Dbfetch

ID   CP000695; SV 1; circular; genomic DNA; STD; PRO; 5629 BP.
XX
AC   CP000695; AAOO01000000-AAOO01000076;
XX
PR   Project:PRJNA15753;
XX
DT   12-MAY-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Acidiphilium cryptum JF-5 plasmid pACRY07, complete sequence.
XX
KW   .
XX
OS   Acidiphilium cryptum JF-5
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acidiphilium.
OG   Plasmid pACRY07
XX
RN   [1]
RP   1-5629
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Han C., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Magnuson T., Richardson P.;
RT   "Complete sequence of plasmid7 pACRY07 of Acidiphilium cryptum JF-5";
RL   Unpublished.
XX
RN   [2]
RP   1-5629
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Han C., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Magnuson T., Richardson P.;
RT   ;
RL   Submitted (04-MAY-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 1558ad23252f0649b7c2b38fb9249b74.
DR   BioSample; SAMN02598339.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000181
CC   Source DNA and bacteria available from Timothy Magnuson
CC   (magntimo@isu.edu)
CC   Contacts: Timothy Magnuson (magntimo@isu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5629
FT                   /organism="Acidiphilium cryptum JF-5"
FT                   /plasmid="pACRY07"
FT                   /strain="JF-5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:349163"
FT   gene            complement(897..1094)
FT                   /locus_tag="Acry_3628"
FT   CDS             complement(897..1094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3628"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29220"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUD8"
FT                   /protein_id="ABQ29220.1"
FT                   /translation="MITTSYDPEADALYVRFAPKGATIAETRELEPGILLDMDEIGHLV
FT                   GIEVLGVRSRATLPAIPYAA"
FT   gene            complement(2806..3369)
FT                   /locus_tag="Acry_3629"
FT   CDS             complement(2806..3369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3629"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29221"
FT                   /db_xref="GOA:A5FUD9"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUD9"
FT                   /protein_id="ABQ29221.1"
FT                   /translation="MATGNPIVDALDALAAEVAKCTESVKAANPDALTRSVDQAATKAV
FT                   SSIKTALDGASEAVKEIQKAASDTAQAASSAVEQVAEVRTATRWLNLRSVAVLALAVVL
FT                   VVSGSLASIWWERHKFHRLHTKVIALRAEVQTERANLKALKAKGARVKWETCGGHLCFE
FT                   ASSDQHSGWVTTKGNIKLVIPRGY"
FT   gene            complement(3371..4456)
FT                   /locus_tag="Acry_3630"
FT   CDS             complement(3371..4456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3630"
FT                   /product="plasmid mobilization system relaxase"
FT                   /note="PFAM: MobA/MobL protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3630"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29222"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUE0"
FT                   /protein_id="ABQ29222.1"
