Dbfetch

ID   CP000692; SV 1; circular; genomic DNA; STD; PRO; 37415 BP.
XX
AC   CP000692; AAOO01000000-AAOO01000076;
XX
PR   Project:PRJNA15753;
XX
DT   12-MAY-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence.
XX
KW   .
XX
OS   Acidiphilium cryptum JF-5
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acidiphilium.
OG   Plasmid pACRY04
XX
RN   [1]
RP   1-37415
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Han C., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Magnuson T., Richardson P.;
RT   "Complete sequence of plasmid4 pACRY04 of Acidiphilium cryptum JF-5";
RL   Unpublished.
XX
RN   [2]
RP   1-37415
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Han C., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Magnuson T., Richardson P.;
RT   ;
RL   Submitted (04-MAY-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; a3ae681ab3a60176120b2f5262720efa.
DR   BioSample; SAMN02598339.
DR   RFAM; RF01725; SAM-I-IV-variant.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000181
CC   Source DNA and bacteria available from Timothy Magnuson
CC   (magntimo@isu.edu)
CC   Contacts: Timothy Magnuson (magntimo@isu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..37415
FT                   /organism="Acidiphilium cryptum JF-5"
FT                   /plasmid="pACRY04"
FT                   /strain="JF-5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:349163"
FT   gene            complement(838..1383)
FT                   /locus_tag="Acry_3553"
FT   CDS             complement(838..1383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3553"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain; Resolvase
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3553"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29151"
FT                   /db_xref="GOA:A5FU69"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU69"
FT                   /protein_id="ABQ29151.1"
FT                   /translation="MIYGYARVSTDGQSVAAQVMQLKAGGCGKVFQETASGARTDRVQL
FT                   RKAIDRLEAGDTLLVTRLDRLARSTRDLLNTLATIAEKGAGFRSLSDSWADTTTPHGRL
FT                   MLTVLGGLAEFERELIRARTGEGRERAKARGVRMGRKPKLTLHQRQEALRRRDAGEAVR
FT                   EIARSYNVSHSTISRLAD"
FT   gene            2471..2728
FT                   /locus_tag="Acry_3554"
FT   CDS             2471..2728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3554"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29152"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU70"
FT                   /protein_id="ABQ29152.1"
FT                   /translation="MTAPILADQVGWRHQELVRILLFRQGPPELVEVTKHGREEIVRHL
FT                   LDVGGPANSTNRRIGRGEQIVVGRNRRCFWHRCLADERLF"
FT   gene            complement(2934..3404)
FT                   /locus_tag="Acry_3555"
FT   CDS             complement(2934..3404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3555"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3555"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29153"
FT                   /db_xref="GOA:A5FU71"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU71"
FT                   /protein_id="ABQ29153.1"
FT                   /translation="MTVDRIEIELADARSPDLINLVTALDDFLNRVCGVERNHGSPIDR
FT                   LAHDDTQMFIARIAGQAVGCAGLQVFEDGTGEVKRMYVVTEVRTTGIGSRLLARVVEAA
FT                   LTAKLSVLRLETTEFLPDAQRLYRANGFVPCPAYGPYVANPINLYFERWLMR"
FT   gene            complement(4269..4682)
FT                   /locus_tag="Acry_3556"
FT   CDS             complement(4269..4682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3556"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29154"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU72"
FT                   /protein_id="ABQ29154.1"
FT                   /translation="MDEVLEMGDDDEEGFSVAPDDRETPGEAAEYRSAVAQAAIAHLGG
FT                   NENALPCICARCPAAIWTIGDARTAPITESGEIARASDQAPWTIAVFCRAMHKDMTAFA
FT                   PDYKKLVYVVRGGAVVGFCDAYADELMAWQDHH"
FT   gene            complement(4667..6574)
FT                   /locus_tag="Acry_3557"
FT   CDS             complement(4667..6574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3557"
FT                   /product="Relaxase/mobilization nuclease family protein"
FT                   /note="PFAM: Relaxase/mobilization nuclease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3557"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29155"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU73"
FT                   /protein_id="ABQ29155.1"
FT                   /translation="MIPKNISARGGGKRANGAAVFNRVAKYIEKEGGERGKTLTADCVL
FT                   DARTAAVEMEAVAHTCPGCKEPAMHVVLSWQADEHPTERQQRDAVETVLKNLSRDGRDM
FT                   SEHQWIAVLHKETEQDHLHILINRVHPETGRAVAPEWVDRSLHKAGREIEAAQGWRETP
FT                   GLMKWSKERGQAIPTPAVEREAQQAKRKPERAANMESHSYSESLFSYVKSTGAEKELRQ
FT                   ILRGDDATWADVQYSLGRHGLQLERAAKGGFTVTDGQNRVKASDAFRSVFSGKENRDRL
FT                   ERLGEWSPGDRGIAENIYSRHREPQQPEKEAVKEIPQQGQETPREQARPYRRDDPAAQE
FT                   RRARQAEERKQARAVLWDRYQEEKRAWAKKYSPPDKKWVAERYKQIGADLKAERELIRR
FT                   RTKPRTQERIVAQSVAAFRAMERRDALRESLAEQRKASRPPGWQAWVIDQAQAGDKAAQ
FT                   SQLRAWQYAKSRTPEPVRERLEANDRQAPTRNDGVTAGVQWRRRWFLGGVEYKIDGKAA
FT                   VIDKGDKIKIVGKGRASDQAIALGVALQAAKRGGNVRITGNRQFKERAADIAAQRGLFV
FT                   KFEDRRAQQRYEMQRGQQAQQRSQVRRQKDYEVRRPSVAAVVARQRDQEKQRGRGWMRF
FT                   "
FT   gene            6658..6939
FT                   /locus_tag="Acry_3558"
FT   CDS             6658..6939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3558"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29156"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU74"
FT                   /protein_id="ABQ29156.1"
FT                   /translation="MFHQSTQAAKLIERLNIRQGTTRNHAAAERPPPDVFAQCDASRLC
FT                   RRLKLRPLGRRKPDLKGGGHLLGTARARHLSSLASNGGLGGLPLSKNR"
FT   gene            7053..7466
FT                   /locus_tag="Acry_3559"
FT   CDS             7053..7466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3559"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29157"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU75"
FT                   /protein_id="ABQ29157.1"
FT                   /translation="MWLYRENHANDLRWSNGGLIVPKVVKNSLTAADVQAIAEKLDQLE
FT                   EKPRPLSTREIINMLKPKVAALRAKGYSFDEIAAELTKNGIKISGLSLKSYTGAKKPVR
FT                   KPVDKKSTAPDQSEDKSPEPPAGDNMTPKKNIS"
FT   gene            7483..9297
FT                   /locus_tag="Acry_3560"
FT   CDS             7483..9297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3560"
FT                   /product="Type IV secretory pathway VirD4 components-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3560"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29158"
FT                   /db_xref="GOA:A5FU76"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU76"
FT                   /protein_id="ABQ29158.1"
FT                   /translation="MLSIKPSTSNAVYRVAMGFTMIYAALLTFGFWFAWLRAESAYLFI
FT                   LQSSAASIIVNVGLPAIANMARNQVERRQIFHRALSLVVVLGIVNFAGLYYGSKYLYET
FT                   GFPGWAAWFTTILVAGMVTLLATFITLGAPSIEKQIMEIPPHIGALRPGEKWLRGAKIE
FT                   AAPQGQIIDRGRLSVGGIPLEWDREVQHTFLNGAAGTGKTQVAEGFLRAIRERALLPYI
FT                   KKSPRVIILDPGGAYYSRFGQDGDVLLNPFDARSVAWSPFAEIKRPQDFNRVAAAFVPL
FT                   AEGPNKEWSEFGRKTMADTMRAMVRNDEKSPQELFRLLDGSAENLAFYLNNAEIYGLTG
FT                   EENMKMFSNAKATIAPNIEIFQYLKPDGNFSVRDWLRKGDEANDSGWLFITYRDDQMKL
FT                   LRQFVAAMADLAILEGLSLPSNEGLPAEEHRRLFYFMDELDSIGAVSELKDALIKLRKF
FT                   GGCCVLGLQTISQLRAVYGRDTTRAILGNVATNVVLRPQDGETAEEMEKLLGDQDIERE
FT                   TVTYSQSAGNSRSGMFGNGHSNTSTGRTANQQRQIVTRKCVLASELQNMENLHGILMRP
FT                   ASPHHPFTLDYVEMPRINAPFVEHEYAG"
FT   gene            9281..9850
FT                   /locus_tag="Acry_3561"
FT   CDS             9281..9850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3561"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29159"
FT                   /db_xref="GOA:A5FU77"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU77"
FT                   /protein_id="ABQ29159.1"
FT                   /translation="MNMLANRLVRWGITAIIGLIALQLALGILTALIPDLWWFLLLVDA
FT                   GFIVWRIVEVWPHVNTTTQGIAPGQAAPQPPSPSPLPRINVPQAAPRQTGRQAIAELES
FT                   MTGLHSVKKEINTLMARLEVEKKRRAQGLSVSPMSLHMIFTGPPGVGKTVVARKLGAIY
FT                   QDLGVLKKGHVVETERAGLVGQYMRP"
FT   gene            10080..10706
FT                   /locus_tag="Acry_3562"
FT   CDS             10080..10706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3562"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3562"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29160"
FT                   /db_xref="GOA:A5FU78"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU78"
FT                   /protein_id="ABQ29160.1"
FT                   /translation="MSMVGYARVSTREERQIFDRQMDALTVAGCERIFEDRGSGARSDR
FT                   PGIKACLDYLRRGDVLVVLDLDRLGRLAGELIGLVDDLEARGVGFRALNTAFDTTTPAG
FT                   RAFLQIQAAFAEMERNVIRQRVREGIVAARARGRKGGRPRMMTAERLRYAQHLMADSTR
FT                   SIPSICRELGGIPASTLYHYVQADGTLKSPGIKLLGADPVAIGAV"
FT   gene            complement(10734..11249)
FT                   /locus_tag="Acry_3563"
FT   CDS             complement(10734..11249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3563"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3563"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29161"
FT                   /db_xref="GOA:A5FU79"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU79"
FT                   /protein_id="ABQ29161.1"
FT                   /translation="MGGVQRVARITPAAYPARAIVHPTVERTASEKRLLSSSEGWLVDR
FT                   GFMGSLESWLIKTAEIRLPQLSVPYTPPIVSGQEAMQYTEKEKRKLVNRLSRIRGQVEA
FT                   MQAALDADARCTALLQQATACRGALDGFIGTVIEHHIRQHIVDPKQQETDRAQAAEELI
FT                   GVVHSYLT"
FT   gene            11540..12913
FT                   /locus_tag="Acry_3564"
