Dbfetch

ID   CP000691; SV 1; circular; genomic DNA; STD; PRO; 88953 BP.
XX
AC   CP000691; AAOO01000000-AAOO01000076;
XX
PR   Project:PRJNA15753;
XX
DT   12-MAY-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Acidiphilium cryptum JF-5 plasmid pACRY03, complete sequence.
XX
KW   .
XX
OS   Acidiphilium cryptum JF-5
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acidiphilium.
OG   Plasmid pACRY03
XX
RN   [1]
RP   1-88953
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Han C., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Magnuson T., Richardson P.;
RT   "Complete sequence of plasmid3 pACRY03 of Acidiphilium cryptum JF-5";
RL   Unpublished.
XX
RN   [2]
RP   1-88953
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Han C., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Magnuson T., Richardson P.;
RT   ;
RL   Submitted (04-MAY-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 823a599d91e3f6f4c6f4672057266847.
DR   BioSample; SAMN02598339.
DR   EnsemblGenomes-Gn; EBG00001153610.
DR   EnsemblGenomes-Tr; EBT00001742934.
DR   RFAM; RF00519; suhB.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000181
CC   Source DNA and bacteria available from Timothy Magnuson
CC   (magntimo@isu.edu)
CC   Contacts: Timothy Magnuson (magntimo@isu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..88953
FT                   /organism="Acidiphilium cryptum JF-5"
FT                   /plasmid="pACRY03"
FT                   /strain="JF-5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:349163"
FT   gene            complement(452..1051)
FT                   /locus_tag="Acry_3471"
FT   CDS             complement(452..1051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3471"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3471"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29074"
FT                   /db_xref="GOA:A5FTZ2"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTZ2"
FT                   /protein_id="ABQ29074.1"
FT                   /translation="MRNSSLKIRYSRHSIGLPATTTTPGAVRGATKRCSLECGWRSESI
FT                   GATLEAHSAGGFPMVNRIALVSFVAVFVAGFATAALPVFPAPALAGGMPDGNAVKGKSI
FT                   FSAQCAACHSVVAGQNGIGPSLYGVFGKPAASVAGFPFSPALKSAHIVWTAAALDKFLT
FT                   NPQAAVPGTKMPYMGMPNAQKRANVIAYLATLKDQN"
FT   sig_peptide     complement(962..1051)
FT                   /locus_tag="Acry_3471"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.953 at
FT                   residue 30"
FT   gene            complement(1381..2487)
FT                   /locus_tag="Acry_3472"
FT   CDS             complement(1381..2487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3472"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29075"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTZ3"
FT                   /protein_id="ABQ29075.1"
FT                   /translation="MHDKIPGGLRPSFKSNDVVVPQQTSLFYGGALDAQLGLGAFIQAT
FT                   YSGVSKSVHWDGMDIRFAHPATLFGKPLFYGLTFNNAPTITDLWNTIPAWGFPYIHSNV
FT                   QPGPVADDQIDALGGEVYGIGAYGALNITPSDMLYTEADLYKSLPNHLSYALGVGPAPR
FT                   VNGVIPYVRLAFQHTWANNSFEVGSYALFDRPYPSGRLNGPTDRILDVAADSQFQYITA
FT                   KQALSIQANFVHETQDWRASYPLGITANPSDTLDILTFSVSELLFQKYGVIESFRTVYG
FT                   NADPLLYAPSPIGGSANGKPDTNSWTTELDYYPFNNGGPKWLPWLNAKLFVTDTVYPTF
FT                   NGLAHNYDGFGRSAGANDTLFAGMWVAF"
FT   gene            2688..3359
FT                   /locus_tag="Acry_3473"
FT   CDS             2688..3359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3473"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29076"
FT                   /db_xref="GOA:A5FTZ4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR014737"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTZ4"
FT                   /protein_id="ABQ29076.1"
FT                   /translation="MRQPCLRPQAARNSDVTKSSFTVPRDFKQAALPHVCQDGRDAGRP
FT                   RHASDGEGPEHLCLTMIEAREIDGNGECASLLWRPLTTIEANDAAGAAEIVRLYRLYRL
FT                   RWRIEEVFRSLKSEALRLKETRLQDARHLFKLALIGLAANSRTVQLVDARNGSDRPATD
FT                   IIDPGLLTAADAIGPPLDGKTPRQKNFHPPRSLAWLAWIVARLGGWNSYYKSPGLKTMR
FT                   A"
FT   gene            3491..4162
FT                   /locus_tag="Acry_3474"
FT   CDS             3491..4162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3474"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29077"
FT                   /db_xref="GOA:A5FTZ5"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTZ5"
FT                   /protein_id="ABQ29077.1"
FT                   /translation="MAETEFPVLLATNVLGLLPAPALMRATILLMRRLGRTHPRLFRAL
FT                   AAHKPCTIGIEPTDLRHRFVLRFGGGPASLVPTSTLEQSLNACVRGRLATLVGLLEGRL
FT                   DSDALFFSREVVITGDIEAIVSLRNALDRETVNVFKAATTLFGPGERAARRVALMLERR
FT                   LTAAHQRLTMGHEALHTARREEHPVTAYCERVEAELQALRTRMAKIEAQTRRRNPIGAV
FT                   T"
FT   gene            4159..5154
FT                   /locus_tag="Acry_3475"
FT   CDS             4159..5154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3475"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3475"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29078"
FT                   /db_xref="GOA:A5FTZ6"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTZ6"
FT                   /protein_id="ABQ29078.1"
FT                   /translation="MTRYLELVCPAGTLAALRVAVDAGADTVYCGFQDCTNARNYPGLN
FT                   FTREDLHTGISYAHARGCRVFVAVNTFPRAGDLGPWQRAIDDAASCGADAVILADLGVL
FT                   DYASRRHPNLRRHLSVQAAAASPLGIRFYRDIFGISRVVLPRVLSVEEVTSLIGQTGIE
FT                   AEAFAFGSLGTMVEGRCFLSSYMTGRSPSSDGVCAPAECASYHEDGDRLVSRLGEVMIN
FT                   RFAHNEPAAYPTPCKGRFLVHGRPSYLFEEPTGLNVIPLLAELKAAGVTALKIEGRQRS
FT                   RTYVATVVTAFRHVLDALAEGAPTAPIPAVLREVAEGGRETFGAYAKGWR"
FT   sig_peptide     4159..4230
FT                   /locus_tag="Acry_3475"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.691) with cleavage site probability 0.450 at
FT                   residue 24"
FT   gene            5151..6050
FT                   /locus_tag="Acry_3476"
FT   CDS             5151..6050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3476"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3476"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29079"
FT                   /db_xref="GOA:A5FTZ7"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTZ7"
FT                   /protein_id="ABQ29079.1"
FT                   /translation="MSCLTLGPLQFHWPAARRRDFYARIADEAPVECVYLGEVVCSKRL
FT                   PWFEKDLPKIAERLRRAGKQVVFSTPALIITDHEVAMIRALCETGDLIEINDLACLQLL
FT                   NGQAFVSGPLVNVFNEGALDVLLRLGAMRVNAPMELSIGAIATLAARNQSSEVEVFVFG
FT                   RQPLAISQRCYHARAHDLHKDNCQFVCGQDADGLEIAQLDGRPLLAINGTQTLSHGHVA
FT                   LLEELTDLQAAGVTHFRLSPHALDMVEISTLYRAVLDGIYDAKEGLTRLRELTAQLPFV
FT                   NGYLHGRAGMDWQPSRAG"
FT   gene            6120..7280
FT                   /locus_tag="Acry_3477"
FT   CDS             6120..7280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3477"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3477"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29080"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTZ8"
FT                   /protein_id="ABQ29080.1"
FT                   /translation="MDCSGRVISKSFGRMTGGSEHYIVIEPPADLDLTEQLACLEQRYD
FT                   ETRQELGLPAGGSVFRRLFVSDAMNQAPLLRRSRLAEDEDGSPVALSIIQQPPLSGTKL
FT                   SLLAYHVSGALDLSKRRLTPRHVVVEKNGLAHLWTTGLCPGSDDRLVPVTQQTRRMFDT
FT                   LIDGLDGLGGTLHNNCVRTWIYVKGIDVFYKDMVTSRSEMFLEQGLSAETHFIASTGIE
FT                   GACAHRFDIVTMDAYSILGLAPQQVSYLNDFDRLCPTRDYNVTFERGTRIAYADRAHLF
FT                   ISGTASIDRSGQVVHPGNVMRQFDHALDNVEALLRAGSAGLSELMHLIVYLRDPTDHPR
FT                   IKTALSERLPGVPAIIVQGPVCRPEWLVEVEGIAIADNEDLTLPSF"
FT   gene            7497..8426
FT                   /locus_tag="Acry_3478"
FT   CDS             7497..8426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3478"
FT                   /product="pyridoxal phosphate synthase yaaD subunit"
FT                   /note="PFAM: Vitamin B6 biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3478"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29081"
FT                   /db_xref="GOA:A5FTZ9"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTZ9"
FT                   /protein_id="ABQ29081.1"
FT                   /translation="MSDMPTNLTETSPLRLKTGLAEMLMGGVIMDVTTAEQAKIAENAG
FT                   AVAVMALERVPAQIRAEGGVARMASPKKIKEIMTAVSIPVMAKCRIGHFAEAQVLQALG
FT                   VDFIDESEVLSPADEMHHINKHAFVSPFVCGARNLGEALRRIAEGAAMIRTKGEAGTGD
FT                   VMHAVRHVRQITKDIHALTILREDELYAAAKELAAPYELVRIVASIGRLPVPNFAAGGI
FT                   ATPADAALVRHLGAEAVFVGSGIFMRDSQNFVDPSEAQSRAEAIVQATTHYDNPQILAE
FT                   ISESCLGAIHGLAAASLKEEVLLQTRGW"
FT   gene            8453..9040
FT                   /locus_tag="Acry_3479"
FT   CDS             8453..9040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3479"
FT                   /product="pyridoxal phosphate synthase yaaE subunit"
FT                   /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
FT                   domain protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3479"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29082"
FT                   /db_xref="GOA:A5FU00"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU00"
FT                   /protein_id="ABQ29082.1"
FT                   /translation="MPLKIGVVALQGDYAAHAEALRSSDTEIVLVRATKELADLNGLVI
FT                   PGGESTALLKLLTRENMFEAVREFSIAKPVFGTCAGCIILAKKVLPSQQQSLAVLDIVV
FT                   QRNAYGRQNESRVAMGNCALSGGGLEMVFIRAPCIVRAGSRVEILARYGGFPTLVRQGN
FT                   ILAATFHPELSTDRRIHRFFCAMIRSGEPCLT"
FT   gene            9651..11534
FT                   /locus_tag="Acry_3480"
FT   CDS             9651..11534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3480"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3480"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29083"
FT                   /db_xref="GOA:A5FU01"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU01"
FT                   /protein_id="ABQ29083.1"
FT                   /translation="MCDTAVVGRGFAQRVTEGFASQNLVDPIATLEEYLNREDWRVKAN
FT                   ANQSYSLGGLILHGAAKLVANYWLDHIYPPEVGRAHREADLHIHDLDMLAGYCAGWSLR
FT                   TLLVEGFNGVADRVEASPPRHLSSAVGQMVNFLGTMQNEWAGAQAFSSFDTYLAPFVRK
FT                   DGLSYAEVRQNIQEFIYNLNVPSRWGSQTPFTNITFDWVCPKDLRDQIPLIGGNEMPFR
FT                   YGDLQAEMDMINHAYIEVMSAGDANGRVFTFPIPTYNITPDFDWDSENAERLFAMTAKY
FT                   GLPYFQNFLNSDLEPHMVRSMCCRLQLDLRELLKRGNGLFGSAEQTGSIGVVTINCARL
FT                   GFQHRGNRSSLFERLDALLAHACDSLEIKRQVIGQYLDAGLFPYSKRYLGTLRNHFSTI
FT                   GVNGINEMIRNFTADTDDITTPAGHRMACDLLDHIRAKIIGFQEQTGHLYNLEATPAEG
FT                   TTYRFAKEDLRRYPEILQAGTPDKPYYTNSSQLPVGFTEDPFEALTRQDELQGKYTGGT
FT                   VLHLYLGEQISSSAACRDLVRRALTRFRLPYLTVTPTFSVCPVHGYLPGAHHHCPRCAA
FT                   EEPATIPRVCEVWTRVMGYHRPVSSFNIGKQSEFIERRFFVEPRAMCHATA"
FT   gene            11521..12228
FT                   /locus_tag="Acry_3481"
FT   CDS             11521..12228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3481"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase activating protein; PFAM: Radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3481"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29084"
FT                   /db_xref="GOA:A5FU02"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU02"
FT                   /protein_id="ABQ29084.1"
FT                   /translation="MPQPDEPLVSGWAPFTTLDFPGRLAATFFLRGCPLRCRYCHNVDL
FT                   QARRGTSPLRWLEALTWLDQRRGLLDSVVFSGGEPTMDRCLEQMIRDVRSLGFEVALHT
FT                   AGVSPKRLERVLPMLQWVGLDIKAPFGDYARITGSEASGARARVALAMLRESGVPYEVR
FT                   TTVHPALLDAQVLQTLALDLRASGIGRWVLQPFCGRGCVEPALSAENISIETSLVTHLR
FT                   RIIPEIVVRSNGC"
FT   gene            12650..13633
FT                   /locus_tag="Acry_3482"
FT   CDS             12650..13633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3482"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3482"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29085"
FT                   /db_xref="GOA:A5FU03"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU03"
FT                   /protein_id="ABQ29085.1"
FT                   /translation="MCAVISGAESWEDMALYGRSKQDWLGTFLALPNGIPSHDTFRRVF
FT                   MLIDTGRFEACFEAWARSFGTTLDREVVAIDGKASRGSFDRSRDQAAFHVVSAWASDRG
FT                   LVLGQRQVGDKSNEITAIPELLDVLDIKGAIVTLDAMGCQRAIAANILEGGADYFVTLK
FT                   ANQGKKHSAVAELCATTCFSRSPTHRPVHDEFDDGHGRLVRCRVFVCPDAVALEPLRDW
FT                   PGLKSVLAVETICGVNGSGKIEAEIRYFLSSSDDQPEILARAIRQHWQIENSLHWVLDV
FT                   TFNEDHCRIRDRNAVQNFSLLRKIAINLVRRHQSPNLNGSASIGCV"
FT   gene            complement(13617..14444)
FT                   /locus_tag="Acry_3483"
FT   CDS             complement(13617..14444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3483"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3483"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29086"
FT                   /db_xref="GOA:A5FU04"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU04"
FT                   /protein_id="ABQ29086.1"
FT                   /translation="MAWTEIARQRYCRAGLRYASDLTDAEWALIEPFMPLPLHRGRPRT
FT                   VVLRRIVEAIFYMLSTGCQWRQIPKEFAPFTTVQGYFYRFCRDGTFDRINHVLVMQARE
FT                   IAGREASPTAGVIDSQSVKTTEAGGPRGFDAGKKIKGRKRHIVTDTVGHLVGAVVHHAG
FT                   IQDRDGAPDVLKSVKSLYPWLRHVFADGGYAGPKLNGRLAKIGKWTIQIVKRSDTASGF
FT                   ELLPRRWVVERTFAWLGRCRRLAKDFEATVTSATAWLFLAHIRLLTRKITRNR"
FT   gene            complement(14666..15412)
