Dbfetch

ID   CP000696; SV 1; circular; genomic DNA; STD; PRO; 4909 BP.
XX
AC   CP000696; AAOO01000000-AAOO01000076;
XX
PR   Project:PRJNA15753;
XX
DT   12-MAY-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Acidiphilium cryptum JF-5 plasmid pACRY08, complete sequence.
XX
KW   .
XX
OS   Acidiphilium cryptum JF-5
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acidiphilium.
OG   Plasmid pACRY08
XX
RN   [1]
RP   1-4909
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Han C., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Magnuson T., Richardson P.;
RT   "Complete sequence of plasmid8 pACRY08 of Acidiphilium cryptum JF-5";
RL   Unpublished.
XX
RN   [2]
RP   1-4909
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Han C., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Magnuson T., Richardson P.;
RT   ;
RL   Submitted (04-MAY-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 593aa2bbd6101f2a7876ba6800e5aefe.
DR   BioSample; SAMN02598339.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000181
CC   Source DNA and bacteria available from Timothy Magnuson
CC   (magntimo@isu.edu)
CC   Contacts: Timothy Magnuson (magntimo@isu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4909
FT                   /organism="Acidiphilium cryptum JF-5"
FT                   /plasmid="pACRY08"
FT                   /strain="JF-5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:349163"
FT   gene            1120..1605
FT                   /locus_tag="Acry_3633"
FT   CDS             1120..1605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3633"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29225"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUE3"
FT                   /protein_id="ABQ29225.1"
FT                   /translation="MWGMLASMSKHSMASLRERRAALGLVQMNLWIREEDRAAFTAAVA
FT                   PFKQRAGELDPAQRPGRKRQEFARASSRPVARQKPPEAPQRPAERRSAPRPAIALPCRL
FT                   IFPTRPPARLRNAMKEDGWFYDKLTGTWTADEAEPVELWIDELVRDWGGRIIAPAGG"
FT   gene            1770..2378
FT                   /locus_tag="Acry_3634"
FT   CDS             1770..2378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3634"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29226"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUE4"
FT                   /protein_id="ABQ29226.1"
FT                   /translation="MRRCGAHSMDCAITLVAGRFSASRETMNEIDPKRQERNKRYRTGL
FT                   EERGIKAFQVVAPETAKGLFRRAAELMTRDNDPMEPRQAMRLVGGANEPELGDSAPALI
FT                   AELDEARKRIAEIERQAEARRAITAQAAERHRQMLEAERDAARAAEAAEREKVQAIAME
FT                   ALQAQERVGRAETVILQVKTLPGIKGRLVRWLAGDVLPD"
FT   gene            complement(2704..3048)
FT                   /pseudo
FT                   /locus_tag="Acry_3635"
FT   gene            complement(3385..3825)
FT                   /locus_tag="Acry_3636"
FT   CDS             complement(3385..3825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3636"
FT                   /product="protein of unknown function DUF29"
FT                   /note="PFAM: protein of unknown function DUF29"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3636"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29227"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUE5"
FT                   /protein_id="ABQ29227.1"
FT                   /translation="MSTSTLYDRDFYAWANEQAGLLRAGKLTQADIEHIAEEIESMGKT
FT                   EKRELISRLAVLLTHLLKWQYQPVRRGASWEVTIRIQRRDLARHLRDNPSLQAKLDEAI
FT                   SDAYGDAILAAYGETAIPKQTFPTTCPWSFDQMMAEDFWPEA"
FT   gene            complement(3839..4234)
FT                   /locus_tag="Acry_3637"
FT   CDS             complement(3839..4234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3637"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29228"
FT                   /db_xref="GOA:A5FUE6"