FT                   /translation="MAIYRCEIKNISRGQGRSCVAAAAYRHRTRLHDQRQELDHAYTHK
FT                   GDVELSEIVAPEAAPEWVHDRERLWNAADAAEKRKDARTAKEVLVALPRELNTAEQASL
FT                   VREFARAEFASKGLVADIAIHAPKAQDGETQPHAHIMLTTRPLENGNFAKGKDYSLDKP
FT                   PGIEAIRERWATHCNRALERVRSPERVDHRSLADQRQAALAAAENPAQPEPDRIRAAAR
FT                   AMELDRAPEPKIGPVAMQMARQGRGTRAYALRDAMQVRQDRGMLRTMSRSWEQVRQAGS
FT                   NLMQTMRERLPGLASVLRQALPLPSALIAATTSPDMQRATQMLDMRAAEKILKTREHEN
FT                   QQRQQQRTPDQGRERGRGIEM"
FT   gene            4650..4973
FT                   /locus_tag="Acry_3631"
FT   CDS             4650..4973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3631"
FT                   /product="relaxasome subunit MobC"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3631"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29223"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUE1"
FT                   /protein_id="ABQ29223.1"
FT                   /translation="MAKRTDDEILADLTAKQREIETRINAVKARSKERARKEETRRKVL
FT                   VGAVILAEAERSEAAKQRLQALLDKHLVRPIDREVFGLPPRPDQSGQAATSSDSTARPD
FT                   DAD"
FT   gene            5065..5613
FT                   /locus_tag="Acry_3632"
FT   CDS             5065..5613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3632"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29224"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUE2"
FT                   /protein_id="ABQ29224.1"
FT                   /translation="MAKNSRDGNRERAARRRAALAERGIRPIQVLAPDAAHPLIRQAAA
FT                   LMTRDDAPLEPRAALRRAGGANEPEPGEASPGLAAELEAAKARITEIERQAEAQRVMAD
FT                   DAAERQRRALEVEQEKARASAEEAQKAARSAQVAEGRAAEALRRAEKAEATIRQAKALP
FT                   GLKGRLVRLLAGEVLKWPD"
XX
SQ   Sequence 5629 BP; 1140 A; 1514 C; 1723 G; 1252 T; 0 other;
     taatagggtt ccaattcttc agctttttgc tgatgctcca agttaaggcg aagtgtgatc        60
     gaccaaggtt cggtcatatg gtcgtaggcg aggattccta cgggtttcgc ggaaaagcca       120
     tccgccatcg aaattttttt ctggaggtca acatgcatca gcatgtttta aatccagcga       180
     tggtgcgtag tttggctgaa ttgatatacg caatcgctgt attgttgaaa gccgtatggc       240
     caaaagggtt taattaacaa taacttctgg gtcatgaaac aattttatca tggcccagtt       300
     tttttattga tattagatat ttctattggc aattcgattt ctaggtctga attataatgg       360
     aaagagggga atttataatt tttgctaaat tttattatat cattgtcaat aatttttgat       420
     ccgctacttt tgtatatttt tactttttcg gcatgaccga gattgtttat ttctaatgaa       480
     ataattggtg atatcttttt aatatgatat ttttcaaaat catttataat atctgattta       540
     taaatagact tcttaaatga tgacatccaa attttttcgt aacttaaagc ggaattttta       600
     ttccaaactt tatgccgacc gatcgacata atattatatc ctacaaatat aacaataata       660
     gaaaacataa taataattgc cgtataccaa agcactggat aaagataata aaataaaata       720
     gataaagcta aagccggaat ccatcctatt ataattccta ttaaaaatcc aaataaatgt       780
     atagataata cgtatgttga aatgaatatt aaaattgaaa ttataaatag taataaatct       840
     aacatcatat tattcgaaaa gagattttct tgaaaaatct atgatgccga atattttcat       900
     gccgcatatg gaattgccgg tagtgttgcc cgtgatcgca cacccagcac ttcgatcccg       960