FT                   /locus_tag="Acry_3484"
FT   CDS             complement(14666..15412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3484"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; IstB
FT                   ATP binding N-terminal domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3484"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29087"
FT                   /db_xref="GOA:A5FU05"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU05"
FT                   /protein_id="ABQ29087.1"
FT                   /translation="MLNHPTLDQIHQLGLAGMARAFTELHANPETPSLSHAEWLGLLLD
FT                   REITVRRDKRLSTRLRHAKLRHDAAIEDVDYRSARGLDRALFQKLIQGEWIDAHDNLVL
FT                   SGPTGVGKSWLACALGHKACRDDRSVLYQRAPKLFTELALARAEGRHGRMIRTLGTVNL
FT                   LILDDFGLAPLDASARHDLLEIVEDRYGRRATIITSQIPPAHWHELIGDPTYADAILDR
FT                   LLHNAHRIELTGESLRKTRKQTPKTA"
FT   gene            complement(15430..16977)
FT                   /locus_tag="Acry_3485"
FT   CDS             complement(15430..16977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3485"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3485"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29088"
FT                   /db_xref="GOA:A5FTS4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS4"
FT                   /protein_id="ABQ29088.1"
FT                   /translation="MPVERIAMRDVREIVRLRMAGLSTRQVGIRVGVAASTVRLTLRRL
FT                   EAAGLDGPGALALSEAALERRLFEGSAGKRPGHRRVDEPDWGRIRRELQRKHVTLSILW
FT                   DEYIAEHPDGYRYSRFCELYRSWEARLPVTMRQTHASGEKLFVDYAGDTVPVVIDRLTG
FT                   ETRAAQIFVAVLGASSFTYAEATWTQTLPDWIEAHNRTLAAIGGVPALLVPDNARVAII
FT                   RACLYDPQVNRTYTDMARHYGTAILPARPRRPRDKAKVEVAVLLAERWLLGKLRNRAFY
FT                   SLAELNAAIAEFCRWLNEERVVRRLGATRRHLLETLDRPALKELPAEPYVLAQWRRRRV
FT                   GIDYHVEIEKHFYSVPYRHARAEVEARFTVRTVEIFLRGERIAVHARGSGNGKHTTIAE
FT                   HMPSSHRRYGDWTIARIHQEAARLGPSVATLCTLILERRPHPEQGFRACIGILRLARSV
FT                   GADRLDAAAERALTIGTLTYGSVKSILDHRLERAAGTASPDPTPIRHPNIRGGGYFH"
FT   gene            17083..17289
FT                   /pseudo
FT                   /locus_tag="Acry_3486"
FT   gene            17437..18690
FT                   /locus_tag="Acry_3487"
FT   CDS             17437..18690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3487"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3487"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29089"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTD8"
FT                   /protein_id="ABQ29089.1"
FT                   /translation="MASSDIFTLGLGLTPPWRVVDQRLETDYQPHELHLAVAADPGARF
FT                   PCPTCGRLCKPHDWKELSWRHLNFFQHACIIEARVPRTDCPEHGVLRIAVPWARPDSGF
FT                   TLLFEQAALALMREMPVAAAARIIGVTDQRLWRILRYYVGRAIERLDLSGVEAIALDET
FT                   AAKRGHSYVTVFIDLDAAERPVLFVTPGKGKECMTAFRAFLAEHGGEARRIAEVVCDMS
FT                   AAFLAAAAESFPQASVTVDWFHVVQIFTTAVEQVRRAEAHQHNLPKGVRWATLKRPENL
FT                   TMAQRQALDQLENSGFATAEAYRAKEMLRWVRLAATPQAARWRLTNFLNHVTARLDDPD
FT                   HLLDPVRQAVDTVRRNAKRIIRRWKSGHSNARLEALNGLFQAARARARGYRNTATFACI
FT                   IYLLGAPINAMLDVFHST"
FT   gene            19600..21297
FT                   /locus_tag="Acry_3488"
FT   CDS             19600..21297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3488"
FT                   /product="potassium-transporting ATPase, A subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="TIGRFAM: potassium-transporting ATPase, A subunit;
FT                   PFAM: K+ transporting ATPase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3488"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29090"
FT                   /db_xref="GOA:A5FU08"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU08"
FT                   /protein_id="ABQ29090.1"
FT                   /translation="MTLHGIGFIALALALVFGAAFPLGAYLARLYRGDLRFLAAIEAPI
FT                   YRLCGIDPQRQMAWGAYAVGLLLLSLIHFLLLYAILRLQYFLPFNPEHIRGMSPKLAFN
FT                   TAVSFTTNTNWQAYAPESQISYGAQMFGLVVHMFISAAAGLAAAGALMRAFASGGIRTL
FT                   GNFYVDLVRITLYLLVPIAIVAALFLIGSGVPMTLAPYAHVHALAGGMQTIARGPVALQ
FT                   EAIKELGTNGGGFFNANSAHPFENPTAWTNLLEIFLLLVIGFALPIAFGHVAGRRRDGR
FT                   ALFAVMAVILACGMVGAYAAEAANNPILVHAGLAAHPGNMVGKEVRFGVAQSTTFNVAA
FT                   TGTSTGAVNSFTDSYLPLGGLVPLFMMQLGEIAPGGVGSGLYGIVLFALLAVFVAGLMV
FT                   GRTPEYLGKKIEAREMKLAMLAILVQTLFILAGAGFSLLTKSGLASLANAGPHGLSEML
FT                   YGWTSATENNGSAFAGLSANTMLLDYGLGLAMLFGRFAVMIPVLAIAGSLGAKPRLPHS
FT                   EGTFPTDGPLFIGLLIGVIVILVGLQFMPADLLGPIVEHYLLLAGKTF"
FT   sig_peptide     19600..19677
FT                   /locus_tag="Acry_3488"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.553 at
FT                   residue 26"
FT   gene            21309..23345
FT                   /locus_tag="Acry_3489"
FT   CDS             21309..23345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3489"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; K+-transporting ATPase, B
FT                   subunit; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3489"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29091"
FT                   /db_xref="GOA:A5FU09"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU09"
FT                   /protein_id="ABQ29091.1"
FT                   /translation="MSRKAETIGLFDRDILIRAIRDAFAKMNPRTLIRNPVIFVTEIIA
FT                   LLTTFVGIREMVSGQAWAFSIVIAIWLWITVLFATFAEAVAEGRGRVRAESLRRARSDT
FT                   MAKRLDDPADRAAFTLVPAPQLRREDLVLVEAGDLVPADGEIVEGIASVNESAVTGESA
FT                   PVIREAGGDRSAVTGGTELVSDWLVVRVTSEPGSSFLDRMIALVEGAARRKTPNEIALD
FT                   ILLAGLTIVFVIVVVTLPGFAAYSHTRLGIAELAALFVCLIPTTIGGLLSAIGIAGMDR
FT                   LVRFNVIATSGRAVEAAGDVDTLLLDKTGTVTFGNRMASAFHPVPGVDVRRMAEAAACA
FT                   SLGDETPEGRSIVRLAREEFGVDPVLPDGAEIVKFSANTRLSGIDAGERHWRKGAVDSI
FT                   LDLVGGAAPDAFGAAVDRIARAGGTPLGLMAEGALLGVIELKDIVKPGIRERFEALRRI
FT                   GIRTVMVTGDNRVTASVIAAEAGVDDVIAQATPEDKLGYIRKAQAEGRLVAMCGDGTND
FT                   APALAQADVGVAMQTGTQAAREAGNMVDLDSDPTKLIEIVQIGKQLLITRGALTTFSIA
FT                   NDIAKYFAILPAIFAASYPQLGALNIMALASPESAILSAVIFNALVIVVLVPLALRGVA
FT                   FRPMGAAALLRRNLLIYGLGGIVTPFVGIKVIDLILNSFHIFS"
FT   gene            23361..23960
FT                   /locus_tag="Acry_3490"
FT   CDS             23361..23960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3490"
FT                   /product="potassium-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="TIGRFAM: potassium-transporting ATPase, C subunit;
FT                   PFAM: K+ transporting ATPase, KdpC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3490"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29092"
FT                   /db_xref="GOA:A5FU10"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU10"
FT                   /protein_id="ABQ29092.1"
FT                   /translation="MLRELRPAFSLVVLFTLLLGLAAPLAVTGLAQLVFPFEANGSLIR
FT                   VHGQAVGSALIGQDFRGAQWFHSRPSALTGTNAKGQTIPTPYDASESGASNLGPTSKAL
FT                   VAHVTARIAAYRKAYGPGPVPDDAATSSGSGLDPDISLANALRQAPAVARARGMPAATV
FT                   ERLVRRLAVRPAFGVIGTAHVDVLRLNLALARNSQK"
FT   sig_peptide     23361..23441
FT                   /locus_tag="Acry_3490"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.336 at
FT                   residue 27"
FT   gene            23977..24477
FT                   /locus_tag="Acry_3491"
FT   CDS             23977..24477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3491"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29093"
FT                   /db_xref="GOA:A5FU11"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU11"
FT                   /protein_id="ABQ29093.1"
FT                   /translation="MPDKRKAAVGKKRHQMPHVHSLEVVPRITMRLFTVWAIMWLMVFS
FT                   IVIFYLMNRKIGIGEKNLLESSILPWIVVSSSILMRLLSLKRHINTKFFSDYLFRIVQP
FT                   FISIMVIEYSILFLTKYKPIFVEIFICSTVSILTIIISLVSLILLSFFSFKLYGAELPN
FT                   PWE"
FT   gene            24585..25796
FT                   /locus_tag="Acry_3492"
FT   CDS             24585..25796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3492"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29094"
FT                   /db_xref="InterPro:IPR011486"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU12"
FT                   /protein_id="ABQ29094.1"
FT                   /translation="MSLDHSRTPGRRNRTRLIAASFGAAISLCALQSAQAFNGPSAIKI
FT                   DGGPLGPLQLSGGADGYMYALSGTGNSTNSGLLTTDKSTGAEFMNGQIEVQKTSGLVQF
FT                   TIQVGSNNSLTLGTKPTATSVQTFSTGPLYAGYITLAPTKNFSISVGQIGSLEGYESGI
FT                   DWNNANVLTTDLFYVENSQSRGVSATYTMGPVSASVTFGDGFDTGVFNFLQGLVTYSFN
FT                   DNNALSVFGATNLGHTGLLANTYGSATTPYNQSTVGSNGANYINSTMIGGYYSYTHGNL
FT                   NLVPEVQYVYAKPDQKVGISKFTSNFGAALFADYAFGKSPYSLGGWVEYFSSNGPGFWF
FT                   LNPGAQGYGLSVTPTWQNKNLFVRGDLGLLHLTKVGYAGSTGYGANGTGRNQATFVVEA
FT                   GVLF"
FT   sig_peptide     24585..24695
FT                   /locus_tag="Acry_3492"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.859 at
FT                   residue 37"
FT   gene            26086..28689
FT                   /locus_tag="Acry_3493"
FT   CDS             26086..28689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3493"
FT                   /product="osmosensitive K+ channel signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase A domain protein; Osmosensitive K+ channel
FT                   His kinase sensor; UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3493"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29095"
FT                   /db_xref="GOA:A5FU13"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU13"
FT                   /protein_id="ABQ29095.1"
FT                   /translation="MGSASPENRPDPDALLARANSDGRGQLKIFLGAAPGVGKTWEMLA
FT                   AARRRFETGTDVVAGLVETHGRAETAEQLADLPVLPRRIVPYRGRLLEEFDLDSALKRR
FT                   PALLLVDELAHANAPGLRHAKRWQDVAALLEAGINVWTTLNVQHLESLNDQVARITGIR
FT                   VAETLPDTVLGLADDIELIDLPPEELRTRLKQGLVYRPDVARRALGGFFRPGNLAALRE
FT                   MALRRVAQHVDRDIAAYMRAQAIAGPWPAAERVMAVVEAGEAAEQVVRHASRLAEALRA
FT                   PFFAFHAERAATGMAVQPALDLAIQLGGTVETTTNADVFAALLDAAARQNVAHIVIARG
FT                   RGRWRWRRGLASRLARGARAYALHVVPDPAASRPAPPHRAPPPKLMPFGISLGIMIVTT
FT                   IGGFALRGVLPAEAMGYVFTAIVVGMASLYGRSVGIFAALTGFVLWNFFFLPPIYTLSV
FT                   TNPRDVTALFAFLVVGVLTGSLAGRVRAEAETARTRIEALRRITLFGRALAQVSDEAGL
FT                   AAVVEAEARALAGEAVLLLARGDGLPRAGGFDEAAVAAAEFAWRNRVATGMGTTTLPAS
FT                   AWRFQPLATEAGAIGVLGVRPETPPAEPVIQTLSALADQAALAAERLRLATSAAEARAH
FT                   ESTQRLRTALLSSLSHDLRTPLTAIRGAAETLAEADGELPEATRRDLLASIVEDVGRMT
FT                   RFLANITGMARIETGEIVARHEKVDLAPVVEHAVARVKEAFHTAVNIPEDAATVRADPA
FT                   LLEQVLVNLLENAVKYGPEGGAISVFARRAGDSVVLSVADEGVGIPPEDLPHVFDSFFR
FT                   VVRGDRVAPGTGLGLAIARAFVEAMGGTIAAESPRRDLPADGLPGTIIRVELPVP"
FT   gene            28686..29381
FT                   /locus_tag="Acry_3494"
FT   CDS             28686..29381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3494"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3494"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29096"
FT                   /db_xref="GOA:A5FU14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU14"
FT                   /protein_id="ABQ29096.1"
FT                   /translation="MTEAKRIETGRVLVVDDEPQIHRFLKPALEAAGYVVLRAERGAEA
FT                   LRLAATMVPDVILLDLGLPDLDGQDVIVKLREFSDVPVIVLSARDQEAQKIAAFDAGAN
FT                   DYVEKPFGLGELLARIRNAFRLIATGQGVPTEAIEIDGLRIDEAARSVSLDGAEIHFTK
FT                   TEFRILAALARHRGKLVTHDDILQAGWGDLQEYDRAYVRIYIRSIRQKLGKFADNHLKT
FT                   KSGLGYILI"
FT   gene            complement(29420..29818)
FT                   /locus_tag="Acry_3495"
FT   CDS             complement(29420..29818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3495"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29097"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU15"
FT                   /protein_id="ABQ29097.1"
FT                   /translation="MFPLCPLMLHRGAFRYFGPLGFDAVVSDGLAYFGHVSDAGCAHDV
FT                   IRTGSGPAAARSPTFKWVNTALGNIKSAIVGTYRAISSKHVPRYLAEFEYRFNRRYDLA
FT                   SMIPRLGWAAAHTPPMPYRLLKLAENAG"
FT   gene            complement(29818..32808)
FT                   /locus_tag="Acry_3496"
FT   CDS             complement(29818..32808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3496"
FT                   /product="transposase Tn3 family protein"
FT                   /note="PFAM: transposase Tn3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3496"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29098"
FT                   /db_xref="GOA:A5FU16"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU16"
FT                   /protein_id="ABQ29098.1"
FT                   /translation="MGHRRILTGEQIAQLFDPPTDRRGIIRHYTLSVTDLAMIRRGRGD
FT                   HHRLGLALMLCYLRYPGRPLHAGEIPDPALVSFVATQIDVLPDSLGAYLRVDQNRRRHS
FT                   AALQDRLGLRPWGPRVAADLADWLLAHALETDRLVDLAALVLEECRGRGVLLPRPAQLE
FT                   RLCIEVRYRARREIERLLTEGLSADQRRRLDALTERRLDTSQSWLAWLRQIPESAKPAS
FT                   MLGVIERLEHIRAIGIDPARGRRINQSRLAQLVREAGRTTVQHVAGYERRRRHAVLTAI
FT                   DLDLSARLTDQAITLFERLIGAMFRKAEGRHARAFQAEGRAINEKVRLYARIGAALMAA
FT                   RAGQGDPFAAIDKVIPWDRFCSTVMEAETLVRSEDFDPYEVLSEHYAGIRRWAPAFLAT
FT                   FEFQGVPAAASLMRAIAMLRAMNSAGASTLPKSAPTAFVRPRWARHVLTAHGIDRRYYE
FT                   LCVLAELRQRLAAGDVWVAGSRQYRAFEERLISRETFQVLQKESSIPVAVETDFERFIA
