Dbfetch

ID   CP000694; SV 1; circular; genomic DNA; STD; PRO; 8781 BP.
XX
AC   CP000694; AAOO01000000-AAOO01000076;
XX
PR   Project:PRJNA15753;
XX
DT   12-MAY-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Acidiphilium cryptum JF-5 plasmid pACRY06, complete sequence.
XX
KW   .
XX
OS   Acidiphilium cryptum JF-5
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acidiphilium.
OG   Plasmid pACRY06
XX
RN   [1]
RP   1-8781
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Han C., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Magnuson T., Richardson P.;
RT   "Complete sequence of plasmid6 pACRY06 of Acidiphilium cryptum JF-5";
RL   Unpublished.
XX
RN   [2]
RP   1-8781
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Han C., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Magnuson T., Richardson P.;
RT   ;
RL   Submitted (04-MAY-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; fed65aa3e34035de2080887baf195aa2.
DR   BioSample; SAMN02598339.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000181
CC   Source DNA and bacteria available from Timothy Magnuson
CC   (magntimo@isu.edu)
CC   Contacts: Timothy Magnuson (magntimo@isu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8781
FT                   /organism="Acidiphilium cryptum JF-5"
FT                   /plasmid="pACRY06"
FT                   /strain="JF-5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:349163"
FT   gene            complement(66..407)
FT                   /locus_tag="Acry_3618"
FT   CDS             complement(66..407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3618"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29211"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUC9"
FT                   /protein_id="ABQ29211.1"
FT                   /translation="MLKDGGWLEVRQIGPTGTANAYIVNDRVAWSGNRDGIRYSLFSAA
FT                   VLVSDDEQPDKAELGAQPPLERIPTLLPGERQLPTGDGLPPVSQPFLEGLEADLPARSA
FT                   HLHQEESAE"
FT   gene            complement(1194..4442)
FT                   /locus_tag="Acry_3619"
FT   CDS             complement(1194..4442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3619"
FT                   /product="ATP-dependent exoDNAse (exonuclease V) alpha
FT                   subunit-helicase superfamily I member-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3619"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29212"
FT                   /db_xref="GOA:A5FUD0"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUD0"
FT                   /protein_id="ABQ29212.1"
FT                   /translation="MASRSRTFRRSSAAAMARHVAQQAGLAAALKDEVTGAQLAEVFAR
FT                   DRLPGRWIGRGAAKLELGELVRMPDILAVMRDGVLKRPDPLDPLAPDTEIRLRGAGAEV
FT                   GFYGVILALPKSVSLLLASDDPAEREAAEEAARVAERVFLETLEGLVRTRTGRDGVNSV
FT                   SGDGLIAASFTHRGSSAGDPHLHVHFMISNSTQGSDYAWRTIDSKLFMSSQRVATAAAM
FT                   RAMKACISELLGLSEDAWLSRQVGSVQTPELRDLAGAAENLSRASERLWRDRVKSGLHR
FT                   TIDDRLDHHLWRLDREANAADYEKIEAEIDLTLANGGENADRLRADWRTLGGAALEKGL
FT                   AGLRARRGGEAPSPSPSRRKRGGYDQKAALDFICGQEIFCLTDLAAWMVGEGVPAADSM
FT                   LKAAKFLDAAAAEGLVHMTGKLSPTVFAMQEGLAVDTRRAHAVAGIGGRIVTDRRVQWE
FT                   ARMIEEFSALARQQRQRLLIEVPETATVEQSIALRLIAEGRGLCAIRGVAGAGKSFILK
FT                   PAAEAARRQGMEVIAIARNAKIGRNLGQDIEANAAMSIADFLTRHQSRVGKARKPTLLV