FT   CDS             11540..12913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3564"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /note="PFAM: natural resistance-associated macrophage
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3564"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29162"
FT                   /db_xref="GOA:A5FU80"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU80"
FT                   /protein_id="ABQ29162.1"
FT                   /translation="MSAETDILISPETARITFPEGLEARLRDRLRIQRLRIGKQSLGSR
FT                   IALGLALVGPGLLVMLGDNDAGGVITYAQTGATYGFSLFIPLMIPLGFIAYLVQEMTVR
FT                   LGAVTRRGHAEMIWKRYGAFWGAFSLIDLVVANILTLMTEFIGIRVASAIFHIPYLVTI
FT                   PAAFVFIVSILLFLKYYSWERISLFVAAFNLVFVPLALMSHPDWGAIGRTFTGAGWALP
FT                   GGLFSAGFLILVSANIGTTIAPWQLFFQQSCVVDKGLLPRDIAASRRDLMLGVIGMVVV
FT                   ATSIIVISGQYLHGLPNAASLDDHSVLVDIGSQLGHGAMVIFALGLLEAGLIASIVITA
FT                   STAWAIGEALDVPRSVNISPRQSLYFYAPAILGTAIAASVLMLPHVPVGFLNLTVQVIA
FT                   TVFMPAAMLFLLMLLNDRELLGDHVNSPLRNILSVGVMVMLIACNGLYGIATVFPHAL"
FT   gene            12941..13237
FT                   /locus_tag="Acry_3565"
FT   CDS             12941..13237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3565"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29163"
FT                   /db_xref="GOA:A5FU81"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU81"
FT                   /protein_id="ABQ29163.1"
FT                   /translation="MKQDNSFPASETRRAKGVSRIPVSRAARASQRDLDRAAHDRSADI
FT                   AAIARAEGWLTPLVPIERVALRPWQQTVFWGLRLYIGVMLIIMGWGFLHVAGG"
FT   gene            13258..13974
FT                   /locus_tag="Acry_3566"
FT   CDS             13258..13974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3566"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3566"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29164"
FT                   /db_xref="GOA:A5FU82"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU82"
FT                   /protein_id="ABQ29164.1"
FT                   /translation="MTDLSQPFPVPFLTTVGDFAVAFVLGTLIGAERQWRQRSAGLRTT
FT                   VLVALGAAAFADLGVRLAGPAGSTRVVAYIVSGIGFLGAGVILKEGANIRGINTAGTLW
FT                   CSAAVGAFCGCGYSAEATLLTVFILAGNTLLRPLVNYINRRPIDARATEAQYAIHALCD
FT                   PADVSDVRDLLFSELEAAHYPIREIATLSDSEELVELAATLVPTNAKPDELDAVVAALE
FT                   KAGPIKTATWTVSTTA"
FT   gene            14027..16660
FT                   /locus_tag="Acry_3567"
FT   CDS             14027..16660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3567"
FT                   /product="transposase Tn3 family protein"
FT                   /note="PFAM: transposase Tn3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3567"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29165"
FT                   /db_xref="GOA:A5FU83"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU83"
FT                   /protein_id="ABQ29165.1"
FT                   /translation="MAQRRLLTDEERHVLLGVPTDPDGLVRHYTFTRSDRNFLLTRRGK
FT                   ANQLGFAVQLALLRHPGTTLSYIAGSVAALVAWLATQLEIPQSAFETYQRRPQTMTDHA
FT                   QILATTLGLRLPNKGDFASMIDAASLAAWGTDRGPMIVKGVIADLRARKIILPTTGVIE
FT                   RVAIAGRARARKRTADALVQGVSPDQITRLDPLLIVDRDLGMTPFGWLKDMPTSPKPDN
FT                   IRGLIERLRMVRRFAISPDVARQVHEDRFRQLVREGRITDAHQVARYATHRRRAIMVAV
FT                   LIDLESRLIDGVLDMSDKLIGGMFARARKSKERHYVASTRDVGRLMHLFSATIEALATA
FT                   HESGRDGFSVVDETVGWTKLQRVRSEVRAFAEFTEEDPLIRASDRYATLRKFAPDIIEA
FT                   LAFKTARSDSPLLAAIRLLKDLNETGQRHIPADAPMPFRKEWAKLVQGGDRPNRRLYET
FT                   AVFATLRGKLQSGDVWVERSSNYRRFDSYLIAPEAVPSIATELGLPATADIWIAARGRD
FT                   LDQRLKRFARRLARGDLEGVEWRDDRLHISPVKALTPPAADTLASEITALLPYARITEI
FT                   LHEVNRQTGFAAAFTNLRTGEHCDNENALLAAILADATNLGLTRMAAASQGVTRDQLIW
FT                   VADAYIRPETYKAALGRIIDAHHRLPVAALWGAGTTSSSDGQFFRSGKRGETAGDINAR
FT                   YGADPGLGFYTHVSDQHAPYNVRVMSATSHEAPYVLDGLLHHGTSLKIDTHYVDTGGAS
FT                   DHVFALCSMLGIRFCPRLRDFPDRKLASIEPVTAYKNLQPLLGRRIRTDVIREHWSDIV
FT                   RLVASLKAGAVAPSTMLKKLAAYQRQNQLDLALQEIGRIERTLFMLDWLESSDLARSNG
FT                   SPRAVA"
FT   gene            complement(16679..19669)
FT                   /locus_tag="Acry_3568"
FT   CDS             complement(16679..19669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3568"
FT                   /product="transposase Tn3 family protein"
FT                   /note="PFAM: transposase Tn3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3568"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29166"
FT                   /db_xref="GOA:A5FU84"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU84"
FT                   /protein_id="ABQ29166.1"
FT                   /translation="MGHRRILTGEQIAQLFDPLTDRRGIIRHYTLSAADLAMIRRGRGD
FT                   HHRLGLALMLCYLRYPGRPLHAGEIPDPALVSFVATQIDVLPDSLGAYLRVDQNRRRHS
FT                   AALQDRLGLRPWGPRVAADLADWLLAHALEADRLVDLAALVLEECRGRGILLPPPARLE
FT                   RLCIEVRYRARREIERRLTAGLSADQRRRLDALTERRLDTSQSWLAWLRQIPESAKPAS
FT                   MLGVIERLEHIRAIDIDPARGHRINQSRLAQLVREAGRTTVQHVAGYERRRRHAVLTAI
FT                   DLDLSARLTDQAITLFERLIGAMFRKAEGRHARAFQAEGRAINEKVRLYARIGAALMAA
FT                   RAGQGDPFAAIDKVIPWDRFCSTVMEAETLVRSEDFDPYEVLSEHYAGIRRWAPAFLAT
FT                   FEFQGVPAAASLMRAIAMLRAMNSAGASTLPKSAPTAFVRPRWARHVLTAHGIDRRYYE
FT                   LCVLAELRQRLAAGDVWVTGSRQYRAFEERLISRETLQVLQKASGIPVAIETDFDRFIE
FT                   TRRTWLDARLAEVDARARGGLLPDVTIEKGVLRITPIEKSTPPEAEALAAKLYATLPRI
FT                   RITDLLTEVAGWTGFLDCFTHLRTGEAAADPRVLMAGLLADGLNLGLTRMAEACSIASL
FT                   GQLAWTADWHIRDETYALALRRLVEHQSREPLAALFGSGTASSSDGQFFRAGGSGRDAS
FT                   RINAHYGPEPGLKFYTHLSDRYAPFHTRVIAATASEALHVLDGLLDHHGDAPPRQHRHH
FT                   TDGGGVSDHVFALCALLGYVFAPRIPDLKDRRLYSFARPAAYPTLAPMIAGRINVDLIR
FT                   AHWPDLLRIATSIRTGTVSASVILRQLAAYPRQNAVAAALRELGRLERTLFTLDWLEDP
FT                   GLRRESSHELNKGEARNSLARAVFIHRLGEIRDRTFENQTHRASGLNLLVTAIILWNTR
FT                   YLAQAIQALRQVEDVPGTLLRHLSPIGWEHVNLTGDYIWSANQKSTENHAGLRPLRPIP
FT                   DTTTHAA"
FT   gene            complement(19769..20977)
FT                   /locus_tag="Acry_3569"
FT   CDS             complement(19769..20977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3569"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3569"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29167"
FT                   /db_xref="GOA:A5FU85"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU85"
FT                   /protein_id="ABQ29167.1"
FT                   /translation="MTDDRLPLAELLAKAGDGDFLRSVAEAVVQLLMEADVEGLIGAGR
FT                   HERTGERTTYRNGYRDRSLDTRLGNLQLRIPKLRQGSYFPPFLEPRKTSEKALVAVIQE
FT                   AWVGGVSTRRVDDLVQAMGLSGIGKSTVSKLCKDIDERVNAFLERPLTGDWPYLWLDAT
FT                   YLKQREGGRIVSVAAIIAVAANTEGKREIVGLHIGPSEAETFWAAFLKSLVRRGLRQVK
FT                   LVISDAHEGLKSAIRRVMGASWQRCRVHWMRNALAYVGKGQQSMVSAALRQAFIQPDRA
FT                   GASQTLRHTADQFRAKWPKLAAFIDDSEVDVLAHMDFPVQHRVKIHSTNPIERLNKEVK
FT                   RRADVVGIFPNEAAIIRLVGAVLLEQNDEWQTQNRYMQTEPMAELTPPAIDVFPPQIAT
FT                   AAE"
FT   gene            complement(21120..21713)
FT                   /locus_tag="Acry_3570"
FT   CDS             complement(21120..21713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3570"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3570"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29168"
FT                   /db_xref="GOA:A5FU86"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU86"
FT                   /protein_id="ABQ29168.1"
FT                   /translation="MLIGYMRVSTDNDRQVLDLQRDALLGAGVDERHLFDDRAAGSRRD
FT                   RPGLAAALAYLKSGDCLVVWKLDRLGRSLPHLLETVNSLRARGVGFRSLTEQMDTTTPQ
FT                   GEFLFHVFGALAQFERSLIQERVQAGLAAARRRGRRGGRPMAIDAEKLAAVIAALDAGA
FT                   TKASVCRTFGISRSTLVDSLARIGLMSALVVEIV"
FT   gene            21978..22343
FT                   /pseudo
FT                   /locus_tag="Acry_3571"
FT   gene            22457..22942
FT                   /locus_tag="Acry_3572"
FT   CDS             22457..22942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3572"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29169"
FT                   /db_xref="GOA:A5FU87"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU87"
FT                   /protein_id="ABQ29169.1"
FT                   /translation="MDGILFIDEAYTLSGGKGGHDFGQEAIDTLLKEMEDKRDRLVIIV
FT                   AGYPAEMRAFINSNPGLASRFAKTIEFQPYSPPELIEIFKGMLRKEDLHLAPDWPEAEL
FT                   TGWFSSRLTDPQFGNARTVRTIVERIREAQSLRLAQNGAGDLQTVTAEDVQEALASC"
FT   gene            22936..23262
FT                   /locus_tag="Acry_3573"
FT   CDS             22936..23262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3573"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29170"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU88"
FT                   /protein_id="ABQ29170.1"
FT                   /translation="MLNPEFRDHLRAVHRALWRQDNSYRLAILAAPVLLVLAVIHALPG
FT                   GKNASPPTPSGPPVSSSHSSASNIPPPAAKPAAAAVPLKIKPGAPLPATQPASAGGYHS
FT                   PFNQ"
FT   gene            23270..24100
FT                   /locus_tag="Acry_3574"
FT   CDS             23270..24100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3574"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29171"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU89"
FT                   /protein_id="ABQ29171.1"
FT                   /translation="MRLCSISAVAVFVAAPAFAQSAAPSPDAALWASASKGAAGELQLY
FT                   LGQYPHGQFAGQAKAALAALNSRPAAFPAPTAKAAASSATSKPSKPAPSPTVSKPANLK
FT                   PGWLVEVRATHQQATSSGQTWLPDPVALSLKPQPGPVFNIATLAQGIPAAGTLPAIAGS
FT                   AKWLVRKAGQWGIGTDIKWHNTGPCTATVTVQGNRIIKSTTNQVSYAPGSGDTSFSAAL
FT                   SLTPGVYNVAWTLVCQPTSSYLPGKDATLSLLVAPPQGALAAPTTGEFVYQPNK"
FT   sig_peptide     23270..23329
FT                   /locus_tag="Acry_3574"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.856 at
FT                   residue 20"