FT                   TRRTWLDARLAEIDIRARGGLLPDVTIEKGVLRITPIEKSTPPEAEALAAKLYAALPRI
FT                   RITDLLTEVAGWTGFPDCFTHLRTGEAAADPRVLMAGLLADGLNLGLTRMAEACSIASL
FT                   GQLAWTADWHIRDETYALALRRLVEHQSREPLAALFGSGTASSSDGQFFRAGGSGRDAS
FT                   RINAHYGPEPGLKFYTHLSDRYAPFHTRVIAATASEALHVLDGLLDHHGDAPPRQHRHH
FT                   TDGGGVSDHVFALCALLGYVFAPRIPDLKDRRLYSFARPAAYPTLAPMIAGRINVDLIR
FT                   THWPDLLKIATSIRTGTVSASVILRQLAAYPRQNAVAAALRELGRLERTLFTLDWLEDP
FT                   GLRRESSHELNKGEARNSLARAVFIHRLGEIRDRTFENQTHRASGLNLLVTAIILWNTR
FT                   YLAQAIQALRQVEDVPGTLLRHLSPIGWEHVNLTGDYIWSAKQKSSENHAGLRPLRPIH
FT                   DTTTHAA"
FT   gene            complement(32747..33406)
FT                   /locus_tag="Acry_3497"
FT   CDS             complement(32747..33406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3497"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3497"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29099"
FT                   /db_xref="GOA:A5FU17"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU17"
FT                   /protein_id="ABQ29099.1"
FT                   /translation="MLIGYMRVSTDNDRQVLDLQRDALLGAGVDERHLFEDRAGGSRRD
FT                   RPGLAAALAYLKSGDCLVVWKLDRLGRSLPHLLETVNSLRARGVGFRSLTEQMDTTTPQ
FT                   GEFLFHVFGALAQFERSLIQERVQAGLAAARRRGRRGGRPVAIDAEKLAAVIAALDAGA
FT                   TKASVCRTFGISRSTLVDSLARIGWSPILNRQEGGTSGSSTDIDRGTDRTAVRPAD"
FT   gene            33407..33646
FT                   /pseudo
FT                   /locus_tag="Acry_3498"
FT   gene            33812..34258
FT                   /locus_tag="Acry_3499"
FT   CDS             33812..34258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3499"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29100"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU18"
FT                   /protein_id="ABQ29100.1"
FT                   /translation="MHENAEHGEIWFFPFHNPLSKSGRKVSAIRNGAYRAVSDKSCDDP
FT                   KFKRAAHEFAGYIASNAGSLINYGERFRSGERISSSLAESTVNAVISKRFAKRQQMQWT
FT                   KRGAHLLLQARTRTLDGTLRPLFERWYPGLANDNGNGATHPAAA"
FT   gene            complement(34259..34534)
FT                   /locus_tag="Acry_3500"
FT   CDS             complement(34259..34534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3500"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29101"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU19"
FT                   /protein_id="ABQ29101.1"
FT                   /translation="MDIFDRPELTEPPRRLFAALERASASFARLDQALTMHPLSSAFLF
FT                   RFRLDAVRRQAGADGQLIEPWHLAALLEGVRLRMDPYLRRPSGSVG"
FT   gene            34957..35931
FT                   /locus_tag="Acry_3501"
FT   CDS             34957..35931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3501"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3501"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29102"
FT                   /db_xref="GOA:A5FU20"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU20"
FT                   /protein_id="ABQ29102.1"
FT                   /translation="MKPPKRRNVPATGRLIGYARVSTDTQGADPQLDELRAAGCTIIHE
FT                   EHASGADRGRPVLMRLLKEIRPGETLVVVRLDRLARSVSHLLAVIEQLETAGAHFRSLR
FT                   DPIDTTTPQGMFSLQVLGAVAQLERALIAERTRAGLLAARSRGRIGGNPGLRARDPEAI
FT                   RKIKKSRDAGYLNTVLAQVDAWLPTVRRMRPDQPWGDVVRVLNRGQATPAHHASGRIWT
FT                   VERLRRTVHRLVAEGLADRTLLGRAPPQRSDDRLVRLVAGIKTAAPGHTLQQIATQLEA
FT                   MRERTPRGGTRWHPSSVRHLLIRAERLGLLATPIDHTATTLQS"
FT   gene            36270..37616
FT                   /locus_tag="Acry_3502"
FT   CDS             36270..37616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3502"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3502"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29103"
FT                   /db_xref="GOA:A5FU21"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU21"
FT                   /protein_id="ABQ29103.1"
FT                   /translation="MLASVANTPILPGLSPVAGKSIEARFDGEMLSSDGGLLALREVEK
FT                   RLGIAAQLAACIDDPRTPERVQHGLDEIIRFRMLMIAAGYEDGNDADRLRNDPMFKLAM
FT                   ERLPEAGDLCSQATISRTENLPGPRALLRMGLAMVEHYCASFRTIPNRVVLDIDDTFDA
FT                   AHGAQQLCLFNAHHDEYGFQPIVVFDGDGRMLAAVLRPACRPKGSQIVKWLRRLIDAIR
FT                   SHWPRTAIMLRGDSHYCTPEVLRFCRARRLDYIFGVAPTTTLRKHVIALEASTTARAQQ
FT                   APGEKIRRFKEFNDGAASWDRVERIIARVEAGPMGVDTRFIVTSLKAGSPRTLYQEIYC
FT                   ARGQAENHIKAWKTHLAADRTSCSRASANQMRLFLHIGAYWLMWSLRSLMPRRSRWRGI
FT                   QFDTLRLRLIKLAVRLETLKRSIRLHLPRSMPDQAILGYALARLPRLVI"
FT   gene            37793..37963
FT                   /pseudo
FT                   /locus_tag="Acry_3503"
FT   gene            complement(38074..38616)
FT                   /locus_tag="Acry_3504"
FT   CDS             complement(38074..38616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3504"
FT                   /product="Antirestriction protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3504"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29104"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU22"
FT                   /protein_id="ABQ29104.1"
FT                   /translation="MPNSRMANAGQTDLQRRSCGIIRITALCPLCRYRHNGHATGHPSR
FT                   LNRPDLGTPFGSEAYAREELRAEIASLMIADKLGVGHDPGQHAAYVGSWIKALQQDARE
FT                   IFRAAADAEKISGYLMALRAEQKAGQAAGRSDDAQAGDQARGYWQRAAESGAEIRRAER
FT                   AEQPEQERQTRRATAGR"
FT   gene            complement(38619..39611)
FT                   /locus_tag="Acry_3505"
FT   CDS             complement(38619..39611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3505"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3505"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29105"
FT                   /db_xref="GOA:A5FU23"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU23"
FT                   /protein_id="ABQ29105.1"
FT                   /translation="MSAAALPALIQRFFTDRLCVQMEASRNTVAGYRDTFRLLLRYASA
FT                   RHVKPPVKLTIEDIDADLIADFLVHTETARGNSARSRNTRLAAIRSFFRYVAMSDPTWL
FT                   LQCQRILAMPNKRYVKRTVTFLDSDEIAALLAAPDRTTWAGRRDHALLLLAVQTGLRAS
FT                   ELVGLQCGDVVLESGAHIRCMGKGRKERATPLRRETVKLLAAWIGDDKNKSKPLFPSIR
FT                   GERLSRDALEHLVRKHCLTASLTCPSIGSKRVTPHTLRHSTAMDLLHHGVDPAVIALWL
FT                   GHENVETTQIYIHADMRLKEKALARVAAPDTPSSRFRPDDQLLAFLEGL"
FT   gene            complement(39608..40549)
FT                   /locus_tag="Acry_3506"
FT   CDS             complement(39608..40549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3506"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3506"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29106"
FT                   /db_xref="GOA:A5FU24"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU24"
FT                   /protein_id="ABQ29106.1"
FT                   /translation="MSLTIQLDRYLNVRRSLGYDLGTSERILRRFTRFADREGAAYIDT
FT                   ALFLRWHATLAEACTSTRAARLSVVRLFAQWLSSFDPAHEVPPRGLLPGSVQRSRPHIY
FT                   SETEIGSIIVAAKELPSIYGLRGLTCSTLFGLIAVTGLRISEALALDRDDLDAEHGVLR
FT                   VRQGKLGKERLLPLDPSVVTQLIDYLAERDRLIGHPAKPLFVTDKATRLTDCAARYNFA
FT                   RACQQIGLRTHQPYCKHGRGPRIHDLRHSFAVKTMIDWYRTGKDPAREMIRLTTYLGHS
FT                   DPSNTYWYLEAVPELLDLAMARATADGREAVQ"
FT   gene            complement(40546..41757)
FT                   /locus_tag="Acry_3507"
FT   CDS             complement(40546..41757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3507"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3507"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29107"
FT                   /db_xref="GOA:A5FU25"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU25"
FT                   /protein_id="ABQ29107.1"
FT                   /translation="MSENLETCVDPYLASFGESFAVANYKAATIKSYRSIIRKLGQVMD
FT                   AEGIEPSALTLNQAERLGRMVPRKHGQTVCPHNLARRFAGHLIDIGVAQPVPLTEARIA
FT                   RAALLANFETYLVKQRGLSQRTIYHTLRFADRFLDHRFGETMVDPGRLRPADAIGFIEH
FT                   VLAGARRDKTIATHVRIFLQYLFGCGATATNLALSVPKTARRWGARLPRHLSPNGVEAV
FT                   LASVRDNQRHGARDYAMLLLMARLGLRAAEVIAIQLDDIDWRAGELLVRGKGKLHDRLP
FT                   ITVEVGDALSRYLREERGPATCRTMFVTHRAPHRPFKDGQIVNAILKDALKATGQKPVT
FT                   PYVGSHLLRHSLATRLVNTGASLDEVGDVLRHRSRSSTMIYARLDIDGLRSIAQPWPAA
FT                   GGAQ"
FT   gene            complement(41817..42542)
FT                   /locus_tag="Acry_3508"
FT   CDS             complement(41817..42542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3508"
FT                   /product="domain of unknown function DUF1738"
FT                   /note="PFAM: domain of unknown function DUF1738"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3508"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29108"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU26"
FT                   /protein_id="ABQ29108.1"
FT                   /translation="MRTWRIPTRPPMAGDYAQTVAASIVKQLEDGTAPWVKPWEPSGLR
FT                   FIPYNAITGKDYQGGNAIWLMAVAEMKGYSDPRWTTYKQAQSLDAQVMKGEKGTLIQYF
FT                   KKFDRVPVKDEQGRPVKDAEGNQVYRSVELERPRVFSAVVFNAEQIAGMPKIEARPALA
FT                   EWERHAAAEHIMSNSGVPIIYRPGDRAFYTLAQDRVTMPERDQFKAADRFYSTALHELG
FT                   HNAVIRIMPRAVEKARLAA"
FT   gene            43114..44712
FT                   /locus_tag="Acry_3509"
FT   CDS             43114..44712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3509"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3509"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29109"
FT                   /db_xref="GOA:A5FU27"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU27"
FT                   /protein_id="ABQ29109.1"
FT                   /translation="MPPQPGGVLARAPPWSRPSGPRRIPPHNGETFVPGRHINDHQKRL
FT                   FMRYRQTDGVALAAARAGFSTAAGYRLEQERHLPSSPKPPRGRRRPDPLATIFDAEVVP
FT                   LLEAAPGLRAVAIFEEMCRRHPDLAPGVRRTLERRIRTWRALHGPEQEVIFRQTHEPGA
FT                   MGLSDFTDMNELGIIVAGAPLNHRLYHFRLVWSGFEHAHVILGGESYVALAEGLQNALW
FT                   LLGGAPREHRSDSLSAAFRNLTAENVADLTRRYDALCAHYGMTPSRNNRGVAHENGAIE
FT                   SPHGHLKRAVRDALLLRGSTVFVDLEAYRRFIAEIVGRQNRHHAERIDAERAALQKLPD
FT                   QRTADYEETVVTVTSSGGFTLRKVFYTVPSRLIGQRLRARLYDNRLELFLAATPLMTLP
FT                   RGRPQPDGRHGHVVDYRHVIHSLRRKPMALLNLVYRHQLFPRDAYRRTFEHLLEQTPPR
FT                   DACRIMVELLAIAHERACEAELASVLAADIKAGRQPDLKAIRQRFAPDPASLPALTIPT
FT                   MPLASYDILLQGAAA"
FT   gene            44709..45584
FT                   /locus_tag="Acry_3510"
FT   CDS             44709..45584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3510"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3510"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29110"
FT                   /db_xref="GOA:A5FU28"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU28"
FT                   /protein_id="ABQ29110.1"
FT                   /translation="MSETARTVDAQRLTLLLNELRLPAIKQVWSDFAARADKEAWPAAR
FT                   LLATLAEHEVAERDRRRIERHLLEARLPPGKTIATFAFEAVPMISKAQILALCSGDGWL
FT                   ETGANLLAFGPPGGGKSHLAAAIGLALVENGWRVLFTRTSDLVQKLQIARRELALEATI
FT                   AKLDKFHLLILDDLAYVTKDQAETSVLFELISARYERRSLMITANQPFGEWGKVFPDPA
FT                   MTLAAVDRLVHHATIFEMNVESYRRKTAIQRRAGPGRPPTRATINENIRLSLHDNQVAE
FT                   TRLPASNQSD"
FT   gene            complement(45805..46215)
FT                   /locus_tag="Acry_3511"
FT   CDS             complement(45805..46215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3511"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3511"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29111"
FT                   /db_xref="GOA:A5FTF1"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTF1"
FT                   /protein_id="ABQ29111.1"
FT                   /translation="MIFIDASALIAMIAGEEDADMLADLLAQERTRLVSPVAMWEATAG
FT                   LCRSFGLSMDGARQKVKSFMSALGIEVISLGEREYDLAIQAYADFGKGRHPAALNMGDC
FT                   FAYGAAKSYRAALLFKGDDFSKTDIRRAEMNL"
FT   gene            complement(46212..46454)
FT                   /locus_tag="Acry_3512"
FT   CDS             complement(46212..46454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3512"
FT                   /product="Rv0623 family protein transcription factor"
FT                   /note="PFAM: Rv0623 family protein transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3512"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29112"
FT                   /db_xref="InterPro:IPR011660"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU30"
FT                   /protein_id="ABQ29112.1"
FT                   /translation="MPLYIRDNATAELVAKLAKERGLTKQDAVRLAVQAELDRTREAKP
FT                   LRERLREWREANPLPPPTGLKADKAFFDDLSGEGE"
FT   gene            complement(46521..47201)
FT                   /locus_tag="Acry_3513"
FT   CDS             complement(46521..47201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3513"
FT                   /product="NERD domain protein"
FT                   /note="PFAM: NERD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3513"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29113"
FT                   /db_xref="GOA:A5FU31"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU31"
FT                   /protein_id="ABQ29113.1"
FT                   /translation="MVATGAAAAAIITRPTDQATETHAQRAGAAGEKRVARALERAGVP
FT                   AIHDITLQDRRGTHQIDHVAAAGDCLYCLETKTWRGELMGHAHAQQWTLKKPDGAAQRV
FT                   YNPLLQNETHRDVIRRVTQVPVRPLVILAGHVQLAGEPVPGMISLTSAIMEMTRAGAAS
FT                   GRALAALEALERFRGQSRQAVLSAAHRRRMRRHKPACTRQLWILAVGAALVFFVLAGEQ
FT                   AILW"