FT                   IDESGVVDEADLLAVLRLAADPASQIQVVMTGDRSQSQSIDRKATWGVLTRAAEQAGAV
FT                   AELKTSFRNRAWAAEAQALREGDARAVVDAAARGGRLKTANSADYARVVAALWAEHPGS
FT                   LVVTYTNEEAARISAEIQKLKEIEPVVEIARDQGCGVGDTIRTRRNDHDRSIYNGDTWE
FT                   VIGAEEDGIFVENAAGRVVFLTSEYVKQHVELGYASTLDSAQGMTVDRAIFVGRAGLGR
FT                   NQMYSGSTRGRAAPIYVMVSDEEQPEAVLASILETDDTIATADERVEEIAAKADELKKP
FT                   RRLDAERERVEAERAARVAKTVRIWEAIKAAGGAEVSSLRQMTGVIRRASAAIHEQERL
FT                   ALERRQNRENRRFDLYEVLEANRAGLLEAERQLDRLSEALAAERARKLPETATRAAHQA
FT                   QAQRIATLEALLENQRGLYGRVAERWQGVETNCAARLAEIDEIDASDRAWQADFLGRLR
FT                   GEADAAEAGIKDFLARAAGRQARPKATGSGPEVT"
FT   sig_peptide     complement(4371..4442)
FT                   /locus_tag="Acry_3619"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.773) with cleavage site probability 0.528 at
FT                   residue 24"
FT   gene            4766..5308
FT                   /locus_tag="Acry_3620"
FT   CDS             4766..5308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3620"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29213"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUD1"
FT                   /protein_id="ABQ29213.1"
FT                   /translation="MAKNSRDGNRERAARRRAALAERGIKQVLLMAPEQAHPLLKHAAS
FT                   LMTRDDDPLEPRAALRRAGGANEPEPGDASPGLAAELEAAKARIAEIERQAEAQRVMAD
FT                   DAAERQRRLLEVEQEKARASAEEAQKAARSAQAAEGRAAEALRRAEKAEAAISQAKTMP
FT                   GIKGRLVRWLAGDVLPD"
FT   gene            complement(5502..6086)
FT                   /pseudo
FT                   /locus_tag="Acry_3621"
FT   gene            complement(6671..6925)
FT                   /locus_tag="Acry_3622"
FT   CDS             complement(6671..6925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3622"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29214"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUD2"
FT                   /protein_id="ABQ29214.1"
FT                   /translation="MRDVIPLPGYRLAVRFHDGTAGTVDMAAMITAPTAGVFARLRDPA
FT                   EFARVHVLYGVVTWPGEIDLAPDAMHDALAATGEWVLAA"
FT   gene            complement(7238..7528)
FT                   /locus_tag="Acry_3623"
FT   CDS             complement(7238..7528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3623"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29215"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUD3"
FT                   /protein_id="ABQ29215.1"
FT                   /translation="MASLAETETPDIRVRTVSVTDYELIVGLMDGRTIAVPLAWFPRLL
FT                   NASPEQRSHWELAGAGYGIHWPDLDEDLSTEGLLRGARAPRGSATWRPRIA"
FT   gene            complement(7506..7745)
FT                   /locus_tag="Acry_3624"
FT   CDS             complement(7506..7745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3624"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29216"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUD4"
FT                   /protein_id="ABQ29216.1"
FT                   /translation="MPVVFRHEGYRFYFYSHEPNEPPHVHIDRAEATAKLWLEPVALAS
FT                   NAGFSPRELGLLLRMTRDHQQTLLESWYGFFGRD"
FT   gene            complement(7746..8192)
FT                   /locus_tag="Acry_3625"
FT   CDS             complement(7746..8192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3625"
FT                   /product="protein of unknown function DUF29"