FT                   /db_xref="InterPro:IPR007889"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUE6"
FT                   /protein_id="ABQ29228.1"
FT                   /translation="MLSQRRAAQAWGISRATLQRAVSSGKISVLPDGTIDPAEMLRAFG
FT                   EAKGGPPGHHNEPLGPPLGRGDEMAFQAEIRVLKAQIEAKEALLSAKDRHIEDLSQALR
FT                   LLAGPPAPAPQPSLLARLFSRQKPPRS"
FT   gene            complement(4247..4822)
FT                   /locus_tag="Acry_3638"
FT   CDS             complement(4247..4822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3638"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29229"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUE7"
FT                   /protein_id="ABQ29229.1"
FT                   /translation="MSKVPPKTVGLATAPSGTWVQTERAAHERWAKLIGSHPKAAALMH
FT                   VIVGNMGRHNALVASVPNLQRMMGCSRNTALRAINVLKEQNWIEVRQLGGVGTTNAYIV
FT                   NDRVAWTGSRDGIRYSLFSAAVLVSDDEQPDKAEIGAQPPLERVPALYPGDRQLPTGNG
FT                   LDPPTQPPLVGLEPDLPAQVKEPHGPHD"
XX
SQ   Sequence 4909 BP; 1013 A; 1378 C; 1503 G; 1015 T; 0 other;
     tgacaaaaaa cgtccaaacc cgtcccatca gctatgggac taccccgtcc catcagctat        60
     gggactaccc ccccctataa aatattgatt taattcatta tttttttcac tccttctatg       120
     atctagagga gcacccccga agggggctgc ctgccgtgca ggtagtccac ggggatgcgt       180
     agcggagcgc cccgatagga ggctggcgac gcgcagccat tccggtgggc ccacctgtgc       240
     ggactggctg atcaggcggc cctcggggcc gatgattgaa ggagcggaaa gccgctgacg       300
     cggcttaatc atgaacggcg gccctgaagg gccgcgcggg accagggcga gggaccggcg       360
     cgggcgcgct gcgccctccg ggtctcccgc gctgcgctcg acccgcgcca cgaggtgaga       420
     gacggcgacg cgggaagcaa aggcggcatt gggggcgatg cggcgaggat ggccgtaaaa       480
     tcccgtcaga cgggcgtaca caggtttttg gggttttctg ctcccctttc agcgtccgat       540
     ccgcaaggcc gctctacggc ctcctgaggg gctggaatgg gcattccgga ttagtagccg       600
     cgtgggatga ccagcctgat atgccccttg gtggttaccc aaccgccgtg ctggtcactg       660
     ctggcctcga agcagagatg accgccgcag gtctgccact tcacccgcgc acccttggcc       720
     ttgagtgcct tgaggttggc ccgttcggtc tggatctcgg cccgcagggc ctctgcacgt       780
     caatagaaca cagcacaacc acagcagagt cacaccataa agtccgccat aatcacggca       840
     gatacgatgc aaaaacacaa catgtccgct gcatatctgc gccagaaacc ccgccaaacc       900
     cccgccacta tgcgggcgga aagttcagga gagaagtcac agaccattgc acctttggag       960
     cctccggaca tgaaagcgca ttgacccgcc ccggtgcggt cctcgcggcc cggaatggca      1020
     gcaatcctga gcgcgtctgt ccctctgccc tgaccttcgc tggggcaccg aactgcaccc      1080
     cttggggtgc aatcgcggca ctagtgtcgt tgtcggaaaa tgtggggtat gctcgcgagc      1140
     atgagcaagc actcgatggc ctcgttacgg gagcgccggg cggcgcttgg cctggttcag      1200
     atgaatctct ggatcaggga agaggaccgc gcggcgttca ccgcggcggt tgcgccgttc      1260
     aagcagcggg ccggggagct ggacccggcg cagcggcccg gcaggaaacg ccaggagttc      1320
     gccagagcgt cgtcccggcc ggtggcacgg cagaagccgc cagaggctcc ccagaggccc      1380
     gcagaaaggc gatcggcacc cagaccggcg attgccctgc cctgtcggct gatcttcccc      1440
     accaggccgc ccgcccgcct ccgcaatgcg atgaaggagg atgggtggtt ctacgacaaa      1500
     ctcaccggca cctggaccgc tgatgaggct gaaccggtcg aactctggat cgatgaattg      1560
     gttcgcgatt ggggcggtcg gatcatcgca ccggcaggcg gataatttcc ccggcatcct      1620
     cgtggcaaga actagtgctt aattaccaaa gggcgcactt acgagttgct gcgcaactca      1680
     gtgtgctgga ggtacagaca aggcagggcg gttaatccgg gcaagcggct ttcgccgcag      1740
     aaagcgcgtg agacggccat tagcgtcttg tgagacggtg tggtgcgcac tctatggatt      1800
     gtgccataac tctggttgcg gggcggttca gtgcgtcgcg tgagacgatg aacgagatcg      1860
     atccaaaacg ccaggagcgg aacaagcggt atcgtacggg gcttgaggag cgcggtatca      1920
     aggcgtttca ggtggtggcc ccagagacgg ctaaggggct gtttcggcga gcagcggaac      1980
     tgatgacccg cgacaatgac ccaatggagc cacgtcaagc catgcgtctg gttggcgggg      2040
     caaatgagcc ggaattgggt gatagtgcac cagcattgat cgctgagctg gacgaggcac      2100