FT   gene            complement(47274..47615)
FT                   /locus_tag="Acry_3514"
FT   CDS             complement(47274..47615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3514"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29114"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU32"
FT                   /protein_id="ABQ29114.1"
FT                   /translation="MSRKPSLLASALKSSEPETLPAPRQPSAEPKAAVVSPPLPQKVEP
FT                   QGGSYVPPSRANKTAKTHHLPPAYWETLEEISFRTRDEKGKRVPQERLVAEALNLLFVK
FT                   YNYPQVRDE"
FT   gene            complement(47612..48271)
FT                   /locus_tag="Acry_3515"
FT   CDS             complement(47612..48271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3515"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3515"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29115"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU33"
FT                   /protein_id="ABQ29115.1"
FT                   /translation="MLAVAFCTQKGGTGKTTIATALAVAAHRAGKKSALLDLDPQTNAV
FT                   DWFDRRQGDGPDVASIQPGAIRRSLDAYRKLGMEWVFIDTPGKMDSASTEAAKHADLVL
FT                   IPTQAQIFAIDTLEPLKRLLVMAGNPPAFVVLNQVHPNAAGRAGEDAAAIAERFKVPVA
FT                   PIHMSRLKAYEDAPALGQSPQEYEPKGRAAREIAELFAFLTEQGSMITGKHESMKL"
FT   gene            48491..48832
FT                   /locus_tag="Acry_3516"
FT   CDS             48491..48832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3516"
FT                   /product="protein of unknown function DUF891"
FT                   /note="PFAM: protein of unknown function DUF891"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3516"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29116"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU34"
FT                   /protein_id="ABQ29116.1"
FT                   /translation="MPERSKLIEFRGGALDDLRDFPISARREAGHQLDQVQQGHDPDDW
FT                   KPMRTIGQGVREIRIRDEAGAFRVIYVTKFADTIYVLHCFQKKTQATSKPDLELATKRY
FT                   RDLVKELSS"
FT   gene            48829..49110
FT                   /locus_tag="Acry_3517"
FT   CDS             48829..49110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3517"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3517"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29117"
FT                   /db_xref="GOA:A5FU35"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU35"
FT                   /protein_id="ABQ29117.1"
FT                   /translation="MSNERFTSVWDAIEDTPAEAENMKLRSALIMALKERITREGLSQS
FT                   QAAKLFGVTQPRISDLLRGKINLFGLDTLVNMAVAAGLHVELRVLEAA"
FT   gene            complement(49198..50559)
FT                   /locus_tag="Acry_3518"
FT   CDS             complement(49198..50559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3518"
FT                   /product="replication protein C"
FT                   /note="PFAM: replication protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3518"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29118"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU36"
FT                   /protein_id="ABQ29118.1"
FT                   /translation="MPVSAPTGRVSPIPVGVSMQLPHQAERGHVPPSLPARPTGLRRLT
FT                   PAMLPTGRLADEFAGGDVTPGQALAAFKAAAPFLGIGPRAAQAIDWLFRFTQPQDWQPG
FT                   ARPIVWPSAAMMAAELGITETQTKRLNRHLAELGVVTMRDSPNGKRYGHRDRSGRIIEA
FT                   YGFDLSPIAQRIEEFRALAEAGREERAAVAKLRRRASIARASLRQTWETFREQEIDLPA
FT                   PLRTAAQAASRGLKALDSSQRLKPAVEALEAIAVDARRALEMALAGASREQTSISESVE
FT                   MCPKGHADVPHITTTNQILYPNKDTVIALKECSRGDLPGRTAQTKPPARQERQERQDRG
FT                   SSLKLTPDELVRLAPRLVPYLRHPSPSWPEIVDAADWLRHDLGVSKPLWGEACLAMGRE
FT                   QAAIALALVSAKPPGHFRSSPGGYFHGMVERARDGGLHLDRTIWGLRGASAHKK"
FT   gene            complement(50726..51496)
FT                   /locus_tag="Acry_3519"
FT   CDS             complement(50726..51496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3519"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29119"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU37"
FT                   /protein_id="ABQ29119.1"
FT                   /translation="MGLNMRTQLHPRHVSCWIFPRLCRAAQNGRDDNSFVFRSSPSFSG
FT                   SRKLLARMCLRRLRSYVFIAQCKFGLQQFMEMHVKESGDRGHAINGNVDLSMLNLTDIG
FT                   AIRLDEMRHVGQRKTERISAGSHIVPEYGSLRGFQQAAIDGRQFASSPFRALYRHLCRL
FT                   LQLAHAHPILMPDICCSHRFSRFAHMTRPMSCDSKQWVNLSHRIGRFLETQAYRVMTLL
FT                   YSSTAAIIAGARISQRESRAMLFFDTGGMTAKHT"
FT   gene            51980..52666
FT                   /locus_tag="Acry_3520"
FT   CDS             51980..52666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3520"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3520"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29120"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU38"
FT                   /protein_id="ABQ29120.1"
FT                   /translation="MLITPAHFLALANRCAPEVAPGTLAAVASTESGFNTLAIQDNTTR
FT                   QSMRPSDVRSAIAVARRLIADGHSVDLGLMQIDSANLPRLGLTVTTAFDACASVRAGGK
FT                   LLTQDYKRPDGQGRQAALLAALSRYNTGSAWQGFQNGYVSRVVSTAKYVVPEIDPADSV
FT                   QAPKASPSSASSSPHPPAWDVFPNSIGPAGFASAHAVTLQASRASGPSGLAQPSKQETR
FT                   GETKAH"
FT   gene            52647..53012
FT                   /locus_tag="Acry_3521"
FT   CDS             52647..53012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3521"
FT                   /product="VIRB2 type IV secretion fmaily protein"
FT                   /note="PFAM: VIRB2 type IV secretion fmaily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3521"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29121"
FT                   /db_xref="GOA:A5FU39"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU39"
FT                   /protein_id="ABQ29121.1"
FT                   /translation="MKQRLTKLRDRVANFAAGTVSKIDRGAWIQPAVLVTVGFLLPAVA
FT                   HAQVVSGGTSPTTIIDNIATFILGPFGEGVAVLAVAAVGFMCWTGRMGFHAIGWLAAGL
FT                   VLVFGSSYLVTTFVGGG"
FT   sig_peptide     52647..52790
FT                   /locus_tag="Acry_3521"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.840) with cleavage site probability 0.829 at
FT                   residue 48"
FT   gene            53016..53348
FT                   /locus_tag="Acry_3522"
FT   CDS             53016..53348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3522"
FT                   /product="type IV secretory pathway, VirB3 family protein"
FT                   /note="PFAM: type IV secretory pathway, VirB3 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3522"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29122"
FT                   /db_xref="GOA:A5FU40"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU40"
FT                   /protein_id="ABQ29122.1"
FT                   /translation="MTERQRDPLFVAATRPALFLGLPIEMAVVIIMIAAMIVIFGHNPF
FT                   YLTLVLPLWFGARCLVRYDYNAPRVAWLWFRTKATGAGENQAWGGASPAPFPMKVQQGR
FT                   GMRDAG"
FT   gene            53338..55731
FT                   /locus_tag="Acry_3523"
FT   CDS             53338..55731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3523"
FT                   /product="type IV secretion/conjugal transfer ATPase, VirB4
FT                   family"
FT                   /note="TIGRFAM: type IV secretion/conjugal transfer ATPase,
FT                   VirB4 family; PFAM: CagE, TrbE, VirB component of type IV
FT                   transporter system"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3523"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29123"
FT                   /db_xref="GOA:A5FU41"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU41"
FT                   /protein_id="ABQ29123.1"
FT                   /translation="MPVNRIRAERSAERYLPYLGHVRPDILLMDDGSVLAMAEIPGAPY
FT                   ELAADADRAASLVTVNALCKNVADDNVTLHSAFVRGPGAGQLAHAVMPNEFAASLDRAY
FT                   RERVLAGRLYQNTWYLTVIVSPRNPLGGKAGGATASLFGGKRERQKPHATAEGIRQLEE
FT                   VWQTISQTLAPYDVRRLGLRPAANGQFYFSEIAEALRLILTGTAAPVPLVSGPLGAALY
FT                   TDRAIFGRRVFELRGPGVSRFGAIFGYREYPSETYAGMYDGVFSLPCPVVMVHTFDFHA
FT                   RHTSEKRLGLKAAQMTAANDKARSQISDLADAQDHLASGKIAMGEHHFSLTVYADTIEE
FT                   LDRLSGLTRTVIANSGGVVAQESAGLEAAYFAQLPGNRKWRTRPGTITTRNFAAFSGFE
FT                   AFPRGQRAGKWGPAMARFRTTAGTAYDYVPHVEDVGMTAIFGKIGQGKTTFMLFLLALF
FT                   PQYFAARNGAVVFFDKDRGGELLCRAVGGRYLVVRAGRDSGLAPLKALDNTPESVAFLV
FT                   QWLTALIQQDGHGPLPPEDDARLTRGVQALLRLAPDMRSLAGLRQFLDWRNPMGAGARL
FT                   ERWCKGGSLGWAFDGERDDVSLEATTVGFDLTAILDNGTVCAPAANYLLYRISQALDGR
FT                   RFVLSCDEFNFYLLNPLFAKIWADFMLTVRKSNAVVLLATQEPAPVLDSPQGDSILRQC
FT                   QTLVFCPTPGAEEHLYRKRLNFTAGEFRAIAEDMLPNSRQLLIKRHGGSAIIDFDLSAL
FT                   PEFVAILSSRKSSVGFVEQLRATHGDDPAAWLPAFMARFHEEVE"
FT   gene            55741..56499
FT                   /locus_tag="Acry_3524"
FT   CDS             55741..56499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3524"
FT                   /product="type IV secretion system family protein"
FT                   /note="PFAM: type IV secretion system family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3524"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29124"
FT                   /db_xref="InterPro:IPR014158"
FT                   /db_xref="InterPro:IPR023220"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU42"
FT                   /protein_id="ABQ29124.1"
FT                   /translation="MLKPSRRLGIASAIAILGFASPTLAQVPVIDSASLAQIVNQLNEA
FT                   KQQYSELVSQYNELKSTYNALSQNVNPNQWAQQLDQSAMQDTVPNTSILPNMLDGISPP
FT                   SSLSGNVGSLAQQYYNMNKVYIPAGSDFGSKQIQQGANETANFEAIATQNLQSLEAREQ
FT                   ELPQIQSQLNSATTIQQVASIQARLSAEQNYVQAQQAQAQNLQLLAFEENRAGQEAAAQ
FT                   ENAQGGEQTLSTLCGDAQTLGGEPSACQGQ"
FT   sig_peptide     55741..55818
FT                   /locus_tag="Acry_3524"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            56729..57616
FT                   /locus_tag="Acry_3525"
FT   CDS             56729..57616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3525"
FT                   /product="TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /note="PFAM: TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3525"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29125"
FT                   /db_xref="GOA:A5FU43"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU43"
FT                   /protein_id="ABQ29125.1"
FT                   /translation="MSVPNTTINIFEFMYNQYSTGFLQSLNSDVGSALSAALPPLSAAL
FT                   VIWVIILGYLMMTGSLDIRYGISKVSTMAIVVGIIASTSLYDSYVQTLFMKSLPSFVAS
FT                   TFSSGNTSNIPQSLDQTFNNFWVAGQIIYKKANCATCVLEPYVLGIEIELVLVVFFIAL
FT                   ALVFAVYLISTTLTGLLVAIGPFLLIGYLFEATKGIPERWLGKLIGLAILLLLITALLS
FT                   LFTGGMTDFLNTKVSTTFTADPVQTEIIILGEIAAYTAITAFITIMLPGIAAYIGGGVD
FT                   FNISGIVNPANWFK"
FT   gene            57795..58496
FT                   /locus_tag="Acry_3526"
FT   CDS             57795..58496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3526"
FT                   /product="VirB8 family protein"
FT                   /note="PFAM: VirB8 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3526"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29126"
FT                   /db_xref="GOA:A5FU44"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU44"
FT                   /protein_id="ABQ29126.1"
FT                   /translation="MNADMKNTALPIDNERLAAYFQDVESFQATEKRTARRWGRVGWVV
FT                   AGVSLAVNVTLAGAIVMILPLEKLVPAFIIVKSDGTTSTTMNFNSLPSDEKAAMTRAAI
FT                   WQYVRARESYDFADAQYRYDVASLMSNPTVQGTYQSWFLDKGPGSTSPQVTVGKKGQIS
FT                   VAMVSMSMVRPNVALVRFRRTVTMYGSVPQTSTWTATVGFENVATLPVSARLADPSGLI
FT                   VTNYQAQKDSP"
FT   gene            58493..59383
FT                   /locus_tag="Acry_3527"
FT   CDS             58493..59383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3527"
FT                   /product="Conjugal transfer protein TrbG/VirB9/CagX"
FT                   /note="PFAM: Conjugal transfer protein TrbG/VirB9/CagX"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3527"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29127"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU45"
FT                   /protein_id="ABQ29127.1"
FT                   /translation="MTCARKLAASGFLWLGMMGTALAIQYPHPGHEDPRVRYVPYQSGN
FT                   VTDIWTAPGAALTVQFGRNEKVVSVAESDSAYLKVVPVQNYLFIKPTGILPAQPIAVLC
FT                   KTSDGKLRHYFFQFETVNKHLGAGENVDYAVVFTYPHQAYERRLAKRKAAEAKAVQKEA
FT                   RSRLDEARAVMNAATVDQYQGPRNYEYVARGDHQLAPAEVWDNGYSTVFTFPAMQRIPA
FT                   IFYVQPDGKEATANYSVNGNTVVVPGTAPEWRLRDGHTVLDIYDLKYNPTGATPGTHTI
FT                   SPDVEREMRTFNNGK"
FT   sig_peptide     58493..58564
FT                   /locus_tag="Acry_3527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.800 at
FT                   residue 24"
FT   gene            59373..60509
FT                   /locus_tag="Acry_3528"
FT   CDS             59373..60509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3528"
FT                   /product="conjugation TrbI family protein"
FT                   /note="PFAM: conjugation TrbI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3528"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29128"
FT                   /db_xref="GOA:A5FU46"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU46"
FT                   /protein_id="ABQ29128.1"
FT                   /translation="MANEDTPDRPYGPIRHTNAAPSPVEQEQSAVASQQRLSGRQIGGI
FT                   LLACALGAGVVLVVTRLTAHHEPKLAHKAAVTGGTEGRPFVNNASSGTTPSSKPAGLPL