FT                   /note="PFAM: protein of unknown function DUF29"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3625"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29217"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUD5"
FT                   /protein_id="ABQ29217.1"
FT                   /translation="MSNATLYDRDFYAWANEQAALLRERRFDAADLANIIEEIETLGRG
FT                   EMRELVSRIRVLLLQLLKWQYQPNFQGPSWRTSIVIQRHKISEHLTENPSLRSRLVEAI
FT                   SRAYRLARSEAAMETGLADQTFRPVCPWSFEQMMTEDFWPGEES"
FT   gene            complement(8189..8389)
FT                   /locus_tag="Acry_3626"
FT   CDS             complement(8189..8389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3626"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29218"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUD6"
FT                   /protein_id="ABQ29218.1"
FT                   /translation="MITTSYDPDTDAVYVRFGPKGTTVAETRELEPGILLDMDEIGHLV
FT                   GIEVLNVQSRTKLSAGSENAK"
FT   gene            complement(8370..8681)
FT                   /locus_tag="Acry_3627"
FT   CDS             complement(8370..8681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3627"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3627"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29219"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUD7"
FT                   /protein_id="ABQ29219.1"
FT                   /translation="MPVIFTAEALDDLAHIRQHIGRENSHAATRVAVQFVAACDRFEYL
FT                   PERGSSGLVSGALELTVIWPHVIVHRVSVPDVEILRIWYNAQNHGALIEDLDHDHDQL"
XX
SQ   Sequence 8781 BP; 1685 A; 2665 C; 2691 G; 1740 T; 0 other;
     ttccttaact gcctcaacga aagcctcagt atccgagttg tccggtatgg gtgtggggtt        60
     ggagatcatt cagcagactc ttcctgatgg aggtgggcgc tacgcgccgg cagatcggct       120
     tcaaggcctt ctagaaacgg ctgggagacg ggtggaaggc catcgccggt gggtaactgc       180
     cgctcgccgg gtagtagcgt cggaatacgt tccaatggtg gctgcgcgcc aagctcggcc       240
     ttatccggct gttcgtcatc agacaccagg actgcggcgc taaacaggct gtagcggatg       300
     ccatcacggt tgccagacca ggccacacgg tcattcacga tataggcgtt ggctgtgccg       360
     gtcgggccga tctggcggac ttctagccat ccgccatctt tgagcacttg taaggccgtt       420
     cttaccgtgc ggtcggtgca gcctattagg ctagccagtg ttttctgacg ccactagagc       480
     gttgtggcgg cccattttcg acacgatcac atgcatgagg gcgcaagctc tcgggttgcc       540
     tacggctagc tgtgcccatt tttcgtgagc tgctcgttct gtttgaaccc acgttccgct       600
     gggcgcggtt acgataccgt aagatttttc tcgggcagcc attttcacga atccagaaaa       660
     aatttttcaa atttgtatgt caaatttccg caccccaggc aattttttat ttcttgaatc       720
     aagaaaaata tttcccgaat tttccgaacc ccggaagtag ctggcttccg gggggtagga       780
     agtagctggc ttccgggggg gggggtataa tatgatgaaa aaaaaggttt ttttctttgc       840
     ctcttctatg atctagagga gcactcccga agggggctgc ctgccgtgca ggtagtccac       900
     ggggatgcgt agcggagcgc cccgtaagga ggctggcgac gcgcagcctt cccggtggac       960
     ccacctgtgc ggactggctg atcaggcggc cctccgggcc ggtttttttg gctcgacgga      1020
     cagagaaaag aacggaaaag cgctgaagcg ctttatcctt caaaggccac ccctgacggg      1080
     gtggcagggc aacggccaaa ggctcgtgcc agctcagact tcagattggc tttggaggac      1140
     gatgcgagag cgtttcaggc tgatgaccag cggcatggga gccccatggt gggctaggtg      1200
     acttcaggcc cgctcccagt ggccttgggt cgcgcctgac ggcccgccgc acgggccagg      1260
     aaatccttga tccccgcttc cgcagcgtcg gcctcccctc tcagcctacc caggaaatcc      1320
