Dbfetch

ID   CP000693; SV 1; circular; genomic DNA; STD; PRO; 37155 BP.
XX
AC   CP000693; AAOO01000000-AAOO01000076;
XX
PR   Project:PRJNA15753;
XX
DT   12-MAY-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Acidiphilium cryptum JF-5 plasmid pACRY05, complete sequence.
XX
KW   .
XX
OS   Acidiphilium cryptum JF-5
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acidiphilium.
OG   Plasmid pACRY05
XX
RN   [1]
RP   1-37155
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Han C., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Magnuson T., Richardson P.;
RT   "Complete sequence of plasmid5 pACRY05 of Acidiphilium cryptum JF-5";
RL   Unpublished.
XX
RN   [2]
RP   1-37155
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Han C., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Magnuson T., Richardson P.;
RT   ;
RL   Submitted (04-MAY-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; a9550cbddc6e07fb5f09e4c179bc2f91.
DR   BioSample; SAMN02598339.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000181
CC   Source DNA and bacteria available from Timothy Magnuson
CC   (magntimo@isu.edu)
CC   Contacts: Timothy Magnuson (magntimo@isu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..37155
FT                   /organism="Acidiphilium cryptum JF-5"
FT                   /plasmid="pACRY05"
FT                   /strain="JF-5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:349163"
FT   gene            45..392
FT                   /pseudo
FT                   /locus_tag="Acry_3586"
FT   gene            complement(525..5624)
FT                   /locus_tag="Acry_3587"
FT   CDS             complement(525..5624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3587"
FT                   /product="ATP-dependent exoDNAse (exonuclease V) alpha
FT                   subunit-helicase superfamily I member-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3587"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29183"
FT                   /db_xref="GOA:A5FUA1"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUA1"
FT                   /protein_id="ABQ29183.1"
FT                   /translation="MLTFRAGAASTSSGAAGKMADHLMTMTLPGFEQDMATYYQRGMTA
FT                   EGGLWQPGTEAAEDNAAATATDAARPGTIPEPRRDMHPAVAAALGIDTSRPLTRDEIAE
FT                   LLAGNRADGEKIAGKQYQRAVTPLAEVFGLDPMRLPTRAELENLLAGKRADGSDLPAAP
FT                   VEAPPSTRAQDAAPAVPEADETEDRDAALAAEAAALGELGHAPDGPPPWPDDFAPPPME
FT                   EAGGDDRDAALAADWQADVARGGEPAVPPRGPAAEERPAEPRAIDVAAALDAAGVPYRT
FT                   SGGRLRLQATWRGVDSWTVSVNATTGQWTDFAASEGGRFESLVRRLGVKAEAVELDPEA
FT                   AKAARAAEVRRNAFRKSIAGKLWDEAIPGAGELREPNLRGSVGQKLRQRAAHEARVEEA
FT                   EGMRASARAYLNGRGLDADWLMSHVRLVRPHPNYDSAEVAAGAAVVMLTPMFGQDEDGR
FT                   VRLTGVQRTYLTEGGAKIGRRMLGASGAWLLHPPAGAAVPIGGHDQARVAGEGFETVAS
FT                   VVQATRQAGVVGYDAGGLVAWAGQFTGSTPVALLADRDNARRHNGRDVGEAGQKAAAKA
FT                   AALIEANGGEVVYLEPPADVAGGAKGADWADALRAGGAAGLRQALAAAEASSAADRARI
FT                   EAKLAPASPSAAPDGPPAQVADQNQPAPHPELVRLYKALGAKDGNGLSETERANILDGK
FT                   RADGAALDAADWRNAVNRSKTPIGYVDFTFSADKTISLAWAFAPTEAERNQLAQAHKDA
FT                   VAATMAEIEQVIGQARKGKGGKEATEQGRIGWITFDHYTARPTLEIARETADGRTETEI
FT                   VSVKVAGDPQLHTHVAVPNVIVTESGRVVSLNTLQMHGRIHEWGAIYQAHLAQNLRRAG
FT                   ASIELDRTTGAARLSAVPEEIRAAFSKRTRDALSDAKAYAASVGAEWDRMTGDERIKLL
FT                   KGGAFASRSAKADDMSDFASWRRQAEERGYQHKSVLQDAAPAENLTEAARLDRAYEAAA
FT                   RVLGEQFARRAVIKDEDERVAAARGLVAAGIKDGGDVDRVIARLRARGVVETGGAGGNG
FT                   EPARTQIIAVETVRDDPDNPDVKITTTRLTTRAHVEQESALVELAAQAGQDRRGTLNPA
FT                   QVKRGIAASGLSFTGEHGVAQRRMIDHLGMSGRFAVGIGAAGAGKTTLLKPLVAAWRDQ
FT                   GADIHGISLGWRQARELREAGLNTEAETGGRDTIAAVSVFINRVESGRLDLSNRSVVVI
FT                   DELGTIGTRQMLDLLRLQERHGFRMVAIGDPKQCQSIEAGQVIGLLEKGLGEVPSIESS
FT                   VRQTNERAREIAGLLRKGGAEAVGKALDMKRQDGTAEIVAGGPSEVIARAAALWDERRK
FT                   ANADRPRFTLSISTPTNQDARAIGEAIRQRLLASGELGQSRMTLAAVDKNTGEHYAMPI
FT                   ATREKIRLFARTNAAMLDGGKGAIGDNGSILEITSIRDEGLVLRNDHGREGFVKWDTLA
FT                   DKETGRMRLAYGYAMTTNTAQGITTTEHIFVTPGGSQTTDGFKTYVSGSRHRERDYWLT
FT                   SEGAERQEIAGRRPLGDPRPIREHDIWTNWTRNIARQPEKTNALDLVKIGEEARRNAAR
FT                   AFLKGLAADEKREAAGLPSDLSQRFARTQARAGAQGSLTETMARAAEDKGQALARIERA
FT                   APAVRAAVAAGWERARPLIEAARRSARARLQSALEGHRRQAQRQAEAHTDEQESRKRGR
FT                   GR"
FT   gene            complement(5624..5956)
FT                   /locus_tag="Acry_3588"
FT   CDS             complement(5624..5956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3588"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29184"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUA2"
FT                   /protein_id="ABQ29184.1"
FT                   /translation="MPEPETAPMPPKDDRLDAVIQALRLMIETQNTHSQMLARLIELAT
FT                   PSEESPFEESLAEIAGALRDQTTALLQIGTTLDGLGAEVEAGVMRGLATALEPGDEATQ
FT                   QEAGEG"
FT   gene            6694..7419
FT                   /locus_tag="Acry_3589"
FT   CDS             6694..7419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3589"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29185"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUA3"
FT                   /protein_id="ABQ29185.1"
FT                   /translation="MAVSAIELRRRGYDDEDIALARTVQDANRRAGAPYRTLAEILSGQ
FT                   KARSRPSAPPEDLTTRQLGRRGRLGQAALLADQAALAENDPDRAAQMRYHAQGLKALAR
FT                   KPVQLEFDFFGGGNVSLGHQYIDAIQTRLLKTDATPADRMQALATLTMIVRHLGWQSYA
FT                   CDKTAAELCELLGVHRQHMSDTLALLERIGAITRTKRGRTKLITINPEGAFRGDVTRHA
FT                   EAVDRYRAEVVQLRPEPAE"
FT   gene            7583..7861
FT                   /locus_tag="Acry_3590"
FT   CDS             7583..7861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3590"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3590"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29186"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUA4"
FT                   /protein_id="ABQ29186.1"
FT                   /translation="MPVIFTAEALDDLAHIRQHIGRENPHAATRVAVQLVAACDRLEYL
FT                   PERGRTGLVSGTRELTVIWPYVIVYRISASSVEILRVWHGAQDRDGC"
FT   gene            8654..9310
FT                   /locus_tag="Acry_3591"
FT   CDS             8654..9310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3591"
FT                   /product="protein of unknown function DUF1555"
FT                   /note="PFAM: protein of unknown function DUF1555"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3591"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29187"
FT                   /db_xref="GOA:A5FUA5"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUA5"
FT                   /protein_id="ABQ29187.1"
FT                   /translation="MKRFLLASLLGLGALTACSGVALAGPEYSLALSESGYSTTSVSSS
FT                   TVAQYTGNYGTFSINSVSTLGVPTIGNAYATSSINTSSNSAGVLTVEATVTDLTSPLGT
FT                   YDMLSGLTSNLLTGGALSVAETTYLDPANVAFGMTDKLASNTFTSIGNDNVLTTTPALT
FT                   GPYSLTEMFVVTATGTGSANSTISMTDVPEPGSLILLGTGLLGLAAIMRRKRRRA"
FT   sig_peptide     8654..8728
FT                   /locus_tag="Acry_3591"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 25"
FT   gene            complement(10449..10988)
FT                   /locus_tag="Acry_3592"
FT   CDS             complement(10449..10988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3592"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29188"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUA6"
FT                   /protein_id="ABQ29188.1"
FT                   /translation="MAKNSREGNQSRKKRYYEALAERGIRPVQVLAPESAHPLIRQAAG
FT                   LMTREDDPLEPRAALRRAGGANEPESGEASPALAVELEAAKARIAEIERQAEALRVMAD
FT                   DAAERQRRALEVEQEKAQASAEEAQKAAISAQVAEGRAAEALRRAEKAEAAIRQAKAMP
FT                   GIKGRLVRFLAGDVLK"
FT   gene            11355..12896
FT                   /locus_tag="Acry_3593"
FT   CDS             11355..12896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3593"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3593"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29189"
FT                   /db_xref="GOA:A5FUA7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUA7"
FT                   /protein_id="ABQ29189.1"
FT                   /translation="MPARRELTMRQIRQMLRLAGDGISAREIGRMLGVARSTIQDNLKR
FT                   AQEAGLAWPVPAELTDAAIEERLFARSGYKQGVRRRAEPAWDELVCELKRPGVNLQVLW
FT                   EEYRDQHPDGYGYSRFCELFREFEARLSPVMRQDHRAGDKVFVDYSGKRIGIVDRASGE
FT                   VRQAEIFVGVLGASSFTYAEASWTQTLPDWIGAHVRMFRAFGGVPRLIVPDNLKSGVNK
FT                   PSFYDPEINLSYGRMASHYGVGVLPARPFRPRDKAKVESGVRFAQTYILGRLRRQTFFS
FT                   LAEANQAIAGMVDRINDYVMRRIGVSRRHLFETIERPALAALPASDYEFAEWGLARVAL
FT                   DYHVEVCGFFYSVPHELIRQQVDTRATERGIEIFHHGKRIAVHQRRYGGRKHGTDIEHM
FT                   PSAHRRYAEWTPERFRRWGASIGPHTEGLITAILASRPHPEQGFRTCLGILRLFKDLEP
FT                   ARAEAVADRAVAIGAFTYKSLASIVANKLDRSTAAAGEPQAVITHGNLRGSGYFH"
FT   gene            12908..13660
FT                   /locus_tag="Acry_3594"
FT   CDS             12908..13660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3594"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; IstB
FT                   ATP binding N-terminal domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3594"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29190"
FT                   /db_xref="GOA:A5FUA8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUA8"
FT                   /protein_id="ABQ29190.1"
FT                   /translation="MLTHPTLDQLHDLGLHGMAKGFKDLGAHPETASLDHAAWLALLLD
FT                   HETTLRRQKRFERLARVAKLRQAATVEDIDYRTARGLDRAMFLKLAGCDWIRAKHNLLI
FT                   TGPCGVGKSWIACALGQKACREDLSTAYHRVPRLFAALALARGDGRYAAMLRQIARVDL