FT                   PPKQNAGFHNPFLTNQQESPAMKALKAPIMAFNQTGGGSSAQPASNTVGQNGAPSAGSA
FT                   KPTAFANKLDADQFSAADASMIAHPNFTIAAGTIIPCTLQTAINSTLPGFVKCVLPQPV
FT                   RSMTGTVTLLDKGTQVLGEVREGLVQGQDRLFILWDRAVTPQNVAIQLASPAADPLGRA
FT                   GVSGAVNNHFLERFGAAIMMTIIGGSLQVAANAAQNSAGNTYLEYMNSSTNQIANTTLQ
FT                   HTIDIPPTLTKHQGENVSIFVARDLNFSKVYKLSVVSP"
FT   gene            60506..60826
FT                   /locus_tag="Acry_3529"
FT   CDS             60506..60826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3529"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29129"
FT                   /db_xref="GOA:A5FU47"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU47"
FT                   /protein_id="ABQ29129.1"
FT                   /translation="MREGWRTRLDRLTQAGQRLNRHVEKTVVKYVEWQDRRHARRRQKF
FT                   LRQGWLYSTLLGLWLVLIILELLGHQSAAVIHSSAGLGLIFLALKIWHSAMVIRAKKRG
FT                   EL"
FT   gene            60823..61890
FT                   /locus_tag="Acry_3530"
FT   CDS             60823..61890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3530"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3530"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29130"
FT                   /db_xref="GOA:A5FU48"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU48"
FT                   /protein_id="ABQ29130.1"
FT                   /translation="MNGTDFSDDLVAESPAAPLLRFLLAPLQPWLNDGATEELCINRPG
FT                   ECWVRQRGVFERFKVPLDRSALEDIAVLAGALRRQDVGPTSPLCSTELPGGERLQICLP
FT                   PAVPTGTVSLTIRRPGSTVAPLSSVTSRYQSDGWNSWAENRDTRNFAEALDYYDSGDLE
FT                   GFLAAAVRCRMTILLCGATGSGKTTMSKTLISAIPMAERIITIEDTAELVIPQPNHVRL
FT                   LYSKDGLSTAKIDAEALLQASLRMRPDRVLLQELRDDAAWTYVNEVVSGHPGSITTIHG
FT                   ANPAQAFKKLFSLIKGSPKGASFDDATLCDLLAAAVDLIIPFETSGTTYRIGKVWFGPD
FT                   ATRRGETAAALLRAA"
FT   gene            61890..63710
FT                   /locus_tag="Acry_3531"
FT   CDS             61890..63710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3531"
FT                   /product="TRAG family protein"
FT                   /note="PFAM: TRAG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3531"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29131"
FT                   /db_xref="GOA:A5FU49"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU49"
FT                   /protein_id="ABQ29131.1"
FT                   /translation="MTWRGVMRLLVGLVLGLVFFSVLATMIFLIGTGLFWHFRHPFWQW
FT                   WLYLFEASGDPTVRVWLVISGVPAFAIPFLAGVVQLVRGRRVTGWSLRRDHAPTKPVDA
FT                   PIRAPTDNHGHARWMTMEEARARFPGPAPEYGGLVVGEAYEVHRDSVASMPFRPKDRST
FT                   WGQGGKAPLLIDPCEIGSTHCMMFAGSGGYKTTTAVSTLLTWTGSAIVLDPSVELGPML
FT                   RQAREDMGHKVYMLDPRTAREVGFNVLDWVDVSSPLAEIDVQAVVEWVCGDTKAGGDEN
FT                   ASFFKNSGKELVTALLAHMLWDEHLEPHEKTLRAVRAAIVTPEKELRNVLAHIHKNSQS
FT                   RLARDLAGSLKDIVDETFSGIYKNATQDTAWLSTAAYADLVSGNAFRCAELTLGKTTVF
FT                   INIPLKALDATPAVARVITGALLNAAYEADGVIEGRVLFLLDEAARLGPMKILETARDC
FT                   ARKYKITLFPFYQSIGQLRELFGQNGPAKWFESVSWYGFAGVKTKAVAEELAAAIGEYG
FT                   VLAWSEGSNTGNSAKGLEAGTRSTGQTKTYHELKRQLIRAEEIMHDMRDDEQIIFPKSG
FT                   RPLRCGRAIYFRRPEMAARVGENRFAVNAT"
FT   sig_peptide     61890..61964
FT                   /locus_tag="Acry_3531"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.932 at
FT                   residue 25"
FT   gene            complement(63838..64320)
FT                   /locus_tag="Acry_3532"
FT   CDS             complement(63838..64320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3532"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3532"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29132"
FT                   /db_xref="GOA:A5FU50"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU50"
FT                   /protein_id="ABQ29132.1"
FT                   /translation="METVDLDQFDRALLSKLQVNNQTSARVLADQVGLSESAVLRRLRR
FT                   LRRSGVIVADVSIVHPAVLGTPLTIHVLVSLEREGIAALDAFEAKLRGRDEVKCAWYAT
FT                   GEADFVLLLQVSGVGAYERFARDVFHNDPNVKGFQTIIALREIAGLSNRSLSVCGV"
FT   gene            64386..65438
FT                   /locus_tag="Acry_3533"
FT   CDS             64386..65438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3533"
FT                   /product="Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3533"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29133"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU51"
FT                   /protein_id="ABQ29133.1"
FT                   /translation="MKTGMIMVMNATTETPRTSGIASDLARLSPDYAPTPLLELPALAR
FT                   RLGVAQVLAKDEGCRMLGSFKSLGGTYAGLRALARAANTDIAALIATRPGGQPTLVCAS
FT                   DGNHGLAVAAAARFAGASARVYLHSSVPQSRAKRIEAQGAEVIWVQGTYDDAVHEAAEA
FT                   ARNEVGILVADTTDDPNDPVVRDVMAGYGVMAAEIRAQVEAAGHARPTHLFVQAGVGGL
FT                   AAVMAKGLGDWLAAPGRIIVVEPETAPAVAAALTAGTIIRVQGDLETTAEMLSCGEASA
FT                   PALETLRRHRVEAITVSEATLDEAPLLLRDCGGPATTSSGAASLAGALARPGLPADARV
FT                   LILVTEGVPA"
FT   gene            65435..66604
FT                   /locus_tag="Acry_3534"
FT   CDS             65435..66604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3534"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="TIGRFAM: amidohydrolase; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3534"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29134"
FT                   /db_xref="GOA:A5FU52"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU52"
FT                   /protein_id="ABQ29134.1"
FT                   /translation="MMTDDAFWAELRAWRRDFHAHPEFGFEERRTSRLVAERLRSFGIT
FT                   DIVEGVGGTGVVATLTRGSGNRAIALRADMDALRIEEKSDLAYRSQVPGVMHACGHDGH
FT                   TTMLLGAAKLLAAEGGFDGSVRFVFQPAEEWGKGALAMLADGLTERFPFEEIYALHNKA
FT                   GLPVGKFQARVGTTMSAEDNFEIVLRGMGGHASRPQDGREVLVAACALVVNLQTIVSRR
FT                   VAPTDSAVVSVTELLTDGTRNALPSTARILGDARSFQTVVSETIEAELRRIATGTAASY
FT                   DVGCDVTYTREFVPTVNDPVATAAALAAARTVLGEENVTLADQPGTGSEDFARFLQHAP
FT                   GCYAFIGNGEGSVPAHHPEFDFNDDALPTGTGFFVQIVRDRLATRPTQP"
FT   gene            66601..67914
FT                   /locus_tag="Acry_3535"
FT   CDS             66601..67914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3535"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="TIGRFAM: amidase, hydantoinase/carbamoylase family;
FT                   PFAM: peptidase M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3535"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29135"
FT                   /db_xref="GOA:A5FU53"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU53"
FT                   /protein_id="ABQ29135.1"
FT                   /translation="MTGPRINAERLLGRLRTLGNIGRDEGRLTRLAASDSDRAGRDAVV
FT                   GWMHDAGLEVMVDRIGNLFGIWHAGDANSAPLMLGSHIDTVIDAGIYDGCYGVVGGLEV
FT                   VQTLREAGVKPDRPVVIAAFTNEEGVRYAPDMMGSLVYAGGLGVAEALATVGTDGTVLG
FT                   EELARIGYAGPHEPGFLRPHAYLELHIEQGPILDREGVAIGAVENLQGISWQRVTIDGV
FT                   ANHAGTTPMAMRRDAGQAAARVVTFLRDLISQTNAPTVATVGCMAFEPNAINVIPSRAV
FT                   FTVDLRDPDEDRLRAAEATLARYLESLADAEGVTVVVERLAQFDPVTFDPAIVAAIEAA
FT                   AAENGLRSRRMTSGAGHDAQMIARLCPAAMIFVPSLKGISHNPREHTQAADLQAGANVL
FT                   LDVIRKLTHVASGEARSFSQQNSKLGFAYDDSFTKEGI"
FT   gene            complement(68011..69267)
FT                   /locus_tag="Acry_3536"
FT   CDS             complement(68011..69267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3536"
FT                   /product="UMUC domain protein DNA-repair protein"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3536"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29136"
FT                   /db_xref="GOA:A5FU54"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU54"
FT                   /protein_id="ABQ29136.1"
FT                   /translation="MPTFGLIDGNSFYCSAEQAFAPELRSRPLVVLSNNDGCAIARTPE
FT                   AKALGIKMGEPWHLFRKRPESRAVEWRSSNYALYGDMSRRVYDVLTERVPQVEPYSIDE
FT                   MFLDLDGIPDLDRFCRDLRRDVRQIAKIPTCVGIGPTKTIAKLANKIAKKETALGGVCD
FT                   LRDPELRARHYERLPIAEVWGIGGQVGAKLAAAGITTIADFVRADPRAVRDMLTVTGAR
FT                   VQTELRGASCLPLSLMAPTRKGIAVSRSFGHMIDRPAELREAICTFAARAAEKLRAEGL
FT                   EAGQITVFTHTNPHNGDPWYSAQRQGKIEPTADTGLLIGEAIRLLRAVWHPGYRYFKAG
FT                   VMLQDLAPARRQAVLFASFDRDQSAAAMKAMDAINARFGRGTLRIASTATSPSWGARRQ
FT                   NLSPRYTTQAGEMLVANSF"
FT   gene            complement(69273..69662)
FT                   /locus_tag="Acry_3537"
FT   CDS             complement(69273..69662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3537"
FT                   /product="SOS response UmuD protein"
FT                   /note="Serine peptidase; MEROPS family S24"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3537"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29137"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU55"
FT                   /protein_id="ABQ29137.1"
FT                   /translation="MEVYMGSYTGGNTTGFVSPAGDSLEGPIDLSEILDLRRPSRYPVR
FT                   VAGDALTSRGIFSGDILIADAATPPAPGKVAVVMLAGDVLVAQLAWRNGQWQLLSGRAG
FT                   TEPLPVEGDDAEIWAVITGLVRTQV"
FT   gene            69707..70417
FT                   /locus_tag="Acry_3538"
FT   CDS             69707..70417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3538"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3538"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29138"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU56"
FT                   /protein_id="ABQ29138.1"
FT                   /translation="MCGRFAAFQPVEAIRKLFGAVNSAPADARPSWNIAPSQRALVVRR
FT                   HPETGERRIDLLSWGLVPHWTKDLKEARRPINARAETLATSPMFKPAFASRRCLVPVDA
FT                   WYEWQVTPDGKRPFAFARTDRATMAFAGLWESWVTPGTGKVLRTFTIITTSANAMAAPV
FT                   HDRMPVILDADDWPLWLGERTGEPAALLRPAPDMMIEAWPVGRSVNSPQNNGLELLSLL
FT                   AEHKDLYLTNPADG"
FT   gene            complement(71277..72293)
FT                   /locus_tag="Acry_3539"
FT   CDS             complement(71277..72293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3539"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29139"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL3"
FT                   /protein_id="ABQ29139.1"
FT                   /translation="MDVLAREDLPFPQSLPEFQRIFPNDAACAAYLESARWNGGFACPR
FT                   CGVVGEPFRFEARPGVLRCRACRKDVSLMAGTVMERSHTPLSTWFWAAYLIASQTPGMS
FT                   AVQFQRQLGLSRYETAFGILHKLRAGMVRPERDKIGDTPQEHVEVDETWVGGRTRGDGR
FT                   GVHHKVLVACAVEVRHRKPGTKLDNRKDGRYAGRVRLAVVPDRSANSLCGFVENAVAPG
FT                   SLIVTDDWSGYAGLGRRGFDHHAIAECGDPEVAEEFLPIVHLVFTNLKTWINGIHHGVS
FT                   AKHLQAYLNEFTFRFNRRLYPFNAFRSLLGIAGRAAAPTFDELYSGEWTHPTFSGCG"
FT   gene            72734..73360
FT                   /locus_tag="Acry_3540"
FT   CDS             72734..73360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3540"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29140"
FT                   /db_xref="GOA:A5FU58"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU58"
FT                   /protein_id="ABQ29140.1"
FT                   /translation="MMGSGVAHATPSLDFSVQAWTAQTPNSGSASSNQQALPSNPIISA
FT                   TNAFFTGNFLGLPNWQDNSQNTNTLNDFTNNLTGFSNVKYYNGNSGTTVLSTGGFGSAT
FT                   LFDLTFTLNHTLSATVTHDDGFSLWNATNTGNALFNYAHPTSAVPDSISVGPGTYNLWY
FT                   LEANGAPAQLTFSNVKVPEPGSLLLLGTGLVGLGLILRRRRSRTA"
FT   gene            complement(73588..75783)
FT                   /locus_tag="Acry_3541"
FT   CDS             complement(73588..75783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3541"
FT                   /product="ATP-dependent DNA helicase, RecD/TraA family"
FT                   /EC_number="3.1.11.5"
FT                   /note="TIGRFAM: helicase, RecD/TraA family; SMART:
FT                   Helix-hairpin-helix DNA-binding, class 1; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3541"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29141"
FT                   /db_xref="GOA:A5FU59"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU59"
FT                   /protein_id="ABQ29141.1"
FT                   /translation="MGNHFIATAPAQTPDREVLAGLVERVTFHNVENGFCVLRVKARGH
FT                   RDLVTVIGHAATISAGEWLTASGEWVNDRVHGQQFRARFLRTSAPTTAEGIERYLASGM
FT                   IRGIGPVYAKKLIRAFGETVFDVIEAKPERLREVPGIGAVRAGRIVNAWAEQKVVREIM
FT                   VFLHSHGVSTARAVRIFKTYGADAVQVMSENPYRLARDIRGIGFRTADAIAEKLGIARD
FT                   AMIRVRAGIGHALATAMDDGHCGLPAGELVSLAETLLEVPAPLIGTALDLELAEGTVIA
FT                   DQVAGTDCVFLAGLYRAEQGIAERLRIVASGATPWPSIDADKAIGWVESHLGMNLATSQ
FT                   SEAVRLALTAKLLVITGGPGVGKTTIVRAILRILAAKSVRILLAAPTGRAAKRLAETTG
FT                   GEAKTIHRLLEVDPASGSFRRGVDHPLECDLLVIDETSMVDVPLMHALTRAIPDEAALL
FT                   VVGDVDQLPSVGPGQVLADLIGSGAVPVVRLTEIFRQASASRIITVAHSVNRGEIPDLG
FT                   RADPESDFHFVAADEPETAVERIVELVKTRIPHRFGLDPIRDIQVLCPMARGGVGARSL
FT                   NITLQAALNGAAEPRVERFGWTYAPGDKVMQIENDYDREVYNGDIGFIARVDAEAGEVG
FT                   VGFDGREVVYGLGELDGLVPAYAATIHKSQGSEYPAVVIPVLTQHYVMLQRNLLYTGIT
FT                   RGRRLVVLVGSRRAVAIAVRNVSGRRRWSKLREWLSG"
FT   gene            complement(76117..81168)
FT                   /locus_tag="Acry_3542"
FT   CDS             complement(76117..81168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3542"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3542"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29142"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU60"
FT                   /protein_id="ABQ29142.1"
