAAGAVASLAYWRHARRHPHPILDLTLMRIDTFANSTIAG
FT                   SFFRVLAGAMPFLLPLMLQLGFGDSAAKSGTITFAAAVGALAMKPLAEPILRRLGFRVA
FT                   MMLFGGLAVVFTAACAAFRPGWPELALDAVLLVGGVFRSLQFTALNTIAYADVPRSRMS
FT                   AATSFYATFQQITLTLGISVAAGALEFTTIFAGHAEPSIADYGWAFLIVSAIGGLSVPV
FT                   CARLSPAAGDDVSGHHAPPPAGPAIDANPAARQ"
FT   gene            661089..662828
FT                   /locus_tag="Acry_0588"
FT   CDS             661089..662828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0588"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter, transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29812"
FT                   /db_xref="GOA:A5FW30"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW30"
FT                   /protein_id="ABQ29812.1"
FT                   /translation="MMETGSSIALARRLWRQHVSAYRGRVALIIVATLIMSGTTALYPA
FT                   LIDRAFTMFARRDPRILYQVPLIVLAVTLVKALAQYAQTLLTQQVVLGTIRRLQVSMFD
FT                   HLTGAELARIDREAPAALAARFTTDATVIREAMSRAVNGIADFFTLIGLVGTMLWIDWE
FT                   LSLIAALLYPLAGLPIQKIGRRIRRASGGMQERMGETAALLNESFAQARTVRAYGLEED
FT                   ERRRAERAFEHLYRALMRMIRGRAALDPVLEVLGGLAIALVIGFAGWRHAAGASGIGNF
FT                   TGFVAALLIASRPLRALGTMNAAVQEGMAGLERVFHVIDEPSVVADRPDAVELPPGPGR
FT                   VEFRHVGFAYPDGRPGLRDLSFVAEPGRTLALVGASGAGKSTALALLPRLYEADRGAIL
FT                   IDGADISAVSLDSLRGAIAYVGQDALLFDDTIAANIAMGRRGASIDEIRAAAEAAAAGF
FT                   IADLPEGFETRVGVNGQRLSGGQRQRVALARALLRDPRILLLDEATSALDAESEAAVQQ
FT                   ALARLRRGRTTIVVAHRLATVRDADRIVVMADGAVVESGTHEDLIAGDGAFARLVRAQA
FT                   LAG"
FT   gene            663071..663682
FT                   /locus_tag="Acry_0589"
FT   CDS             663071..663682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29813"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW31"
FT                   /protein_id="ABQ29813.1"
FT                   /translation="MTAPSAPSPGFLLRPRFDAFIEALCAHIAGEGAKRRIAGPLIILI
FT                   WQRLRRLAARFARLVTTPPRARATPPRARITRPAGRPGAPHPLPRAFGWLARLIPGTAS
FT                   VAAPFRALLDTPDMAALIAATPEAGRILRPLCHTLGIRPPAPLRRPRQPRLAPPPEAPS
FT                   PELPPRPEPPAHHLAPPPNPAWPRAPGATRFNPPRRKKPA"
FT   gene            663877..665019
FT                   /locus_tag="Acry_0590"
FT   CDS             663877..665019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0590"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29814"
FT                   /db_xref="GOA:A5FW32"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW32"
FT                   /protein_id="ABQ29814.1"
FT                   /translation="MVENRPTTVALSSAALDAPWEDGAFWLFFPDYRGSSPYQSLLAEA
FT                   LAGRADVAPGTIGMALEAAARRRTVFHLHWEDALYADAGGESEVAATISDALERLAAFR
FT                   ARGGRLVWTVHNAAPHEDRFPALSLGLRQGLARLADVVHVHCRTGVDLALGLGAPAERI
FT                   VMVRHPDLAPAYPDDITNAAARRYFGFADSDIVFANLGANRGYKDLGGLHDGFTALNAL
FT                   IPAARLVLAGRQGGYFEQRYIEPRPGIRLIPRFVDDAVVQYVVRAADFMVLPYRRILTS
FT                   GALALAFGFGRPAIVPDLPALLDVVRPGVDALVYRADDTGDLLRAMIEAAELPAAERLR
FT                   MRAQALQAGREVGFDRLAGALLDAIPPARGRSVPAAMRCG"
FT   gene            665025..665795
FT                   /locus_tag="Acry_0591"
FT   CDS             665025..665795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0591"
FT                   /product="glucose-1-phosphate cytidylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate cytidylyltransferase;
FT                   PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29815"
FT                   /db_xref="GOA:A5FW33"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR013446"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW33"
FT                   /protein_id="ABQ29815.1"
FT                   /translation="MKAVILAGGLGTRISEESYLKPKPMIEIGGKPILWHIMKIYAHHG
FT                   INDFIICLGYKGYVIKEYFANYFLHMSDVTFDMRNNRMQVHHRHAEPWRVTLVDTGADT
FT                   LTAGRLRRVREYLGNDTFCLTYGDGVTDLDLAALLDFHAGHGKLATLTAIQPPGRYGAL
FT                   NLDDRTVRNFQEKPAGDGAWINGGYFVLEPGVFDYIESDMTPWEGEPLERLATDGELMA
FT                   YQHSGFWQAMDTLRDKNHLESLWMRHDPPWKVWA"
FT   gene            665792..666868
FT                   /locus_tag="Acry_0592"
FT   CDS             665792..666868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0592"
FT                   /product="CDP-glucose 4,6-dehydratase"
FT                   /note="TIGRFAM: CDP-glucose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29816"
FT                   /db_xref="InterPro:IPR013445"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW34"
FT                   /protein_id="ABQ29816.1"