FT                   LILDDWGPETLNADQRRDLLEIVEDRHDRRSIIITSQVPVDRWYEIIGDPTIADAVLDR
FT                   LVHNAYRIELTGESLRKKKNPATVTMQA"
FT   gene            13772..14719
FT                   /locus_tag="Acry_3595"
FT   CDS             13772..14719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3595"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3595"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29191"
FT                   /db_xref="GOA:A5FUA9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUA9"
FT                   /protein_id="ABQ29191.1"
FT                   /translation="MKSECMAGFIGIRSQLLAFFEKRPRCLIGMEACAGAHDWGRRLRE
FT                   LGHDVRLMPPSYVKPYVKRGKTDAADAAAICEAVTRPSMRFVAIKSEACSSVLVVHRTR
FT                   DFLVRQRTQIGNAIRAHMTEFGIVAAKGAQNVDRLKEQLDRLPEAAQLPVSLLFDQLAE
FT                   TDKRIDRLTDEIEEAFKQNETSQRLATIPGVGILSATIIAATTPDVDNFDCARDYAAWL
FT                   GLTPKPHSTGGKQKVGRISKMGNRYIRRLLYLGAIAQIMLRYRLKREPGADWLSSMLIR
FT                   KKTKVAAIALAHRMARTIFAVLRDGSRYRPQATA"
FT   gene            complement(14884..15282)
FT                   /locus_tag="Acry_3596"
FT   CDS             complement(14884..15282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3596"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29192"
FT                   /db_xref="GOA:A5FUB0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUB0"
FT                   /protein_id="ABQ29192.1"
FT                   /translation="MTRSHGRCARGERLRMGFPHGHRKTTTLVAGLRMTGMVAPMVLDG
FT                   PINGDWFEAYVTKVLTPELRPGDVVIMDNLSSHKRDAVRERIEAAGATLRFLPPYSPDF
FT                   NPCMDGSCGSRCRIGFGERVGCGHVCGV"
FT   gene            complement(15369..15755)
FT                   /locus_tag="Acry_3597"
FT   CDS             complement(15369..15755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3597"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3597"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29193"
FT                   /db_xref="GOA:A5FUB1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUB1"
FT                   /protein_id="ABQ29193.1"
FT                   /translation="MGQPLSMDLRRRLLAAIDEGMSCRAAAARFGVAPATAIRWRAQRR
FT                   DTGSFAPKPQGGDTRSRRVEERRADILAIWETRKDISLAELRLALIEVGLHVSVAGLHR
FT                   FFIRRGMTRKKRQATPSSRIAPIS"
FT   gene            complement(16045..16371)
FT                   /locus_tag="Acry_3598"
FT   CDS             complement(16045..16371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3598"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="PFAM: PemK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3598"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29194"
FT                   /db_xref="GOA:A5FUB2"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUB2"
FT                   /protein_id="ABQ29194.1"
FT                   /translation="MNRGDIYLVDLEPTAGHEQRGHRPVLVVSPDAFNRLTQCPVILPI
FT                   TNGGDFARRVGFAVPISGIKTTGVVRCDQPRALDLSARNARKVDTLPAAILDDVLATAA
FT                   TLFE"
FT   gene            complement(16371..16634)
FT                   /locus_tag="Acry_3599"
FT   CDS             complement(16371..16634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3599"
FT                   /product="transcriptional regulator/antitoxin, MazE"
FT                   /note="PFAM: SpoVT/AbrB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3599"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29195"
FT                   /db_xref="GOA:A5FUB3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUB3"
FT                   /protein_id="ABQ29195.1"
FT                   /translation="MHTTNLRKVGGSIMLAVPPALLDVLHLAPGTKVGLAVDNGRLVVE
FT                   PQARPRYTMADLLAEAEAAGVYPLPPEEREWIDAPAVGKELI"
FT   gene            16863..17522
FT                   /locus_tag="Acry_3600"
FT   CDS             16863..17522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3600"
FT                   /product="plasmid segregation oscillating ATPase ParF"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3600"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29196"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUB4"
FT                   /protein_id="ABQ29196.1"
FT                   /translation="MILTVGNTKGGVGKTTLAVQLAISRAMAGRDVWLIDGDRQGTAAA
FT                   AIAARSEAGRKPGIACAQYADGKELRGQVQQQRDKWQDIIIDAGGRDSTALRAALILSD
FT                   VLLVPFAPRSYDVWALDDMASLVDEANSVRDGLRCFAVMNQADPGEHSADNAEAAAAVA
FT                   EVPQFAYLPVPIRRRKAFSNAGGAGLAVAELAPRDPKACAELETLISSLFNIHTHS"
FT   gene            17537..17812
FT                   /locus_tag="Acry_3601"
FT   CDS             17537..17812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3601"
FT                   /product="plasmid segregation centromere-binding protein
FT                   ParG"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3601"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29197"
FT                   /db_xref="GOA:A5FUB5"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUB5"
FT                   /protein_id="ABQ29197.1"
FT                   /translation="MVIQRKPKTTPAAQAAAVDAFVSGAPDAAHAAPAAGAYNKGVVKG
FT                   NKRQISLTIAPDLLRRVDEIAKRTGQGRAGIINMAIYRAIEGDVFK"
FT   gene            18125..19235
FT                   /pseudo
FT                   /locus_tag="Acry_3602"
FT   gene            19545..19934
FT                   /locus_tag="Acry_3603"
FT   CDS             19545..19934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3603"
FT                   /product="Type IV secretory pathway VirD4 components-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3603"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29198"
FT                   /db_xref="GOA:A5FUB6"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUB6"
FT                   /protein_id="ABQ29198.1"
FT                   /translation="MANMREWFESVSWYGFAGVKTKAVAEELAAAIGEYGVLAWSEGSN
FT                   TGNSAKGLEAGTRSTGQTKTYHELKRQLIRAEEIMHDMRDDEQIIFPKSGRPLRCGRAI
FT                   YFRRPEMAARVGENRFAGKAVKAAE"
FT   gene            20084..20242
FT                   /pseudo
FT                   /locus_tag="Acry_3604"
FT   gene            complement(20298..23288)
FT                   /locus_tag="Acry_3605"
FT   CDS             complement(20298..23288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3605"
FT                   /product="transposase Tn3 family protein"
FT                   /note="PFAM: transposase Tn3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3605"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29199"
FT                   /db_xref="GOA:A5FU16"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU16"
FT                   /protein_id="ABQ29199.1"
FT                   /translation="MGHRRILTGEQIAQLFDPPTDRRGIIRHYTLSVTDLAMIRRGRGD
FT                   HHRLGLALMLCYLRYPGRPLHAGEIPDPALVSFVATQIDVLPDSLGAYLRVDQNRRRHS
FT                   AALQDRLGLRPWGPRVAADLADWLLAHALETDRLVDLAALVLEECRGRGVLLPRPAQLE
FT                   RLCIEVRYRARREIERLLTEGLSADQRRRLDALTERRLDTSQSWLAWLRQIPESAKPAS
FT                   MLGVIERLEHIRAIGIDPARGRRINQSRLAQLVREAGRTTVQHVAGYERRRRHAVLTAI
FT                   DLDLSARLTDQAITLFERLIGAMFRKAEGRHARAFQAEGRAINEKVRLYARIGAALMAA
FT                   RAGQGDPFAAIDKVIPWDRFCSTVMEAETLVRSEDFDPYEVLSEHYAGIRRWAPAFLAT
FT                   FEFQGVPAAASLMRAIAMLRAMNSAGASTLPKSAPTAFVRPRWARHVLTAHGIDRRYYE
FT                   LCVLAELRQRLAAGDVWVAGSRQYRAFEERLISRETFQVLQKESSIPVAVETDFERFIA
FT                   TRRTWLDARLAEIDIRARGGLLPDVTIEKGVLRITPIEKSTPPEAEALAAKLYAALPRI
FT                   RITDLLTEVAGWTGFPDCFTHLRTGEAAADPRVLMAGLLADGLNLGLTRMAEACSIASL
FT                   GQLAWTADWHIRDETYALALRRLVEHQSREPLAALFGSGTASSSDGQFFRAGGSGRDAS
FT                   RINAHYGPEPGLKFYTHLSDRYAPFHTRVIAATASEALHVLDGLLDHHGDAPPRQHRHH
FT                   TDGGGVSDHVFALCALLGYVFAPRIPDLKDRRLYSFARPAAYPTLAPMIAGRINVDLIR
FT                   THWPDLLKIATSIRTGTVSASVILRQLAAYPRQNAVAAALRELGRLERTLFTLDWLEDP
FT                   GLRRESSHELNKGEARNSLARAVFIHRLGEIRDRTFENQTHRASGLNLLVTAIILWNTR
FT                   YLAQAIQALRQVEDVPGTLLRHLSPIGWEHVNLTGDYIWSAKQKSSENHAGLRPLRPIH
FT                   DTTTHAA"
FT   gene            complement(23227..23886)
FT                   /locus_tag="Acry_3606"
FT   CDS             complement(23227..23886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3606"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3606"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29200"
FT                   /db_xref="GOA:A5FU17"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU17"
FT                   /protein_id="ABQ29200.1"
FT                   /translation="MLIGYMRVSTDNDRQVLDLQRDALLGAGVDERHLFEDRAGGSRRD
FT                   RPGLAAALAYLKSGDCLVVWKLDRLGRSLPHLLETVNSLRARGVGFRSLTEQMDTTTPQ
FT                   GEFLFHVFGALAQFERSLIQERVQAGLAAARRRGRRGGRPVAIDAEKLAAVIAALDAGA
FT                   TKASVCRTFGISRSTLVDSLARIGWSPILNRQEGGTSGSSTDIDRGTDRTAVRPAD"
FT   gene            23887..24159
FT                   /pseudo
FT                   /locus_tag="Acry_3607"
FT   gene            24319..25728
FT                   /locus_tag="Acry_3608"
FT   CDS             24319..25728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3608"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3608"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29201"
FT                   /db_xref="GOA:A5FUB9"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUB9"
FT                   /protein_id="ABQ29201.1"
FT                   /translation="MTTSAALPPVENTVSEALNQVVFSPFHLRAIFAAGMGFFASAYDL
FT                   FIIGTALTLIKGEWHLSPGSVALIGSISLAATFVGAFMFGRTADIFGRKSIYGLEALLM
FT                   TAGALLSAFAPNVTILLIARVILGFGIGGDYPLSAVLMSEYSNTKSRGRMVSLVFSTQA
FT                   AGLVVGPAIALTLLAAGIDHDIAWRIMLGLGALPAAMVIYIRRTLPESPRWLARVKGDG
FT                   TRAARELASFSLGTATSAGRDKVVKQPFSRYLLVFLGTAGTWFVFDYAYYGNTISTPMI
FT                   MQQIAPHADLLMSTAMSLIIFAAAAVPGYILAILTVDRIGHKRLQLIGFAGMGLMFLII