FT   gene            24356..25762
FT                   /locus_tag="Acry_3575"
FT   CDS             24356..25762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3575"
FT                   /product="transposase"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase, IS891/IS1136/IS1341 family;
FT                   transposase, IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3575"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29172"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU90"
FT                   /protein_id="ABQ29172.1"
FT                   /translation="MMLTFRVRACPTRQQHAWFTACLDHTRDLYNAALEERLGAWRKAR
FT                   KRITLGEQGKALTELRRDAEYAAFPRRMQRWTLDRVDVAYREHVKRLADPARPRGDIRF
FT                   RGKPFWRTIGFDSPIDFEMRDRGLYQRKALGGTLRLKRDRDLPPWENCKAITLTREDRR
FT                   WFVNLTYEMPAPAHSPRLVPMRPVGLDLGLKTSVVRSDGAEIDAVGSLRAALPELRRLG
FT                   RALARCKKRSRRRHKVKARLARLHAKISRRRGARLHEISARLVHHWDAVAVEDLNLAGL
FT                   MRAGDRRAQGRGMRRKWRDFSPGRLVSLIEWKCQREGRAFARVDPRGTSQECAGCGSFV
FT                   PKTLRDRMHRCENCGIVLDRDHNAALNVLNRAGWGPGGANPDGKVGNPADLVRDCPGNT
FT                   AGDDPAGPRRGGLATSLHPTTCNRWNGAYGNSCSISYGYRKTVPRARGDEPRLGQYVIA
FT                   AIVRSPRTRG"
FT   repeat_region   complement(25677..25828)
FT                   /rpt_unit_range=25677..25706
FT                   /note="CRISPRs"
FT   gene            complement(25913..26179)
FT                   /locus_tag="Acry_3576"
FT   CDS             complement(25913..26179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3576"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29173"
FT                   /db_xref="GOA:A5FU91"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU91"
FT                   /protein_id="ABQ29173.1"
FT                   /translation="MMASNPDENAERLYLREQIARFDQMHERIWRMREESWPRIDALLA
FT                   QAARDRAAIHRNDTNWPAIIAAGGAVLSGISAILAVLVAAHLI"
FT   gene            complement(26565..27131)
FT                   /locus_tag="Acry_3577"
FT   CDS             complement(26565..27131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3577"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29174"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU92"
FT                   /protein_id="ABQ29174.1"
FT                   /translation="MALEADYLEALGLLGRVCEEYRRETGSPAYLVGGAAVALWTGGAF
FT                   HSADFDLIVAAEERFHEILLQRGFCPEDRAGKLKVGYYHPDYPQFGWQLVTGPMFDGRA
FT                   DRMRVAQFQIDAGSAVVLPAIEDLIADRLGQYAGGKPPDESRLNQARVLFEMADRIDSA
FT                   YLKKRVEEEGGDISLLNGLNSELEP"
FT   gene            complement(27154..28509)
FT                   /locus_tag="Acry_3578"
FT   CDS             complement(27154..28509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3578"
FT                   /product="replication protein C"
FT                   /note="PFAM: replication protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3578"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29175"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU93"
FT                   /protein_id="ABQ29175.1"
FT                   /translation="METESPGFGQNTKTNQRSGGLRRLSLAMIATDRTAEGFTGLSDGA
FT                   GGPGAVLAAFKAAAPYLGLPPRVVHAVDWLFRFTQRQDWEPGARPVVWPSATVQQADLD
FT                   LGVSQTKALNRLLVELGLVVMRDSPNGKRYGRRDRSGRIIEAYGFDLSPLGVRLEEFRA
FT                   VAEKGRAEREAVRQLRRRVTIARKAIEQIAETAVEVGLEPGGFVREAEEARRLCWRLGK
FT                   EERSTVLVFGVTRLEDRHGELRQRLESLIAERRGSAQKDVETDPKGPENRPHQYRYKSN
FT                   ADPEQDTVSGIEKSSPAPVMSVAPTGSPGLRDGSSGPQTGRGGQKPALQDDGTVLRITP
FT                   DELVRLAPRLRPYLGRSSPAWPDVVEAADWLRHDLGVSKPLWGEACLAMGREQAAIALA
FT                   IVSARPAGHFRSTPGGYFHGMVARARAGELNLGKTIWGMRSKRDTHGWDQPQ"
FT   gene            29311..29994
FT                   /locus_tag="Acry_3579"
FT   CDS             29311..29994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3579"
FT                   /product="ATPase involved in chromosome partitioning-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3579"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29176"
FT                   /db_xref="InterPro:IPR009744"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU94"
FT                   /protein_id="ABQ29176.1"
FT                   /translation="MPTVVFASPKGGAGKSTSAVILATELAAAGAEITIIDADPNKPVA
FT                   RWSRLPGKPASLRVIDDVSEKTIIRVIDTEAERAAFVIVDLEGTASRMVPYAMSRADLV
FT                   LIPTRGSVLDAVEAVAAIREVKQQEEAFRLHIPAAVLFTNTSAAIRPRTLSAIETEFAE
FT                   NGVNVLKTRLHEREAYRALFSFGGTLEALDPANVRNIPAAIENAQAFAREVVDLLRQNR
FT                   EEVAA"
FT   gene            30434..31087
FT                   /locus_tag="Acry_3580"
FT   CDS             30434..31087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3580"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29177"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU95"
FT                   /protein_id="ABQ29177.1"
FT                   /translation="MGVQLYLLDRRPTTLVVGGTSHKIGTLRRFWKVTELNNARMTEIG
FT                   AAQGRIRQKAAPVAVMLNDVMEAALEMEPGRSLPAHIVLGWDADRVSVTDQDWEYLPVL
FT                   GYAVRNPETGIYVLHETGEGEGGLLRPVTRDRAIHRGLITTDDQLVRHGQPRITTCHSV
FT                   TPLIETYAEADCLLADGRSTRILTSVTSGRLPDPAWYAGKRPADVKAYPIDRAA"
FT   gene            complement(31098..32336)
FT                   /locus_tag="Acry_3581"
FT   CDS             complement(31098..32336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3581"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29178"
FT                   /db_xref="GOA:A5FU96"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR015109"
FT                   /db_xref="InterPro:IPR015300"
FT                   /db_xref="InterPro:IPR023372"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU96"
FT                   /protein_id="ABQ29178.1"
FT                   /translation="MALTDLVGWMDEYGVPGAVWFAKRLAANDTLATGAHGAGPYIPKE
FT                   FLFSVFPDLNHPEEENPDCWFDLYIDSHADRRRIRAIWYNNRLRGGTRNEARLTNFGGG
FT                   RSALLDPDSTGALAVFAFLPHGPGRQMECHVWVCDQGAEADLLEERIGPVEPKAPVVWQ
FT                   PGEIARDLFMHTDAGPGSCRLLPGEIPPAWLTRFPTGEEIIRETVKRRQRNGLEPDRLL
FT                   MRRRECEFEIFLSVEEAVYLPRIRQGFSAIGDFLSLAQTILQSRKTRSGTSLELHVREI
FT                   MTEEGLLADTSFTYRPVIENGKRPDFLFPSKAAYDNPAFPAERLRMLAAKTTCKDRWRQ
FT                   VLNEADRIATKHLLTLQEGVSEGQFREMSEAGVRLVVPAELHRSYPASVRPHLVTFENF
FT                   IGDVRPLSAIQGP"
FT   gene            complement(32323..32787)
FT                   /locus_tag="Acry_3582"
FT   CDS             complement(32323..32787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3582"
FT                   /product="T/G mismatch-specific endonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /note="PFAM: DNA mismatch endonuclease vsr"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3582"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29179"
FT                   /db_xref="GOA:A5FU97"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU97"
FT                   /protein_id="ABQ29179.1"
FT                   /translation="MPDIVDRQTRSRMMAGIRSANTRPERMIRSALHVRGFRYRLHPRA
FT                   LPGRPDIVLPRYRAAIFVHGCFWHGHDCGLFRLPGTRPEFWAEKIRRNRQRDAAVMNEL
FT                   VATGWRVLTIWECAIRRRRGMVPEPVIDEAVSWLRSGDGNLEIRGNNGAD"
FT   gene            complement(32780..34243)
FT                   /locus_tag="Acry_3583"
FT   CDS             complement(32780..34243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3583"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3583"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29180"
FT                   /db_xref="GOA:A5FU98"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU98"
FT                   /protein_id="ABQ29180.1"
FT                   /translation="MLRLGVRVCRSGMIFPAHDELEPRDHDLVKSQTRAKDILGVASPS
FT                   LPAPLPARCESGIESEKFPEVTVTEFSILRQKAGLSVVEAAEALGYHERHVYRWENGKG
FT                   KPPRQAVLDCLRARQPGGHKPVADTSAFTFIDLFAGIGGLRRGFEAIGGRCVFTSEWDK
FT                   YSQATYAANYPYDDHTISGDITKIGEKDIPEHDVLLAGFPCQPFSIAGVSKKNALKRPH
FT                   GFACEAQGTLFFELARIIKHHRPKVFLLENVKNLVNHDRGTTFRIIRDVLENQLDYRID
FT                   FRVIDAKSWVPQHRERIFIAGFRDRNAEFTFKTLDIPDPASGPRLASILHPEDGTEKPD
FT                   GHFTEGPLATVTERYTLTDHLWNYLQNYAEKHRRAGNGFGFGLCGPEDVARTLSARYYK
FT                   DGSEILIRQNGKRPRRLTPRECARLMGFDRPGEADFKIPVSDTQAYKQFGNAVAVPVVA
FT                   AVARHMKQWILEAVEGDENHHATGLQESA"
FT   gene            34246..35343
FT                   /locus_tag="Acry_3584"
FT   CDS             34246..35343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3584"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29181"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU99"
FT                   /protein_id="ABQ29181.1"
FT                   /translation="MDTPWGPLAGLKLDDPEEAVKILAADKHQLIEGLVVESLFDQIVA
FT                   SVPESTEQKIIALDVDSAVIDTMRRSERWLCLVWARTESEGLGRYLQALEKCVTPYLVR
FT                   YRNGEFEAVRICEGRRAGKYRPLPELMQEMSGSRMTRFEVDPAVRNVNRQKQAFWGFLS
FT                   EHYGNRLGNRVVLPRILMNCGIQPYFRRVWNLDRVFISGNSVWIFEIKHKYPIVPNAHI
FT                   SPGPLQFGINDGELGMLQKLSDAGIRCLHTILVKPVWSKDAGSMYLLNDLAMRSRAAVI
FT                   ALALDSSTIRRIMGGQSGQSAAHTSITGKSTLSYKKIPVSDFSVLGRFSDPPQDIARRI
FT                   AAIMAETAMPRATDMWISDLRKFVP"
FT   gene            complement(35674..36135)
FT                   /locus_tag="Acry_3585"
FT   CDS             complement(35674..36135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3585"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29182"
FT                   /db_xref="UniProtKB/TrEMBL:A5FUA0"
FT                   /protein_id="ABQ29182.1"
FT                   /translation="MKEGFIMDLSEIANELFGGNMSALIGQVSRLAQVSYSDVVAWLNG
FT                   HGRNADGDRVVAAIACFVRLVKLKRAKAHAKAEADMAENALLERIKKQNDLLMAIIDKR
FT                   ILAESEQEELNLLRKYFENTWKAQFQEAMIYFNGEEERPTPSAGSVPTP"
XX
SQ   Sequence 37415 BP; 7500 A; 11662 C; 10645 G; 7608 T; 0 other;
     tcgccggcgg cctgtgtggc gactatgtga cgacttcccg gggatttccg gggatgttcc        60
     ataatacgga attctgggag aaccaacaat gggacttgag ccgacaataa gaccaacaac       120