FT                   /translation="MADHLMTMTLPGFEQDMAAYYQRGMTVEGGLWQPGTAAAEDNAAA
FT                   TATDAARPGTIPEPRRDMHPTVAAALGIDTSRPLTRDEIAELLAGNRADGEKIAGKQYQ
FT                   RAVTPLAEVFGLDPMRLPTRAELENLLAGKRADGFDLPAAPVEAAPAITPQTAAPEAVE
FT                   AHEAEDRDAALAAEAAALGELGSAADGPPPWPEDFVPPPMEEVAGYDRDAALAADWQAD
FT                   IARGGEPAVPPRGPAAEDRPAEPRAIDVAAALDAAGVPYRTSGGRLRLQATWRGVESWT
FT                   VSVNATTGQWTDFAASEGGRFESLVRRLGVKAEAVELDPEAAKAARTAEIRRNVFRKSI
FT                   AGKLWDEAIPGTGELHAPSLHGSAGQKLQQRTAHAARVDEAAALRASARAYLSGRGLDD
FT                   DWLMSHVRLVRPHPNYDAAEVAAGAAVVMLTPMFGQDEDGRVRLTGVQRTYLTEGGAKI
FT                   GRRMLGASGAWLLHPPAGAAVPIGGHDQARVAGEGFETVASVVQATRQAGVVGYNAGGL
FT                   VAWAGQFSGSTPVVLLADRDNARLHNGRDVGEAGQKAAAKAAALIEANGGEAVYLEPPA
FT                   DVAGGAKGADWADALRESGAAGLRRALATAEASSAADRARIEAKLSSASPGAAPDGPSA
FT                   QETEQGQPAPHPELVRLYKALEAKDGRGLSETERANILEGKRADGTALDAADWRNAVNR
FT                   SKTPIGYVDFTFSADKSVSLAWAFAPTEAERNQLAQAHKDAVAATMAEIEQVIGQARKG
FT                   KGGKEGTEQGRIGWITFDHYTARPTIEIARQTADGRTETEIVSVKVAGDPQLHTHVAVP
FT                   NVIVTESGRVVSLNTLQMHGRIHEWGAIYQAHLAQNLRRAGASIELDRTTGAARLSAVP
FT                   EEIRAAFSKRTRDALSDAKAYAASLGADWDRMTGDERIKLLKGGAFASRSAKADDLSDF
FT                   ASWRRQAEARGYQHKSVLQNAAPAEKMTEAARLDRAYEAASRVLGEQFARRAVIKAEDE
FT                   RVAAARGLVAAGIKDGGDVDQVIARLRARGVVETGGAGGNGESARTQIIAVETERDDPE
FT                   NPDVTITTTRLTTRAHVEQESALVELAGQAGRDRRGTLNPVQIKRGIEASGLSFTGAHG
FT                   AAQRRMIDHLGMGGRFSVGIGAAGAGKTTLLKPLVTAWREQGADIHGISLGWRQARELR
FT                   EAGLNTDTDTEAGGRDTIAAVSVFINRVESGRLDLSSRSVVVIDELGTIGTRQMLDLLR
FT                   LQERHGFRMVAIGDPKQCQSIEAGQVIGLLEKGLGKVPSIESSVRQTNERAREIAGLLR
FT                   KGGAEAVGKALDMKRQDGTAEIIAGGHGEVIARAAALWDERRKANVDRPRFTISISTPT
FT                   NQDARAIGEAIRQRLLASGELGQSRMTLAAIDKNTGEHYALPIATGEKIRLFARTNAAM
FT                   LDGGKGAIGDNGSILEITSIRDEGLVLRNDHGREGFVKWDTLADKETGRMRLAYGYAMT
FT                   TNTAQGITTTEHIFVTPGGSQTTDGFKTYVSGSRHRERDYWLTSEGAERQEIAGRRPLG
FT                   DPRPIREHDIWTNWTRNIARQPEKTNALDLVKIGEEARRNAARAFLKGLAADEKREAAG
FT                   LPSDLSQRFARTQARAGTQSRLTETMARAVEDKGQALARIERAAPAVRAAVAAGWERAR
FT                   PLIEAAHRSARARLQKALEGHRRQAQRQAEERPVEQESRKRGRGR"
FT   gene            complement(81216..81554)
FT                   /locus_tag="Acry_3543"
FT   CDS             complement(81216..81554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3543"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29143"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU61"
FT                   /protein_id="ABQ29143.1"
FT                   /translation="MPEPEAAPSPRKDDRLDAVIQAMRLMIETQNTHSQMLARLIELAT
FT                   PSEESPLEEALAGIAGALRDQTTALLQIGTTLDGLGAEVEAGVMRGLATALEPDDDGSQ
FT                   SEAGGETC"
FT   gene            81761..82492
FT                   /locus_tag="Acry_3544"
FT   CDS             81761..82492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3544"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29144"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU62"
FT                   /protein_id="ABQ29144.1"
FT                   /translation="MPINCRVIDGRCRPPLSSRAMANTPPPEIDLDDLRRHMVEHGARS
FT                   PIVQWMVANHDEFAAAVAVAGIRWEKVAAYLAEHGLRTARGGIPSGETMRRCWIRARRM
FT                   VAKQRDGQRQTAVPPADQPAPEPKFKPFTLRNEGRGGSAAERQALGDATAPADQAAQPT
FT                   PKFQRSWMRNEGRGTSAAEQPAPDHPAALAAPEPPPKPKFEFVRLRNEGRGVSAAERRT
FT                   LGDPTAPADPDDPKWKGDKSR"
FT   gene            82502..83392
FT                   /locus_tag="Acry_3545"
FT   CDS             82502..83392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3545"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU63"
FT                   /protein_id="ABQ29145.1"
FT                   /translation="MTETPSSEKKPTGTQKHATPVFRPGSAAAALKPVEIKPLLTSEQT
FT                   RSEPVAQGIDLADRPKIILAAGRGKTGKTTFLRWAVEMAQHAGRNILMADIDPTNATFS
FT                   TYFKGAARPDTFNQEAVRDWLQDFMEFAIVGKHTAIIDLGGGDTILRTLAAEMPGFDAM
FT                   IEEAGMAVVMFYLAGPHPEDLTPAATLGALSFKPRARAFVLNEGVAPAGQSRDQAFSRV
FT                   ISSNVYRDETAAGAVPLWMPRLHAAEAVERHTASFVAARDGHTEPPLGVFNRSRVGHWL
FT                   KAMDEQFAGVKSWMP"
FT   gene            83629..84093
FT                   /locus_tag="Acry_3546"
FT   CDS             83629..84093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3546"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29146"
FT                   /db_xref="GOA:A5FU64"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU64"
FT                   /protein_id="ABQ29146.1"
FT                   /translation="MAQTIDQAFQAAKVQAEAAHADLSRQFVASFAKEAEQRLKSMSRW
FT                   VWWRTIASGAALAIVILALGYGLGYWHGNAAGYSQAAGTIHAAGAVEQSVLASQGPAGL
FT                   AQWHKLMRDNTILDTMKSDCSGKNVAHQDGRTACHLWLWTTPNVAPAAHG"
FT   gene            84098..84418
FT                   /locus_tag="Acry_3547"
FT   CDS             84098..84418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3547"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29147"
FT                   /db_xref="GOA:A5FU65"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU65"
FT                   /protein_id="ABQ29147.1"
FT                   /translation="MEEHFTPSADRSARSAGFTSQLSRVLLGLLRGALRFLLVAVLDVV
FT                   ILAVRLRLAAFALGTGFLMMTLSRASLLLNDRLRFCQLQLHAWAQGWPMKRYAFTALPP
FT                   RR"
FT   gene            complement(84795..85472)
FT                   /locus_tag="Acry_3548"
FT   CDS             complement(84795..85472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3548"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29148"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU66"
FT                   /protein_id="ABQ29148.1"
FT                   /translation="MQYPPVPAVEDIAQHFMRAVRQSERGDWPYRHWKLRDVLPLDVCT
FT                   GILTLPIAPPMLGLTDGTRNTYNDSRCFITPALRRKYPGCEALAQALQRPDVAALMAEI
FT                   CDIQANGSYLRMEYIQDLDGAWLEPHRDIKEKLFSMVIYLFLGPDAAEWGTDIYDADKR
FT                   WVGQSSGEFNSGTIFIAGPATWHGFDPRPIVGVRRLMEINYVSADWRDRQQLAMPEAAI
FT                   QVW"
FT   gene            complement(85472..86161)
FT                   /locus_tag="Acry_3549"
FT   CDS             complement(85472..86161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3549"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29149"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU67"
FT                   /protein_id="ABQ29149.1"
FT                   /translation="MTDTSAPFKMLDEAAIAAAALRRDPYDYCFVENAMPQRLKEEVLG
FT                   DAPTIPERGSYALPDLQHGPHFGAVVQDLMSDRFRHLVEAKFDIDLSKRPACIVMMGNT
FT                   SGHYNEGYAHPDSPHKIITVLVGFTRAWPYERGRLRVLRSKNRNDYAFEFAPEFGHMLM
FT                   FRVSDHSWHGFLPQKGQRKSLQLCYVDSEWYVRKEYARHSLSAYAKSVPLLRKAIDWAP
FT                   RRLPGGR"
FT   gene            complement(86218..87280)
FT                   /pseudo
FT                   /locus_tag="Acry_3550"
FT                   /note="hypothetical protein"
FT   gene            complement(87820..88932)
FT                   /locus_tag="Acry_3552"
FT   CDS             complement(87820..88932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3552"
FT                   /product="CitB domain protein"
FT                   /note="TIGRFAM: CitB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3552"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29150"
FT                   /db_xref="GOA:A5FU68"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012830"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="UniProtKB/TrEMBL:A5FU68"
FT                   /protein_id="ABQ29150.1"
FT                   /translation="MPEIDPLVEVRRAAEICNACRFCDSYCAVFPAMELQRAFSDGDLR
FT                   YLAYLCHNCRGCYYACQEAPEPIDINLPRSFAELRDESHSRFVWPGLFAPLFRRNGLVV
FT                   SVTCLVSIMLVFLVTLLSLPPGGITHARSGPGAFYQVIPWVLMASIAGGSLLFSVFALA
FT                   VSGVKFWRESGRKGKAAKLTVILHALRDIATLQNLGRGDQDCSDHDKSFSILRRRFHHA
FT                   MAYGFLLCFLATSTATIYAHFFDQPAPYPLFSLPVLFGMIGGIGLTIGTSGLIWVKIIS
FT                   DPAPAVARLMSTDLALLGLLWLAAMTGLLLLAMRSTAAMGVLLALHLGTILALFLLLPY
FT                   SKFVHGLYRSLALLRAAADRSQLDPNNCSP"
XX
SQ   Sequence 88953 BP; 16740 A; 28209 C; 27056 G; 16948 T; 0 other;
     tgggccgcac gaaatcggcg ccgccaacca tgagaatctt acctaaactg ggcgcttctg        60
     aatgatacaa acgcccagtt ctttatcggt agaagcggtc gtttcttgcg ctcggtcgag       120
     ttaggatgag cgcgaggata tcgggataca aggggaactg cacgggttgt tgccttgcgg       180
     tcactgcgac gatttgttct gggcgacggc caagtgggtc aagaagcgct taaccagggc       240
     tgtagtagag tgttcgacta acggttaggc cgatctgctt cggctgtcgc caagcggcat       300
     ggactcgccg tcgaggtacc gagtggtgtg acacgcgcgc gatcaatacc catgatcggg       360
     cggcggtact ccaggcattt gggatcacgc tattcttcct gtcgaattgg tcaggcgtgt       420
     cccacacggt cagttgccgc ccacacgtta attaattttg gtccttcaag gttgccagat       480
     aggcgatcac attcgcgcgc ttctgtgcat tcggcatgcc catgtaaggc atcttggtgc       540
     ccggcacggc ggcttgcggg ttggtcaaga atttgtccag tgcggccgcg gtccaaacga       600
     tgtgggcgga tttcaacgcg ggcgagaacg ggaatccggc cacgctcgcg gctggctttc       660
     caaagacgcc gtaaaggctc gggccgatgc cgttttgccc ggcgaccacg ctgtggcatg       720
     cggcgcattg tgcgctgaag atcgacttgc ccttgaccgc attgccatcg ggcatgccgc       780
     cggccagagc aggcgccggg aagaccggga gtgccgctgt ggcaaaacca gccacgaaga       840
     cggcgacgaa tgaaacgagg gcgatacgat taaccatggg aaagcctcct gcagaatgtg       900
     cctctagagt ggcaccaatc gattcagaac gccacccaca ttccagcgaa caacgtttcg       960
     ttgcccccct caccgcgccc ggcgtcgtcg tagttgcggg caagccaatt gaatgtcgac      1020
     tatatcgtat cttcaatgat gaatttcgca tttgcccaag ggcaaccaag cggatccgcc      1080
     gttgttgaac gggcagtagt cgttcttggc ggtccaattg ttagtattgg atttaccgat      1140
     cgcgttggcg tcgatcaaag atgcggtgca gaacaccgga tcggctgacg tcgttgaaag      1200
     tcggcgtcgg aacacttccc agcgcctcga aatacctgtg tcgtataaga actttcgccg      1260
     attcagagcc ccgatggacc taacgcttga ggaatccgca cctagatgcc gtaatgggcc      1320
     gagtgcctgg cgctaggcat atttcggcat ctaggtcagt aggggagaca ctcattccat      1380
     ctaaaatgcc acccacattc cagcgaacaa cgtgtcattg gcaccggcac tacgaccgaa      1440
     gccgtcgtag ttgtgggcca atccattaaa cgtgggataa accgtatcgg tcacaaataa      1500
     tttggcgttc aaccatggca gccacttggg tccgccatta ttgaacgggt agtagtcaag      1560
     ctctgttgtc cagctattcg tgtctggctt tccatttgcg cttccaccaa ttggtgatgg      1620
     tgcgtacagc agcggatcag cgttaccata aactgtgcgg aaagattcaa taacaccgta      1680
     tttttgaaat agaagctcag agacactaaa tgttagtata tctagagtat cggaaggatt      1740
     tgcagtaatt ccgagcggat agcttgccct ccaatcctgc gtctcgtgaa caaaatttgc      1800
     ttggatcgaa agtgcctgct tcgctgtgat gtactggaat tgggagtcag cggcgacgtc      1860
     gaggattcga tcggtaggtc cgttgagcct gcccgatggg taggggcggt caaataatgc      1920
     gtatgacccg acctcgaacg agttgtttgc ccaagtgtgc tggaacgcaa gcctgacata      1980
     tggaatgacg ccattaacgc gcggcgctgg accaaccccc agtgcgtagc tgaggtggtt      2040
     aggaagcgac ttgtaaaggt cggcttcagt gtaaagcata tctgatggcg tgatgttcaa      2100
     ggcgccgtac gcaccaatgc cgtagacttc gccgcctaag gcatctatct gatcatcagc      2160
     aacgggtccg ggttgcacgt ttgagtggat atacgggaag ccccaagcag gtattgtgtt      2220
     ccacaggtcc gtgatggtcg gggcattgtt gaacgtaagg ccataaaaca acggcttccc      2280
     gaacagcgta gcgggatgtg caaaccggat atccatacca tcccagtgaa cactctttga      2340
     tactccagaa taggttgcct gaatgaatgc gcctagccca agttgtgcat cgagagcacc      2400
     accatagaat aggcttgttt gctgcggcac cacaacgtcg ttagatttga agctcggacg      2460
     tagtcctccc ggtattttgt cgtgcaactg ggtaaaacct atttgagcag cgatggcaac      2520
     gtttttccat gtcggaaatg ttccgccggc aatatatccc tcaagtttga aatcacgacc      2580
     gtacggagtg agttgaggaa agccgatatg acaggccgag cagggttcgc cagtctgcgc      2640
     cgcaaaggcg ggaatcgcgt aggcagcgcg aggtaccgca agccaggatg cggcaaccat      2700
     gcctgcggcc gcaagccgcc aggaatagcg atgtgaccaa gtcttcattt acagtccccc      2760
     gtgatttcaa acaggcggcc cttcctcacg tgtgccaaga tggtcgagac gctggcaggc      2820
     cgcgccatgc cagcgacggg gaagggccgg agcatctctg cctgaccatg atagaggcgc      2880
     gcgagatcga cgggaatggc gaatgcgcgt cgcttttgtg gcgcccgctt accacgatcg      2940
     aggccaacga cgctgccggt gccgccgaaa tcgtacggct ctaccggctc taccggttga      3000
     ggtggagaat cgaggaagtt ttccggtctt tgaaaagtga agccctcagg ctcaaagaaa      3060
     cccggctgca ggacgccaga cacctgttca agctggccct gatcggtctt gccgcaaact      3120
     cccgcaccgt ccagctcgtc gatgcacgca acggcagcga tagaccggca accgacatca      3180
     tcgatcccgg actgctcaca gcagcggatg ccatcggccc gccgctcgac ggcaaaactc      3240
     caagacagaa aaactttcat ccaccccgat ccctcgcgtg gctcgcctgg attgtcgccc      3300
     gcctcggtgg ctggaactcc tactacaagt cgccaggtct caaaaccatg cgcgcgtaac      3360
     ctgggtagtt acaatatgtg agaatgcgtc gacgcgcctt gatctaaatc aaggcgcgtt      3420
     cgtcttctgc atgttgacaa gatgcggttg tcgctgcggt gcggcatgga aatcgcagga      3480
     gtgatggctc atggcggaga cggaattccc ggttctgctc gcgaccaatg tgttgggatt      3540
     gcttcccgcg ccggctctga tgcgtgctac gattttgctg atgcgccggc ttggccgaac      3600
     acatccgcgg ttgttccgcg ccctcgcagc ccataagccc tgcacgatcg gtatcgagcc      3660
     gaccgatctg cggcatcgat tcgtgctccg cttcggggga gggccagcat cactggtgcc      3720
     gacatcgacc ttggagcagt ccttgaatgc ctgcgtgagg ggccggttag cgacattggt      3780
     ggggctgctc gaaggccgac tcgacagcga tgcgctgttc ttttccagag aggttgtcat      3840
     tacaggagac attgaggcga tcgtcagctt gcgcaacgca ctcgatcgcg aaaccgtcaa      3900
     tgtattcaaa gcggcaacca cactgttcgg accgggagaa cgtgccgccc ggcgggtggc      3960