     ggaagcggat tgctgagatc gagcgtcagg cggaggcgag aagggctatc acggcgcagg      2160
     ctgccgaacg gcataggcag atgttggagg ccgagcggga tgcagcgagg gcagcagagg      2220
     ccgcagagcg tgagaaggta caggcgatcg ccatggaggc tctgcaagcc caagagcgag      2280
     taggtcgagc cgaaactgtc atcctgcagg ttaagacctt gccgggaatc aagggccgtc      2340
     tggtgcgctg gctggcagga gacgtactgc cggattagct gtccggaatc gaccgtattc      2400
     ggacaggtaa ttttaccatg cccataaatt aggcttctag agttatggac aatcaaatac      2460
     tattgaacat ggttttaatc tcgggattct ggacggttca atcatcggtg tgagccgaac      2520
     ctgagttacg gcctcgacga cgaaacgaaa agatatttga tcagagcggc gattatcaaa      2580
     acaatcaacg tcatgatggc aataccgaac agcgccatac ctcccatcat ccagccgccc      2640
     atcataccat gcatcatcgg gttgctccgt gtttcagtca gccttgccca tcatcccgcg      2700
     catcattgcc ggcatcccat ccttcgcaaa gcgatcgagc tcccgtgcat gggcatagat      2760
     cacctttacc atttccggat cgtccgaagt ttcggtgacc tgaatcccgg taggtaagag      2820
     tttataagat cgtttatact tcgtgctgtt ggcaaacatg gccggtacac tgttgctcat      2880
     cgggtaggga aatggtcgat tctcagcgag gcgattatac atttcgatca cgtgcgcctg      2940
     gatgaggtga gcggttgttg gattactcga aacagtggtg tcaattatgc cgttgggcat      3000
     gtagtccgta gcgcgcgtga tctccgtatg tcgctcgaat agtttcatgc cgagcttcat      3060
     cggccccatc atgttgctgc gggacatcat gccctgcatg tccatgtggg acatatttga      3120
     tcccatcatt ccgcccatca ttccgccaga tgaacccgta gtatctgcgg actgtgcagc      3180
     ggcgcatcgt ggtccaagac cgagaagggc gagaaagccg gaaaatgtgc tgccaaggat      3240
     agcggagagg gtacgacgct tcatgaggtt tcacatctct cgattgattg ggatggcaaa      3300
     acaagtctaa accttaccat catggcagtg taaagaaagc gtcagaatct cgaattatgg      3360
     aaaacgtgga cactacgcgt ccttttaggc ttccggccag aagtcttcgg ccatcatttg      3420
     gtcgaaggac caggggcagg tggtggggaa ggtttgctta ggtatagccg tttcaccgta      3480
     tgccgcgagg attgcatcgc cataggcatc gctgatggct tcgtcgagct tggcttggag      3540
     gcttgggttg tcacgtagat gacgggcaag atcacggcgc tgaatgcgga tagtcacttc      3600
     ccatgacgct ccacggcgga caggctgata ttgccatttc aagagatgcg tgaggagtac      3660
     tgcgaggcgg ctgatcagtt cccgcttctc ggtcttgccc atgctctcga tctcctcggc      3720
     gatgtgttca atgtcggcct gcgtcagctt cccagcgcgc agaagtccgg cctgttcatt      3780
     cgcccaggcg tagaaatcgc ggtcatagag ggtcgatgtg ctcatggtat taattctatc      3840
     acgaacgggg cggcttctgg cgggaaaata gcctggccag cagagacggc tgtggtgccg      3900
     gcgctggcgg gccagcgagc agccggagcg cctggctcaa atcctcgatg tgccgatcct      3960
     tcgcggagag cagagcctcc ttggcttcga tctgcgcttt gagcacccgg atttcggcct      4020
     gaaaagccat ctcatccccc cggcccaggg gtggcccaag tggctcattg tggtggcccg      4080
     gtgggccacc cttggcttcg ccaaaggcgc gaagcatctc tgccggatca atcgttccat      4140
     ccggcaaaac actaattttt ccgctggata cggcccgctg tagggtggct ctggatatcc      4200
     cccaggcttg ggcggctcgc ctctggctca gcatggccca agtggctcaa tcatgtggcc      4260
     catgtggctc tttcacttgg gccggtaggt ctggctctaa cccgaccagc ggaggctgcg      4320
     tcggcggatc gaggccgttt ccagtcggca attggcggtc tcccggatac aaagcaggaa      4380
     cccgctctag gggcggctgt gcaccaattt cggccttgtc tggctgttcg tcgtcggaaa      4440
     ccagtaccgc cgcactgaac aggctgtagc gtatgccatc gcggctccca gtccatgcca      4500
     cgcgatcatt cacgatgtag gcgtttgttg ttccgacacc gcctagctga cggacctcaa      4560
     tccaattttg ttccttcagc acgttgatcg cacggagagc ggtattccga gagcaaccca      4620
     tcatccgctg aaggttaggg acgctggcta ccaaggcatt gtgacgtccc atgttgccta      4680
     cgatgacgtg catgagtgcc gcagccttgg ggtgggagcc gatgagtttt gcccatcgct      4740
     catgtgctgc cctttcggtt tgcacccatg ttccgctcgg cgctgtagcg agaccgacgg      4800
     tttttggggg aactttcgac atgggactac cccgtctcac tcatgaacaa tgattgtcag      4860
     tacgtagaca atcaatgtct attttagcgg acatttaatg tcaatgaac                  4909
//