     tgaatgtgag atcaaagaga atggaaactg gatcaaggtg acggtcgcag aggcgcttga       180
     gatacaggga cagaagcgct gtatatcatg tcatggccct gtgagagctc atagggcagg       240
     tattggaagg gcccatatcg aacatcttag acgacattca ggctgtcctc gaagcgatgc       300
     atatgacgga cgaggcatta ccctacatcc atatgcctta gattagcaca attcataatg       360
     tgaattctgg ggggcgaaat tatttaatca atcaacgtcg gtgacgagat gataatattt       420
     ccatcatggc tagcctttat ttcattttta ataccgctat tcacgatttc cggttcggct       480
     attgctttta tagtaaaatt atttattgat agatcagata aaattcataa tagatttttt       540
     gatttattga aaataattga ttcaaaagaa ccgatagcaa caaaaatggg cgctgtgtac       600
     gaacttagga attttcctca acataaagaa ttcataatac gcttctgtga aagccaaaat       660
     tctaatataa taggatctga tacggcagtt tcagctttac gcgctgagat ggattccaca       720
     aaaattgcaa tgcaaaaaat aaaaccaaag ttttttaaaa atcaggagtg atgcaccgag       780
     ccggcccgta ggtttcatgt tcacctttct ggtgcggaag tctggagcag aaaggcgtca       840
     gtctgcgagc ctagaaatcg tgctgtggct gacgttgtag gagcgggcga tctcgcggac       900
     ggcctcgccg gcgtcgcgcc ggcgcagggc ttcctggcgc tggtgcaggg tcagcttcgg       960
     cttgcggccc atccgaacac cgcgggcctt cgcccgttct cttccttctc cggtccgggc      1020
     cctgatcagc tcccgttcga attccgccag gccgccgagg acggtgagca tcagccggcc      1080
     gtgcggcgtt gtggtgtcgg cccagctgtc actgagggag cggaacccgg cacccttctc      1140
     ggcgatggtc gccagcgtgt tgagcaggtc ccgggttgag cgggcgagac ggtcgagccg      1200
     ggtgaccaac agggtatcgc cggcctcgag ccgatcgatc gccttgcgga gctggacccg      1260
     atcagtgcgc gcgccgctgg cggtttcctg gaagaccttt ccgcagccgc cggccttcag      1320
     ttgcatgacc tgagcggcca cgctctgccc gtcggtggag acccgtgcat agccgtaaat      1380
     catgccgata ttatgcaccg gacttatgca acagaaaacc ccgcttccgg cctatggggt      1440
     gggtctggtg cgaaattcat gaattaccgt ccgatctgga tataggaaaa gccggtaacg      1500
     tatagaagtt ttcctgacca aaataatcca tggtcatcat cgtcatattg accgtgatct      1560
     tttaagccat taccaaaaat ctcaaatgaa atttgtttta tttcttttat atgaacataa      1620
     aactcatcaa atgattgttt gtttattttt atactgaaat ctattaattc ttcaaatcct      1680
     tttatttgat cataaaatcg aagatggcct aatgcttgaa attttatttc attcccattt      1740
     tcatctaaat ctgttacttc aaaaaaatta tccttttctg aacactcaat atttacagta      1800
     gccatatttc tgtaaatccc atttggaaga tatatttcat attttggcct ggttcgaaga      1860
     attatgatag aactgttatc gttatagctt atatttttaa tatatcttga ttcgcagaca      1920
     tcttgaaaaa tattacgttt tatcattttt tgtgctcttt attgttggtc gatcaaatct      1980
     ctttttcttc gaggttgagg tgttttcatc ttccggtatt gggataccct taccaataca      2040
     cacaggacat aatcgaccat cctgcaattg tctgctgcca ccacaccagt cacatataga      2100
     ttttatattc tgcatcatcc cagaatccac attatggaac tttgccggaa gtccccggaa      2160
     agtcgtcaca tagtcaccac acaggccgcc ggcgaacccc agagtaaccc cgccaaagag      2220
     actgtcaaag caccccgcca caagcgggac agggcggaat caatacttgt taggccggat      2280
     ccaaaggctc taggcggagc cgccagggct gcggctattt cttgcccttg ggtttcggtt      2340
     ttgcctggga caggtcggac gccgcgacct tcttttccgc cttggttgat ttcggatcgc      2400
     tcaggatctt gccggctttc gacgccgcct tcttgccagt cgccatagct gtcaccttcc      2460
     gggtggtttc atgacggcac cgatattagc cgatcaggtc ggctggaggc accaggaatt      2520
     agtccgcatc ctcctctttc ggcagggacc tcctgagctt gtcgaggtca caaaacatgg      2580
     ccgagaggag atagtccggc acctcctcga tgtaggcggc ccggcgaaca gcacgaaccg      2640
     ccgcatcggc cgcggggaac agattgtcgt tggccggaac aggaggtgtt tctggcatcg      2700
     gtgcctcgca gacgaacggc tcttctagct gggtcgatcc tgggccccgt gccagatgcg      2760
     aaggagccgc acagtgtccg gtgttacatc gacctcatag acgaacatgt gaattcgctg      2820
     gacggtcgcg ggtggcgcag gggaggcggc agtgcgttga actctccctg gctaagacgc      2880
     agaagccaag cgcgcatgtc ctcgtgggtc acgtagcgcg gatccctcgg ctattatctc      2940
     attagccatc tctcaaagta caaattgatt gggttggcaa cgtaggggcc atacgccggg      3000
     cacggaacga atccattcgc ccgatagagc ctctgggcat ctggaagaaa ttccgtggtt      3060
     tccagcctca gaaccgacag cttggcggtc aatgccgctt ccacaacgcg cgccaggagc      3120
     ctactgccta taccagttgt tcgtacctcg gtgacaacat acatgcgctt cacctcccct      3180
     gtaccgtcct cgaacacctg aagccctgca cagccaacgg cttgtccggc aatccgcgcg      3240
     ataaacattt gcgtgtcgtc gtgtgctaac cgatcaattg gagagccgtg attcctttcc      3300
     accccgcaga cccggtttaa gaaatcgtcc agagcagtta ccaagttaat caggtccggg      3360
     gaccttgcat cggccagctc aatttcgatt ctatcgacag tcattctcat cctctttctt      3420
     gaagagaaga gcgcatgacg ccgtggtggc ttgtcccgtt tagttgccgg accggccaca      3480
     tcttcttccg aaggaagaaa gccaccttgc tcgggaagca ggttggcgct gggcgtcggc      3540
     ccaactcttg atgctgaagg tgacgatagc cggcaatatc gaactgggca agcacctcag      3600
     tttgaggaat aacacgtgac cgtccttgga tcgtatcggt cttccacgaa gaccagccaa      3660
     ttctcttttg gaacagcttt ctttgccatg tggatgttta cactttcgag tcagggataa      3720
     acggccgaag aagaggcggc caaccctggc gacctacgaa ccgcattgac cgcgcagcgt      3780
     gaagcggcgg agcatccata aagcatgatt catggtccat ccgccggcgg ctccgtaata      3840
     tggaagccga tgcggttcgg tgtctcgttc aatttcggta aggcagtgag caagatgctt      3900
     agttgcgaaa cgtgttggac gaggcgttgc ggttttccat gttcattcac cccctcaaac      3960
     accagaatat ccatgttcaa attataaaat ttgagaatat gaaagcaggt atttcctgga      4020
     gctccaacaa taattccacc gacctcttct tcgtcagtaa gcatcgattc gaaatctgcg      4080
     atttcttcgc ctaagcgttc aacagctttt tcggcgggat ttcttggacc gagtattggc      4140
     acggccggag gcgcgaaggc gtttatgtga ttaaggacct taggaagatc cgccatcccg      4200
     caacctttct cgattcgcca gcaaaaactt acgataatgg tatactattc tagccagatg      4260
     cacgactgct aatggtggtc ctgccacgcc ataagctcat ccgcataggc gtcacaaaag      4320
     ccgaccaccg cccctccacg caccacatag accaactttt tgtaatctgg tgcgaaagca      4380
     gtcatgtcct tgtgcatcgc ccggcaaaac accgcgatcg tccacggcgc ttgatctgac      4440
     gcccgtgcaa tctccccgct ctcggtgatc ggcgcagtgc gggcatcccc tatggtccag      4500
     attgccgccg gacatctggc gcagatacag ggcaaggcgt tctcattacc ccctagatgg      4560
     gcaatcgccg cctgcgctac ggcgctccga tactccgccg cctcgcccgg cgtctccctg      4620
     tcgtccggcg caactgaaaa gccttcttcg tcgtcgtcac ccatctctag aacctcatcc      4680
     atccgcgtcc gcgttgcttt tcctggtcgc gctgccgtgc cacaaccgcc gccacagagg      4740
     ggcggcggac ctcgtaatct ttctgccgcc gcacctggct acgttgctgc gcctgttggc      4800
     cgcgctgcat ctcatatcgc tgttgcgctc gccgatcctc gaacttcaca aacaggccac      4860
     gctgagcggc aatgtcggcc gcccgctcct tgaactgccg gttcccggta atcctcacat      4920
     tcccgccgcg cttcgccgcc tgcaaggcaa caccaagagc tatagcctga tcgctcgctc      4980
     gccccttacc aacaatcttg atcttgtcgc ccttgtcgat gacagcggct tttccgtcga      5040
     tcttgtattc cacgccaccc agaaaccagc gacgccgcca ctgaacaccg gccgttaccc      5100
     catcattgcg cgtcggcgcc tgccggtcgt tcgcctccag gcgttcgcgc accggctccg      5160
     gggtccggct cttggcgtac tgccacgctc taagctgaga ctgcgcagcc ttatcccccg      5220
     cctgggcctg gtcaatcacc cacgcttgcc acccaggggg acggctcgcc ttacgctgct      5280
     ccgcgaggct ttcgcgcagc gcatcccgcc gctccatcgc cctgaaagcc gcaacgctct      5340
     gtgcgacaat tcgctcctgg gtgcgtggct tcgtcctccg cctgatcaac tcccgctcgg      5400
     ccttaagatc ggcgccgatc tgcttgtagc gctccgccac ccatttctta tcaggggggg      5460
     agtatttctt tgcccatgcc cgcttttcct cctggtagcg atcccacaac acggcgcgcg      5520
     cctgcttgcg ttcctccgcc tgccgcgccc gtctctcctg cgccgcggga tcgtcccgcc      5580
     ggtagggccg cgcctgctcc cgtggcgtct cctgcccctg ttgggggatt tcttttaccg      5640
     cttccttctc cggctgctgc ggctccctgt gccgggaata gatattctcc gcgataccac      5700
     gatcgccggg ggaccactcg cctaatcgct caagccgatc cctgttctcc ttgccggaaa      5760
     acacggagcg aaaggcatcg ctcgctttta cccggttctg cccgtccgtg acggtgaagc      5820
     cgcctttcgc cgcccgttcc agttgaaggc catgccgccc aagcgagtac tgcacgtctg      5880
     cccacgttgc gtcatcgcct ctcaatatct ggcgtagctc cttctccgcc ccggttgatt      5940
     tgacgtagct gaataagctc tccgagtagc tatgcgactc catgttcgcc gcccgctccg      6000
     gcttgcgctt cgcctgctgg gcttcacgct caacggctgg tgtcgggatc gcctggcccc      6060
     gctccttgct ccacttcatc aagccgggtg tctctcgcca tccctgcgcg gcctcgatct      6120
     cgcgccctgc cttgtgcaag ctccgatcga cccattccgg cgctaccgcg cgcccggtct      6180
     ccggatgaac acgattaatc agaatgtgca ggtgatcttg ctccgtctcc ttatggagaa      6240
     cggcaatcca ttgatgctcg ctcatgtcac gcccatcgcg ggacaggttc tttaagaccg      6300
     tctcaacggc atcccgttgc tgccgttctg tcggatgctc atcggcctgc cacgacagaa      6360
     caacgtgcat ggctggctct ttgcaccccg gacacgtatg cgccacggct tccatctcca      6420
     ccgctgccgt gcgggcatcc agcacacaat cggccgtcaa cgtctttccg cgttcgccgc      6480
     cttccttttc gatatatttg gccacgcggt taaatacagc cgcaccgttc gcgcgcttgc      6540
     ctcccccccg cgccgatatg ttcttgggaa tcatgccgcg acccgctctg ccgcttcgcg      6600
     tagcgcggcc aacgcggttc tgaggtcgtc gggattgcca acctcttcca gcgccaggtg      6660
     tttcaccaat ccacccaggc ggcgaagctc attgagcgtc tgaatatccg tcagggcacg      6720
     acgcgcaacc acgcggcggc cgagcgcccg ccgcctgatg tattcgctca atgtgatgcc      6780
     agccgtctct gccgccgcct caagctccgc ccgctcggtc ggcgtaagcc tgacctgaaa      6840
     gggggtggtc atttgctcgg tacggcgagg gcgcggcatc tttcatcctt ggcgtcaaac      6900
     gggggtctcg ggggcttgcc cctgagcaag aaccgctagg ccctttgcgg agcatcccgg      6960
     cagggatgca gagtaaaggg ccggtgcacc tagaaactcg cagaagtttc gtagtgcaag      7020
     cggcatcttg ccttcttagt taacagaaat ttttgtggct ttatagagaa aatcatgcca      7080
     atgatcttag gtggagtaac ggaggtctga tcgtgccaaa ggttgtaaag aattccctga      7140
     ccgctgctga tgtccaggcc atcgcagaaa agctcgatca gctcgaagaa aagccgcgcc      7200
     cgctatcaac gcgggagatc atcaacatgc tcaagccaaa ggtggccgct cttcgcgcga      7260
     agggatattc attcgacgag atagcggcag agttgacgaa gaacggcatc aaaatatccg      7320
     ggctatcgct caagtcatat accggagcca agaagcccgt gagaaagccg gttgataaaa      7380
     aatccaccgc tccggatcag tcagaagaca aatcgccaga gccgcccgca ggcgacaata      7440
     tgacgccaaa gaaaaatatc tcttgagcgg ctcgagctta aaatgctgag catcaaacca      7500
     agcacaagca acgctgtata tcgcgtggca atgggcttca cgatgatcta cgcggcgctt      7560