FT                   GLFPMLISTVGLFLIIYGLSYFFAEFGPNTTTFLLSSEVFPVNIRTTGHGASAGVAKVG
FT                   AFIGAFIFPILITDFGLYGTLRITFLFSMVGLVLTAVCLREPAGLSLEAVSNETTDEVA
FT                   MSPMMARASST"
FT   gene            26128..28587
FT                   /locus_tag="Acry_3609"
FT   CDS             26128..28587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3609"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3609"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29202"
FT                   /db_xref="GOA:A5FUC0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUC0"
FT                   /protein_id="ABQ29202.1"
FT                   /translation="MYNVMEPYIHRRHKKLMRPTSYKHIIFLLGTTAMATLPFSHTASA
FT                   QTVSSGGGTVVNAGEVTASSGALNTLLKLPTKREIFNSTQSIKVVGKKQIKALGPAAGA
FT                   AQALAVAPGVSIEADGTSGSPRAGISINGMKTGWGNIAGNSNDGTVMVTFDGVPMVDPA
FT                   YGVWQASEIPNLSFIKGLSVTYGPGYPINRWYDNIGGGLNFVPIEPTAKARADIGGYFG
FT                   SYGARGTNFSFDTGEHDGWSAVFAGTIGRSGNYLSGYGFNNPSNNYAYYAKIIKKFPGG
FT                   RISIGGFASRASAYRPVPIPVSPNSQVTINGDNPITGNSYPGPIYSQQTTGFYNTLPKS
FT                   IYYKRIPIRTYLIYSKFFDKLDSTTSFHNILFYRYGERIHEHYDNYGQSNNVLIQYFNA
FT                   HSQTFGDKAYFTFKLPYNTVSLGGYAVYNKFNSFLDYYNPNNPAVYDSGPNAGQPVLIN
FT                   GIPVNYSLVVPHNYHNSYLYETDLAAFAQDVIRPTKNIRLTPGLSVVSMHTDFVNNSLA
FT                   AFPYNTTTGLDSFVGVNGDRRPNSSTNFVEFEPSIGANYKINKNIALYANYSTAYKGVG
FT                   GASGTYAHFVATTLKPQKSNQYQFGIKVLIPNAPYLHHAIFSANYYHLNDLNQIIPIPI
FT                   ANQNYRRFASGSSVFHGFNLYFQDDPQYNIHVYANASFESANYANYVTGGQSYNGLPIS
FT                   NVPWVTFNGGLYYSFFKSNILYQPRIWYQYTGSQDIYNNNTGLPTRNKLGGYGILNLGM
FT                   KVALATSKVKFVHAVDFNLDLLNVLNNKYNSFEYYSGGGYYGIPGQLLAEPGAPFTAYG
FT                   SLNVKFR"
FT   sig_peptide     26128..26265
FT                   /locus_tag="Acry_3609"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 46"
FT   gene            28668..29333
FT                   /locus_tag="Acry_3610"
FT   CDS             28668..29333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3610"
FT                   /product="outer membrane transport energization protein
FT                   ExbB"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3610"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29203"
FT                   /db_xref="GOA:A5FUC1"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUC1"
FT                   /protein_id="ABQ29203.1"
FT                   /translation="MSYDYIVHLANYSDGVLYVLAGLFVIAVAVIIDRMWYLRRAILRG
FT                   GSIVRRMAAMGRVNEQDLAALRDFAGRMPEGLLLDTALNHMNDADHAGMNSRMDEAIML
FT                   VAPRLDRRMWVLDTIVTLAPLLGLFGTIIGMFHAFSILATPGHAPAEVTGGVADALVAT
FT                   ACGIFIAMIGLATFNMLQNQVRLIIHQLETIRTMVLNRTDGAPVVVPKPMDNTKSCGE"
FT   gene            29380..29670
FT                   /locus_tag="Acry_3611"
FT   CDS             29380..29670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3611"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29204"
FT                   /db_xref="GOA:A5FUC2"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUC2"
FT                   /protein_id="ABQ29204.1"
FT                   /translation="MFLGRFTMPRAISLRTDFDAATLRRQARRSREAALARRLLALAAI
FT                   YDGGTRSEAARLGHVTLQIVRDWVIRFNADGPDGLRDRKAPGPTPQLTAVS"
FT   gene            30222..31430
FT                   /locus_tag="Acry_3612"
FT   CDS             30222..31430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3612"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3612"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29205"
FT                   /db_xref="GOA:A5FU85"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU85"
FT                   /protein_id="ABQ29205.1"
FT                   /translation="MTDDRLPLAELLAKAGDGDFLRSVAEAVVQLLMEADVEGLIGAGR
FT                   HERTGERTTYRNGYRDRSLDTRLGNLQLRIPKLRQGSYFPPFLEPRKTSEKALVAVIQE
FT                   AWVGGVSTRRVDDLVQAMGLSGIGKSTVSKLCKDIDERVNAFLERPLTGDWPYLWLDAT
FT                   YLKQREGGRIVSVAAIIAVAANTEGKREIVGLHIGPSEAETFWAAFLKSLVRRGLRQVK
FT                   LVISDAHEGLKSAIRRVMGASWQRCRVHWMRNALAYVGKGQQSMVSAALRQAFIQPDRA
FT                   GASQTLRHTADQFRAKWPKLAAFIDDSEVDVLAHMDFPVQHRVKIHSTNPIERLNKEVK
FT                   RRADVVGIFPNEAAIIRLVGAVLLEQNDEWQTQNRYMQTEPMAELTPPAIDVFPPQIAT
FT                   AAE"
FT   gene            31513..32640
FT                   /locus_tag="Acry_3613"
FT   CDS             31513..32640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3613"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3613"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29206"
FT                   /db_xref="GOA:A5FUC4"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUC4"
FT                   /protein_id="ABQ29206.1"
FT                   /translation="MNALKKALAERALSAEMDYHLSDEAEAENSRNGYGRKSVSTGTGK
FT                   IEIAIPRDRAGSFDPQLIAKYQRRFPGFDDKIISMYARGMSTREIAEHLREIYGMDASA
FT                   ELISTITDAVLDEVTSWQQRPLDPVYPLVFFDAIRVKIRDEGVVRNKAIHIALGVMADG
FT                   TKVVLGMWIEQNEGAKFWLRVMNELKNRGVEDILLAVVDGLKGFPEAITAVFPETIVQT
FT                   CIVHLLRNSMDFVSYKDRKAVATALKDIYRAVDAGAAEAALADFEAGPWGQKYPAIGQS
FT                   WRRVWQEVIPFFSFPGEVRRIIYTTNAIEALNSKLRRAIRARGHFPSDEAAAKLLYLIL
FT                   NRSEKDWVMPPREWAMAKAQFALIFGDRFVRALAA"
FT   gene            complement(32743..33822)
FT                   /locus_tag="Acry_3614"
FT   CDS             complement(32743..33822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3614"
FT                   /product="Transposase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3614"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29207"
FT                   /db_xref="GOA:A5FUC5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUC5"
FT                   /protein_id="ABQ29207.1"
FT                   /translation="MADETEQVWGGRLFAPLRRRGHSKEGRDNQPQVIIAMAVTRDGMP
FT                   VRSWVLPGDTADVATVARIKEDLRAWNLGRCLFVGDAGMYSADNLAALSKGLGRYILAV
FT                   PMRRLRDVDEAVLTRRGRYRKVADNLQVKEVVVGDGERRKRYVLCLNPEEAERQRRHRD
FT                   EVLASLRAELALLAARDADHPRAACALLTSRRYGRYLSTDDAGRPHLDSGKIAHAARFD
FT                   GKFVVITNDDTLSAEDVALGYKGGAIIEACFRRMKQTGLEVRPMFHWSPRRIEAHVRLC
FT                   VLALQMQRAAELRCSLPWARIAHSLAGLKAVRYQVEGRTIVQRTKIRPEAAEILKNLGI
FT                   STPKKLLSVTEPRHTQVAA"
FT   gene            complement(33928..35151)
FT                   /locus_tag="Acry_3615"
FT   CDS             complement(33928..35151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3615"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3615"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29208"
FT                   /db_xref="GOA:A5FUC6"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUC6"
FT                   /protein_id="ABQ29208.1"
FT                   /translation="MARRKAPAIPDELLDQLLAGGDAAAALNSGDLVNALKKALAERAL
FT                   SAEMDYHLSDEAEAENSRNGYGRKSVSTGTGKIEIAIPRDRAGSFDPQLIAKYQRRFPG
FT                   FDDKIISMYARGMSTREIAEHLREIYGMDASAELISTITDAVLDEVTSWQQRPLDPVYP
FT                   LVFFDAIRVKIRDEGVVRNKAIHIALGVMADGTKVVLGMWIEQNEGAKFWLRVMNELKN
FT                   RGVEDILLAVVDGLKGFPEAITAVFPETIVQTCIVHLLRNSMDFVSYKDRKAVATALKD
FT                   IYRAVDAGAAEAALADFEAGPWGQKYPAIGQSWRRVWQEVIPFFSFPGEVRRIIYTTNA
FT                   IEALNSKLRRAIRARGHFPSDEAAAKLLYLILNRSEKEWVMPPREWAMAKAQFALIFGD
FT                   RFVRALAA"
FT   gene            35342..35629
FT                   /locus_tag="Acry_3616"
FT   CDS             35342..35629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3616"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3616"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29209"
FT                   /db_xref="GOA:A5FUC7"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUC7"
FT                   /protein_id="ABQ29209.1"
FT                   /translation="MDDAEADVLAYMNFPAQHRAKLHSTNPLERLNGEIKRRSDVVGIF
FT                   PNEAAVVRLIGALLLEQHDEWAVQRARYMTLETIAPLGDTPTVSLPTIAA"
FT   gene            35908..37095
FT                   /locus_tag="Acry_3617"
FT   CDS             35908..37095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3617"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29210"
FT                   /db_xref="GOA:A5FUC8"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUC8"
FT                   /protein_id="ABQ29210.1"
FT                   /translation="MTTMIRRVIAASKNVPEWTLFLAFLLPIGVGLIQRFSRPNHWFRD
FT                   YDAVSCAASRIAQHSELYVHTTHCILRKPTPYVYPPYLASLWSALQHSTGISGATALYG
FT                   GLYYFLLIYILRILITGRSVGGQGWLRACLLTVIGADIFICGNIAVIVHCTLALCAVLF
FT                   WEIPIVLVAGIICAAAIKPIFLVYNAVFLLHPMRWRQKIFYTGLATAGGILPFVAFMKL
FT                   SPHLFTHDMALIRYYALINDRGAGFLNLMSLIGLRQFSADMATLYVIGVAILLSSAIYI
FT                   CRVAQARANQRIWIGITVSILSDPRLMFYDVLTLAPGIVSLVGLSARLGRSAERVGGGL
FT                   VVALCIACAVLNSRGGQYGLYVFVPAAYVLIIALAGGFLVESWRSREQSIKGIPG"
XX
SQ   Sequence 37155 BP; 7004 A; 11511 C; 11099 G; 7541 T; 0 other;
     tgcacgttct gaggatgccg gcgtcagtag gtggcatagg tcaaatgcac atccctgcga        60
     catggttgac ggttctggca aaggtcggct ttgcgccccc tcgagtcaca catgatcgtt       120
     gcacgaatat tgaggcgggc gcgtggatca tggcgttcga ccgcatgcga accaggctta       180
     gaacgtcagc gcccgcagcc gcacccgcgc cgttcctccc gagtgctgcg acgcagaatg       240
     atcggggcgc ggcggtatca gcgtcgtgca ttcaaggcgc ggcacggttt taccatctgc       300
     ctgtcgcact gttctctgcc gtgcttcgca cggagggcgg cactgtcggc cagagttatc       360
     ggccgggacc aagcggcttt ggcacagctc accgcttttg ggggggataa agcttgatca       420
     tttgggaatg cgacaccaca gatcatgcgg ctctgaacca agtccttctc agcttccttg       480
     gcccgccctc ccggcataga gaaggcccca tctggtggcc gttgctaccg cccgcgtccg       540
     cgcttccggc tttcctgctc atccgtatgc gcctcggctt ggcgctgcgc ctggcgccga       600