     gcctgccacg cacggtcgga agcatcaatc tcgtcgatct cagccagcct ggcagcgcag      1380
     ttcgtctcga ccccctgcca tcgctcggcc acccggccgt aaagcccgcg ctgattttca      1440
     agcagggctt ccagcgtcgc aattcgctga gcctgcgcct gatgcgccgc ccgagtggcg      1500
     gtttccggca gtttgcgcgc ccgctcggcg gccagagcct cagacaggcg atccaactgc      1560
     ctctcggcct ccaggagccc ggcccggttc gcctccagga cttcgtagag gtcaaaccgc      1620
     cggttttcac ggttctgccg gcgctcaagg gcaagccgtt cctgctcatg gatcgccgca      1680
     ctagcccgtc gtatcacgcc ggtcatctgc cgcaggctgc tcacctcagc gccccctgct      1740
     gccttgatcg cttcccagat cctgacggtt ttcgccaccc gcgccgcccg ctcggcctcg      1800
     acccgctcac gttccgcatc gagtcgccgc ggcttcttga gctcgtcggc cttggcggcg      1860
     atctcctcga cccgctcgtc agcggtggcg attgtatcgt cggtctccag gatcgaggcg      1920
     agcaccgcct cgggctgttc ctcgtcgctg accattacgt aaatcggcgc ggcgcggccg      1980
     cgcgtcgatc ccgagtacat ttggttacgc cccaaaccgg cgcggccgac gaaaatcgcg      2040
     cggtcaacgg tcatgccctg ggccgagtcg agggtcgagg cgtaccccag ctcgacgtgc      2100
     tgtttcacat actcagaggt gaggaaaacg acccggcctg ccgcgttttc cacgaaaatt      2160
     ccgtcttctt cggccccgat cacttcccag gtgtcgccgt tgtagatgct gcggtcgtgg      2220
     tcatttctcc gggttctgat cgtatcgccg acaccgcagc cttggtcgcg cgcgatctcg      2280
     acgactggct cgatctcctt aagcttctga atttcagcgg aaattcgggc ggcttcttcg      2340
     ttcgtgtacg tcacgaccag gctgccaggg tgctcggccc aaagggccgc cacgacgcgg      2400
     gcgtagtctg ctgaattggc tgttttcaat cgcccgccgc gtgccgcagc gtcgacgacg      2460
     gcacgcgcat cgccctcgcg gagcgcctgg gcttcagcgg cccaggcgcg gttgcggaag      2520
     gatgttttca gctcggccac cgccccggcc tgctcggcgg cgcgcgtcag caccccccat      2580
     gtggctttcc gatcaatgct ttgggattgt gatctgtcgc ccgtcatgac gacctggatc      2640
     tggctcgccg gatcggcagc caatcggaga accgcgagca ggtccgcctc atcgacgact      2700
     ccggactcgt cgatgaccag cagtgtcggc tttcttgctt tccccacccg cgactgatgg      2760
     cgggtcagga aatcggcaat cgacattgcc gcattcgctt cgatgtcttg cccgaggttg      2820
     cgtccaattt tagcgtttcg ggcgattgcg atcacctcca tcccctgccg ccgcgcggct      2880
     tcggcagcgg gcttgaggat gaagctcttc ccagccccgg cgacaccgcg gatcgcacag      2940
     agaccccggc cctcggcgat caaccggagg gcgatggact gttccaccgt cgccgtttcc      3000
     gggacctcaa tgaggaggcg ctggcgctgc tggcgagcga gggcggaaaa ttcctcgatc      3060
     atgcgggctt cccactgaac gcggcggtct gtcacgatgc ggccgccgat gccggcgacc      3120
     gcgtgcgcgc gccgggtgtc cactgccagg ccttcctgca tcgcgaaaac cgtgggcgag      3180
     agcttcccag tcatgtgaac gaggccctcg gcggccgcgg catcgaggaa tttcgcggcc      3240
     ttgagcattg aatcggcagc cggaacgccc tcgccgacca tccacgcggc gaggtccgtc      3300
     agacaaaaaa tctcctgccc acagatgaag tctagggccg ctttttggtc atagccccct      3360
     cgctttctgc gggaggggga gggagacggc gcctcgccgc ctcgccgcgc gcggaggcca      3420
     gccaagcctt tttcaagagc cgcgccgccc aaagtccgcc aatccgctcg cagcctgtcg      3480
     gcgttctcgc ccccgtttgc gagggtcaaa tcgatctcgg cctcgatctt ttcgtagtcg      3540
     gcggcgttgg cctcccggtc caaccgccag aggtgatgat ccagccggtc gtcgatcgtc      3600
     cggtgcaggc cggattttac ccggtcccgc caaaggcgct cactcgccct gcttagattt      3660
     tcggcggccc cggccaggtc gcggagttcc ggcgtctgca ctgagccgac ctgacggctg      3720
     agccaggcgt cctcgctcag ccccagcagc tcgctgatgc aggctttcat ggcccgcatc      3780
     gcggcagccg tcgccacgcg ctgcgaggac atgaacagct ttgaatcgat ggtccgccac      3840