     ctcaccttcg gtttctggtt cgcctggcta agggcggagt ccgcctatct gttcatcctg      7620
     caaagttcgg cagcatcgat catcgttaat gtgggtctgc cggcaatcgc caatatggcc      7680
     cggaatcagg tggaacggcg acagattttt caccgagcgc tctccctcgt cgtggtgctt      7740
     ggcatcgtca attttgcggg cctctactac ggctcgaaat atctatacga aacaggtttc      7800
     cccggctggg ccgcgtggtt caccacgata ttggtagccg ggatggtaac gctcctggca      7860
     accttcatca cgctgggagc cccatcgatt gaaaaacaga tcatggaaat tccgccacat      7920
     atcggcgcgc tcaggccagg tgaaaaatgg ctgaggggag cgaagatcga agccgcgccg      7980
     caaggacaga tcattgatcg cgggcgtctg tcggtcggag gaattcctct ggaatgggat      8040
     cgggaagtcc agcacacctt tctcaatggc gcggccggta cgggaaaaac ccaagtcgcc      8100
     gaaggttttt tgcgggcaat tcgcgaacgc gcactgctcc cctatataaa aaaatcgccc      8160
     cgcgtgatta tcctcgatcc gggcggcgca tattatagcc gcttcggaca ggacggggat      8220
     gtcttgttga acccgttcga tgcccgctcg gtggcatggt caccattcgc ggagataaaa      8280
     aggccgcagg actttaatcg ggtagctgcg gctttcgtgc cccttgcgga gggaccaaat      8340
     aaggaatggt ctgagttcgg cagaaagact atggccgaca cgatgcgggc gatggtcagg      8400
     aatgacgaaa aaagcccgca agagctattc cgccttctgg atggatcggc tgaaaatctc      8460
     gcattctatc tgaacaacgc agagatttat ggccttacag gcgaggaaaa catgaagatg      8520
     ttttccaacg ccaaggcgac catcgcgccg aatatcgaga tatttcaata tctgaaaccg      8580
     gacggcaatt tctcggtgcg ggattggtta cgcaagggcg atgaggcgaa cgactccggc      8640
     tggctgttca tcacctaccg cgacgatcag atgaagctgc tccgccagtt cgtcgcggcc      8700
     atggccgatc tggctatcct ggaagggctg agcttgccct ccaacgaagg gctgccggcc      8760
     gaggaacacc gccgcctgtt ctatttcatg gacgagctgg actccatcgg cgcggtgtcc      8820
     gagctgaaag acgcgctcat aaagctacga aaattcggcg gctgttgtgt tctcggcttg      8880
     cagacgatct cacagcttcg cgccgtctac ggcagagaca cgacccgcgc catcctcggc      8940
     aacgtcgcga ccaatgttgt cttgcgcccg caggatggcg agactgccga agaaatggaa      9000
     aagctgctcg gagatcagga tatcgagcgc gagacggtca cctactccca aagcgccggc      9060
     aattcgcgct ccggcatgtt cggtaatggg cactccaaca catcaaccgg gcgaaccgcc      9120
     aaccaacaaa ggcagatcgt cacccgcaaa tgcgtgctgg cctccgagtt gcagaacatg      9180
     gaaaacctgc acggcatcct tatgcgcccc gcgtcgccgc atcacccctt caccctggat      9240
     tacgtggaga tgccccggat caacgcgccg ttcgtagagc atgaatatgc tggctaatcg      9300
     gctcgtccgc tggggcatca ccgcgattat cgggctgatc gctctccagc tcgcccttgg      9360
     catcctcacc gcactcatcc ccgatctgtg gtggttcctg ctgttggtcg atgccgggtt      9420
     catcgtctgg cggattgtcg aggtctggcc gcacgtcaac acaacaacgc aaggcatcgc      9480
     accggggcag gcggcgcccc agccaccatc cccgtcgccc ctgccgcgca tcaatgtgcc      9540
     gcaagcagcg ccccggcaaa ccggcaggca ggccatcgcg gaactcgaat ccatgaccgg      9600
     gctgcactcg gtcaagaagg aaatcaacac gctgatggcc cggctcgagg tcgagaaaaa      9660
     acgtcgcgcc caaggactga gcgtctcgcc catgtccttg catatgattt tcaccggccc      9720
     gcccggcgtg ggcaaaaccg tggtggcgcg aaagctcgga gcaatctatc aagacctcgg      9780
     cgtgctgaaa aagggccatg tagtcgaaac cgagcgcgcc ggcctggtgg ggcagtatat      9840
     gaggccatag catcggttgt tcgccagaca acgctaaggg tgaaccaagc aagaacgcca      9900
     caaactctgt aagaggccaa tcatcgggtg agtccattca cgacaaacac ttctttttcg      9960
     tgagtgcgac cgtcccggtg tcgcagcggc attttatcca cgacaaatcc gcaaaaatct     10020
     attgacagaa aatattctat tcgaacagtt ttcgtgaact aattcgataa ggaacggcta     10080
     tgtcgatggt ggggtatgca cgggtctcca cgcgagagga acgacagata ttcgatcgcc     10140
     agatggatgc tttgacggtt gccggctgtg agcgaatttt tgaagatcgc ggcagcggag     10200
     cgcgttcgga tcggcccggt atcaaggctt gccttgacta tctccggcgc ggtgatgtcc     10260
     tggtcgtcct ggacctcgat cggctggggc gacttgccgg cgaactgatc gggctggttg     10320
     atgacttgga agcacgcggc gttggcttcc gcgccctgaa caccgccttt gatacaacaa     10380
     cgccggccgg ccgggctttc ctgcagatac aggctgcatt tgcggagatg gagcggaacg     10440
     tcatcagaca gcgggtgcga gagggaattg tagcggcccg cgcaagaggc cgtaagggcg     10500
     gccggccccg tatgatgaca gccgagcgtt tgcgatatgc tcagcatctg atggcagatt     10560
     ccacgcgcag catcccgtcc atatgtcggg agttgggcgg catcccggcg agcacgcttt     10620
     atcattatgt gcaagcagat gggacattga agtcgcctgg tatcaaattg ttgggggccg     10680
     accctgtcgc cattggggcg gtttgatcag aaattcaacc tacgtaattc aacctacgtc     10740
     aggtaggaat gaaccacacc gatcagttcc tccgccgcct gagcgcgatc ggtctcctgc     10800
     tgctttggat cgacgatatg ctggcggata tggtgttcga tcacggtgcc gatgaacccg     10860
     tccaacgcac cgcggcacgc cgttgcctgc tgcaacaatg ccgtgcatcg cgcatccgcg     10920
     tccagcgccg cctgcatcgc ctcgacttgg ccgcgaatgc ggctgagccg gttcaccagc     10980
     ttgcgttttt ccttttcggt gtattgcatc gcctcttgac cagatactat ggggggggta     11040
     tatggcacgg atagctgcgg aaggcgaatt tccgcggttt tgatcaacca actttccaag     11100
     gaccccatga aaccgcgatc gaccagccag ccttcggagg acgatagtaa gcgcttttcg     11160
     cttgctgtcc gttcaaccgt gggatggacg attgcccggg ccggatacgc ggctggagtg     11220
     atgcgcgcaa cgcgctgaac cccgcccatc cctcccgggt tccagccaat gctgaccagg     11280
     aggagggatc acgatgatct tctgcagaaa acgaactgat cggccgtctt cgccgatcag     11340
     gagtaaccca tcgagtgacg cggcattccc ccgccgtcgg cttgtcacct gttggcgccc     11400
     cgacggttcg gggcggctcg tgacctattg gaaagtggtc gcggcaccac gcggcgagcc     11460
     tcccggctga atccggtccg gatcaccgtc aacttccgca tcattcccac ctcacatttg     11520
     ccgatcacgg agacatgcca tgtccgccga aaccgatatc ctgatctcac cagaaacggc     11580
     ccgcatcacc tttccagagg gtcttgaagc ccggctgcgc gatcggctgc gcattcagcg     11640
     gctgcgtatc ggcaagcaga gcctgggcag ccgcatcgcc cttggccttg cgttggtcgg     11700
     tcctggcctg ctggttatgc tcggcgacaa cgatgccggt ggcgtcatca cctacgcgca     11760
     gaccggcgcc acctacgggt tcagcctgtt catcccgctg atgatcccgc tcggcttcat     11820
     cgcctatctg gtccaggaaa tgaccgtccg gctcggcgcc gtcacccgcc gcggccatgc     11880
     cgagatgatc tggaagcgct atggcgcgtt ctggggcgcg ttttcgctga tcgatctggt     11940
     agtcgcgaat atcctgacgc tgatgaccga gttcatcggc atccgggtcg ccagcgcgat     12000
     ttttcatatc ccttacctcg tgacgattcc cgccgccttc gtcttcatcg tcagcattct     12060
     gctgttcctg aaatactata gctgggaacg gatttcgctg ttcgtcgccg cgttcaacct     12120
     cgtcttcgtt ccgctcgcat tgatgtcgca cccggattgg ggcgcgatcg gccgtacctt     12180
     cacgggagcg ggctgggcgc tgccgggtgg gctgttctcc gcaggatttc tgatcctggt     12240
     ttcggcgaat atcggcacca ccatcgcgcc gtggcaattg ttcttccagc aatcctgcgt     12300
     ggtggacaag ggcctgctgc ctagggacat cgccgcgagc cggcgcgacc tgatgctcgg     12360
     cgtgatcggg atggtagttg tcgctacctc gatcatcgtg atttctgggc aatatttgca     12420
     cgggctgccg aacgcagcgt cgctggatga ccattcggtg cttgtcgata tcggttcaca     12480
     gctcggccac ggcgcgatgg tgatctttgc gctcggcctg ctcgaagccg gcctgatcgc     12540
     ctcgatcgtg atcaccgcca gcaccgcctg ggcgatcggc gaggcgctcg acgtgccacg     12600
     ctcggtcaat atctcgccgc gccagtcgct gtatttttat gcgccagcga ttcttggcac     12660
     ggcgattgcg gcgagtgtgc tgatgctgcc gcacgttccg gtcgggttcc tcaacctgac     12720
     cgtccaggtg atcgcgaccg tgttcatgcc ggcggccatg ctgttcctgc tgatgctgct     12780
     caatgatcgg gaattgctgg gcgaccacgt gaattcaccg ctccgcaata tcctgtcggt     12840
     cggggtcatg gtgatgctga tcgcgtgcaa tggcctctac ggcatcgcga ccgtatttcc     12900
     ccatgccctt tgaaaattct gcgctcagga gcagaaagtc atgaaacagg acaatagttt     12960
     tcccgccagt gagacccgtc gcgcgaaagg cgtcagccgg ataccggtgt cgcgcgcggc     13020
     cagggccagt cagcgcgacc tcgaccgcgc cgcccatgac cgcagtgccg acatcgccgc     13080
     gattgcccgc gcggaaggct ggttgacgcc actcgtgccg atcgagcggg ttgctctgcg     13140
     gccctggcag cagaccgtgt tctggggtct gcgcctctat atcggcgtca tgctgatcat     13200
     catgggctgg ggatttcttc acgttgcggg gggataggct gatcagcgag gttttgaatg     13260
     accgatttat cccaaccgtt tccggttcca tttctcacga cagtcggtga tttcgcggtc     13320
     gccttcgtgc tcggcaccct gatcggtgcc gaacgccaat ggcggcagcg ctccgccggc     13380
     ctgcgcacca ccgttctggt cgccctcggc gccgccgcct tcgccgatct cggggttcgc     13440
     ctcgccggtc ccgccggatc gacccgcgtg gtcgcctaca tcgtctccgg catcggcttt     13500
     ctcggcgccg gcgtcatcct gaaggagggc gccaatatcc gcggcatcaa cacggcggga     13560
     accctctggt gctcggctgc ggtcggcgcg ttctgtggct gcggctactc cgccgaggcc     13620
     accttgctga ccgttttcat ccttgccggc aacacgctgc tccgtcccct cgtgaattac     13680
     atcaaccgcc ggccgatcga cgcgcgcgcc accgaagcgc aatacgcgat ccatgcgctg     13740
     tgcgacccgg ccgacgtgtc ggatgtgcgc gaccttttgt tctccgaact ggaggccgca     13800
     cactacccga tccgcgagat cgccacccta tccgacagcg aggaactggt tgaactggcg     13860
     gcaaccctgg tgcccaccaa cgccaaaccc gacgaactcg atgccgtcgt cgccgcactg     13920
     gaaaaagccg gcccgatcaa gaccgcaacc tggaccgtca gcaccacggc ctgatcgcga     13980
     gttcctgaag cgaaaatcac tttgttgccg gaaaagggag gattgattgg cgcaaagaag     14040
     attgctgaca gacgaagaac gccatgttct ccttggtgta ccgaccgatc ccgacggcct     14100
     ggtgcggcac tacaccttta cccggtccga tcgaaatttc cttctcacgc gccgcggtaa     14160
     agccaatcag ctcggtttcg cggttcaact cgcacttctg cgccaccccg gcacgaccct     14220
     gtcttatatt gccgggtccg tcgccgcact ggtggcctgg ctggctaccc agctcgaaat     14280
     tccccaatcg gcattcgaaa cctatcaacg tcgtcctcag acgatgaccg accacgctca     14340
     gatccttgcg acgaccctcg ggttgcgctt gcccaacaaa ggcgatttcg cctccatgat     14400
     cgacgccgca tcacttgccg catggggcac tgaccgcggg ccgatgatcg tcaagggcgt     14460
     cattgccgac ttgcgcgccc ggaagatcat tctcccgacc acgggtgtca tcgagcgcgt     14520
     ggcgatcgcc ggtcgtgctc gcgcccgcaa gcgcaccgcg gacgctttgg tccaaggggt     14580
     gtcgcccgat cagataaccc ggcttgaccc gctgctcatc gtcgatcgtg atctcgggat     14640
     gacgccgttc ggctggctga aagatatgcc gacgtctccg aaacctgaca acattcgtgg     14700
     cctgatcgag cgattgcgca tggtacgcag attcgcgata tcgcctgacg tggccaggca     14760
     agttcacgaa gaccgctttc gccaactggt gcgcgagggg cggattaccg atgcccacca     14820
     ggtggcccgc tacgcgacac accggcgccg tgcgatcatg gtcgcggtgc tgatcgatct     14880
     cgaatcacgc ctgatcgatg gcgtgctcga catgtccgat aaactgatcg gcggcatgtt     14940
     cgcccgcgcc aggaagtcca aggagcggca ctatgtcgcc agcactaggg atgtcggccg     15000
     gctgatgcac ctgttctccg cgacgattga ggcgcttgcg accgctcatg aaagtggccg     15060