     actcatgctc gagcggcggc tcaccgctgc gcatcagcgc ctaaccatgg ggcacgaagc      4020
     gctgcatacg gcaagacgag aagaacatcc cgtcaccgcg tattgcgaac gggtagaggc      4080
     agagttgcag gcattgagaa cgcgcatggc caagattgaa gcgcaaacga ggcgtcggaa      4140
     tcccatcggt gcggtgacat gacacgctat ctcgaactgg tctgtccggc gggcactctt      4200
     gctgccttgc gcgtcgcggt cgacgctgga gccgacaccg tctattgcgg tttccaggac      4260
     tgcacaaatg cccgcaacta tcctggcctg aattttaccc gcgaagattt acacacgggc      4320
     atcagctacg cccatgcccg cggttgccgc gtcttcgtcg ctgtcaacac gtttccccga      4380
     gccggcgacc ttggaccatg gcagcgcgcg atcgatgatg ctgcttcatg cggcgcagat      4440
     gcggttattc ttgccgatct cggcgtgctc gattatgcgt cgcgccgcca tccaaactta      4500
     cgacggcacc tctcggtgca ggcggccgca gcgagtccgc tcgggatccg attctaccgg      4560
     gacatctttg ggatcagccg tgtcgtgcta ccacgcgtgc tttcggtcga agaagtcacg      4620
     tcgttgatcg gacaaacagg catcgaggcc gaggcgtttg cctttggcag ccttggcacg      4680
     atggtggagg gccgctgctt tctctcctct tatatgaccg gccggtcgcc gagtagcgac      4740
     ggtgtctgcg ctccggccga gtgtgcttcc taccatgagg acggggatcg cttggtctcc      4800
     cgtctcggcg aagtcatgat taaccgattc gcgcacaatg agccggcagc ctacccgacc      4860
     ccctgcaagg gtcgcttcct agtacacggc cgtccgagtt atctgtttga ggagccgacc      4920
     ggtctcaacg ttatcccgct cctcgcggaa ctcaaggcgg ccggggtaac tgccttgaag      4980
     atcgagggcc gccagcgcag tcgcacctat gtggccaccg tcgtcaccgc tttccgccac      5040
     gtcctcgacg cgcttgccga gggcgcgccg acggcaccga ttcccgccgt gctgcgtgag      5100
     gtcgccgaag gaggacgcga gacattcggc gcctatgcga aaggctggcg atgagctgtt      5160
     taaccttggg gccgttgcag ttccactggc ccgcggcgcg taggcgggat ttctacgctc      5220
     gtatcgccga cgaggcgcct gtcgagtgcg tctatctcgg cgaggtggtt tgtagcaagc      5280
     gtctgccttg gttcgagaaa gacctaccga agatcgccga gcgtctgcgt cgagcaggaa      5340
     agcaggtcgt gttctcgaca ccggcgttga tcatcaccga tcatgaggtc gcgatgatcc      5400
     gcgcgctctg cgagacaggt gatctgatcg agatcaacga tctcgcatgc ctgcaactgc      5460
     taaatgggca ggcattcgtc tccggtcctc tggtgaacgt tttcaatgaa ggtgcactcg      5520
     atgtccttct ccgtctgggt gccatgcggg tgaacgcgcc aatggagcta tccattggcg      5580
     cgattgccac gttggcggca cggaaccaat cgagtgaggt tgaagtgttc gttttcggcc      5640
     gccaaccgct ggccatctca caacgctgct atcacgcgcg cgcacatgat ctgcataagg      5700
     ataattgcca gttcgtctgt ggccaggatg cggatggttt ggagatcgca cagcttgacg      5760
     ggcgtccact gctggcaatc aacggcacgc agaccctttc gcacggccat gtcgctctgc      5820
     tcgaagaact caccgatctc caggcagcag gcgtcaccca tttccgtctt tcgccacacg      5880
     cactcgacat ggtcgaaatc tccacacttt accgcgccgt gctcgacggc atttatgacg      5940
     cgaaggaggg gctcacgcgc ctgcgcgaac tcaccgcgca gctgccgttt gtcaatggtt      6000
     atctgcatgg gcgcgccggg atggactggc agcctagccg ggcaggatag aggcaatagc      6060
     agcagccttc cggacaccac atttttggga tctaccaaac cacgggaagc attctgagta      6120
     tggactgtag tggcagagtt atcagtaaaa gcttcgggcg gatgaccggc ggaagcgaac      6180
     attacattgt catcgaacca cccgctgatc tcgacctcac cgagcagctc gcctgtcttg      6240
     agcaacgtta tgatgaaaca cggcaggagc tcggtctgcc ggccggcggt tccgtgttcc      6300
     ggcgattgtt cgtcagcgat gcgatgaacc aggcaccttt gctgcggcgc agccgtttgg      6360
     cagaggatga agatggctct cctgtggcac tgtctatcat ccagcagccg cctctctcag      6420
     gaaccaagct gtcccttctt gcctatcatg tcagcggagc tctcgatctc tccaagcgcc      6480
     ggcttacgcc gcggcatgtc gtggtcgaaa aaaatggtct tgcccatctc tggacaacag      6540
     gtctttgccc gggatcggac gataggctgg ttcctgtgac acaacagaca cggcggatgt      6600
     tcgacactct tatcgatggg ctcgatggtc tcgggggcac cctacacaat aattgcgtcc      6660
     gcacctggat ttacgtcaag ggcatcgacg tattctataa ggatatggtg acaagcagga      6720
     gtgagatgtt tcttgaacag ggtctgtcgg cagagacgca tttcattgcc agcaccggca      6780
     ttgagggtgc gtgcgcacac agattcgata tagtaacgat ggatgcctac tcgatcctcg      6840
     ggcttgcacc acaacaggtg tcctatctca atgatttcga tcgtctttgc ccgacgaggg      6900
     actacaacgt aaccttcgag cgtggcaccc gcattgcata tgccgatcgc gcccatctct      6960
     ttatctcggg aacggccagc attgatcgct ccgggcaggt agttcatccc ggaaatgtga      7020
     tgcgccaatt cgaccacgcg ctcgacaatg tggaggcgct tttgcgcgcc ggctcggcgg      7080
     gactcagtga gctgatgcac ctcatcgtct atctgcgtga tccaaccgac catccacgta      7140
     tcaaaacggc attgtcggag cgcttgcccg gcgtcccggc gatcattgta cagggtccgg      7200
     tttgccggcc ggaatggctg gtagaggtcg agggcatagc catcgccgat aatgaagatc      7260
     tgacccttcc aagtttctga tcttccgagt cttcgcaatg ttcggccgtg gagtgtcgtc      7320
     ataagcgacc gcacaagaag ccgcatagaa agccgttgat attaggctga agtcaaagga      7380
     atgtatgagc gggcagaagc gggataattt tcaactctac tgtctatacg cggaaattcg      7440
     cagccgcgaa gcgcgtgtcg gcttgctaga cggacgctta cacaggaggt ctatatatga      7500
     gcgatatgcc gactaatctt accgaaacat caccgttacg acttaagacg ggactagccg      7560
     aaatgctcat gggtggggtc atcatggatg tcactaccgc agagcaggcg aagatcgcag      7620
     agaatgccgg tgcagtggca gtgatggcac tcgagcgggt ccccgcacag atacgagccg      7680
     agggtggcgt cgctagaatg gcttccccga aaaaaatcaa ggagatcatg actgccgttt      7740
     cgatccccgt gatggcaaaa tgccggatcg gccatttcgc cgaagcgcag gtgcttcagg      7800
     ctctcggcgt agatttcatc gatgagtcgg aagttctgag cccggctgat gaaatgcatc      7860
     atatcaacaa gcacgctttc gtatctcctt tcgtctgtgg ggcacgtaac ctgggcgagg      7920
     cactgcggcg gattgccgaa ggagccgcaa tgataaggac aaaaggggag gccggtaccg      7980
     gcgatgtgat gcacgcagtc cggcacgtcc gacaaatcac caaggatatt cacgccttaa      8040
     cgattctacg cgaggatgaa ctgtatgccg ccgcaaagga attggcggct ccctacgagt      8100
     tggtaagaat cgtcgccagt atcggccgac tgcccgtgcc aaacttcgcg gccggcggca      8160
     ttgcaacccc tgctgacgcg gcgctcgtcc gtcatctagg ggcagaagca gttttcgtag      8220
     gctctggtat cttcatgaga gactcacaga attttgtcga tcctagcgag gcacaatcac      8280
     gcgcagaagc aatagtccag gcaacaacgc attacgacaa cccccagatc cttgccgaga      8340
     tcagcgaatc atgcctcgga gccatacacg gccttgctgc ggctagtttg aaagaagaag      8400
     tgttgctcca gactcgaggc tggtaggtgc tgccgataag ggattgacag acttgccgct      8460
     gaaaatcggt gttgtggctt tgcagggcga ttacgcggca catgcggagg ctttgcgcag      8520
     tagtgatacc gagattgtgt tggtccgcgc gacaaaagaa ttggctgatc ttaacggctt      8580
     ggtgattccg ggcggcgaat cgacggcgct cctcaagctg ctcacacgcg aaaatatgtt      8640
     cgaagccgtg cgtgagtttt ctatagccaa gccagtgttc ggtacctgtg ccggctgcat      8700
     tatcctcgcc aaaaaggttc tgccgtcgca gcagcaaagc cttgcggttt tggacatagt      8760
     cgtgcagcgc aacgcttatg gacgacagaa cgaatcccgt gttgctatgg gaaattgcgc      8820
     cctctccggt ggggggctcg aaatggtctt catccgcgcg ccgtgtatcg tgagggcagg      8880
     ctcccgcgtg gaaattctgg cacgatatgg aggttttcct accttggttc gtcagggcaa      8940
     catactcgca gccaccttcc accctgaatt gtctacggac cgacggatcc accgcttttt      9000
     ttgcgccatg atccgcagcg gagagccttg tctaacctga aaattcttga agcggtattc      9060
     ggctttggac gtcatgcggg ccttacgaca ggacattggg caggcgcgga gcagcgcagg      9120
     cgtgtgggtc cggggctggc gggcttggtg atggcgagac gccgggattg gagggatgcg      9180
     ggctcggcgg ggcacatgcc cctgggctta tgtgatcagc ccgggcagcc tggcgagagc      9240
     ataagcgagg atcgcctgat tgggcgaact gcgtgacaga tgcaagcgga tcgacttact      9300
     gagggtctcg atgtggacgg cgagcttgat aagtcgcagg cgatttgtgt cgaactagca      9360
     acagcgccag agtgaccggc gcggcatcag gacgccgaat gccaccttca ccaccctggc      9420
     aaagcccaca ccactgcaag ccgccgcctt cgacctgttc gggatcgaac tcatgcgtgt      9480
     ccagtaaacg tcaataccag gtcagaaact tcatcgataa atacatggat ttttgtacca      9540
     atcagaaaac ccacggctta ctcggcgcgc attcctctga tgaaaatact atatattgcg      9600
     tttgttatcg attcatgcca ctagatattg accgtaacgg aggatttctg atgtgcgata      9660
     cagcggttgt agggcgcgga tttgcccagc gggtaaccga gggttttgct tcgcaaaacc      9720
     tcgtcgatcc cattgccaca cttgaggaat acctcaatcg tgaagactgg cgggttaagg      9780
     ccaatgccaa ccagagctac tcgcttggcg gattgattct tcacggcgcg gcaaagctcg      9840
     ttgccaatta ctggctcgat catatttatc cacctgaggt cggccgcgcc catcgggagg      9900
     ctgacctcca tatccacgat ctggacatgc ttgctggcta ttgcgccggc tggtccctac      9960
     gcacattgct cgtggaaggc ttcaacggcg tcgcggatcg tgtcgaggcg tcgccgccga     10020
     gacacctttc aagcgcggtc ggccaaatgg tgaatttcct gggcacaatg cagaatgagt     10080
     gggccggagc acaggcattc agttcttttg acacctatct cgcgccgttc gtgcgcaagg     10140
     atggtctttc ctatgccgag gttcggcaga atatccagga attcatctac aacctcaacg     10200
     ttccatcccg ctggggaagc cagacgccat tcaccaatat tacgtttgac tgggtatgtc     10260
     ccaaggatct ccgtgatcag atacccctga ttgggggcaa tgaaatgccc ttccgctacg     10320
     gcgatctgca ggcggaaatg gacatgataa accacgccta tatcgaggtg atgagtgccg     10380
     gtgatgccaa cggccgcgtc ttcaccttcc caatcccgac ctataatatc acgccagatt     10440
     ttgattggga ttcggagaac gccgaacgtc ttttcgcaat gaccgcgaaa tatggattgc     10500
     cctattttca gaattttctg aactccgatc tcgagcccca tatggtgcgc tcgatgtgct     10560
     gccgactgca gctcgacctg cgcgaattgc tcaagcgcgg taacggcctg ttcggatcag     10620
     ccgaacagac cggatcgatc ggggtcgtga cgatcaactg tgcacggctc ggctttcaac     10680
     acaggggtaa tcgttcaagt ctctttgaga ggctcgatgc gttgcttgcg catgcatgcg     10740
     acagcctgga gatcaagcgg caagtgatcg ggcaatatct cgatgccggt ctgtttccct     10800
     attctaaacg ctatctcgga accctgcgca atcatttttc gacgatcggc gtcaatggaa     10860
     tcaacgaaat gatccgcaat tttacggcgg atacagacga cataacgacg ccggcgggac     10920
     atcggatggc ctgtgacctg cttgaccata ttcgggccaa gatcatcggc ttccaggaac     10980
     agaccggcca tctctacaat cttgaagcaa cgccagctga aggaaccacc tatcgctttg     11040
     cgaaagaaga cctgcgccga tatccggaaa ttcttcaggc aggtacgccg gacaagccct     11100
     attacacaaa ttcatcacag ttgcctgtcg ggtttaccga agatcctttc gaggcgctta     11160
     cccgtcagga tgaactgcag ggtaaatata ccggcggcac ggttctgcat ctctatctcg     11220
     gcgaacagat ctcttcctct gcggcctgcc gagacctggt gcggcgggca ctgacgcgct     11280
     tccggctacc ctacctcacc gtaaccccga ccttttctgt ttgtccggtg cacggctatc     11340
     ttccaggcgc acatcatcac tgtccgcgct gcgccgctga agagccagcc acaatcccac     11400
     gcgtgtgtga ggtctggacg cgtgtgatgg gttatcatcg tccggtatcc tcgtttaata     11460
     tcggcaaaca gagcgaattc atcgaacggc ggtttttcgt cgaacccaga gccatgtgcc     11520
     atgccacagc ctgatgagcc gctggtcagt ggctgggcgc cgttcaccac ccttgatttt     11580
     cccggacgcc ttgctgcgac gttctttctc cgtggctgcc cactccgttg ccgctattgc     11640
     cacaatgtgg atttgcaggc acgccgaggg acttctccct tacgatggct ggaagcgctg     11700
     acttggcttg atcagcgacg tggtctgctt gatagtgttg tctttagtgg cggcgaacca     11760
     acaatggatc ggtgcctgga acagatgata cgtgacgttc gctcattggg gtttgaggtc     11820
     gctctgcata cggccggcgt ttcgccgaaa cgtcttgagc gggtactgcc tatgctccag     11880
     tgggttggtt tggacatcaa ggctccgttc ggcgactatg ctcggatcac tggctccgag     11940
     gcgagcggtg cccgagcgcg agtcgccctt gcgatgctcc gtgaaagtgg cgtgccgtac     12000
     gaagtgcgga ccaccgtgca cccagcattg ctggatgcac aagtgcttca gactctggcg     12060
     ctcgatctcc gagcgagtgg catcggacgg tgggtgcttc agccgttttg tggccgtggc     12120
     tgcgtggagc cagcgctaag cgcagaaaac atcagcattg agacatctct tgttacacac     12180
     ttgcgacgga ttattccaga aatcgtcgtt cgttcgaatg gttgttgatc gaggaccatt     12240
     ttctggatgg gtaatcttac acagttcgtg ctttcgctga acaagagagg cacgagaaat     12300
     ggtccgcatc tgtcccagcc gctgttccag gcgtcgctcc gtcagctggg ctgttcaacg     12360
     ctttgggata ttgatgagag caaggatgtg gttgaggcca gcaagcgcgg tgcggtagcc     12420
     gtcttggcta agccccctaa cggtcgtcct ggggccgtgg gcaggggcta cgcatgaaaa     12480
     tttggggcat aattgacggc acggaatcga gtgtgattcg gggagtctcc ttgagattgg     12540
     gagacgtgca tgtcggtgag gcggcttgtg gaggaatttt cggccctgac agacccccca     12600
     ctgaggcggc aaggtcgagc accggctgat tgatattctg gtgattgcgg tgtgcgcggt     12660
     gatctccggg gcggaaagct gggaggatat ggcgctatat ggccgcagca agcaggattg     12720
     gctgggcacg tttctggcgc tgccgaacgg cattccatcc cacgacacct tccgacgtgt     12780
     gttcatgctg atcgataccg ggcgtttcga ggcctgtttc gaagcgtggg cgcgctcatt     12840
     cgggacgact ttggaccggg aagtggtggc gattgacggg aaagcgagcc gcggttcgtt     12900
     tgatcgcagc cgggaccagg cggcgtttca cgttgtgagt gcatgggcaa gtgatcgggg     12960
     actggtgctc ggccagcgtc aggtcggcga caaatcgaac gagatcaccg cgatcccgga     13020
     attgctggat gtgctggaca tcaagggcgc cattgtcacg ctggacgcga tggggtgcca     13080
     gcgagccatc gctgccaata tccttgaggg gggcgccgat tatttcgtca ctctgaaagc     13140
     caaccagggg aaaaaacaca gcgccgtggc ggagctttgc gcaaccacct gcttcagccg     13200
     ctcacccact catcggccgg tccacgacga attcgatgat ggtcatggcc gtcttgttcg     13260
     gtgccgggta ttcgtctgtc cggacgccgt agcgctggaa ccgctgcgcg actggccggg     13320
     gttgaagagc gttctggccg tggaaaccat ctgcggtgtc aacggatccg gcaagatcga     13380
     agccgaaatc cgctacttcc tgtccagcag cgacgatcaa cccgaaatcc tggcaagagc     13440
     gatccgtcaa cattggcaga tcgagaacag cctacactgg gtactcgacg tcaccttcaa     13500
     cgaagatcac tgccggatcc gggatcgcaa cgccgtccag aacttctccc tgcttcgcaa     13560
     gatcgcaatc aacctcgtac gccgccatca gagcccgaat ctgaatggta gtgcgtctat     13620
     cggttgcgtg tgattttcct tgtgagcagg cggatatggg caaggaagag ccatgcggtg     13680
     gcgctggtaa cggtggcctc gaaatccttt gcaagacgtc ggcatctgcc gagccaggcg     13740
     aaggttctct ccacgaccca gcgtcgcggc aggagttcga acccgctggc ggtgtcggag     13800
     cgcttgacga tctgtatggt ccatttgccg atttttgcga ggcgtccatt gagtttggga     13860
     ccggcatagc cgccgtcggc gaacacgtgc cgcaaccaag gatacaggga tttgacggat     13920
     ttgagcacgt cgggcgcccc atcccgatcc tgaataccgg catgatgaac gacggcgccg     13980
     acgaggtggc caactgtatc ggtgacgatg tggcgcttgc ggcccttgat cttctttccg     14040
     gcatcgaacc cgcgcggccc gccggcttcg gtggtcttga ccgactggct gtcgatcacg     14100