     actaggtgtc cgatctcgtc catatccagc aggatgccag gctccagttc cctggtctcg      1020
     gcaatcgtcg ctcccttagg ggcgaaccgg acatagagcg catccgcctc gggatcatag      1080
     ctggtcgtga tcacggtctg gctcctcgat caaaactctc tacgatcctg tgcgccgtgc      1140
     cagatgcgaa ggacttcagc gttctggccg acaattcgat aaacgataat gtagggccaa      1200
     atcacggtca gttccctcgt ccctgaaacc aagccgggcc gcccacgctc aggtagatac      1260
     tcaagccgat cacaggccgc tacgagctgc accgcgatgc gagtggctgc ggcagggttt      1320
     tcccggccga tgtggtggcg aatatggaca agatcattga tagcctcagc cgtgaagatt      1380
     accggcattt aggttcggac agctcgtttt cagttcccca ggaaagcagc catttccgag      1440
     cttcctcgta gggtacggtg cgcccggagt ccgcagccgc aatccctttt ttgacggctt      1500
     caacgaaagc ttccgtatca ggatcatctg gcatggatac agggttcggg atcattcagc      1560
     ggactcctct tggtggaggt gagtactacg cgctggcaag tcatgttcta gtccatcaaa      1620
     tggtggttga gatggcggag gctcgccatt accagacggg agttggcgtt cacctggtag      1680
     caatgttgga atttgcctta gaggatcttg gctgatctct tcctgttcgt cggaacgagc      1740
     caaaacttcg gctgagaacc tagcgtagcg gagcttgtcg cgctcttgcg tccaagcaac      1800
     tcggctattg atgactatgg cattggcggc acctttgccg cctatctgaa taacctcaat      1860
     ccaacgttcg ctacggagat cagcgattgc ccgacgaacg gttgcgaccg acatcccgct      1920
     aatcgaggct agggtcgccc acgacgccac cacagcatca ctatgaccca tttgagcaac      1980
     gagatagtgc atcaatgcgg ctgctcgagg tttgctgacg gaaagccgcc cccaagcttc      2040
     atgggaagct cgatcggtct gaatccatct tggaggggag ttggcgttct gagtgagcaa      2100
     ccccctgctc atatgtgcac cattcgtttg cactggagta ttcatatgaa tcactcgtga      2160
     tcgatacggg tgattcatat atgatcacat ctgatccata caaatcaacc ctgctcacct      2220
     aagtgagcag ggggctgctc acttaggtga gcagcccccc ctttgtaaca tattgattta      2280
     attggaaatt ttttcgcccc ctctctatga tcttaggact ggggctcccc ctcatttttg      2340
     tcgtcccggt agtccacagg gaacgagggc cgcgagccgc ccgaagggag gcgaagcgag      2400
     cggcccgaac ttccctgtgg gcccaccggg gcgacgggca ctacgcacgc gcgagcgcgc      2460
     gaggctgcga agttgggaag ggggtgcggg ggaaaccaga tgcggcaaat cgcgatgcga      2520
     tttgaccatg aaaggcggcc ctgacgggcc gcgctagggg aaggtaaggg ctggcgcggg      2580
     cgcgatgcgc cctccgggtc tcccgctctg cgctcgaccc gcgccacgag gtcaggggca      2640
     acgggacggt aagcaaaagc ggcattggag acgaagcggc gaggatggcc gtgaaacccc      2700
     gtcagacggg cgtacacggg ttttttgggt ttggtgctgt tttggggtgt caggacataa      2760
     aacccgttct acggccttct gccgggccgg aatgcccatt ccggatcaat agccgcgtgg      2820
     aatgaccagc ttgatattcc ccttggtggt tacccaaccg ctgtgctggt cactgctggc      2880
     ctcgaagcag agatgaccgc cgcaggtctc ccacttcacc cgcgcgccct tggccttgag      2940
     tgccttgagg ttggcccgtt cggtctggac ctcggcccgc agggcaatga ccttggtatg      3000
     gaggcggtgg aatttgtgtc gttcccacca gatcgaggcg agactgccgc tcaccaccag      3060
     cacaacggcc agcgccagga cggcgactga gcgcagattg agccagcgtg tcgcggtgcg      3120
     gacctcggca acctgctcga cggcgctgga cgctgcctga gcggtgtccg aggcggcctt      3180
     ctggatctcc ttcacggcct cgctggcgcc gtccagagcg gtcttgatgc tgctcacggc      3240
     cttggtggcg gcctgatcga cggagcgggt gagggcgtcc ggattggcgg ccttcacgga      3300