     tgacggcttc tcggttgtcg atgagaccgt cggctggaca aaattgcagc gcgtccgcag     15120
     cgaggttcgg gcattcgccg aattcaccga ggaagacccg ctgatccggg catcagatcg     15180
     ttatgcgacg ctgcgcaaat tcgccccaga catcattgaa gccttggcgt tcaagacggc     15240
     acgatccgat agcccgttgc ttgcggcgat ccggttactc aaagacctca acgagaccgg     15300
     tcagcgtcac attccggcgg atgcgcccat gccgttccgc aaggaatggg ccaagctcgt     15360
     gcagggcggc gaccggccga accggcggct ctacgaaacg gccgtgttcg ccacgctgcg     15420
     cggcaagctc caatccgggg atgtctgggt cgaacggtca tcgaactatc gtcggttcga     15480
     cagctacctg atcgcgccgg aggccgtgcc gtcgatcgcc actgagttgg gtttgccggc     15540
     gacggccgat atctggatcg ccgcccgcgg ccgggacctc gatcagcggc tcaagcgatt     15600
     tgcccgccgt ttggcacgcg gtgatctcga aggcgtcgaa tggcgcgatg accgccttca     15660
     tatttccccc gtgaaggcgc tcacgcctcc ggccgctgat actcttgcga gcgagatcac     15720
     ggccttgctc ccctacgccc ggatcaccga aatactccat gaggtgaacc gccagacggg     15780
     ctttgccgcg gcgttcacca atctgcgcac cggcgagcat tgcgacaatg aaaatgccct     15840
     gctcgccgcc atcctggccg atgcaaccaa tctcggcctg acacgaatgg cggcggccag     15900
     ccaaggggtg acccgcgacc agttgatctg ggtcgccgac gcctacatcc gcccagaaac     15960
     ctacaaggcg gcgctcggcc ggatcatcga tgcgcaccat agactgccag tcgctgcgtt     16020
     atggggcgcc ggcacaacgt catcatcgga cggccagttc ttccgatccg gcaaacgggg     16080
     cgagaccgcc ggcgatatca acgcccgcta tggtgctgat cctggacttg ggttctacac     16140
     ccatgtctcg gaccagcacg cgccctacaa tgttcgggta atgtcggcga ccagccacga     16200
     agcgccgtat gtgcttgacg ggctgctcca ccatggcacc agcctcaaga tcgataccca     16260
     ctacgtcgat acgggcggtg cctcagatca cgtcttcgct ctctgctcca tgctcgggat     16320
     ccgcttttgc ccgcggctgc gtgatttccc cgatcgcaag ctggccagca tcgaacctgt     16380
     gacggcctac aagaatcttc agccgttgct gggccggcgg atcaggacag acgtgatccg     16440
     tgagcattgg agcgacattg tccgcttggt cgcttccctg aaggcgggag ccgtcgcgcc     16500
     atccaccatg ctgaagaagc tcgccgccta tcagcggcag aaccagcttg acctcgccct     16560
     tcaggaaatc ggccgtatcg aacggaccct gttcatgctc gattggctgg aaagctccga     16620
     cctggcccga agtaacggat cgccccgcgc tgtagcataa gcggacaaag tgggaacatc     16680
     aggctgcgtg ggtggtcgtg tcggggattg gccggagcgg ccgcaatccg gcatggtttt     16740
     ccgtcgattt ctgattggcg ctccagatgt agtcgccggt caggttcaca tgctcccagc     16800
     cgatcggcga gagatgtctg aggagggttc cgggcacatc ctcgacctgg cgtagggcct     16860
     gtatggcttg cgcgagatag cgtgtgttcc agaggatgat ggcggtgacc aggagattca     16920
     ggccagaggc tcgatgtgtc tggttctcga aggtccggtc gcggatttcg ccgagccggt     16980
     gaatgaagac ggcgcgggcc aggctgttgc gggcctcgcc cttgttgagt tcatgactgc     17040
     tttcacggcg caggcccgga tcttccagcc agtcgagggt gaacagcgtc cgctcgagac     17100
     ggccgagttc gcgcagtgcc gcggcaacgg cgttctgtcg tgggtaggcg gcgagttgtc     17160
     gcaggatcac cgacgcggac accgtgccgg tgcggatcga ggtggcgatc ctcaggagat     17220
     cgggccaatg ggcgcggatg agatcgacgt tgatgcggcc ggcgatcatc ggcgcgagcg     17280
     tcggataggc tgccggtctg gcaaaactgt agagacgccg gtctttcagg tcaggaattc     17340
     tcggcgcgaa tacgtatccg agcagggcgc acagggcaaa gacatgatcc gacaccccgc     17400
     cgccatcggt atggtgccgg tgctgacgtg gcggcgcatc gccgtgatga tcaagcaggc     17460
     cgtcgaggac atgcagggct tcgctggcgg ttgcggcgat caccctggta tggaacggcg     17520
     cgtagcgatc ggagagatgg gtgtagaatt tcagacccgg ttcggggccg tagtgcgcat     17580
     tgatccggct cgcatcacgg ccagaaccgc cggcgcggaa gaactgcccg tccgaggatg     17640
     aggcggttcc cgacccgaag agggcggcga gcggctcgcg gctctggtgt tcgaccaggc     17700
     ggcgcagcgc cagggcgtag gtctcgtcgc ggatgtgcca gtcagcggtc caggcgagct     17760
     ggcccagact ggcgatgctg caggcttcgg ccatccgggt caggccgaga ttgaggccat     17820
     cggccagcag ccccgccatc agcacccggg gatcagcggc ggcttcgccg gtgcgcaaat     17880
     gggtgaagca gtccaggaag ccggtccagc cggccacttc cgtcagcagg tcggtgatcc     17940
     ggatgcgggg cagcgtggca tagagcttcg ctgccagcgc ttcggcctcg ggcggagtcg     18000
     atttttcgat cggcgtgatt ctcagcacgc ccttctcgat cgtcacatcg ggaagcagcc     18060
     cgccccgggc acgggcgtcg acctcggcca gccgcgcatc cagccaggtc cgcctggtct     18120
     cgataaagcg atcgaagtca gtctcgatgg caaccggaat gccggacgct ttctgcagga     18180
     cctgcagcgt ctccctggag atcaaccgct cctcgaaggc ccggtattgc cggctgccgg     18240
     taacccagac atcgccggca gcaaggcgct ggcgcaattc cgccaggacg cagagttcgt     18300
     aataacgccg gtcgatgccg tgtgccgtga ggacatgccg cgcccagcgc ggccggacaa     18360
     aggcggtcgg cgctgacttg ggcagcgtcg aggctcccgc gctgttcatg gcgcgcagca     18420
     tggcgatcgc gcgcatcaac gacgccgcgg cgggaacacc ctgaaactcg aaagtggcca     18480
     gaaacgccgg cgcccagcgc cgaatgccgg cataatgttc gctcagcacc tcgtagggat     18540
     cgaaatcttc cgaacgaacc agagtttccg cttccataac ggtcgagcag aaccggtccc     18600
     agggtatcac cttgtcaatc gccgcgaagg gatcgccctg gccggcgcgc gcggccatca     18660
     gggcggcgcc aatcctcgca taaagccgga ccttctcgtt gatcgcccgg ccttcggcct     18720
     ggaacgcccg ggcatgtcgg ccttccgcct tgcggaacat cgcgccgatc agccgctcga     18780
     acagagtgat cgcctgatcc gtcaggcggg ccgacagatc gagatcgatc gcggtgagca     18840
     cggcatgccg gcgccggcgc tcgtagccgg caacatgctg caccgtggtc cggccggcct     18900
     cgcgaacaag ctgggcgagc cgggattgat tgatccggtg accgcgcgcc ggatcgatat     18960
     cgattgcccg gatgtgctcc aaccgctcga tcaccccgag catggacgcc ggctttgccg     19020
     attccgggat ctggcgaagc caggccagcc agctctggct ggtgtccagg cgccgctccg     19080
     tcaacgcatc cagccgacgc cgctgatcgg cggacagacc cgcggtcagc cgacgctcga     19140
     tttcccggcg cgcgcggtat cgaacctcga tgcagagccg ctcgaggcgc gccgggggcg     19200
     gtagaagaat cccgcgaccg cggcactctt ccagcaccaa agccgccaga tcgaccagcc     19260
     ggtcggcttc cagtgcatgc gccagcagcc agtcggcaag gtctgccgcc acgcgcggcc     19320
     cccatggccg caacccgagg cgatcctgca atgccgccga atgccggcgt cgattttgat     19380
     ccaccctcag ataagcaccg agggaatccg gcaagacgtc gatctgtgtg gcgacgaacg     19440
     agaccagggc aggatcgggt atctcgccgg catggagcgg ccggccggga taccgcaggt     19500
     aacagagcat gagagccaga ccgagacggt gatgatcgcc ccgcccgcgc cggatcattg     19560
     caagatccgc agcagacagc gtgtagtgac gaattatgcc gcgtcgatca gtcagcgggt     19620
     cgaacagctg tgcgatctgt tccccggtca atatccgtcg atgacccact ggtccctccc     19680
     tcctgcctgt tgagggcagg agaccagccg atccgggtca cgtccgtcaa cgtggtggaa     19740
     attatagatg gtttaaggtg accaaggatc attcggctgc ggtggcgatc tggggtggaa     19800
     atacgtcgat tgcgggcggt gtaagttcgg ccattggctc ggtctgcatg tagcgatttt     19860
     gtgtttgcca ctcgtcattc tgctcgagga gcacggcgcc cacgagcctg atgatggcgg     19920
     cttcgtttgg aaagatgccg acgacatcag cgcgccgctt gacctccttg ttcaggcgtt     19980
     cgatcgggtt ggtagagtgg atcttgaccc tgtgttgcac ggggaagtcc atgtgggcga     20040
     ggacatcgac ctcgctatca tcgataaatg cggcgagctt gggccatttg gcgcggaact     20100
     ggtcggcggt gtggcgtagc gtctggctag cgccggcacg gtcaggctga atgaaggctt     20160
     ggcggagcgc cgccgagacc atgctctgct ggcccttgcc gacataggcc agggcattgc     20220
     gcatccagtg aacgcggcat cgttgccagg acgcgcccat gacgcggcgg attgcggact     20280
     tgaggccctc gtgcgcgtcg gagatgacca gctttacctg acgcagaccg cggcgcacca     20340
     agctcttgag gaaggcagcc cagaaggtct cggcctcgct ggggccgatg tgcagcccga     20400
     cgatctcgcg cttgccttcg gtgttagcgg ccacggcgat tatcgcagcc accgagacga     20460
     tgcgccctcc ctcgcgctgc ttgaggtagg tggcgtcgag ccaaagatac ggccagtcac     20520
     cggtcagcgg gcgctcgagg aaggcgttca cccgctcgtc gatatccttg cacagcttgc     20580
     tcaccgtgct cttgcctatg ccactcagcc ccatggcctg caccaggtcg tcgacgcgtc     20640
     gggtggagac gccgccaacc caggcttcct ggatcaccgc gaccagggcc ttctcggacg     20700
     tcttcctagg ctcgaggaag ggcggaaagt aagagccctg ccgcagcttg ggaatgcgca     20760
     gttgcagatt gccgagccgg gtgtcgaggg agcgatcgcg gtaaccgttg cggtaggtcg     20820
     tccgctcacc agtgcgctca tggcgcccgg cgccgatcag gccttccacg tcggcctcca     20880
     taagcagttg cactacggcc tccgccacac tgcgcaggaa atctccatcg ccggctttcg     20940
     ccagcaattc agccaagggt agtctgtcgt cggtcatcgg gtcctctcgg gttcgggtga     21000
     agcttcgcaa ctccaccgta gccgctcgat ccgatggcca cctaaaccca ggctcatgcg     21060
     ttggatcggc ccctccggcc ggctacgccg acctccggcg ccaatccaac gcacggcagt     21120
     cagacaattt ccaccacaag cgcagacatt agcccgatcc gtgccagaga gtcgaccagc     21180
     gtactccgcg aaatgccgaa agtgcggcag accgacgctt tcgtggcacc agcgtccagc     21240
     gccgcgatca ccgccgccag cttctcggca tcgatcgcca tcggtcggcc accacgcctg     21300
     ccccgccgac gggcggccgc cagacctgcc tgcacacgct cctggatcag cgaacgctcg     21360
     aactgcgcca gagcgccaaa gacatgaaac aggaattccc cctgcggcgt cgtggtgtcc     21420
     atctgctcgg tcagcgaccg gaagccgacg ccacgcgccc taaggctgtt caccgtctcc     21480
     agaagatgcg gcagcgaccg gccgagccgg tccagcttcc agaccacgag gcaatcgccg     21540
     gatttcagat aggccagtgc cgcagcgagg cccggccggt cgcgccggct gcccgcggca     21600
     cgatcgtcga acagatgccg ctcatcgacc ccggctccga gcagggcgtc gcgttgcagg     21660
     tcgagcacct gtcggtcatt gtcggtcgag acgcgcatgt agccgatcag catgtacgga     21720
     aatccccttc gagacggttt ccgtatatca tgccattccg actatgtttt ccgtacatga     21780
     ttcggcacaa aatctgggac ttttcggcag gtctcggacc accgacggaa aacaggtgtt     21840
     ttccgtcagc gcgcgattcc ggcctcagaa ccgcgctctc cgctcaaacc cgcagaaaac     21900
     ctcgatccca accagtcaac gttcccactt tgtccgctta tgctacagcg cagggcgttt     21960
     cgttacttcg tgccgacctg cggcgccggt gccatgccgg gctcaacaaa agcgagcaac     22020
     gccatgtcct ggcccagatc atctgcacgt tcagacaggg ccgcatcgct gagcggggct     22080
     tcgaggcaca acagtttcga gcgtccggcc tcaacctcgt gatcgctgcg attgtctact     22140
     ggaactcgac ttacatggcc gatgccatta tccatctgcg ggctaccggc gcgaccgtgc     22200
     cggatgaatt gctggcccat acctccccgc ttagttggga gcacatcggg ttttctggag     22260
     actttctatg ggaacgagcc gccaaggcgg catccggaag ccgacggcct ctcaacctcg     22320
     gttcacgccg aatgaccgca tgaatcttcc gagttcatcg ttcgttcccc cttagcgttg     22380
     tctggcgcat aaccgatgct atggccacta tatcggccac acggcaccaa aagtgaagaa     22440
     taaggtcgcg gaagcgatgg acggaatcct gttcatcgac gaggcgtaca ccctctccgg     22500