     tgcccctcca gcgcgctctg tagtcgcgcc cgggcgctcc gacgcgcggc ctcgatcaac       660
     ggtcgcgccc gttcccagcc cgccgccacg gccgcccgaa cggccggggc agcccgctca       720
     atgcgggcca acgcctggcc cttatcctcg gcagcgcgag ccatggtttc agtcaagctt       780
     ccttgcgcgc cagcacgggc ctgggtgcgc gcaaagcgct gggacaggtc agagggcaag       840
     ccggcggcct cgcgtttctc atcagccgcc agccccttga ggaaggcgcg ggcggcattg       900
     cggcgggcct cctcgccgat cttcaccaga tcgagcgcat tggtcttttc cggctggcgc       960
     gcgatgttcc gcgtccagtt cgtccagata tcgtgctcgc ggatcggacg cggatcaccc      1020
     aacggccgcc gccccgcgat ctcctgtcgc tcggcacctt ccgaggtcag ccagtaatcc      1080
     cgctcccggt gcctcgaccc ggacacatag gtcttgaagc cgtccgtggt ctgcgagccg      1140
     ccaggtgtta caaagatatg ctcggtcgtg gtgatgccct gagccgtgtt ggtggtcatg      1200
     gcatagccgt aggccagccg catccggccg gtttccttgt cggccagcgt atcccatttc      1260
     acaaagccct cgcggccatg gtcgttccgc agcaccaggc cctcgtcacg gatgctggtg      1320
     atttccagga tcgagccgtt atcgccgatc gcgcccttgc cgccatccag catcgcggcg      1380
     ttggtccggg cgaagagccg gattttttcg cgggtcgcga tcggcatggc gtagtgctcg      1440
     ccagtgttct tgtcgaccgc cgccagcgtc atgcggctct gccccagctc gcctgaagcc      1500
     agcagccgtt gccggatcgc ctcgccgatc gcgcgcgcgt cctgattggt aggtgtgctg      1560
     atcgaaagcg taaagcgcgg ccggtcagcg ttcgctttcc gccgctcatc ccagagcgcg      1620
     gcggcccgcg cgatcacctc gctggggcca ccggcgacga tctcggccgt gccgtcctgc      1680
     cgcttcatgt ccagcgcctt gccaacggct tcggcgccgc ctttgcgcag caagcccgcg      1740
     atttcgcgcg cacgttcatt ggtctgccgc acgctgcttt cgattgaggg cacctcgccc      1800
     agcccttttt cgagaaggcc gatcacctgg cccgcctcga tcgactggca ttgcttcgga      1860
     tcaccgatcg ccaccatgcg gaacccgtgc cgctcctgaa gccgcaacag atcaagcatc      1920
     tggcgcgtgc cgatcgtgcc tagctcatcg atcaccacga cgctgcggtt ggacaaatcc      1980
     agccggccgc tctccacccg gttgatgaac accgacacgg ccgcgatcgt gtcacgcccg      2040
     ccggtctcgg cctcggtatt cagcccggcc tcgcgcagtt cgcgcgcctg gcgccagcca      2100
     aggctgatcc cgtgaatatc cgcgccctgg tcacgccacg ccgccaccag cggcttcaac      2160
     agcgtggtct tgcctgcccc ggccgccccg atccccaccg cgaaacggcc gctcatgccg      2220
     agatgatcga tcatccggcg ctgcgccacg ccatgttcgc cggtgaaact taacccgctc      2280
     gccgcgatcc cgcgcttgac ctgggccggg ttgagcgtgc cgcgccggtc ctggcctgcc      2340
     tgtgccgcca gttcgaccag cgcgctctcc tgctcgacat gggcgcgcgt cgtcagcctg      2400
     gttgtggtga tttttacatc cgggttgtcc gggtcatccc gcacggtctc gaccgcgatg      2460
     atctgggtgc gcgcgggctc accgttgccg ccagcaccgc ccgtctcgac aaccccgcgc      2520
     gcccgcaacc gcgcaatcac ccggtccaca tcgccgccat ccttgatgcc ggccgccacg      2580
     aggccacgcg ctgcggcaac ccgctcgtcc tcgtccttga tgaccgcccg ccgggcaaac      2640
     tgctcgccca gcacccgcgc agcggcctca taggcccggt caagccgagc cgcttccgtc      2700
     aggttctccg ccggcgccgc gtcctgcaga acgctcttgt gctggtagcc gcgttcctcc      2760
     gcctggcgcc gccaactcgc gaagtcgctc atatcgtcgg ccttggcact gcggctggca      2820
     aaggcgccgc ctttcagcag cttgatccgt tcatcgccag tcatgcggtc ccactccgcg      2880
     cccaccgagg cggcataggc tttcgcgtcg gaaagggcat cgcgggtccg cttactgaac      2940
     gccgcccgga tctcctccgg cacggcgctg agccgcgccg cgccggtggt tcggtccaat      3000
     tctatactgg ccccggcccg ccggagattc tgggcaagat gggcctggta gatcgccccc      3060
     cattcatgga tgcggccatg catctgcaac gtgttcaggg acaccacacg gccgctctca      3120
     gtgacgatga cattcggcac cgcgacatgc gtatgaagct gcggatcacc agccaccttc      3180
     acggagacga tctcggtttc cgtgcggccg tccgctgtct cgcgggcgat ttcgagggtg      3240
     gggcgggcgg tgtagtggtc aaaggtgatc cacccgatgc ggccctgctc agtggcttcc      3300
     ttgccgcctt tgcccttccg cgcctggcca atgacctgtt cgatctcggc catggtcgcg      3360
     gccaccgcat ccttgtgcgc ctgggcaagc tggttgcgct ccgcctcggt cggcgcgaag      3420
     gcccatgcca acgaaatcgt cttgtcggcc gagaaggtaa aatcaacgta gccgatcggg      3480
     gttttcgagc ggttcaccgc gttccgccaa tcggccgcat ccagcgccgc gccatccgcc      3540
     cgcttgccat caaggatgtt ggcccgctcg gtctcggaaa ggccgtttcc gtccttggcc      3600
     cctagcgcct tgtagagccg cacaagctcg ggatgggggg caggctggtt ctggtcggcc      3660
     acttgggctg gcggaccatc cggcgccgcg ctgggagagg cgggcgccag cttcgcctcg      3720
     atccgcgccc ggtcggccgc actcgacgcc tcggccgccg ccagcgcctg ccgcaaaccg      3780
     gccgcaccgc ccgcgcgcaa ggcatcggcc caatcggcgc ccttcgcccc gcccgcaaca      3840
     tcagccggtg gctcaagata gaccacctca ccgccattgg cctcgatcag cgccgccgcc      3900
     ttggccgcgg ccttctgccc ggcctcgccg acatcacggc cattatggcg gcgggcattg      3960
     tcgcgatcgg ccagcagcgc aaccggcgtc gagccggtga actgcccggc ccaggccacc      4020
     agaccgccgg catcgtaccc gacaacacca gcctgccgcg ttgcctgcac cacgctcgcg      4080
     acggtctcga agccttcacc ggcaacccgc gcctggtcat ggcctccgat cggcaccgcc      4140
     gcgccagcag gcggatgcaa cagccaggcc cccgaggcgc ccagcatccg gcggccgatt      4200
     tttgctccgc cctcggtcag ataggtgcgc tgcacgccgg tcagccgcac ccggccgtcc      4260
     tcatcctggc cgaacatcgg cgtcagcatc accaccgcag ccccagccgc cacttccgcc      4320
     gaatcatagt tcggatgcgg acggaccagc cgcacatggc tcatcagcca atcggcatcg      4380
     aggccgcgcc cgttgagata ggcacgggct gacgcccgca tgccttcggc ctcttccacg      4440
     cgcgcctcat gcgccgcccg ctgccgcaat ttctgcccca cggacccgcg caaattcggc      4500
     tcgcgcaatt cgcccgcgcc cggaattgcc tcatcccaga gtttcccggc gatgctcttg      4560
     cgaaaggcgt tgcgccgcac ctcggccgcg cgcgctgcct tggccgcctc ggggtccagc      4620
     tcaaccgcct cggctttgac gcccagccgc cgcaccaggc tctcgaaccg cccgccttcg      4680
     ctggcggcaa aatcggtcca ttggccggtg gtggcgttga ccgaaaccgt ccagctatcc      4740
     accccgcgcc aggtcgcttg caggcgcaac cggccgccgc tggtccggta gggcacaccg      4800
     gcggcatcaa gcgccgctgc aacatcgatc gcgcgcggtt ccgctggcct ctcctcggcc      4860
     gccgggccac gcggcggcac cgcaggttca ccgccccgcg caacatccgc ctgccagtcg      4920
     gccgccagcg ccgcatcacg atcatcccca cccgcttctt ccatcggggg cggggcaaaa      4980
     tcatccggcc agggcggcgg gccgtctggt gcgtgcccca gctcgccaag cgccgccgct      5040
     tcggcggcaa gggctgcgtc gcggtcctcc gtctcgtccg cctcgggcac tgccggcgcc      5100
     gcgtcctgcg cacgggttga aggcggcgcc tccacgggcg cggccggcag atcggacccg      5160
     tcagcccgct tgccggcaag caggttttcc agctccgcgc gggtcggcag ccgcatcgga      5220
     tcaagcccga acacctcggc aagcggcgtc accgcgcgct gatactgttt gcccgcgatc      5280
     ttctcgccgt ccgcccgatt gcccgccagc agctcggcaa tctcgtcacg ggtcagcggg      5340
     cgcgaagtgt cgatccccag cgcggcagca acggccgggt gcatgtcgcg ccggggctcg      5400
     ggaatggtgc cggggcgagc cgcgtccgtg gcggtggccg ccgcgttatc ttccgccgcc      5460
     tcggtgcccg gctgccaaag gccgccctcg gccgtcatgc cgcgctgata atacgtcgcc      5520
     atgtcctgct cgaagcccgg cagcgtcata gtcatcaggt ggtccgccat cttcccggcg      5580
     gcaccggatg aggtggaggc cgcaccggcg cggaacgtca gcatcagcct tcgcccgcct      5640
     cttgctgcgt agcctcgtca cctggctcta gcgccgtggc gaggccacgc atcaccccgg      5700
     cctcaacctc tgcccccagc ccgtccagcg tcgtgccgat ttgcaggagc gcggtggtct      5760
     gatcgcgcag cgccccggca atctccgcca gggattcctc aaacgggctt tcctccgaag      5820
     gggtcgccag ctcgatcaac cgcgccagca tttggctgtg cgtgttctgc gtctcgatca      5880
     tcagccgcag cgcctggatg acggcatcga ggcggtcatc tttcgggggc atcggggcgg      5940
     tttcgggctc gggcatcggg cggaactcct gcccaccacc ctaacgccat tgcctcttgc      6000
     gccgcaagct ccataggtgc aatggtctgt gaccccctct ctgcttccgc cgcccgcaca      6060
     ctggcgggaa tttggcgggc tttctggcgc ggatatgctg tgactattgc ggcgtttaat      6120
     gccgtggatg tgacggggat atgccgggct caggggtttc ggaaccacag ggcatcaagc      6180
     cgggacgacg ccctctccgt ggccccagag gcgcacggcg gatcacatcg agtgcgaagt      6240
     acgagtaagg ccagccgacc gtgtttgtga ctacaaacac ccatcttgcc gccagaggct      6300
     ttccaggtca cctggtcgag ttcgacccct cgccattgcc cccccttttc tcaatgccgt      6360
     ttcgctctcc tcctcgctgc ccctgacctg gtggcgcggg tcgagcgcag cgcgggagac      6420
     ccgtagggcg caacgcgccc gcgccgggca ctgtcctttc cgccacgcgg ccctccgggc      6480
     cgccgatttc ggttaaatcg caccgcgatt ttccggcttt ctgatctatt cttttcttag      6540
     gttaggatac cgccggaaga ttgggtcaca aaccggacct attgctctag gttttctgcg      6600
     gctttggcca tgttttcgtt tcgaaaatct cttgacgatt gtcacctagg gggtgacagt      6660
     tgtcacctac caggtgacaa tcggagtcgc gccatggccg tatccgctat cgagttgcgt      6720
     cgtcgcggct atgacgacga agacatcgct ctcgcccgga cggtgcagga cgccaaccgc      6780
     cgtgccggtg cgccctaccg gacgctcgcg gagatcctct ccggccaaaa ggcacgatcc      6840
     cgcccctcgg ccccgcccga ggatctgacc acccgccagc tcggccggcg tggccggctc      6900
     ggtcaggccg ccctgctcgc cgatcaggct gccctcgcag agaatgatcc cgacagggcc      6960
     gcgcagatgc gctatcatgc ccaaggattg aaagccctgg cccgcaagcc agttcagcta      7020
     gagttcgatt ttttcggagg cggcaacgtg agcctaggcc accagtacat cgacgccatc      7080
     cagacccgcc tgctcaagac cgacgccact ccggccgacc ggatgcaggc tctggcaacc      7140
     ctgacgatga tcgtccgcca tctcggttgg cagtcctatg cctgcgacaa aacggccgcc      7200
     gaactctgcg agctgcttgg tgttcatcgc caacatatgt ccgacaccct cgcactactg      7260
     gaacggatcg gggcgatcac gcggaccaaa cgcgggcgca ccaagctcat cacgatcaac      7320
     cccgaggggg cgtttcgggg ggatgtgacc cgccatgccg aggcggtcga tcgctaccgc      7380
     gccgaagtcg tccagctacg cccggagccc gccgaatgat cccaaatccc acctccatgc      7440
     cggatgaccc ggataccgaa gccttcgttg ccgcggtcaa ggacgggatt gcgtctgccg      7500
     acgccggccg cacagtgccc tacgaagatg tgcggaaatg gctactctcc tggggaaccg      7560
     agaacgagtt gcccaagcct gaatgccggt aatcttcacg gccgaggcac tcgatgacct      7620
     cgcccatatc cgccagcaca tcggccgcga gaaccctcac gcagccacgc gcgtcgcggt      7680
     gcagctcgtc gcggcttgtg accggctcga atatctgccc gagcgcggcc ggactggctt      7740
     ggtttccggg acgcgggagc tgacggtgat ctggccctac gtgatcgtct atcggatttc      7800
     cgcttcgagc gttgaaatcc tccgtgtctg gcatggggcg caggaccggg atgggtgctg      7860
     agatgctgac gcgggccgcc agacggcaag tcatcgcggc gtggctcctg tggcagcgga      7920