FT                   /translation="MILFDDAYRGRRVLVTGHTGFKGSWLSMWLARLGADVSGIALDPD
FT                   TSPSHWDLLGLGIDSRRLDLRNAAALREAVREVRPEVVFHLAAQSLVRRSYRDPLGTWN
FT                   TNVMGTANLLEACRDVGGLRAVVIATSDKCYQNNEWCWGYRETDPLGGNDPYSASKAAT
FT                   ELLAASYRRSFFAGGEAALIATARAGNVIGGGDWSEDRLVPDIVRAIAAGAEVQIRSPR
FT                   ATRPWQHVLEPLSGYLLLGARLLRGDDMFATAWNFGPGPEANLEVATFLEAFAALWPDL
FT                   RWRAEDMQGPHEAGQLNLDSARARTELGWRPVWEIGEAIERTVAWYRHHATHGLACSEN
FT                   QVDEFEQDAARGDAVWCR"
FT   gene            666868..667419
FT                   /locus_tag="Acry_0593"
FT   CDS             666868..667419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0593"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="TIGRFAM: dTDP-4-dehydrorhamnose 3,5-epimerase; PFAM:
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase related"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29817"
FT                   /db_xref="GOA:A5FW35"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW35"
FT                   /protein_id="ABQ29817.1"
FT                   /translation="MDIRQTALPGVVVVESPVVTDARGAFQRCFCSRDLAPLLGTREIA
FT                   QINRSLTARSGTVRGLHFQFPPHAEMKLIRCLRGRVWDVAVDLRAGSPQLLRWHAEELS
FT                   AANGRMLVIPEGVAHGFQALENDSELLYIHTAHYAHAAEGGVRCDDPQLGIDWPMMVGG
FT                   LSDRDRALPMLPALFTGFPQ"
FT   gene            667416..668639
FT                   /locus_tag="Acry_0594"
FT   CDS             667416..668639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0594"
FT                   /product="C-methyltransferase"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   domain protein; C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29818"
FT                   /db_xref="GOA:A5FW36"
FT                   /db_xref="InterPro:IPR013630"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW36"
FT                   /protein_id="ABQ29818.1"
FT                   /translation="MMCRHCAADLDQGFLDLGFAPPSNAYLTPEQLRRPEITLPLRLFV
FT                   CTRCWLVQTEDFAAPEDLFAADYAYFSSTSSSWLDHARHYAQMITRRLALDGDSLVIEV
FT                   ASNDGYLLRNFVAAGIPCLGIEPTRDTAEAAERIGIPVLRAFFGRGLGERLAAEGRRAD
FT                   LIIGNNVYAHVSDINDFTAGLQAALKPDGVITLEFPHLLRMIAGRQFDTAYHEHFSYLS
FT                   LTTVARIFHSHGLRIWDVEELPTHGGSLRIYGCHAEDARPEAESVGRMMATERAFGLFE
FT                   RTTYAEFQAIADGIRNNLLGFLVDERRRSTRIAAYGAAAKGNTLLNFAGIRPNLLPYVV
FT                   DAAESKQGKFLPGSHLPVVPPAALRERRPDIVLILPWNIADEIVERHSYVRDWGGRFAV
FT                   AVPEIAFL"
FT   gene            668788..669804
FT                   /locus_tag="Acry_0595"
FT   CDS             668788..669804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29819"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW37"
FT                   /protein_id="ABQ29819.1"
FT                   /translation="MRGERREVGDMSCEDGLTLILPTRGERDISAWIEYHVDLLAGEYG
FT                   DDFSIIVASEIEPGYRRALENRFVRHFRLEECFFRRIERALDMTTTRNFVLVADDDFLL
FT                   SLDRREIEDMPDDVISISPKTLRSTGTTVNELIENIHTVAISSHFEFCHDTKEERLVRY
FT                   LSAPLPSDNSIFYGIFNKDKYRTVLSKHMPFMACLFPACDWTFVAALMAEYKFRSSETS
FT                   VLLRDTTNVLDLIARELRDIKTMPFQAFMPWAKAIPLHLSLSYIRDVIAPDLLPLLSKE
FT                   IVRLNMERYDGLVYANLLDPEVGLNRDDIADVVNNSKWLNSEGCVMFQNLFNQTMTL"
FT   gene            669955..670797
FT                   /locus_tag="Acry_0596"
FT   CDS             669955..670797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0596"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29820"
FT                   /db_xref="GOA:A5FW38"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A5FW38"
FT                   /protein_id="ABQ29820.1"
FT                   /translation="MARILLTGATGFVGRAAAQVLKARGNDLRCVVRTGTVGRLVGLGI
FT                   SDEVVETPDLFAETSEWWSEVAAETDIVLHAAWYAEPGKYLTSGKNVDCLAGTLRIAQG
FT                   VARAGVGRFVGVGTCFEYDLSPGYLTHMTPLDPTTPYAAAKAAAYLTLREWLPRQGVSF
FT                   LWARLFYLYGPGEDERRLVSHLHRQLALGKPVELTRGEQVRDFMDVREAARLLVDELES
FT                   TRIGAVNISSGQGITVRALAESIADIYDRRDLLHFGARPENLTDPPLVVGLRDSGAEA"
FT   sig_peptide     669955..670011
FT                   /locus_tag="Acry_0596"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.911 at
FT                   residue 19"
FT   gene            670924..671694
FT                   /locus_tag="Acry_0597"
FT   CDS             670924..671694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_0597"
FT                   /product="Cephalosporin hydroxylase"
FT                   /note="PFAM: Cephalosporin hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29821"