     gggcaaaggc gggcacgatt tcggccaaga agccatagat acgctgctca aggaaatgga     22560
     agacaagcgc gaccggctgg tgatcatcgt ggccggatac ccggccgaga tgcgcgcttt     22620
     catcaattca aaccccggcc ttgcctctcg cttcgcaaaa accatcgaat tccagccata     22680
     cagcccaccc gagctgatcg aaattttcaa ggggatgctg cgcaaggaag atttgcatct     22740
     cgcccccgat tggccggaag ccgaattgac cggttggttc tcgtcgcgac tcaccgatcc     22800
     gcagttcggc aacgcccgta ccgtccgcac tatcgttgaa cgcatccgtg aggctcaatc     22860
     cctacggctg gctcagaatg gggccgggga tttgcaaacc gtcaccgccg aggacgtgca     22920
     ggaggctctt gcatcatgct gaaccccgaa ttcagggacc atctgcgcgc ggttcatcgc     22980
     gcgctgtggc ggcaagataa ctcttaccgg ctggccatcc tggccgcccc cgttctgctg     23040
     gtcctcgccg tcattcacgc cctgcctggc gggaaaaatg cgtccccacc gacgccatcc     23100
     ggtcccccgg tctcatcgtc acattcctcg gcctcgaaca tcccaccgcc cgcagccaaa     23160
     cctgccgccg cggcggttcc tctgaaaatc aaacccggtg cgcccctgcc cgccacccaa     23220
     cccgcctccg ctggcgggta tcactccccg ttcaaccagt aaggttccca tgcgcttatg     23280
     ctcgatctcc gctgttgccg tcttcgtcgc tgcgcctgca ttcgcccaat cggccgcccc     23340
     atcgcctgac gctgccctgt gggcgtccgc ttccaagggc gcggcggggg agttgcaact     23400
     ctatctcggg cagtatcccc acgggcagtt tgccggccag gccaaggcgg ctctggcggc     23460
     gctcaacagc cgtccagcgg cattcccagc acccaccgcc aaggcagcag caagctcggc     23520
     cacgtcaaag ccttccaagc ctgcgccaag tccgaccgta tcgaagcctg ccaacctgaa     23580
     acccggctgg ctggtcgaag tgcgcgccac gcatcaacag gccacctcaa gcgggcagac     23640
     ctggctaccg gaccctgtgg ccctgtcgct caagcctcaa ccggggccgg ttttcaacat     23700
     cgccacgctg gctcaaggca ttccggccgc tggaacgctg cccgcgatcg ccggctccgc     23760
     caagtggctg gtcaggaaag ccgggcaatg ggggatcgga accgatatca aatggcataa     23820
     caccggtccc tgtacggcaa cggtaacagt ccagggtaac cgcatcatca aaagcacaac     23880
     caaccaggtc agctatgcac caggtagcgg agatacctcg ttttcagcgg ccctctcgct     23940
     caccccgggc gtctacaacg tggcctggac actcgtttgc cagccgacca gcagctactt     24000
     gcccggtaaa gatgccactc tgtccttgct ggtcgcccct ccgcagggtg cgctcgcagc     24060
     gccaaccacc ggcgaatttg tttatcaacc caacaaataa gagctttgac atggaacttg     24120
     tgtatgccgc gttccgccct ctcgccatac ttattgggat cttcagcatt taccggtttt     24180
     tacactgcga tccgctctcc ttgacatcag aacaataccg ccgtgtgtgt ctctggcggg     24240
     cacggcggga tgcccttctg aatttccggc gctgcgatca actcatctgc atgggcctct     24300
     gaccgtcaat caggaactcg gaaacgcacg ccttttagca agaagtgata ccggcatgat     24360
     gctgacattc cgggtccgcg cctgccccac gcggcagcaa catgcatggt tcaccgcctg     24420
     cctcgatcac acgcgagacc tctacaacgc agcacttgag gaaaggctgg gcgcctggcg     24480
     gaaagcacgg aagcgcatca ccctcggcga acagggaaag gcgctcactg aactgcgcag     24540
     ggatgccgaa tatgccgctt tcccgcggcg catgcagcgc tggacgctcg atcgggtcga     24600
     tgttgcctac cgcgagcatg tgaagcgact agctgacccg gccaggccac gcggcgatat     24660
     caggttccgg ggcaaaccat tctggcggac aatcggcttc gattcaccga tcgatttcga     24720
     gatgcgggac cgcggcctgt atcagcgcaa ggcgctgggc gggacgctcc ggcttaagcg     24780
     cgaccgcgat cttccgccat gggaaaactg caaggcaatt acgctcaccc gggaagaccg     24840
     gcgctggttc gtcaacctga cctacgaaat gccagccccg gcacactccc cacggctggt     24900
     gccgatgagg ccggtgggcc tcgatctcgg cctgaaaacc tccgttgtcc gatcggacgg     24960
     tgccgaaatc gatgcggtcg gctccttgcg ggcagcattg cccgaactgc gccgccttgg     25020
     tcgtgccctc gcccgctgca agaagcggtc gcggcgccgg cacaaggtga aagcgcgcct     25080
     ggcgcggctg catgccaaaa tcagccgccg gcggggcgcc cgcctgcatg aaatttccgc     25140
     ccgcctggtg caccattggg acgccgtggc cgtcgaggat ctgaacctcg ctggtctgat     25200
     gcgtgccggc gaccggcgcg ctcaggggcg cggcatgcgc cgcaaatggc gcgatttctc     25260
     accgggcagg ctcgtctcgc tgatcgaatg gaaatgccag cgcgagggcc gggccttcgc     25320
     ccgtgtcgat ccgagaggaa cttcgcaaga atgcgctggc tgcggctctt tcgtgccgaa     25380
     gacgctgcga gaccggatgc atcgatgcga aaactgcgga atcgttctcg atcgcgacca     25440
     taacgcggcc ttgaacgtgt tgaaccgggc cgggtggggt ccggggggcg ctaatcctga     25500
     tggcaaggtc ggtaatcctg ccgatctggt gcgggattgc cccggaaata cggcagggga     25560
     tgacccggcc ggaccacggc gaggtggcct tgccacctcc cttcatccta ctacgtgcaa     25620
     tcggtggaat ggcgcctatg gaaactcttg ttccatatca tatggttaca ggaagaccgt     25680
     tccccgcgca cgcggggatg aaccgcgcct cggccagtat gtgatcgcgg cgatcgtccg     25740
     ttccccgcgc acgcggggat gaaccgctga acatcataga ctttcaccgt caccgaaacc     25800
     gttccccgcg cacgcgggga tgaaccgaaa gacgccggca attcagccgc cgctcattgc     25860
     cgttccccgc gtacgcgggg atgcactgaa atatgccggc ggttacgtca gctcagatca     25920
     ggtgtgcggc gaccagcacc gccagaatcg cactaatgcc gctcaagacg gcgccgccag     25980
     cagcgatgat cgccggccag ttcgtgtcgt tcctgtgtat ggccgccctg tcccgggccg     26040
     cctgggcgag caacgcatca atgcgcggcc agctctcctc ccgcatccgc caaattcgtt     26100
     catgcatctg gtcgaaccgc gcaatttgct cgcgcagata aaggcgctcc gcgttctcgt     26160
     caggattgct tgccatcatg gattacaggg gctgcccgtg aagtgaactc tacgagacat     26220
     cagcaatgcc cacagtccga aaacgggcgc cgccagacag gcatgtgacc aggtcgggtt     26280
     ttgcatcgct gacggtgtcc ttcaatgaaa tgtcgagttc atacgcaacc ctgtccacct     26340
     tgcccgatga atgaagtttc gggacaatca atagtggctg gggacaggct tttttcctgc     26400
     ggcatgtgcc cgtttttcag cccgctccaa caggaccctc ttcgcagtgg ttcgcatctt     26460
     tccagcgttc cgcagagcct cagtcggcac gttccggccg gcagcttcga gttcacgcgc     26520
     tttcgcggca gtccttttca ggtgcgcctc gagcttgatc gtcctcatgg ctccaattcc     26580
     gaattcaggc cgttcaggag cgagatatcc ccgccttcct cttctacccg tttcttcaaa     26640
     taggcggaat caatcctgtc cgccatctcg aagagaaccc gggcctggtt caggcgtgat     26700
     tcatccggcg gcttgccccc cgcatactgc cccagacggt cagcaataag gtcctcgatc     26760
     gcgggcagga caacagcact ccccgcatca atctggaact gcgcaacacg catccggtcc     26820
     gcgcgcccgt caaacatggg gcctgtgacc agttgccagc cgaactgcgg gtagtcaggg     26880
     tgataatacc cgaccttgag cttccctgcc cgatcctcgg gacaaaaccc gcgctgcagc     26940
     aggatctcgt gaaaccgctc ctccgctgca acaatcaggt cgaaatccgc ggaatggaaa     27000
     gcccctccgg tccacagcgc aaccgcagcc cctccaacga ggtacgcggg acttccggtc     27060
     tcgcggcgat actcctcgca gacgcggccg agcagcccaa gcgcctcaag ataatcggct     27120
     tccagtgcca ttaccgcgcc gtcccgtgtt gtctcactgc ggctgatccc agccgtgggt     27180
     gtcacgcttg ctccgcatgc cccagatggt cttgccgagg ttcagctcgc cggctcgagc     27240
     ccttgccacc atgccatgga aatatccccc gggcgtgctc ctgaaatgcc ccgccggccg     27300
     cgccgagacg atagccagcg cgatcgccgc ctgctcccgc cccatggcaa ggcacgcctc     27360
     gccccagagc ggcttcgaca ccccgagatc gtgccgcagc cagtccgccg cctccacaac     27420
     atccggccag gccggcgatg accgcccgag atagggccgc agccgcggcg ccagccgcac     27480
     aagctcgtcc ggcgtgatcc gcagcaccgt gccatcgtct tgcagggcag gcttttgccc     27540
     ccccctgccc gtctgtggtc ccgacgatcc gtcccgcagt cccgggctgc cggtcggtgc     27600
     caccgacatc accggggccg gactactttt ctcaatgcca gatacagtat cctgttcagg     27660
     atcagcgttt gatttgtatc tgtattggtg gggccggttt tccggcccct tggggtcggt     27720
     ttccacatct ttttgtgcac ttccccgccg ctcggcgatc agactctcaa gccgctggcg     27780
     cagctcgcca tgacggtcct cgagccgggt cacgccaaag acgaggacag tggatctctc     27840
     ctccttgccc agacgccagc acagccggcg cgcctcctcc gcctcccgca cgaaaccccc     27900
     aggctccagc cccacctcga ccgccgtctc cgcgatctgc tcaatcgcct tgcgggcaat     27960
     cgtcacccgc cggcgcagct ggcgaaccgc ctcgcgctcc gcccgcccct tctccgccac     28020
     agcccggaat tcctcgagcc gcaccccaag cggtgacagg tcaaacccat acgcctcgat     28080
     gatccgcccg ctacggtcac gccgcccgta acgcttgcca ttcggactgt cccgcatcac     28140
     caccaggccc agctcgacca gaagccggtt cagcgccttg gtctgcgata cccccagatc     28200
     aagatccgcc tgctggaccg tagcggacgg ccagaccacc ggacgcgccc caggctccca     28260
     gtcctgccgc tgggtaaagc ggaacagcca gtccaccgca tgcaccaccc gcggcggcag     28320
     gccgagatag ggcgccgccg ccttgaaggc cgccagaacc gcacccggcc cccctgcccc     28380
     gtctgacagg ccggtgaaac cttcagccgt ccggtccgtc gcaatcattg ccagactcag     28440
     ccggcgaagc ccgccagatc tctgatttgt cttggtattc tgcccgaaac cgggactttc     28500
     cgtctccatc gtgatcctcc gttgtggctg gatcgcgaca ggcaaagctc tcccctcagc     28560
     agaaacggca atttccgctt ggcaaaacag ctcgcaatgg ctatgtctgg agaagaacgt     28620
     atccagacgg cctagccgct acggcccgtc acgagtttac gcaaagcccg cccggcaagg     28680
     cgggcttttg cacgttttag gtcttctgag tggcctgaat cccccgttca attaactgca     28740
     agagcgcttg gctgcggtta cgcaaccctt ggctctcttt gatttcgtca acaaccgcca     28800
     ccagatcctt tggcaaggcg acgacgagtt gatgttgccc gccggcagcc agacgacgcc     28860
     tgtacgcgcg gtgttttcct agaactgcat caacaccagc tggcattcga accccgccca     28920
     cgttgctagc gacccagcta gaattataaa cgtcaatttg tctatagact tattttcacg     28980
     accccgtttt gctttgaaaa gatgggtttt ttgtgaacct ccgaatcaag aaccctaaaa     29040
     gggtgcttgg tttcgccacg cgaatcgtga catgggcagc ctccgattcg gaaaggccaa     29100
     ctatctcgtc tgatacgcga ttttcccccg aaatcgccgc aaatgattga tcacgttcaa     29160
     ccgaccgccg cgagagactt accgtcaacc gcaggtctac tatacgtaga cggtagaccg     29220
     acggttgact ttcttgaatc taaagtctac tattcgtcta tagtcagttt accgtctaca     29280
     ctcagtagac catctgtctg ggggtcatgc atgccaactg tcgtttttgc atcgccaaaa     29340
     ggaggagctg gcaagagcac gtctgccgtg atccttgcga ccgaactggc tgcagccggg     29400
     gctgaaatca caatcatcga tgcagatcca aacaagccag tcgccagatg gagccgtctt     29460
     ccgggcaagc cagcttctct gcgagtgatc gatgatgtct ctgaaaagac gatcattcgc     29520
     gtgatcgaca cagaagccga gcgcgcggct tttgtcatag tcgacctgga aggcacagct     29580
     tcacgaatgg tgccttatgc aatgagccgg gcggatctgg tactgattcc tacgcggggg     29640
     tctgtccttg atgccgttga agccgtggcg gcaattcgcg aggtgaaaca gcaagaagaa     29700
     gccttcaggc tacacattcc tgctgcagtt cttttcacaa acacttctgc cgcaatcaga     29760
     ccgcgcacgc tttcggcgat agaaacagag ttcgccgaaa acggtgtgaa cgtgctcaag     29820
     acccgcctcc atgaacggga agcctatcgc gccctgttct ccttcggtgg aacgctggaa     29880
     gccctcgatc ccgcaaatgt ccggaatatc ccggccgcaa tagaaaatgc ccaggctttc     29940
     gcaagagagg tcgtggacct tcttcgccag aaccgggagg aggttgccgc atgagccaga     30000