     tcatgggagt gtgggatgaa ttctttgcct agagcccgct ccgagttcct gatggcccct      7980
     tctggggccg gtcgagcatg ctgcgcagac ccaggcccca gaaggggcca tcttgggggg      8040
     gcgtataaca tccccccaga attctcattc tgacacaaac ggcagcaaat cagacctatt      8100
     tcccccaggg ttttccttgt gtttaggctc ccggaatttt ggctccccgc tgatctgacc      8160
     gttgtcatcg ttctcttttt gtacctacca ccagtgccct tgcgcgtacg gcttgaatgc      8220
     cgtgccccac ttagcgccgt cttgttgcct cagcggtttt gtgatcgctg ccagtcgttc      8280
     gatccaagta ttcgtgccgg cctggcgcgc ctgtggcggg gtgctttgac agtctctgtg      8340
     gcggggttac tctgggctcg ggcgccgcgc cgggcgtcaa cgatctgacg acttcccggt      8400
     gacttgctgg gagtttccat aatgcagaat tctggctcac cgacagacag tcacgcttcc      8460
     cacctgctgc ggcgcggttg gcgtccgcgc tgtcgcacat gtcgcaccaa tatccgcgaa      8520
     actcgcaatc acctgtcagg attctttaca tttccgccaa gacgaatttt tacatccttg      8580
     attctaatac ataaaatcta ttggcacaaa atttgctcac tacatttaag gcctactttt      8640
     ggaggttttt ctaatgaaac gttttctttt ggcttcactg cttgggcttg gtgcgcttac      8700
     cgcctgttct ggagtcgcct tggcaggccc cgaatactca ctggcgctgt ccgaaagcgg      8760
     ctattcgaca acctcggtca gctcatccac ggtcgcacag tatacgggta attacggaac      8820
     cttttcgatc aattcggtgt ccaccttggg ggttccgacc atcggaaacg cttacgccac      8880
     gtcctcgatc aacacgtcct cgaacagtgc tggggttttg acggtcgagg ccacagtgac      8940
     ggatctgacc tctccgctcg gtacctatga catgttgagc gggctgacga gcaacctgct      9000
     gaccggcggc gctctttctg tggctgaaac gacctacctc gatccagcca acgttgcatt      9060
     cgggatgacc gataaactcg cctccaatac tttcacgtca atcggcaacg acaatgtgct      9120
     taccacgaca cccgcgctga ccggtcctta ctcgttgacc gaaatgttcg ttgtgacggc      9180
     gacgggaacg ggttctgcca actcgacgat tagcatgacc gacgttccgg aaccgggctc      9240
     cctgattctg ctcggcaccg gcctgctcgg cctcgccgcg atcatgcggc gtaagcgtcg      9300
     ccgcgcctga cgacaaaagc cgggcgccaa aacggcgccc ggtcgtcggc gctgcaggaa      9360
     cacgtcacaa catgcctcgc gcttcgcgtc acgtcgtgac gacactacct tggctgcgcc      9420
     gcaatgaagt cgctgcccct tttcgagcgc cgccaaggat gctggttctg gcattacgga      9480
     cattcgccca atttatacaa ccaaagattt ttttcatgat gactcgacca aaagtagtgt      9540
     cagtatattt tacatctcgc ttgtctaaaa tattttatgc attgatttta cgagcttatt      9600
     tggctcggca cgggaattgc tagttctgtt ttgcggccca aatcggcgcc tcccctgcgt      9660
     aaagcagccg aaccgaaatg aaccgaccgc gtcagtcaac gccagccttt cgaaagggac      9720
     gttcatgttg aagtttcgcc atgttgccag cgctgtcgtc atcctggggc ttacaacggc      9780
     aggcgctcgc gccagcctga tcgccgatgg cctcacctat acgctgaccg aatcagcgac      9840
     agccaatccc ttaacggatc agttcaccct taatatcgca ggcataaatg ggccttccga      9900
     tacagaaggt gggcgctatg gcgtacagtc gtttgctttc aaccagccct caaattttgc      9960
     gagtgctctg gccccgtcag gattcacaga atcaatagga ggtctaaacg caaacggctg     10020
     taatgggact ggaaatttct actgcttcat ggccgaaaca actccaaccg gccccgtgtt     10080
     gccggccaat acaagcatta attatgtatt cgatgttacg ttgtcgtctg ggacattttc     10140
     tggatatagt ccggatttta agattaactg ggatgggata aagaataatt atgatcttat     10200
     atcagaaacc ctgacgccga cacccggtac accagtaccc gaacccggct cccttcttct     10260
     gctcggcact ggccttgtcg gtcttggttt ggtcgggcgg cgcaaattct ccaaacgata     10320
     cctctgatag aggtagagct tactgccgct tggggtgggg ttcacaaatc aagaatttcg     10380
     caccacaccc gccccatagg ccggaagcag ggttttttgt tgcataagtc cggtgcagcg     10440
     gcctcctgct atttcagaac atcgccggcg agaaaccgga ccagacgacc tttgattccc     10500
     ggcatagcct tggcctgtcg gatagcggcc tccgccttct ccgcgcgccg gagtgcctct     10560
     gccgcccgcc cttcagctac ctgggcggat atggcggcct tctgggcctc ctcggcgctc     10620
     gcctgcgcct tctcctgctc aacctctagc gcccgcctct gacgctcagc ggcgtcgtcc     10680
     gccatgacac gcagtgcctc tgcctgacgc tcgatttccg cgatccgagc tttggcggct     10740
     tccagttcca cagccagggc cggcgatgcc tcgccggact ccggttcatt cgccccacca     10800
     gctcgccgca gggcagctcg cggttctaat gggtcatctt cgcgagtcat gagacctgcg     10860
     gcctgtcgga tcaggggatg ggcactctcg ggggcgagta cctggacggg ccgaatgccg     10920
     cgttccgcaa gcgcctcgta atagcgcttc ttccggcttt ggtttccctc tcggctgttc     10980
     tttgccatgc catgtcatgg caaatccata ccatggcatg gctatccggg gcacgattgc     11040
     cacctctgaa caactctttc ctcactgagt tgcacagcaa ctcgtgagtg cggttttcca     11100
     cggtttgctc acgctcccca ggcgggggac tgcgccagcc ggtgaggccg ccctggagcc     11160
     atggcagggc ttccggtgcg gattccgatt gaagccggcc aggtattccg aggtgaagcc     11220
     ggccaccgtt ccgatttgaa gccggccggc attccgattt cattccggcc acctgactga     11280
     ggttttgagc gttatttggc tgggtcagcg actcgggcat ctgccttctc gtgatcaacc     11340
     acgtggagga ttggatgccg gccaggagag agctgacgat gcggcagata cgacagatgt     11400
     tgcggcttgc cggggacggc atcagcgcgc gggagatcgg gcggatgctc ggtgtggcgc     11460
     gcagtacgat ccaggataac ctgaagcggg cacaggaggc ggggttggcg tggccggtgc     11520
     cggccgagct gaccgatgcg gcgatcgaag agcggctgtt tgcccgcagt ggctacaagc     11580
     agggggttcg gcgccgtgcc gagccggcct gggacgaact ggtctgcgaa ctgaagcggc     11640
     ctggggtgaa tctgcaggtg ctttgggagg agtaccgtga ccagcacccg gacggttacg     11700
     gatattcgcg gttctgcgaa ctgttcaggg aattcgaggc ccgcctgtca ccggtcatgc     11760
     gccaggatca tcgtgctggc gacaaggtct tcgtcgatta ttccggcaag cggattggca     11820
     ttgtcgatcg ggcgagtggc gaagttcgac aggcggagat cttcgtcggc gtgctcggcg     11880
     catcgagctt cacctatgcg gaggcgagtt ggacccagac gctgccggac tggattggcg     11940
     cgcatgtccg catgttccgc gcatttggcg gtgttccgcg gctgatagtg ccggataatc     12000
     tgaagtccgg cgtcaacaag ccatcgttct acgatcccga gatcaacctc agctacgggc     12060
     gcatggcgtc acattacggg gtcggtgtgc tccctgcgcg tccgttccgg ccccgcgata     12120
     aagcgaaggt ggaatccggg gtacgctttg ctcaaaccta tatcctgggg cgtctgcgcc     12180
     ggcagacgtt cttctcgctg gccgaggcca accaggcgat cgccggcatg gtcgatcgga     12240
     tcaacgacta tgtcatgcgc cggatcggcg tcagccgccg gcatctcttc gagacgatcg     12300
     agcggcccgc gctcgcggcg ttgccggcat ccgactatga attcgccgaa tggggtctgg     12360
     cacgggtcgc gctggattat cacgtcgagg tctgcgggtt tttctactcg gtgccgcatg     12420
     aactgatccg ccagcaggtc gatacccgcg cgaccgaacg cggcattgag atattccacc     12480
     acggcaagcg cattgcggtt caccagcgtc gctacggcgg ccgcaagcat ggcaccgata     12540
     tcgagcacat gccgagtgcc caccggcgct acgccgaatg gacgccggag cggttccgcc     12600
     gctggggcgc ctccatcggc ccgcataccg aagggctgat caccgccatc ctcgccagcc     12660
     ggccgcatcc cgagcagggg ttccggacct gtctcggcat tctccgattg ttcaaggacc     12720
     tcgaacccgc ccgcgctgag gccgtagccg accgcgccgt cgcgatcggt gcgttcacct     12780
     acaaaagtct cgcctcgatc gtcgccaaca agctcgatcg ttcaaccgcc gcggcgggcg     12840
     agccccaggc ggtcattacc cacggcaatc tccgtggttc cggctatttt cattgaaagg     12900
     accaaccatg ctgacccatc cgaccctcga tcaactgcac gaccttggcc tgcatggcat     12960
     ggccaaggga ttcaaggatc ttggggcgca tcccgagacc gccagcctcg atcatgccgc     13020
     gtggctggcg ttgctgctcg atcacgagac aacgctgcgg cggcagaagc gttttgagcg     13080
     gctggcccgc gtggccaagc tgcgccaggc ggccaccgtc gaagatatcg attatcggac     13140
     cgcacgtggt ctggatcgcg cgatgtttct caaactcgcc ggatgcgact ggatccgcgc     13200
     caagcataat ctgcttatca ccggtccctg cggcgtcggc aaaagctgga tcgcctgcgc     13260
     cctcggtcag aaagcatgcc gtgaggattt gtccaccgcc tatcaccgtg tcccgcgact     13320
     gttcgccgca ttggctctgg cgcgcggcga tggccggtac gccgcaatgc tccgccagat     13380
     cgcgcgggtc gatctgctca tcctcgacga ttggggaccg gagacattga acgcagatca     13440
     gcgccgtgac ctgctcgaaa tcgtcgagga ccgccacgac cgccgatcca tcatcatcac     13500
     cagccaggtg ccggtcgatc gctggtacga aatcatcggc gatcccacca tcgccgacgc     13560
     cgttctcgat cgactggtcc ataatgccta ccggatcgaa ctgacaggcg agagcctccg     13620
     caaaaagaaa aaccccgcta ccgtcaccat gcaagcttga ccccaggaaa ggacaagacg     13680
     atctttaaca tgtgacctaa ccgaacgacg cgcaggtggc cggcttcaaa tcggaacggt     13740
     ggccggcttc gtttcggaat gggtggccgg aatgaaatcg gaatgcatgg ccggcttcat     13800
     cggaatacgc agtcagttgc tggcattttt tgagaagcgt ccgcgatgcc tgatcggcat     13860
     ggaggcttgc gcaggtgctc atgactgggg gcgcaggctg cgggaactgg ggcatgacgt     13920
     ccggcttatg cctccttctt atgtgaagcc ttacgtgaag cgcggcaaga cggatgccgc     13980
     ggatgcagct gcgatctgcg aggccgtgac acgtccctcc atgcggtttg tcgccatcaa     14040
     gagcgaagcc tgttcatcgg ttctggtggt tcaccgcacg cgggactttc tggttcgtca     14100
     gcgcacgcag atcggaaatg cgatccgggc ccacatgacg gagttcggca tcgtagcggc     14160
     gaagggcgcg cagaatgtcg atcgattgaa ggaacaactg gaccggctgc cggaagctgc     14220
     ccagttgcct gtgagcttgc tcttcgatca gttggccgag acggacaagc ggatcgatcg     14280
     gttgaccgac gagatcgaag aagccttcaa gcagaacgag acaagccagc gtctggctac     14340
     gatcccaggt gttgggatac tgtcggcaac gatcattgcc gcaacgacgc cggatgtcga     14400
     caatttcgat tgcgcgagag attatgccgc ttggcttggg ctgacaccca agccgcactc     14460
     caccggaggc aagcagaagg tgggccggat ctcgaagatg ggcaaccgtt acatccgacg     14520
     cctgctgtat ctgggtgcca tagcgcagat catgctcagg tacaggctca agcgcgagcc     14580
     gggggcggac tggctgtcga gcatgctgat ccggaagaag acgaaagttg ccgccatcgc     14640
     cttggcgcat cgcatggcaa gaacgatctt cgctgtcctc agggacggat cacgctatcg     14700
     gccacaggcg actgcctgac cggctctcgg aatggtcagg gcaaagtgag gtgatggcga     14760
     acaagcggag acgaagaacc aggacacccc gattaatccg aagcgcctcg agcgcgctcg     14820
     attgagtggg acctgttctc caagcggata ttcatcaggg cgcgcagcga tctcgttgca     14880
     cattcagacg ccgcatacat ggccgcaacc gacccgttca ccaaatccga tccgacacct     14940
     tgacccgcag gagccatcca tacacggatt gaagtcggga ctatagggcg gcaggaagcg     15000
     cagggttgcg cccgccgctt cgatccgttc acgcaccgcg tcacgcttgt ggctcgacag     15060
     attgtccatg atgaccacgt cgccgggccg cagttcgggt gtgagaactt tggtgacata     15120
     tgcctcgaac cagtcgccgt tgatggggcc gtccagcacc atcggcgcga ccatcccggt     15180
     catgcgcagc cccgccacca acgtggtggt cttgcggtga ccgtgtggga agcccatccg     15240