     ctcggtgcat ttggcgacct cggcggcgag ggcatccaga gcgtctacga tggggttgcc      3360
     ggttgccatg ctacatctcg atcccccggc cgcgttcccg gccctggtcc ggtgtgcgtt      3420
     gctgctggcg ttgctggttc tcgtgctcgc gggttttgag gattttctcg gcggctcgca      3480
     tgtccagcat ctgggtggcg cgttgcatgt ccgggctggt ggttgcggcg atcagggcgg      3540
     agggcagggg cagagcctgt ctgagcacgc tggcgaggcc ggggaggcgt tcgcgcatgg      3600
     tctgcatgag gtttgagccg gcctggcgga cctgttccca ggagcggctc atggtgcgga      3660
     gcatgccgcg atcctgcctg acctgcatgg cgtcccggag ggcgtaagcc cgcgtgccgc      3720
     gtccctggcg tgccatctgc atggcgacgg ggccgatctt gggttccggg gcgcggtcca      3780
     gttccatggc tctggcggct gccctgatgc ggtcgggttc gggctgggcg gggttctcag      3840
     cggctgcgag ggcggcctgg cgctgatcgg cgagggagcg gtgatcgacc cgttcggggc      3900
     ttctgacgcg ctcgagcgcc cgattgcagt gggtagccca ccgttcgcgg atggcctcga      3960
     tgccgggtgg cttgtcgagg ctgtagtcct tgcccttggc gaagttgccg ttctcgaggg      4020
     ggcgggtggt gagcatgatg tgggcgtgag gctgtgtctc gccgtcctga gccttggggg      4080
     cgtggatggc gatatcggca accagcccct tgctggcgaa ctcagcgcgg gcgaactcgc      4140
     ggaccaggct ggcctgttcg gcggtgttca gttcgcgtgg gagggcaacc agcacttcct      4200
     tggcggtgcg ggcatccttg cgcttctcgg cggcatcggc ggcattccac aggcgttcgc      4260
     ggtcgtggac ccattcgggt gcggcctctg gtgcgacgat ctcggagagt tcgacgtcgc      4320
     ccttgtgggt gtaggcatgg tcgagttcct gacgctggtc gtgcaggcgg gtacgatgcc      4380
     gataggcggc agcggcgacg caggatcgac cctgaccccg gctgatattc ttgatctcgc      4440
     aacggtagat tgccacagat cggcctcgac gaatgaggaa atcaggttaa gctattttgg      4500
     cggtttgaac aaccacgaaa ggattgagtg cgcggttacg tgttgctgcg caacacccgc      4560
     ggcaatcctg ggggcgttgc ccccgccctg cgggcgcccc ccaccaatgg gcttgcgcgc      4620
     cccttggaac cccgactagt ttttgtgtca tggcaaagcg gacggacgac gaaatccttg      4680
     ctgatctcac cgcgaagcag cgtgagatcg agacgcggat caatgcggtg aaggcgcgct      4740
     cgaaagaacg cgcccgcaag gaggagaccc gccgcaaggt gctggttggc gcggtcatcc      4800
     ttgcggaagc ggagcggtct gaggccgcga agcaacggct ccaagccctg ctcgacaagc      4860
     atcttgtacg ccctatcgat cgcgaggtgt tcgggctacc gccccggcca gaccagtctg      4920
     gccaggcggc tacgtccagc gactcaacag cccgccctga cgatgccgac tgagtctcaa      4980
     tcggccctga accatagccg gctcaaacca tgacatgtca tggtttgagc gtgacatgtc      5040
     atggttgcct tgccatgata tgtcatggct aagaatagca gggacgggaa tcgagagcgc      5100
     gccgcccggc gccgggcggc tctcgccgag cgtggtatca ggcccattca ggtgctggca      5160
     ccggacgcgg ctcatccttt gatccgtcag gctgcggccc tcatgacccg cgacgatgcc      5220
     cccctggaac cacgggcggc gctgcgtcgg gctggcgggg cgaatgagcc tgagcccggt      5280
     gaggcatcgc ccggcctggc tgcggaactg gaagctgcca aagccaggat cacggaaatc      5340
     gagcgtcagg cagaggcgca gagggtcatg gcggacgacg ccgcagagcg tcagaggcgg      5400
     gcgctagagg ttgagcagga gaaggcgcgc gcgagcgcag aggaggccca gaaggccgcc      5460
     agatccgccc aggtagccga agggcgggcg gcagaggcgc tacggcgcgc ggagaaggcg      5520
     gaagccacca tacggcaggc caaggctcta ccgggcctca aaggccggct tgtgcgcctt      5580
     ctggccggcg aggtgctgaa gtggcctgat tgacggcctc caccatcga                  5629
//