     gatccagcat attccacaat ccacatccgc cgctggatgt cagcgacttc aaaccggcag     30060
     gtggaaagca acaccgacca gcccccgccg ctatcgatga gatcagcagt aaaggccggt     30120
     ttcagagccg cgagccggaa cctgcaatac cggggcagtc tatagacagc ccaccatcca     30180
     ccagacgaca accgatgacc taccgtaccg ggcgcaataa ggtcttcagc gtgaaaacag     30240
     atccggcgac cgccgatgag ttctatgcca tcgcgcagaa aaacggctgg aaggctgcag     30300
     aaacatttga aaaggccgtt gctgcgctca gacgcgagct gaccagttga gacgcgcccg     30360
     gacaacccgg cccgaagggc agtatgatgt tggcaaccat gaccgccgga ttggccacta     30420
     aggaaccata acgatgggtg ttcagctgta tctgcttgac cgcaggccaa ccacccttgt     30480
     ggtcggcggc acatcccaca aaatcggcac ccttcgacgt ttctggaaag tgaccgagct     30540
     caacaacgcc cgcatgacag agattggcgc tgcccagggc cggatccggc agaaagccgc     30600
     gccggtggcc gtgatgctga acgatgtgat ggaagctgct ctggaaatgg aacctggccg     30660
     gagcctaccg gcccatatcg tgcttggctg ggatgccgac cgggtttcgg taacggatca     30720
     ggactgggaa tatctgcctg ttcttggcta cgccgtccgg aaccctgaaa ccggtatcta     30780
     cgtgctgcac gaaaccgggg aaggggaggg cgggctgctg cgcccggtca cgcgggatcg     30840
     tgccattcac cgcggactga ttaccacgga tgaccagctt gtacgtcatg gccagcctcg     30900
     tatcactaca tgccatagcg tgaccccgct catcgaaacc tacgccgaag ccgactgcct     30960
     gctagcggat ggaaggtcca cccgaatcct gacctcggtc acatcggggc ggctgccgga     31020
     tcccgcctgg tatgcgggca agcggccggc cgatgtgaaa gcatacccga tagaccgggc     31080
     agcctgatcc tgtgggacta tggcccctga atggcggaca gcggtctcac gtcaccaatg     31140
     aagttctcga acgtgacaag atgcggccgg acactcgccg gataggaacg gtggagttca     31200
     gcaggcacca ccagacggac gccggcctcg ctcatttccc ggaactgccc ctccgaaacc     31260
     ccttcctgga gggtgaggag gtgcttggtt gcgatcctgt cggcctcgtt gagcacctgc     31320
     cgccagcggt ccttgcaggt cgttttcgcg gccagcatgc gcaaccgctc tgccggaaac     31380
     gccggattgt cgtaggcggc cttggacggg aacaggaaat ccggccgctt gccgttctcg     31440
     attactggcc ggtaggtgaa ggaggtatca gccagcagac cttcctcggt catgatctcg     31500
     cggacatgca gttccagcga agtgcctgaa cgggtcttcc ggctctgcag gattgtctgg     31560
     gcaagcgaga gaaaatcgcc gatcgcggag aagccttgcc tgatacgtgg gagatagacg     31620
     gcctcctcga cgctgagaaa tatctcaaat tcgcattcac ggcggcgcat gagaagccgg     31680
     tcgggctcca gaccgtttcg ctggcgtcgt ttgaccgtct ccctgataat ttcctcgccc     31740
     gtcgggaacc tggtcagcca ggcaggagga atttcaccgg gcaggagccg gcacgacccc     31800
     ggtcctgcat ccgtgtgcat gaacaggtcg cgggcgattt cgcccggctg ccagaccaca     31860
     ggagccttcg gctctaccgg accaatgcgc tcttcaagaa gatctgcctc cgccccctga     31920
     tcgcagaccc agacatgaca ttccatctgc ctgcccggcc cgtgagggag gaaggcaaac     31980
     acggccaggg caccggtact gtccggatcc agaagtgctg accggccacc gccgaaattc     32040
     gtcagtcggg cttcgttcct cgtccctcca cgaagcctgt tgttgtacca gatcgcccgg     32100
     atcctccggc ggtccgcgtg agagtcgatg tacaggtcga accagcagtc cggattctcc     32160
     tcctctgggt ggttgaggtc cgggaaaacg ctgaacagga actcctttgg aatatagggc     32220
     cccgctccat gggctccggt tgccagggta tcgttggctg ccagccgctt ggcgaaccag     32280
     acagcgccgg ggacgccgta ctcgtccatc cagcccacaa gatcagtcag cgccattgtt     32340
     cccccgaatt tccaggtttc catctccgga tctcagccac gagacggctt cgtcaatgac     32400
     aggttccggc accatgccgc gcctgcgcct gatcgcacat tcccagatcg tgaggacacg     32460
     ccagccagtg gcgaccagct cgttcatgac agcggcatct ctctgccggt tccgccggat     32520
     cttctcggcc cagaattccg ggcgggtgcc gggcagccgg aacagcccgc agtcgtggcc     32580
     atgccagaag cagccatgaa cgaagatagc ggcgcgatag cggggcagga cgatgtcggg     32640
     acggcccggc agggcacgcg gatgcagccg gtaacgaaag ccacgtacat ggagggcact     32700
     gcggatcatc cgctccggtc gggtattggc cgaccggata cccgccatca tccggctgcg     32760
     cgtctgccgg tcgacaatat caggcactct cctgcagccc ggtggcgtga tgattttcgt     32820
     caccttcgac cgcctcgaga atccattgct tcatgtgacg ggcgacagca gcaactacag     32880
     gcacggcaac cgcgttgccg aactgcttgt aggcctgggt atctgacacg ggtatcttga     32940
     aatccgcctc gccaggcctg tcgaagccca tgagacgggc acactcgcgg ggcgtcaggc     33000
     gccgggggcg cttgccgttc tggcggatca ggatctccga cccatccttg taatagcggg     33060
     ctgacagggt tcgggcgaca tcctccgggc cgcaaaggcc gaagccaaag ccgtttccgg     33120
     cccgccggtg cttctcggca tagttctgca gataattcca gagatgatcg gtgagtgtat     33180
     agcgctcggt gacggttgcc agtgggcctt cggtaaagtg cccgtcaggt ttttccgttc     33240
     cgtcttccgg gtgcagtatg gaggccagcc ggggacccga tgcgggatcc gggatgtcca     33300
     gcgtcttgaa ggtgaactcc gcgttccggt cccggaaacc cgcgatgaag atcctctcgc     33360
     gatgctgcgg aacccatgat tttgcatcga tcacacgaaa atcgatcctg tagtcgagct     33420
     ggttctcgag aacgtcgcgg atgatccgga acgttgtgcc gcggtcatgg ttgaccaggt     33480
     ttttcacgtt ctcgagcagg aaaacctttg gcctgtggtg cttgatgata cgagccagct     33540
     cgaagaacag cgtgccctgg gcctcgcagg caaagccgtg cggtcgtttg agtgcattct     33600
     tcttcgagac gccggcgatg gagaagggct ggcaggggaa gcccgccagc aggacatcat     33660
     gctccgggat atccttctca ccgatcttcg tgatgtcgcc acttatcgta tgatcatcat     33720
     acggatagtt ggccgcatag gttgcctggc tgtacttgtc ccactcactc gtgaaaacgc     33780
     accggccgcc gatcgcttcg aatccgcgcc gcagaccgcc gattccggcg aaaagatcga     33840
     tgaacgtgaa tgcagatgtg tccgcgaccg gtttgtgtcc tcccggctgt cgagcccgga     33900
     gacagtcaag gacagcctgt cgtggcggct ttcccttgcc attttcccac cggtagacgt     33960
     gacgctcgtg atatccgagc gcctcggcag cttccacgac cgacaagcct gccttctgcc     34020
     gcaagatgga aaactcggtc acggtcacct ctgggaattt ttctgactct atgcccgatt     34080
     cgcacctcgc aggcaacgga gccggaaggg aggggctagc caccccaagg atatcctttg     34140
     cccgagtctg gctcttgacc agatcatgat cccgcggctc aagctcatca tgagcgggaa     34200
     aaatcatgcc cgatcggcaa acgcgaacac ctaaccggag cacggatgga cactccctgg     34260
     ggcccgctcg caggactcaa gctggatgat cctgaagagg cggtgaagat cctcgccgca     34320
     gacaagcatc aactcatcga gggtctcgtg gtcgaaagcc tgttcgacca gatcgtggcg     34380
     agcgtgccgg aaagcacgga acagaagatc attgccctcg acgtcgattc cgctgtcatc     34440
     gacacgatgc gccgttccga gcgctggctc tgccttgtgt gggcgagaac ggaatccgaa     34500
     ggcctgggtc gctacctgca ggcgcttgaa aaatgcgtga cgccttatct tgtgagatac     34560
     aggaatggtg aattcgaggc agtccgcatc tgtgaaggcc gacgggcagg taaataccgt     34620
     ccgctgcccg aactgatgca ggaaatgtct ggcagccgaa tgacccgttt cgaggttgat     34680
     cctgctgttc gcaatgtaaa ccgccagaag caggcattct ggggctttct gtcggaacac     34740
     tatgggaatc ggcttggaaa ccgcgtggtt ctgccacgta ttctcatgaa ctgcggaatc     34800
     cagccgtatt tccgaagggt atggaacctc gacagggtat tcatatcagg caattcggtc     34860
     tggatcttcg aaatcaagca caaatacccg attgtgccga atgcacacat atcacccggc     34920
     ccactgcagt ttgggatcaa tgatggtgaa cttggtatgc tccagaagct ttcggatgcc     34980
     ggcatccgct gcctgcacac cattctggtc aagccggtct ggtccaagga tgccggatcc     35040
     atgtatctgc tgaacgactt ggcgatgcga tcccgggctg cggtaatcgc acttgcactc     35100
     gatagctcaa caattcgccg gatcatgggg ggccaatccg gacagtctgc cgcgcacacc     35160
     tcgatcactg gcaaatcgac tctgagctac aagaaaatcc cggtttccga tttcagtgtg     35220
     ctgggacgct tttccgatcc tccccaagat atcgccagac gaatagcggc gattatggca     35280
     gaaaccgcaa tgcctcgtgc aaccgatatg tggatcagcg acctgaggaa atttgttccc     35340
     tgacaaggct gaatccatcc tgagcattgt cttaaaccac ccccatctcg gcaacgaaat     35400
     tgtgccaccc ggaactgaaa atttcagccc gtcgtactag ccacggcaaa tacaggtcgc     35460
     cgcttaggca cacgctcgaa atccgcatca aaaatccatc ggcaaacagc cgatataagc     35520
     gcagtctgaa tgacttcctt gccttggtag gcgacgaaca ttacgccatg gcgggcacgg     35580
     cagtctaagt ttcccagtcc cgtgcagcag gctgttgatt tcgttggcct tggtgttccc     35640
     ggcgatgatg caaatttggc tatgccatat aattcaagga gtaggcacac tacctgcgga     35700
     gggcgtcggt ctctcctcct ctccattgaa atatatcatc gcctcttgaa actgtgcctt     35760
     ccatgtattc tcaaaatatt ttctcaatag atttaattct tcttgctctg attctgcgag     35820
     tattctttta tcaataattg ccataagcaa atcattctgt ttcttgattc tttctaaaag     35880
     ggcattctcg gccatatccg cctctgcttt cgcatgtgct ttcgcacgtt tcaacttcac     35940
     cagccgcaca aaacaggcaa tcgccgcaac aacccgatca ccatctgcat tccgaccgtg     36000
     cccattaagc caagcaacca catccgaata tgacacctga gcgagccgac ttacttggcc     36060
     gatcaacgca gacatattgc caccaaacag ctcattcgcg atttcactta gatccatgat     36120
     gaacccttcc ttcattccca gattttatgc aaagcgcatg aaacaacaaa actgttgcat     36180
     ccggtgcatt taggctcgaa gagagaggct tggctgacgg gatgcctgcg agagttcatc     36240
     cagcaccgca gccccatctg aagattccat gtttctcccc atccgttgtc gcaaaaatcc     36300
     caatttatgc gacaggtcgt gaccgggatg ggaggatacc agataatccg atgttcttgt     36360
     ccaaggtatg acggcggtct ctgctgcatc tccagtcagg agagaccttt attcaaaatt     36420
     attgaatact acctataatt ttattatata accaaaagga gttgtcgaag gtctaactat     36480
     cgggggttca cctatgccag gatgggttac cagagcagga gacacggatt gctatatcca     36540
     ggaagcatcc tggaattgcg cgatggcttg cgccgcgatg gcactgaacc gccttggtca     36600
     tgggcatccg accacacgcg cgatcgcggc ggcttcgcaa gctaacagcg ggaactatat     36660
     accagctaat tcggatcgtg ccggcggcca agacatcacg cagaattcga ccggcttgat     36720
     cgccgcatta gccctgcgcc ggaaagcgat caatccagac gacaaccctc tcgccacttc     36780
     cagcccaggc gacatgttgt ccagactaca aactggctct gatccaggaa ccagcgggaa     36840
     gaacatcgcg aacacgctaa aattgcaata caatgttcag actgcccagt acaaaaccat     36900
     cactgctggc gccgtcggac cgttaaaagc aactatggcg ggcgccacgg ttacccaccc     36960
     ggtgatcctc ggtttggtca atccaccaca tttcgtgctc tgtgagggat tggttcatgg     37020
     ttcatcaaac cgatacaaca tcgtcgatcc ggccgatggc gtgcgttaca cggacggacg     37080
     attgcgctcc ggcccaacct tgaaattcaa cggccaagcc tacaacacag cagttgacga     37140
     ggtcatcgtc acctgacgag gggttacgca tgaaaatcgc tgaggtattt gacggcatgg     37200
     aatcgggtgt gattcgtgtc aacggcggat caaaaccagg ccagcgtggc ggcgtaaaaa     37260
     ccagtcactg gattgtgacg tgacggatat gagaacggcc cctgcagggg ccgttctcat     37320
     atccgcagcc tgcttggcgg tgggtatcag ctgtcgttga tttcgccggt ctcaggatca     37380
     tgaggcaggt cgtcacccag ggattactct ggggt                                37415
//