     cagacgttcg cccctggcgc agcggccatg gctgcgggtc atgttggtgg cggtccaggt     15300
     ttcgtcgata aagacgaggc ggtccgggtc cagatcgaac tggctatcga accagtcctg     15360
     gcgctgtttc aggatatcgg ggcgatcctg ctcgatggcg tggcctgtct ttttttacgc     15420
     gtcatgccgc ggcggatgaa gaagcggtga agcccggcca ccgagacgtg caagccgacc     15480
     tcgatcagcg ccaggcgcag ctctgcaagc gagatgtcct tacgcgtttc ccagattgcg     15540
     agaatgtccg cccgccgttc ctcaacccga cgtgagcgcg tgtcgccacc ctgaggcttc     15600
     ggagcaaagc tgccggtatc gcgacgctgc gctcgccagc ggattgccgt cgccggcgcc     15660
     actccaaagc gggctgccgc tgcccggcaa ctcatcccct catcaatcgc cgccaaaagc     15720
     cgccgacgaa gatccatcga tagtggttgg cccatccatg ccggcctcct tcaccagcac     15780
     ggattctgaa tcagaaatca acgccaatgg gaatcccctc gcgattcaga ccggtcgaaa     15840
     gccgctctaa tcagccagga tcctcggctc ggcgaggcag aggcgatcgt gctggcggtc     15900
     tcgggctcgg ccgcgcgctt gccgccttgg tggtcgcgga aggggtggaa actccttcaa     15960
     ctcccgatcg tgccgcccgc cggggatctg agcctcagcg ggttcacgcc tcgtggcacc     16020
     agtgcgatcg cgcttacccc tgccctactc gaacagcgtg gcggccgtgg ctagtacgtc     16080
     atccaggatc gccgccggca gcgtgtctac cttgcgagca ttgcgggcgc tcagatcgag     16140
     cgcgcgcggt tgatcgcacc gcacgacgcc cgttgttttg atgccgctga ttggaaccgc     16200
     gaaaccgaca cgcctggcga aatcgccgcc gttggttatc ggcaggatga ccgggcattg     16260
     tgtcaggcgg ttgaaggcat ccggggacac gaccagcacc ggccgatggc cgcgctgctc     16320
     gtgtcctgct gtcggctcaa gatcgactag atagatatcg ccgcgattca tcaaatcagt     16380
     tcttttccaa ctgccggggc gtcgatccat tcgcgttctt ccggcggcag cggatagacg     16440
     ccggctgctt cggcctcggc gagcagatcg gccatcgtgt agcgcggccg ggcttgcggc     16500
     tcgacgacca ggcggccgtt atcgacggcc aggccgacct tggtacccgg tgccaggtgc     16560
     aggacatcga gcagtgcggg tggcacggct agcatgatag acccgccgac tttgcgcaag     16620
     tttgtggtgt gcataggaat ctcctttaat tatatcaaaa tataatattt gcgaccgccc     16680
     ttgcaagcca aatcctgctt ggctgtccac aaatccatag ggcgtcctgg gggtgcttcc     16740
     atccatcccc agggcggccg ggggagattg taggcaggca gtgcctgccc ttacgtttag     16800
     tattgtttta atatccaaat agcactaata tgtaatgcac ataactacca aaggtagcac     16860
     atatgatttt aaccgtaggc aataccaagg gaggcgtcgg caagaccacg ttggccgtac     16920
     agctcgccat ctcccgcgcg atggctgggc gtgacgtgtg gctgatcgac ggcgaccgcc     16980
     agggaacggc agcggcggcc attgccgccc gctccgaagc cggcagaaag ccgggcatcg     17040
     cgtgcgcgca gtatgcagac ggcaaggagt tgcgcggcca ggtgcagcag cagcgcgata     17100
     aatggcagga catcatcatt gatgccggcg gccgtgactc gacggccttg cgtgcggcac     17160
     tgattctgtc cgatgtgctg ctggtgccct ttgctcctcg ctcctacgac gtgtgggcac     17220
     tggatgacat ggcctcacta gttgacgaag cgaacagcgt tcgcgatggc ttgcgatgtt     17280
     ttgccgtgat gaaccaggcc gatcctggcg agcactcggc cgacaacgcc gaggccgcgg     17340
     cagccgtcgc agaggttccg cagttcgcct acctgccggt gccgatccgg cgccgcaagg     17400
     ctttcagtaa tgccggcggt gctggcctgg ccgtggctga gctggccccg cgcgacccca     17460
     aagcctgcgc cgaactagaa acattgattt catcactttt taatatccat acgcactcct     17520
     aaaaggagcc tatagcatgg taatccaacg taagcccaag acgacgccag ccgcgcaagc     17580
     ggcggccgtg gatgcttttg tatccggtgc cccggacgcc gcccacgcgg cgccggccgc     17640
     cggcgcctac aacaagggcg tggtgaaagg gaacaagcgg cagatcagcc ttaccatcgc     17700
     ccccgatttg ctgcgccgcg tggacgagat cgccaagcgc accggacagg gcagggcagg     17760
     catcatcaac atggccattt atcgcgccat agaaggagat gttttcaaat gaaaaagaat     17820
     atgaaaagaa tattcatatg gtcggccaag ttggaggatg tatggtagaa aagggcacga     17880
     gactgatgaa aggcggcatt ggcaaacgcg cgacaccacg tccccggacc tacctgacca     17940
     ttggctacga caacaaggat tgggccaagc ggcatggcgc acgatgggat aaggagcgca     18000
     agcgttggta tgtcctagac cagatgttcg cctgagattg gggtgacccg tctcgcagta     18060
     tgcaggtttc cgagggttgc gccgggaggt ccggtgccga gcctcaatgc ataggagacg     18120
     ggtcatggga aagcatatca cttttatcgg gctggacgtg cacaaggaga cgatcacggt     18180
     cgcgctggcg gaatccggcg gccgcgatga cgtgcgcgag tatggccgga tcgcgaacac     18240
     cccggaggcg ctgacgaggg tggtgacgaa gttgcagcgc gtgggcgggg aactgcgatt     18300
     ttgctatgaa gcgggtccat gtggctacgg gatccagcga cagctgacgg cggccgggca     18360
     tgactgcgtg gtggtggcgc cgtcgctgat ccctcgcaag ccgggggaac ggatcaagac     18420
     ggatcgtcgg gatgcggtga acctggccag gctgcatcgg gcgggggaat tagacggcgg     18480
     tctgggtgcc ggatccggcg catgaagcga tccgtgacct gatccggact cgattgatgg     18540
     cggtgcgagc actacggcag gcgcgccagc agctgtccgg cttcctgctg cgtcatgggc     18600
     gacactacag tcgtcaagcc tggacgttga tgcaccggcg ctggctgtcg ggactgcgct     18660
     ttgagcagcc cctccatcac atcgtcctcg aggacctgat tgccgctgtc gaagcggcaa     18720
     cggaacggcg cgatcggctg acgcgacaaa tcgaggcggc cgtaccggcg tggtccctgg     18780
     caccggtggc gaaggcgctg caggcattgc ggggtgtggc gctggtaaac gcagtgacct     18840
     tggtcgccga gctcggcgat atcaccagat ttgccagtcc gcgacagctg atggcctatc     18900
     tcggcttggt tccctcggaa cggtccagtg ggcaaacccg ccggcaaggt ggcatcacca     18960
     aggcgggcaa cggcgccgcc cggcggatgt tgatcgaggc ggcctggagt taccgacatc     19020
     ccgcccgggt cagccgggaa ttgctgttgc gccaggaagg attgccccgg ccgatccgcg     19080
     agatcgcctg gaaggcgcag ttgcgcctct gtcggcgtta ttgccgcctt acccataccg     19140
     gcaagcaggc caatgtcgtc accaccgcga ttgcccgcga gttggccggc tttatctggg     19200
     ccatcgcacg gaaggccgaa atcgcggccg gctgaacaat cggatattcg aagcataccc     19260
     gggaggtgcc cacactgatc aaacccatct gcagccgggc aaggctggag gcgcggtcac     19320
     ggccggagaa ccctcgcagc cactatcagc cgggactttc cgacgctggt tcctagaccg     19380
     aggcagctcc acgacgcatc aggtcctgcg gttccaatcc gcgtatcaga ggatgatcta     19440
     ccgtcgtttc gggattgcgc ctccagcctt acccagtcgc agtcaaaccg aaccgcttgc     19500
     ttgctcatca gcaagcagaa gaaatctctt gcctgcagct tgaaatggcg aacatgagag     19560
     agtggtttga atcggtcagc tggtatggct tcgccggcgt caaaaccaag gcggtcgccg     19620
     aggagctggc tgcggcgatc ggtgaatatg gcgtgctggc ctggtcggaa ggctcgaaca     19680
     ccggcaactc ggcgaagggc ctggaggcgg gcacccgctc gaccggccag accaaaacct     19740
     atcatgagct gaaacgccaa ctcatccgcg ccgaggaaat catgcacgac atgcgggacg     19800
     atgagcagat catcttcccg aaatccggca ggccgctgcg ctgcggccgg gccatctatt     19860
     tccggcggcc tgagatggcc gcccgtgtgg gcgagaatcg gtttgctggc aaagccgtca     19920
     aagcagctga ataggagcgg ataacgtacg attaaaacgc gcggccgatc aggatttcgt     19980
     cggcccgcgt cgtatagcgg ggcgaaagct gctgttccct tgcccgccac ggcagggcgg     20040
     tccctgtgat gccatccgca tcgtctctcg gctgtcaacg tgccgtgaat gccaaggccg     20100
     ccccggtggt cgcacgctcg ccgccttcga ggccggccca tggggccaga aatgccctgc     20160
     tatcggccag agctggcgcc gggtctggcg ggaagtcatc ccgttctttt cctcccctgg     20220
     cgaggcctgt ccgatcgttt atggcccgaa gtaacggaac gctccgcggt gtagcataag     20280
     cggacaaagt gggaacatca ggctgcgtgg gtggtcgtgt cgtggattgg ccggagcggc     20340
     cgcaatccgg catggttttc cgacgatttc tgtttggcgc tccagatgta gtcgccggtc     20400
     aggttcacat gctcccagcc gatcggcgag agatgcctga ggagggttcc gggcacatcc     20460
     tcgacctggc gtagggcctg tatggcttgc gcgagatagc gtgtgttcca gaggatgata     20520
     gcggtgacca ggaggttcag gccagatgct cgatgtgtct ggttctcgaa ggtccggtca     20580
     cggatttcgc cgagccggtg aatgaagacg gcgcgggcca ggctgttgcg ggcctcgccc     20640
     ttgttgagtt catgactgct ttcacggcgc aggcccggat cttccagcca gtcgagggtg     20700
     aacagcgtcc gctcgagacg gccgagttcg cgcagtgccg cggcgacggc gttctgtcgt     20760
     gggtaggcgg cgagttgccg caggatcacc gacgcggaca ccgtgccggt gcggatcgag     20820
     gtggcgatct tcaggagatc gggccaatgg gtgcggatga gatcgacgtt gatgcggccg     20880
     gcgatcatcg gcgcgagcgt cggataggct gccggtctgg caaaactgta gagacgccgg     20940
     tctttcagat cgggaattct cggcgcaaac acgtatccaa gtagggcgca cagggcaaag     21000
     acatgatccg acaccccgcc gccatcggta tggtgccggt gctgacgtgg cggcgcatcg     21060
     ccgtgatgat cgagcaggcc gtcgaggaca tgcagggctt cgctggcggt tgcggcgatc     21120
     accctggtat ggaacggcgc gtagcgatcg gagagatggg tgtagaattt cagacccggt     21180
     tcggggccat agtgcgcatt gatccggctc gcatcacggc cagaaccgcc ggcgcggaag     21240
     aactgcccgt ccgaggatga ggcggttccc gacccgaaga gagcggcgag cggctcgcgg     21300
     ctctggtgtt cgaccaggcg gcgcagcgcc agggcgtagg tctcgtcgcg gatgtgccag     21360
     tcagcggtcc aggcgagctg gcccagactg gcgatgctgc aagcttcggc catccgggtc     21420
     aggccgagat tgaggccatc ggccagcagc cccgccatca gaacccgggg gtcagcggcg     21480
     gcttcgccgg tgcgcagatg ggtgaagcaa tccgggaagc cggtccagcc ggccacttcc     21540
     gtcagcaggt cagtgatccg gatgcggggc agcgcggcat agagctttgc tgccagcgct     21600
     tcggcctcgg gcggagtcga tttttcgatc ggtgtgattc tcagcacgcc cttctcgatc     21660
     gtcacatcgg gaagcagccc gccccgggca cggatgtcga tctcggccag ccgcgcatcc     21720
     agccaggtcc gcctggtcgc gatgaagcgc tcgaagtcgg tctcgacagc gaccggaatg     21780
     ctggactctt tttgcaggac ctgaaatgtt tccctggaga tcagccgctc ctcgaaggcc     21840
     cgatattgcc ggctgccggc aacccagaca tcgccggcag caaggcgctg acgcaattcc     21900
     gccaggacgc agagttcgta ataacgccgg tcgatgccgt gtgccgtgag gacatgacgc     21960
     gcccagcgcg gccggacaaa ggcggtcggc gctgacttgg gcagcgtcga ggctcccgcg     22020
     ctgttcatgg cgcgcagcat ggcgatcgcg cgcatcaacg acgccgcggc gggaacaccc     22080
     tgaaactcga aagtggccag aaacgccggc gcccagcgcc gaatgccggc ataatgttcg     22140
     ctcagcacct cgtagggatc gaaatcttcc gaacgaacca gagtttccgc ttccataacg     22200
     gtcgagcaga accggtccca gggtatcacc ttgtcaatcg ccgcgaaggg atcgccctgg     22260
     ccggcgcgcg cggccatcag ggcggcgccg atcctcgcat aaagccggac cttctcgttg     22320
     atcgcccggc cttcggcctg gaacgcccgg gcatgtcggc cttccgcctt gcggaacatc     22380
     gcgccgatca gccgttcgaa cagagtgatc gcctgatccg tcaggcgggc cgacagatcg     22440
     agatcgatcg cggtgagcac ggcatgccgg cgccggcgct cgtagccagc aacatgctgc     22500
     accgtggtcc ggccggcctc gcgaacgagc tgggcgagcc gggattgatt gatccggcga     22560