     gcgtaatcgc taccttgagt agaattagat atcataaaat gcacgtgcag gtgggggtct      3900
     ccggcagagg agcccctgtg cgtgaagctg gccgcgatca gcccatcgcc ggagaccgag      3960
     ttcaccccgt cgcgtcctgt gcgggtgcgg acgaggccct ccagtgtctc caggaacacc      4020
     cgttcggcga cccgtgcggc ttcctcggcg gcctcgcgct cggccgggtc atccgaggcc      4080
     aggaggagac tgacggattt cgggagggcc aggatcaccc cgtaaaatcc cacttcggcc      4140
     cctgcgcccc ggaggcggat ctcggtgtcg ggagctagcg ggtccagtgg gtcaggccgt      4200
     ttcagaacgc cgtcgcgcat caccgctaga atgtcaggca tcctgaccaa ctcacccagt      4260
     tccagcttcg ccgccccgcg gccgatccac cggccgggca gcctatcacg ggcgaaaacc      4320
     tcggcgagtt gcgcccccgt cacctcgtcc ttgagggccg cggcaagccc ggcttgctgc      4380
     gcgacgtgcc gcgccatcgc cgcggcggac gaccggcgga acgtccggga gcggctggcc      4440
     attgccgtcc ctaccggggt ggtttgggcg ccccagacgg ggggggcgag ctgaggacag      4500
     agatcataat gccgatgtgc ctcggttttt gtgaaaaagc aaggcggctg ggagggagtg      4560
     gcgcgccggc gagcggcggg gaggcggctg ggagggagtg gcgcgccggc gagcggcggg      4620
     gaggcggctg ggagggagtg gcgcgccggc gagcggcggg gaggcggctg ggagggagtg      4680
     gcgcctggct ggcaccagcc atgactaatc acgattggcc atgattagtc atgggttatc      4740
     agggtgatat gtgccatgat tagtcgtggc caagaacagc agggacggga atcgagagcg      4800
     tgctgcccgg cggcgggcgg ctctagccga gcgcggtatc aagcaagtcc tgcttatggc      4860
     tccggagcag gcgcacccgt tgctgaaaca cgcggctagc ctgatgaccc gcgacgatga      4920
     cccactggag ccacgtgcgg cgctgcgtcg ggctggcggg gcgaatgagc cggagcccgg      4980
     cgatgcctcg cccggcctgg ctgcggaact ggaagccgcc aaagccagga tcgcggaaat      5040
     cgagcgtcag gcagaggcgc agagggtcat ggcggatgac gctgccgagc gtcagaggcg      5100
     gctgctagag gttgagcagg agaaagcgcg cgcgagcgca gaggaggccc agaaggccgc      5160
     cagatctgcc caggcagctg aagggcgggc ggcagaggcg ctacggcgcg cggagaaggc      5220
     ggaggctgct attagtcagg ccaagaccat gccgggcatc aagggccgtc tagtgcgctg      5280
     gctggcgggt gacgtgctgc cggattagct gaccggaatc gaccgtttac gggcatggta      5340
     aaattaactg accaaaaatt agggtttgat cgttaatggc aggaagtttt attggtcacg      5400
     gattctgagc gggaccattt ctgaccggat cagacaattg gggtagtgcg caatggtcga      5460
     ttggcgacta ccccaatcaa gcggctttag tcagattcag atcatgcgcg tttctggcgc      5520
     ttgcggatca cgaaaccaag agcaagaaga cctgtgccaa gcaatacgag cgacccaggc      5580
     tctggaacat ctgtcatgct gaccgtcgaa ctggcttcgc cggttccagt tgacactact      5640
     ttataaactg ctgtgattga atatggcccc gtgaagtcag gagtcatagc aacggtgtcg      5700
     tttgttcccg tggacgtgaa cgtcgcggac gcaagttcgg tcgacagtcc gtaggtggca      5760
     tctgaagtgt tggcataagt tgtttctgtt acggcgttga ttgcgccaga atagaaattc      5820
     tccgtcagac cactcagcat gttgtactga ccaagcggac cagtcagccc agtctcagtc      5880
     gcataaacga acaaggtccc tcccgttgac gttgaggtat tgagcgccgt gctcgaaaaa      5940
     tttgtggcag cccccggcgc cccgcttgca gttagctcat tgagcgagaa tgaaccgtaa      6000
     gatccgctaa atattgctcc tccacttcca gtagcttcag ttgtgatggc cccaccattg      6060
     acgccggact cttgcaagcc cagcgaaata acgcctgcct gcgcgacgct cagtgctccg      6120
     agcgaggcgc caatgataaa aaccgaactt agtaggatac gtttcattac attcactcca      6180
     caatgatttg gcgagatctt gtataatgca aaaaacacgc caaaaaataa tatctaaata      6240
     cttcaatatg tcacagattc aaagaatcag atgtgtaaat aatcctgaca atagttacga      6300