     ccgcgcgccg gatcaatgcc gattgcccgg atgtgctcca accgctcgat caccccgagc     22620
     atggatgccg gctttgccga ttccgggatc tggcgcagcc aggccagcca gctctggctg     22680
     gtgtccagac gccgctccgt caacgcatcc agccgacgcc gctgatcggc ggacagaccc     22740
     tcggtcagca gacgctcgat ttcccggcgc gcgcggtatc gaacctcgat gcagagccgc     22800
     tcgagctgcg ccgggcgagg tagaagaacc ccgcgaccgc ggcactcttc cagcaccaaa     22860
     gccgccagat cgaccagccg gtcggtttcc agtgcatgcg ccagcagcca gtcggcaagg     22920
     tctgccgcca cgcgcggccc ccatggccgc aacccgaggc gatcctgcaa agccgctgaa     22980
     tgccggcgtc gattttgatc caccctcaga taagcaccga gggaatccgg caagacgtcg     23040
     atctgtgtgg cgacgaacga gaccagggca ggatcgggta tctcgccggc atggagcggc     23100
     cggccgggat accgcaggta acagagcatg agagccagac cgagacgatg gtgatcgccc     23160
     cgaccgcgcc ggatcattgc aagatcagta acagacagcg tgtagtgacg aattatgccg     23220
     cgtcgatcag tcggcgggtc gaacagctgt gcgatctgtt ccccggtcaa tatccgtcga     23280
     tgacccactg gtccctccct cctgcctgtt gaggatagga gaccagccga tccgtgccag     23340
     agagtcgacc agcgtactcc gcgaaatgcc gaaagtgcgg cagaccgacg ctttcgtggc     23400
     accagcgtcc agcgccgcga tcaccgccgc cagcttctcg gcatcgatcg ccaccggtcg     23460
     gccaccacgc ctgccgcgcc gacgggcggc cgccagacct gcctgcacac gctcctggat     23520
     cagcgaacgc tcgaactgcg ccagagcgcc aaaaacatga aacaggaatt ccccctgcgg     23580
     cgtcgtggtg tccatctgct cggtcagcga ccggaagcca acgccacgag ccctgaggct     23640
     gttcaccgtc tccagaagat gcggcagcga ccggccgagc cggtccagct tccagaccac     23700
     aaggcaatcg ccggatttca gataggccag tgccgcagcg agacccggcc gatcgcgccg     23760
     gctgcccccg gcacgatcct cgaacagatg ccgctcatcg accccggcac cgagcagggc     23820
     atcgcgttgc aggtcgagca cctgtcggtc attgtcggtc gagacgcgca tgtagccgat     23880
     cagcatgtac ggaaatcccc ttcgagacgg tttccgtata ccataccatt ccgacggtgt     23940
     tttccgtaca tgattcggca ggaaatccgg gatttttcgg cgggtctcgg accaccgacg     24000
     gaaaacatgt gttttccgtc atcgcgcgat cccggcctca gaaccgcgct ctccgctcaa     24060
     acccacagaa aacctcgatc ccaaccagtc aacgttccca ctttgtccgc ttatgctaca     24120
     gcctagggcg tttcgttact tcaggccttt atgcaacgaa cgccatagcg gtctcctgtg     24180
     tatcacctga acgttacgcg attttggcct ccgtaattga agcgtaacac acgacggctc     24240
     gcatagcctc tagtgatttc cacgagctgc ccaggtttga attcccaatc aggacttacc     24300
     caggacaacg agctttccat gacaacatca gcagcacttc cgcccgtaga aaataccgtc     24360
     tccgaagcgc tcaaccaggt tgtatttagt ccgttccatt tgcgagccat ttttgcggcg     24420
     ggaatgggat tttttgcctc tgcctacgac ctgttcatca tcggcacggc tctgaccctg     24480
     atcaagggcg aatggcattt gtcgcccgga tcggttgcgc tgatcggctc gatttcgctg     24540
     gccgccacct ttgtcggcgc cttcatgttc gggcgtaccg cggatatttt tggtcgcaag     24600
     tcgatctatg gcctggaagc gctcctgatg acggcgggcg ctctcctctc ggcgttcgca     24660
     cccaatgtca ccattctttt gattgcgcga gtgatcctcg gattcggtat cggtggtgac     24720
     tatccgcttt ccgccgtttt gatgagcgag tattccaaca cgaaatcacg cggccgcatg     24780
     gtcagcctcg tgttttccac ccaggctgcc ggcctggtgg ttggtccggc gatcgcgctc     24840
     actctgctag cagccggcat cgatcacgac atcgcatggc gcatcatgct cggcctcggc     24900
     gctctaccgg cagcaatggt gatctatatt cgacgcaccc tgccagaaag cccgcgatgg     24960
     cttgccaggg tgaaagggga cggtacgcgc gctgcgcggg aactcgcttc gttcagcttg     25020
     ggaactgcga cgtccgcagg gcgcgacaag gtggtgaaac agccattcag ccgctatttg     25080
     ctcgtttttc tgggaacggc cggcacgtgg ttcgtgttcg actatgccta ttatggcaac     25140
     acgatttcga cgcccatgat catgcagcag atcgcaccgc atgcagacct gctgatgagc     25200
     acggcaatga gcctgattat cttcgcggcg gcggcggtgc ccggttacat cctcgcgatc     25260
     ctgacggttg atcggattgg ccataagcga ctgcaactga ttggtttcgc gggcatggga     25320
     ttgatgtttc tgatcatcgg actgtttccg atgctgattt caaccgttgg actattcctg     25380
     attatctatg gtctgtccta ttttttcgcc gaattcggtc cgaatacgac tacatttttg     25440
     ctctccagcg aggtctttcc ggtcaacata cggaccaccg gccacggcgc atcggcggga     25500
     gtagcgaaag tgggtgcgtt catcggcgca tttatcttcc cgatcctgat cacagatttt     25560
     gggctttatg gcacgttgcg catcactttt ctcttctcga tggtaggact ggtgttgacg     25620
     gccgtatgcc tgcgcgagcc ggccggtctc agtctggagg ctgtgagtaa tgagaccacg     25680
     gacgaggtcg ccatgtcacc gatgatggcg agggcatcat cgacgtgaac cagtattaag     25740
     tagtcgttaa atgggaacag aaattttgct gccttgacca gcaacggggc tgacacgccg     25800
     gataccgaag cgcgaccgct ggcgatcgac tgtcggtacg ataaccgaaa tatcggcggt     25860
     gttgccgggg ccatatgtcc gtgcagatcg ccttgcgctc ttggtcgata acaagattaa     25920
     atgccggctg tgcgaccttc agcctgcagt atttcgtagt gggtcgtata tttggccaat     25980
     aatcaaatat atgtgttttt tatcattgta atatgtgtga ctttttattg tcatcaaatt     26040
     catgattttt tttgatatcg gtcccgtggg caggaaattt tttagaaaat tcctgcacgt     26100
     aaaacataac tggcacggag ataccgaatg tataacgtca tggagcccta cattcacaga     26160
     cgtcacaaga aacttatgag accaacgtcg tacaaacata taattttttt actcggaaca     26220
     actgctatgg cgacgttgcc ttttagccat actgcatccg cacagactgt aagttctgga     26280
     ggtggtactg ttgtcaatgc gggcgaggta accgcatcct caggggcatt gaatacgtta     26340
     cttaaactac ccacaaaaag agagatattc aactcgactc aatcaattaa agtggtaggc     26400
     aaaaagcaga tcaaggcatt ggggccggct gccggtgcgg ctcaagcgct agcagtggcg     26460
     cccggagtaa gcattgaagc tgatggcacg agtggttccc cgagggcggg tatcagtatc     26520
     aatggcatga aaacagggtg ggggaatatc gccggcaatt ccaatgatgg gactgtcatg     26580
     gttactttcg atggtgtgcc aatggtcgat ccggcatacg gtgtctggca ggcttcagag     26640
     attcctaatc tttcttttat caagggccta tctgtcactt acggtccggg ataccctatt     26700
     aatcgctggt acgataacat cggtggtggc ctaaattttg taccgattga accaacggcc     26760
     aaggcgcggg ccgatatcgg tggttacttc gggtcatacg gcgcgcgtgg caccaatttt     26820
     tcttttgata ctggcgaaca cgacggttgg tcagccgtat ttgccggaac tatcggcaga     26880
     agtggaaatt atttaagtgg ctatggattt aacaatccat caaataatta tgcgtattat     26940
     gcaaagataa tcaagaaatt ccctgggggt cggattagta ttggcggatt tgcatccagg     27000
     gcttctgcct acagacctgt tccaatccca gtatcgccaa attcgcaggt tactatcaat     27060
     ggcgacaatc ctataacagg gaattcatac ccaggaccaa tttattctca gcagactaca     27120
     ggtttttaca atacattacc taaatctata tattataaaa gaatcccaat aagaacatat     27180
     ctcatatatt caaagttttt tgataaatta gactcaacaa catcgtttca taacatttta     27240
     ttttacagat acggagaaag aatacacgag cactatgata actatggaca gagtaacaat     27300
     gtacttatac aatatttcaa tgctcacagc caaacatttg gtgataaagc ctatttcaca     27360
     tttaaattac catacaatac ggtttcatta ggcggatatg ccgtatataa taaatttaat     27420
     tcattcttag attattataa tccaaacaat ccagctgtgt atgattcggg gccgaatgca     27480
     gggcagcctg ttcttattaa cggtattcca gttaactata gccttgttgt tccgcataat     27540
     tatcacaact cgtatttgta tgagaccgat cttgctgctt ttgcacagga tgtgattcgg     27600
     ccgactaaaa atattaggct gacgcctggc ttgagcgttg tttcaatgca tactgatttt     27660
     gttaataatt cacttgctgc ttttccatat aatactacta ctggactaga ttcttttgtt     27720
     ggtgtcaatg gggatcgtag gcctaattcg tcgacaaact ttgttgaatt tgaaccatct     27780
     ataggcgcga actataaaat caacaaaaat attgctcttt atgccaacta ttctaccgct     27840
     tataaagggg ttggcggggc tagtggcaca tatgcgcatt ttgttgccac gacattaaag     27900
     ccacagaaat ctaatcaata tcaatttgga ataaaagtat tgattccgaa cgctccctat     27960
     cttcatcacg ccatatttag tgcaaactat tatcatctaa atgatctaaa ccaaattatc     28020
     cccatcccaa tcgcgaatca aaattataga cgttttgcat caggctcatc tgtgttccat     28080
     ggcttcaatt tatattttca agatgatcca caatataata tacacgtata tgcaaatgcc     28140
     agcttcgaaa gtgcaaatta cgctaattat gtgactggag gtcagagtta taatggattg     28200
     cctatctcaa atgtcccttg ggtgacattc aatggtggtc tttactattc ttttttcaaa     28260
     tcaaatattc tatatcagcc aaggatttgg taccagtaca ccggaagtca ggatatatat     28320
     aataataata ctggcctgcc cacgcgaaat aagcttggcg ggtacggcat tcttaatctt     28380
     ggaatgaagg ttgccttggc tacatcaaag gtaaaatttg ttcatgccgt cgactttaat     28440
     ctcgatcttc tcaatgttct gaataataaa tataattctt tcgaatatta ttctggcggt     28500
     ggctactatg gtattccggg tcaacttttg gctgaacctg gtgcgccgtt tactgcttat     28560
     ggaagcttaa atgtaaaatt tcggtgagaa taagagtaat aatagaggcg gacaacttcc     28620
     gcctctattt aaattaatga tatgatgttt ttacgtgagg tatgcttgtg tcttatgatt     28680
     atatcgttca tctcgcaaat tattcggacg gtgtgcttta tgtgctcgct ggtcttttcg     28740
     tcatcgcagt agcggtgatc atcgaccgga tgtggtatct tcgccgggcg atcttgcggg     28800
     gcggttcgat cgtcaggcgg atggcggcca tgggccgggt gaacgagcag gatcttgcag     28860
     cgttgcgcga ttttgccggc cgcatgcccg aagggctgct gctcgacacc gccctgaatc     28920
     atatgaatga cgccgaccac gccggcatga acagccgcat ggatgaggcg atcatgctgg     28980
     ttgcgccccg gctcgaccgc cggatgtggg tgctggatac gatcgtcacc ctcgccccgc     29040
     tgctcggcct gttcggcacg atcatcggga tgttccacgc cttctcgatc ctcgccacgc     29100
     ccggccacgc gccggcagag gtgaccggcg gcgtcgccga tgcactggtt gcaacggcgt     29160
     gcggcatctt tatcgccatg atcggcctcg cgaccttcaa catgctgcag aaccaggtcc     29220
     ggctgatcat tcaccagctt gagacgatcc gcaccatggt gctgaatcgt accgacggcg     29280
     cgccagtcgt cgttccgaag ccgatggata ataccaaatc ctgtggggag tgactcacga     29340
     tagtgcttcc gcgacgcggg gacgctgtga gtcaaactgg tgttccttgg gaggttcacc     29400
     atgccgcgcg cgatatccct tcgtactgat tttgatgctg ccacccttcg ccgccaggcg     29460
     cggcgcagcc gggaggcggc tctggcccgg cggttgttgg ctcttgccgc gatctacgac     29520
     ggcggcacgc gctcggaggc ggcgcggctg ggccacgtca cactgcagat tgtgagggac     29580
     tgggtgatcc ggttcaatgc tgatgggcca gatgggttgc gcgaccgcaa ggcgccagga     29640
     ccgacgccgc agctgacggc agtgtcctga atttcgtgtg tgagtggcat agtgggtaga     29700
     aaggaagacc catgaagtgg accctgcgtt gaggaccatg gacctgggaa attaagttgg     29760
     aattggcgcc gcactgatct ccatgaaact caagctgcct tttgctgctg ttgcggctgt     29820
     gggtatgtgg gcgacgcggt agcgtcgtcc gagctcgcct ggagggcgag cgtcatatcc     29880
     acagccatcg gcggcagcgc accgatcatt gccggcagtg tcctgaattt cgtgtgtgag     29940
     tggcatagtg ggtagaaagg aagacccata tggcacgacg gagagcgccg gcgatcccgg     30000
     acgatttgct ggaccagctg ctggctgggg gtgacgcggc ggcaggctaa tgtctgcgct     30060
     tgtggtggaa attgtctgac tgccgtgcgt tggattggcg ccggaggtcg gcgtagccgg     30120
     ccggaggggc cgatccaacg catgagcctg ggtttaggtg gccatcggat cgagcggcta     30180
     cggtggagtt gcgaagcttc acccgaaccc gagaggaccc gatgaccgac gacagactac     30240
     ccttggctga attgctggcg aaagccggcg atggagattt cctgcgcagt gtggcggagg     30300
     ccgtagtgca actgcttatg gaggccgacg tggaaggcct gatcggcgcc gggcgccatg     30360
     agcgcactgg tgagcggacg acctaccgca acggttaccg cgatcgctcc ctcgacaccc     30420
     ggctcggcaa tctgcaactg cgcattccca agctgcggca gggctcttac tttccgccct     30480
     tcctcgagcc taggaagacg tccgagaagg ccctggtcgc ggtgatccag gaagcctggg     30540
     ttggcggcgt ctccacccga cgcgtcgacg acctggtgca ggccatgggg ctgagtggca     30600
     taggcaagag cacggtgagc aagctgtgca aggatatcga cgagcgggtg aacgccttcc     30660
     tcgagcgccc gctgaccggt gactggccgt atctttggct cgacgccacc tacctcaagc     30720
     agcgcgaggg agggcgcatc gtctcggtgg ctgcgataat cgccgtggcc gctaacaccg     30780
     aaggcaagcg cgagatcgtc gggctgcaca tcggccccag cgaggccgag accttctggg     30840
     ctgccttcct caagagcttg gtgcgccgcg gtctgcgtca ggtaaagctg gtcatctccg     30900
     acgcgcacga gggcctcaag tccgcaatcc gccgcgtcat gggcgcgtcc tggcaacgat     30960
     gccgcgttca ctggatgcgc aatgccctgg cctatgtcgg caagggccag cagagcatgg     31020
     tctcggcggc gctccgccaa gccttcattc agcctgaccg tgccggcgct agccagacgc     31080
     tacgccacac cgccgaccag ttccgcgcca aatggcccaa gctcgccgca tttatcgatg     31140
     atagcgaggt cgatgtcctc gcccacatgg acttccccgt gcaacacagg gtcaagatcc     31200
     actctaccaa cccgatcgaa cgcctgaaca aggaggtcaa gcggcgcgct gatgtcgtcg     31260
     gcatctttcc aaacgaagcc gccatcatca ggctcgtggg cgccgtgctc ctcgagcaga     31320
     atgacgagtg gcaaacacaa aatcgctaca tgcagaccga gccaatggcc gaacttacac     31380
     cgcccgcaat cgacgtattt ccaccccaga tcgccaccgc agccgaatga tccttggtca     31440
     ccttaaacca tctataattt ccaccacgtt gacggacgtg acccggcggc agcgctgaat     31500
     tccggggatc tggtgaacgc gctgaagaag gccctggcgg agcgggccct gagcgcggag     31560
     atggattacc atctgagtga cgaagcggag gcggagaaca gccgcaacgg ctatggccgc     31620
     aagtcggtgt cgaccggcac ggggaagatc gagattgcga tcccgcgaga ccgtgcgggc     31680
     agctttgatc cgcagctgat cgccaaatac cagcgccggt ttccaggctt cgatgacaag     31740
     atcatctcga tgtatgcgcg ggggatgagc acccgggaga tcgcggaaca tctgcgcgag     31800
     atctacggca tggatgcctc ggcggagctg atcagcacga tcaccgatgc ggtgctggac     31860
     gaggtgacat cctggcagca gcgtccgctg gacccggtct atccgctggt attcttcgat     31920
     gccatcaggg tgaagatccg cgacgagggc gtggtccgca acaaggcgat ccatatcgcg     31980
     ctgggggtta tggccgacgg gacgaaggtc gtactcggga tgtggatcga gcagaacgaa     32040
     ggcgccaaat tctggctgcg ggtgatgaac gaactgaaga accgcggcgt cgaggacatc     32100
     ctgctggcgg tggtcgatgg cctcaagggg ttcccggagg cgatcacggc cgtctttccc     32160
     gagacgatcg tgcagacctg catcgtccat ctgctccgga attcgatgga tttcgtgtcc     32220
     tacaaggacc gcaaggcggt cgccaccgcg ctcaaggaca tataccgggc cgttgatgcc     32280
     ggggccgccg aggccgctct cgccgatttc gaggccggtc catggggcca gaaataccct     32340
     gccatcggcc agagctggcg ccgggtgtgg caggaagtca tcccgttctt ttccttcccc     32400
     ggcgaggtcc gtcggatcat ttatacaacg aacgccatag aagctttgaa ttccaagctg     32460
     cgccgggcca tccgcgcgcg cggccatttc cccagcgatg aggccgcggc caagctgctc     32520
     tatctgatcc tgaaccgatc cgaaaaagac tgggtgatgc cacctcgaga atgggctatg     32580
     gcaaaggctc agttcgccct catcttcggc gatcgcttcg taagggccct ggcggcctga     32640
     tgttcaaccg ccgcccatac acgggttcgc ggtcatgggg catgcgtgag gaaagatcgg     32700
     ctgtttgccg atggattttt gatgcggatt tggggcgtgt gcctaagcgg cgacctgtgt     32760
     gtgcctcggc tcagtaaccg atagaagctt ctttggcgtt gatattccga ggtttttcag     32820
     gatctcggcg gcttccgggc ggatttttgt ccgttgaaca atagtccggc cctcgacctg     32880
     gtagcggacg gctttcaggc cggcgaggct gtgggcgatg cgcgcccagg gcagggaaca     32940
     gcgaagctcc gcggcccgtt gcatctgcag ggccagcacg cagagccgga catgcgcctc     33000
     gatccggcgc gggctccagt ggaacatggg ccggacctcg agcccggtct gcttcatccg     33060
     ccggaagcag gcttcgatga tcgccccacc tttgtagccg agagcgacgt cctcggcgga     33120
     cagggtgtcg tcgttggtga tcacgacgaa cttgccgtcg aagcgggcgg catgggcgat     33180
     ctttccggaa tccagatgcg gcctgccggc gtcatccgtg ctcaggtagc ggccgtagcg     33240
     gcgcgaggtg agcagcgcgc aggcggccct gggatgatcg gcatctcggg cggcgagcag     33300
     cgccagttcg gcgcgcaggc tggccaggac ctcgtcgcga tgccggcgct gccgctcggc     33360
     ttcctcgggg ttcaggcaaa ggacataacg cttgcgccgt tcaccgtcgc cgaccacgac     33420
     ttccttgacc tgcagattat cggcaacctt ccgatagcgc ccccgtcggg tcagaaccgc     33480
     ctcgtccaca tcgcgcagcc ggcgcatcgg caccgccagg atgtagcggc ccagcccctt     33540
     gctcagcgcc gccagattgt cggccgaata catgccggcg tcgccgacga acaggcagcg     33600
     cccgaggttc caggcgcgca gatcctcctt gatccgcgcc accgtcgcga catcggcggt     33660
     atcgccgggc agcacccagg agcgcaccgg catgccgtcc cgtgtcaccg ccatcgcgat     33720
     gatcacctgc ggctgattgt cgcgtccctc cttgctgtgg ccacgccggc gcagcggcgc     33780
     gaacagccgc ccgccccaga cctgttcggt ctcgtcggcc atgtcgatct cgaaatacgc     33840
     cgtcgtggtg tcgtagaaga tcagatcgac atcaaggcgg aacaggtggc actgtcagga     33900
     attccgtgta tgggcggcgg ttgaacatca ggccgccagg gcccttacga agcgatcgcc     33960
     gaagatgagg gcgaactgag cctttgccat agcccattct cgaggtggca tcacccactc     34020
     tttttcggat cggttcagga tcagatagag cagcttggcc gcggcctcat cgctggggaa     34080
     atggccgcgc gcgcggatgg cccggcgcag cttggaattc aaagcttcta tggcgttcgt     34140
     tgtataaatg atccgacgga cctcgccggg gaaggaaaag aacgggatga cttcctgcca     34200
     cacccggcgc cagctctggc cgatggcagg gtatttctgg ccccatggac cggcctcgaa     34260
     atcggcgaga gcggcctcgg cggccccggc atcaacggcc cggtatatgt ccttgagcgc     34320
     ggtggcgacc gccttgcggt ccttgtagga cacgaaatcc atcgaattcc ggagcagatg     34380
     gacgatgcag gtctgcacga tcgtctcggg aaagacggcc gtgatcgcct ccgggaaccc     34440
     cttgaggcca tcgaccaccg ccagcaggat gtcctcgacg ccgcggttct tcagttcgtt     34500
     catcacccgc agccagaatt tggcgccttc gttctgctcg atccacatcc cgagtacgac     34560
     cttcgtcccg tcggccataa cccccagcgc gatatggatc gccttgttgc ggaccacgcc     34620
     ctcgtcgcgg atcttcaccc tgatggcatc gaagaatacc agcggataga ccgggtccag     34680
     cggacgctgc tgccaggatg tcacctcgtc cagcaccgca tcggtgatcg tgctgatcag     34740
     ctccgccgag gcatccatgc cgtagatctc gcgcagatgt tccgcgatct cccgggtgct     34800
     catcccccgc gcatacatcg agatgatctt gtcatcgaag cctggaaacc ggcgctggta     34860
     tttggcgatc agctgcggat caaagctgcc cgcacggtct cgtgggatcg caatctcgat     34920
     cttccccgtg ccggtcgaca ccgacttgcg gccatagccg ttgcggctgt tctccgcctc     34980
     cgcttcgtca ctcagatggt aatccatctc cgcgctcagg gcccgctccg ccagggcttt     35040
     cttcagcgcg ttcaccagat ccccggaatt cagcgctgcc gccgcgtcac ccccagccag     35100
     aagctggtcc agcaattcgt ccgggatcgc cggtgctttc cgtcgtgcca tatgggtctt     35160
     cctttctacc cactatgcca ctcacacacg aaattcagga cactgccgca agacccagcg     35220
     gcgcatcgtc gccgcctgga tcggcaccgc cttcgcccag aacgacgccg aagccgcccg     35280
     caagcaatgg cgagacgtcg ccgatcaggc ccggccacgc gtcccaaaac tcgccgccct     35340
     gatggacgac gccgaggccg atgttctcgc ctacatgaac tttcccgccc agcatcgtgc     35400
     caaattacac agcacaaacc cgctcgagcg gctcaacggc gaaatcaagc gccgcagcga     35460
     tgtcgtcggg atcttcccta acgaggccgc cgtcgtccgc ctcatcggcg ccctgctcct     35520
     cgagcaacac gacgaatggg ccgttcagcg cgcccgatac atgacactgg aaaccatcgc     35580
     tcccttgggc gatactccca cggtcagcct gcccacaatc gcagcctgac agagcagcca     35640
     accctgctca gaaaacccgt tcctacacca cgcctcgggg cacgatcctg tggatatgac     35700
     gctcgccctc caggcgagct tggacgacgc tatcgcgtcg accacatctc cacagccaca     35760
     acagcagcaa aaggcagctt gattttcatg gagatcagaa cggcgctact tccaacttaa     35820
     tttccccagt ccctggtcct catcacgggg gccagctcag tatcgacaca agataatccc     35880
     gtattcgtca agagccgtca ggataacatg accacaatga tacgccgagt gattgccgcg     35940
     tcaaaaaatg tgcccgaatg gacgctattt ctggcgtttt tactgcctat tggtgttggg     36000
     ttgatccagc ggtttagtcg cccgaaccac tggtttcgag attacgatgc tgtctcatgc     36060
     gcggcatcac ggatcgcgca gcattctgaa ctgtatgttc acacaactca ttgcatcctg     36120
     cgcaaaccga cgccgtatgt ctatccacca tatctagcgt ccctgtggtc ggcgttgcag     36180
     cattcaacag gaatcagcgg ggctaccgcg ctctacggtg gattatacta tttcttgcta     36240
     atctacattc tacgaatcct cattaccggc cgctcagtcg gcggccaagg ttggctgcgc     36300
     gcctgtttgt tgacggtgat aggtgcagac attttcatct gtggaaatat tgcggtgatc     36360
     gtgcattgca cgctcgcact gtgtgctgtt ttattctggg aaataccgat tgtgctggtt     36420
     gctggcatta tctgtgcggc agcgatcaag ccaatatttc tggtttataa cgcagtgttt     36480
     ctcctgcatc ctatgcggtg gcgtcaaaag attttctata ccgggttggc gaccgcgggt     36540
     ggtatcctgc catttgtcgc cttcatgaaa ttgtcgccgc atctttttac gcatgacatg     36600
     gcgctgatac gatattacgc gctgataaat gatcgtggcg ccggtttttt gaacctgatg     36660
     agtttgattg gtctgcggca attcagcgca gacatggcga cactgtatgt tattggcgta     36720
     gccattttgc tttctagtgc catatatatt tgtcgtgtcg cacaggcacg ggcaaatcaa     36780
     cggatatgga ttggcattac cgtttcgata ttatctgatc cgcggctgat gttttatgat     36840
     gtactgacgc tggcccctgg aattgtgagc cttgtcgggt tgtcggcccg cttgggccgg     36900
     tcagcggagc gggttggtgg cggcctcgtc gtcgcattat gtatcgcgtg tgctgttctc     36960
     aactcccgag gcggacaata tggactctat gtttttgttc cggctgcgta tgtgctgatc     37020
     attgcactgg cgggtgggtt tttggtggaa agctggcgat cacgggaaca gagtattaag     37080
     gggatacctg gatgattacg gcagcctgca tcgcctcggc ctctcacgcc tatggcattc     37140
     cgcgagcgtc aataa                                                      37155
//