     aataagcaca acctgtaaaa gcaatgccga tcatttcttc gcgtttaggt ttgttgggcg      6360
     aattaaagtg taaaatcgcg cggggcgtga ctgtcttgca tgtgtatcag ggtctgaagc      6420
     gatcctgctc tatcgggttg cccgacgatt tatacaaagt cacagacggc gccgacgcag      6480
     cgccatccgc aaagcattcg ttgggcgcag aatccacatt atggaacttc caggcaagtc      6540
     atgggtaagt cacggcgtag tccagccacc gcgggcaggc cggggcggta gtcatgggtg      6600
     cgcggggact ggtcgagagg ccccgccaga ggcgcgccag gccgggatga atacttgccg      6660
     gagggcttcg tcatgcggcc aaaacccatt caccggttgc cgcaagagcg tcgtgcatcg      6720
     catcgggggc cagatcgatc tcacccggcc aggtgacgac gccatagagg acgtgaaccc      6780
     gcgcgaactc agccggatca cgcagccggg caaagacacc ggccgtcggt gccgtgatca      6840
     tcgccgccat atcgacggtc cccgccgtac cgtcatgaaa cctcacagcg agacggtagc      6900
     ccggcaatgg aatcacatcg cgcacgtcat ccgcggctgt cgcctcgatc ggcggaatca      6960
     gggcagcggc gaaattttct gaggcggctg attctgcgca catagggtcc aattctccat      7020
     caactcggcg cggtgttgct caccccattc ccgcaccagc gcgagagccg tgcggggcag      7080
     gtgcccctcg atgatgtcga gggtctggat gtcgatctgt gccttgaacc cggcgtaacg      7140
     ggcactgctg atggcagttt gcagataaat tatggcgtgt ttttgccgcc attaacccgg      7200
     aacgcgggct attgatcacg aaaccgcttc caaaacgtca tgcaatcctg ggacgccagg      7260
     ttgcagaacc acggggggca cgggcacctc gcagcaagcc ctcagtgctc aaatcctcgt      7320
     ccaggtcagg ccagtgaatg ccgtagccgg ctcctgccag ctcccagtgg cttctttgct      7380
     ccggagatgc attgagaagg cgcggaaacc aggccagagg cacggcaatc gtccgaccat      7440
     ccatcaagcc gacgatcagc tcatagtcgg tcacagaaac agtacgaacc cgaatgtccg      7500
     gagtttcagt ctcggccaaa gaagccatac caactctcca aaagtgtctg ctgatggtcg      7560
     cgtgtcattc gtaggagcaa accgagttca cgtggtgaaa aaccagcatt cgaagccaga      7620
     gcgacaggtt cgagccaaag cttcgccgtt gcttcggccc gatcaatatg cacgtgcggc      7680
     ggttcgttcg gctcatggct gtagaaatag aaccgatatc cctcatgccg gaaaactacc      7740
     ggcattcacg attcctcccc cggccagaaa tcctcggtca tcatctgctc gaaagaccat      7800
     gggcagaccg ggcgaaacgt ctgatctgcc aagccagttt ccatagcggc ttcactgcgt      7860
     gccaggcggt aagcgcggct gattgcctca accagcctcg atctgaggct ggggttttcg      7920
     gtcaggtgct cggaaatctt atggcgctgg atgacgatac tggtccgcca gctgggcccc      7980
     tggaaattcg gctggtactg ccatttcagc aattgcagca gcaacaccct gatgcggctg      8040
     acgagttcgc gcatttcgcc gcggcccaag gtctcgatct cctcgatgat gttggcgaga      8100
     tcggcggcat cgaagcgcct ttcgcggagc agagcggcct gttcattggc ccaggcatag      8160
     aaatctcggt cgtaaagcgt tgcgttgctc atttggcatt ctccgaacct gccgatagct      8220
     ttgtccgtga ttgcacgttc agcacctcga tcccgactag gtgcccaatc tcatccatat      8280
     ccaacaggat gcctggttcc agctccctgg tctctgcaac ggtcgtgccc ttcgggccga      8340
     accggacata gaccgcatct gtatcaggat catagctggt cgtgatcatg gtctagatcc      8400
     tcgatcaaag ctccatgatt ctgagcgtta taccaaatgc gaaggatttc gacgtccggg      8460
     acggaaactc ggtggacgat cacgtggggc cagatcacgg tcagctccaa cgcccctgaa      8520
     actaagccag agctccctcg ctcgggcaga tattcgaacc gatcacaggc cgcgacgaat      8580
     tgcaccgcga cgcgggtggc tgcgtgcgag ttctcgcggc cgatatgttg gcggatatgg      8640
     gcgaggtcat cgagtgcctc agccgtgaag attaccggca ttcaggtttt gggagctcgt      8700
     tctctgttcc ccaggaaagc agccattgcc gaacttcctc gtagggcacg gtgcgcccgg      8760
     cgtccgcagc tacaatccct g                                                8781
//