     ccggctgtgg gtgacgcctc tcgtccggct atttcccgcg cctgcatgac caggacgtga     14160
     ttgatgcgat caaatgtgcc gtcgcgacag aagcggtaaa aatacccctg cacagtggtg     14220
     aacggcgcga attccttcgg gatctgccgc cactggcaac cggtcgacag catgtagaag     14280
     atggcctcca caatccttcg cagcaccacc gtccggggcc ggcctcgatg cagcggcaag     14340
     ggcatgaatg gttcgatcaa ggcccattcg gcgtcggtga ggtcgcttgc gtagcgcaat     14400
     ccggcccggc aatatcgttg ccgggcgatt tcagtccagg ccatcatgtc tccgttcgtc     14460
     ttcgcaaacg aactgaatca caacccgctg aaatcgctca actatctttt gcggtcaggt     14520
     gcggattccg gagaattcgc ccatggattc cgattttaat tcgcccacga ttccgacgtt     14580
     tattcgcccg gggattccga gatttattcg cccgggtagc ggtctctgtg gctgttgatt     14640
     tcgttgctct cctgttcttg ttgggtcaag cggtttttgg ggtttgcttg cgggtcttgc     14700
     gcaggctttc accggtgagt tcgatgcggt gggcattgtg gagcagacgg tcgagaatgg     14760
     cgtcggcgta ggtcggatcg ccgatcagct catgccaatg cgccggaggg atctggctgg     14820
     tgatgatggt ggcgcgacgg ccgtagcgat cctcgacgat ctcgagcagg tcgtgacggg     14880
     cgctggcgtc aagcggtgca aggccgaagt cgtcgaggat cagcagattg acggtgccga     14940
     gagtgcggat catccggccg tgccgccctt cggcgcgggc gagtgcgagt tcggtgaaga     15000
     gtttcggcgc gcgctgatag agcacgctcc tgtcatcacg acatgccttg tgaccgaggg     15060
     cgcaggccag ccaggatttt ccgacccctg tcggcccgct caggacgaga ttgtcgtgcg     15120
     cgtcgatcca ctcaccctgg atcagcttct ggaacagagc ccgatcgagg ccgcgggcac     15180
     tccggtaatc gacatcctcg attgcagcgt catggcgcag cttggcatgg cgcagccttg     15240
     tgctcaaccg cttgtcacgt cggacggtga tctcgcggtc gagcagaagg ccgagccatt     15300
     cggcgtgact gaggctgggg gtttcgggat tggcgtgcag ctcggtgaac gcgcgggcca     15360
     tgcctgcaag accgagctgg tggatctgat cgagggtcgg atggttcagc atgaggcttc     15420
     tccttgtcat cagtggaaat atccgccgcc cctgatgttg gggtggcgga tcggggtggg     15480
     atcgggactg gcggtgccgg cggctcgctc cagccggtga tcgaggatgg atttgaccga     15540
     gccgtaggtc agggtgccga tggtgagcgc gcgctcggct gcggcgtcga gccggtcggc     15600
     gccaacactg cgggccaggc gaaggatgcc gatgcaggcg cggaacccct gctccggatg     15660
     aggccggcgt tcgaggatca gggtgcagag tgtcgcgacc gacgggccga gccgtgcggc     15720
     ttcctgatgg atccgcgcga tggtccagtc gccgtaacgc cggtggctcg agggcatgtg     15780
     ctcggcgatc gtcgtgtgct tgccgttgcc cgacccgcgc gcatgcacgg cgatccgctc     15840
     gccacggaga aagatctcga ccgtgcgcac ggtgaaccgg gcctcgacct cggcgcgggc     15900
     gtgccggtag gggacggagt aaaaatgctt ctcgatctcg acgtgataat cgatgccgac     15960
     ccgccggcgc cgccattgcg ccagcacata gggttcggcc ggcagttcct tcagcgcggg     16020
     acgatcgagt gtttccagca gatgccgtct tgtcgccccc aggcgacgga cgacccgctc     16080
     ctcgttcagc cagcggcaga attcagcgat cgcggcattc agttcggcga ggctgtaaaa     16140
     tgcccggttg cgcagcttgc ccagcagcca ccgctccgcc agcaaaaccg ccacctcgac     16200
     cttcgccttg tcacgcggcc gccgcggccg cgccgggaga atggccgtgc cgtaatggcg     16260
     cgccatatcg gtgtaggtcc ggttgacctg tggatcgtag aggcaggcgc ggatgatcgc     16320
     gaccctggcg ttgtcgggca ccagcagcgc cggcacgccg ccaattgctg ccagagtgcg     16380
     attatgcgcc tcgatccagt ccggcagggt ctgggtccag gtcgcctcag cataggtgaa     16440
     gctcgatgcg ccgagaacgg cgacgaagat ctgggccgca cgcgtctcgc cggtgagtcg     16500
     gtcgatcacc accggcaccg tgtcgccggc ataatcgacg aacagcttct cgcccgatgc     16560
     gtgggtctgg cgcatcgtca ccggtagccg ggcttcccag ctccggtaga gctcgcagaa     16620
     ccggctgtag cgatatccgt ccgggtgctc ggcgatatac tcgtcccaca ggatcgacag     16680
     cgtcacgtgc ttgcgctgca actcgcggcg gatacgcccc cagtccggct catccacacg     16740
     tcgatgcccc ggccgcttgc ccgccgagcc ttcgaacaag cgcctttcca aggccgcttc     16800
     ggacagcgcc agagcccctg gcccatcgag cccggccgcc tccagtcgcc gcagcgtcaa     16860
     gcgcaccgtc gatgccgcaa ccccgacccg gatccctacc tggcgggtcg aaagccccgc     16920
     catcctcaat ctgacaatct cgcgcacatc gcgcatcgca atccgctcca ctggcattca     16980
     tccactccct cgatcagaca aagggaggga acctgaacca gccagcagag acctcaatcc     17040
     gacccggcca accccgcccg cctgggcgaa taaaagtcgg aacaggtggg cgaattaagc     17100
     ctcctcgacg ccgcgagtgg aacttcggcg gttcctgaaa gtggcgtgac caccaccgca     17160
     ggtagcagcc ctgccacgct ggggccagtt tcttggttcg gctggagtgc cgtttcttcg     17220
     tcccggcctg atcgtgcgcg gggcgtcgtg cacagccgcg gtcaagaatg gccgcaggcc     17280
     atcgcgtagc gacgcgcagc gttcttgacg gcggcgagca cggcgccagt cttgaggcag     17340
     acgggccgag cagccgcatc ccgcagtccg atcgcgcatt ggcgcggcat gcggtgccag     17400
     cccgcacggg acactctgat tgcgcggagc accgccatgg caagcagcga catcttcacc     17460
     ctcggcctcg gactgacccc accctggcgc gtggtcgacc agcggttgga aaccgactac     17520
     cagccgcatg agttgcatct ggccgtcgcc gccgacccag gcgcccgctt cccctgccca     17580
     acctgcggcc ggctgtgcaa accgcacgac tggaaggaac tgagctggcg gcacctcaac     17640
     ttctttcagc acgcctgcat catcgaggcc cgtgtgccac gcaccgactg tccggagcac     17700
     ggcgtactcc gcattgctgt gccttgggca cgtcccgaca gcggcttcac gctgttgttc     17760
     gagcaggccg cgctggctct gatgcgcgag atgccggttg ccgctgccgc gcgcatcatc     17820
     ggcgtcaccg accagcggct gtggcgcatt ctgcggtact atgtcggccg ggcgatcgag     17880
     cggctcgatc tcagcggggt cgaggcgatc gcactcgacg aaaccgcggc caagcgaggc     17940
     cacagctacg tcaccgtgtt cattgacctc gatgcggccg agcgcccggt gctgttcgtc     18000
     acccccggaa agggtaagga atgcatgacc gccttccggg ccttcctggc ggagcacggc     18060
     ggcgaggccc gccgcatcgc cgaggtggtg tgtgacatgt cggcggcctt ccttgctgct     18120
     gcggcggaga gcttcccgca ggcctcggtc accgtggact ggttccacgt cgtgcagatc     18180
     ttcaccaccg cggtcgagca ggtgcggcgc gccgaggcgc atcagcacaa cctgcccaag     18240
     ggggtacgct gggccacgtt gaagcgaccg gaaaacctga ccatggccca gcggcaggcg     18300
     ctcgaccagt tggagaacag cggcttcgcc acagccgaag cctatcgcgc caaggagatg     18360
     ctgcgctggg ttcgcctggc cgcaacgcca caggccgcgc gctggcggct gaccaacttc     18420
     ctcaaccacg tcaccgcccg gctggacgat cccgaccacc tgctcgatcc tgttcgacag     18480
     gccgtcgata ccgtacggcg caatgccaag cggatcattc gacgctggaa gtcaggccat     18540
     tccaatgccc gcctcgaagc gctcaatggg ctgttccagg cagcccgcgc tcgcgcccga     18600
     ggctatcgca acaccgctac cttcgcgtgc atcatctacc tgctcggcgc gcccatcaac     18660
     gccatgctcg acgtcttcca ttccacttga gacgtcgaag agcccgaatt aatctcggaa     18720
     taggtgggcg aataagtccc ggaatcccgg gcgagttaat atcggaatcc cgggcgaatt     18780
     gagcccggaa tcagcagtca ggctctcagg catcaaaggc cagtctcaag gggcgacgca     18840
     aaatggccgc ctgggataac cgttacatgg agcaagtgct caccggcatc tttcatgcgt     18900
     aacccctggg gccgtgggtc ggtcaggtaa tcggccacgc gctgcacgcg ggtggcggcg     18960
     ctgaagatcg cgcgatgaca agacagccag gagcatcctg gccggcatac acttcgcagc     19020
     caccgccatc tgactcaaat gaccgccgag cttagaattt taatattttt tttacaaaaa     19080
     actccaaatt ttgactcgaa tttatacggc gtaaaccggc atgatcttgc ggtccggcaa     19140
     ggtaacctcg gtggcctttg ctgccatttc gaacttgtcg caagtgttgg ttgaagggaa     19200
     ttattaatga atgacttgtt gacagttctt ctaggcgttg tggtgtttgg attgttcttt     19260
     ctttacgtcc atgcatgcga aagaatataa atgatgtata tcaggtcggt tttgagtaat     19320
     atttccacgg tctggagatc atatagtgtt tgatttcttg atcggtggaa ccgttgctgg     19380
     attaattctg atctatctcg tctgggccct tctgcgcccc gaggatttct gaacaccatg     19440
     catctggcgg cgcacatcac tggcctgatc gccgatgccc tgatctgcat cggcagtgct     19500
     ttcgccatcg tcctcgtcat cctgtggatg tggcaggtgg cacgccaggt tcttcaccgg     19560
     catccccccg aacaatagcg tctccgaacg gaaaccccca tgaccttgca cggaataggg     19620
     ttcatcgccc tcgcgctcgc cctcgtcttc ggcgcggcct ttccgctggg cgcctatctc     19680
     gcccgacttt atcgcggcga tctgcgattc ctcgcggcga tcgaagcgcc gatctatcgc     19740
     ctttgcggca ttgatcccca gcgccagatg gcctggggcg cctatgcggt gggcctgctg     19800
     ttgctcagcc tgatccactt cctgctgctc tacgcgattc tccggctcca gtatttcctg     19860
     cccttcaacc ccgaacacat caggggcatg agtccgaagc tcgccttcaa cacggcagtc     19920
     tccttcacca ccaataccaa ctggcaggcc tacgcgcccg agagccagat ttcctatggc     19980
     gcgcagatgt tcggcctcgt cgtacatatg tttatctccg cggcagccgg gcttgccgca     20040
     gcgggggcgc tcatgcgcgc cttcgcgagc ggcggcattc gcacgctcgg caatttctac     20100
     gtcgatctcg tccggatcac cctgtatctc ctggtgccga tcgccatagt cgccgcactg     20160
     ttcctgatcg gctccggcgt gccgatgacg cttgctccct atgcccatgt gcatgccctc     20220
     gcgggcggga tgcagaccat cgcccgcggg ccggtggcgt tgcaggaggc gatcaaggaa     20280
     ctgggcacca acggcggcgg gttcttcaac gccaactcgg cgcatccgtt cgaaaatccg     20340
     acggcctgga cgaaccttct ggaaatcttt cttcttctgg tcatcggctt cgcgttgccg     20400
     atcgccttcg gccatgtggc ggggcggcgg cgcgacgggc gggcgctgtt cgccgtgatg     20460
     gcggtgatcc tcgcgtgcgg catggtgggc gcctatgcgg cggaggcggc gaacaatccg     20520
     atcctcgtcc atgccggcct cgcggcgcat cccggcaaca tggtgggcaa ggaggtgcgc     20580
     ttcggcgtgg cgcagtcgac cacgttcaat gtcgcggcga ccgggacctc aaccggcgcg     20640
     gtcaattcgt tcaccgacag ctatctcccg ctgggtggcc tggttccgct gttcatgatg     20700
     caactgggcg agatcgctcc cggcggcgtc ggctcggggc tttacggcat cgttctcttc     20760
     gcgctgctcg cggtgttcgt cgcggggctg atggtcggcc ggacgccgga atatctcggc     20820
     aagaagatcg aggcgcggga gatgaagctc gcgatgctgg caattctggt gcagaccctg     20880
     ttcatcctgg ccggagcggg tttctcgctg ctgaccaaat cggggctggc atcgcttgcc     20940
     aatgcggggc cgcacggtct ctccgaaatg ctctatggct ggacttcggc caccgaaaat     21000
     aacggcagcg cctttgcggg cctttcggcc aacacgatgc tgctcgatta cgggctgggc     21060
     ctggccatgc tgttcggccg gttcgcggtg atgatcccgg tgctcgcgat cgccggatcg     21120
     ctcggcgcca agccgaggct gccgcattcg gagggcacgt ttccgaccga tgggcctctg     21180
     ttcatcggcc tgctgatcgg cgtcatcgtc atcctggtcg ggttgcagtt catgccggcc     21240
     gacctgctcg gcccgatcgt cgaacattac ctgctgctcg ccggcaagac cttctgagga     21300
     gcgctgacat gtcccgcaaa gccgagacga tcgggctgtt cgatcgcgat atcctgatcc     21360
     gcgcgatacg cgatgccttc gccaagatga acccgcggac gctgatccgc aatccggtga     21420
     tcttcgtgac cgagatcatc gccctgctga cgacgttcgt cggcattcgc gaaatggttt     21480
     caggccaagc ctgggctttc tcgatcgtca tcgcgatctg gctgtggatc acggtgctgt     21540
     tcgcgacctt cgccgaggcc gtcgcggaag ggcgcggacg ggtgcgggcc gagagcctgc     21600
     ggcgggcgcg cagcgacacg atggcgaagc ggctggatga tccggcggat cgcgccgcgt     21660
     tcaccctggt gccggcgccg cagttgcggc gggaggatct cgtgctcgtc gaggccgggg     21720
     acctggttcc cgccgatggg gaaatcgtcg agggtatcgc gagcgtcaac gaaagtgcgg     21780
     tgaccggcga gtccgctccc gtcatccgcg aggcgggcgg cgaccgctcg gcggtgacgg     21840
     gcggcaccga gctcgtgtcg gactggctgg tcgtccgcgt cacgtccgag ccgggctcga     21900
     gctttctcga ccggatgatc gccctggtcg agggggcggc gcggcggaag acgcccaacg     21960
     agatcgcgct cgacatcctg ctcgccggct tgaccatcgt gttcgtgatc gtggtcgtca     22020
     cgctgcccgg cttcgcagcc tattcgcaca cgcggctcgg catcgccgaa ctcgcggcgc     22080
     tgttcgtctg cctgatcccg accacgatcg gcgggctgct ctcggcgatc ggcatcgccg     22140
     ggatggaccg gctggtgcgc ttcaacgtga tcgcgacctc gggccgcgcc gtcgaggcgg     22200
     ccggcgatgt cgacacgctg ctgctcgaca agaccgggac cgtcaccttc ggcaaccgca     22260
     tggcctctgc gttccatccg gtgccgggtg tggatgtgcg gcgcatggcc gaggccgccg     22320
     cctgcgcctc gctcggcgac gagacgccgg aggggcggtc gatcgtgcgg ctggcgcggg     22380
     aggaattcgg cgtcgatccg gtgctgccgg acggggcgga aatcgtgaag ttcagcgcga     22440
     acacaaggct ttcgggcatc gatgccggcg agcggcactg gcgcaagggg gccgtggact     22500
     cgatcctcga cctcgtgggc ggcgccgcgc cggacgcctt cggcgcggcg gtggaccgca     22560
     tcgcgcgcgc cggcggcacg ccgctcggcc tgatggcgga gggcgcgctg ctcggcgtca     22620
     tcgagctgaa ggacatcgtc aagccgggga tccgggagcg gttcgaggcg ctgcggcgga     22680
     tcggcatccg caccgtcatg gtcaccggcg ataacagggt gacagcgagc gtgatcgccg     22740
     ccgaggccgg tgtggacgac gtgatcgcgc aggcgacgcc ggaggacaag ctcggctata     22800
     tccgcaaggc gcaggccgag ggacggctgg tcgcgatgtg cggcgacggc accaacgacg     22860
     cgccggcgct ggcgcaggct gatgtcggtg tcgcgatgca gaccggcacg caggcggcgc     22920
     gcgaggcggg caacatggtc gatctcgaca gcgatccgac caagctgatc gagatcgtgc     22980
     agatcggcaa gcaactgctg atcacccgtg gcgcgctgac gacgttctcg atcgccaacg     23040
     acatcgcgaa atacttcgcg atcctgccgg cgatcttcgc agcgagctac ccgcagctcg     23100
     gcgccctcaa catcatggcc ctggcctcgc cggaaagcgc cattctctcg gcggtgatct     23160
     tcaatgcgct ggtcatcgtc gtgctggtgc cgctggcgtt gcgcggcgtt gccttccggc     23220
     cgatgggggc ggcggcgctg ctgcggcgca acctgctgat ctacgggctt ggcggcatcg     23280
     tcacgccgtt cgtcgggatc aaggtgatcg acctgatcct gaacagtttc cacatcttca     23340
     gctgatcgag cgagaccgtc atgttgcgcg aactccgccc cgcgttttcc cttgtcgtcc     23400
     tcttcaccct gctgctcgga ctggcagcac cgctggccgt gaccgggctg gcgcagctcg     23460
     tctttccctt cgaggcgaat ggcagcctga tccgggttca tggacaggcg gtcggctcgg     23520
     cgctgatcgg gcaggatttc cggggggcgc aatggttcca ttcccgtccc tcggcgctga     23580
     cggggacgaa tgcgaaaggc cagaccatac ccacgcccta tgacgcctcg gaatccggcg     23640
     cgtccaatct cgggccgacc agcaaggcgc tcgtcgccca tgtcaccgcg cggatcgccg     23700
     cctatcgcaa ggcctatggt ccggggccgg tgccggatga tgcggcgacc tcgtcggggt     23760
     cggggctcga tccggacatt tcgctggcga acgcgctgcg gcaggcgccc gcggtggcgc     23820
     gggcgcgggg aatgccggcg gcgacggtcg agcgcctggt gcgccgcctc gcggtgcggc     23880
     cggcgttcgg cgtgatcggc accgcgcatg tcgacgtgct gcggctgaac ctcgctttgg     23940
     ccagaaacag ccagaaatga cggatttcat gctgcgatgc cggataaacg gaaagccgcc     24000
     gtgggcaaga aaagacatca gatgccgcac gttcattcgc tggaagttgt gccacgtata     24060
     acgatgcggc ttttcacggt ctgggccatc atgtggttga tggtattttc gatagtcata     24120
     ttttatttga tgaataggaa aattggcata ggagaaaaaa atttactgga gtcaagcatt     24180
     ttgccatgga ttgttgtttc atcgtcgata ttgatgagat tgctttcgtt gaaaaggcat     24240
     atcaacacaa aatttttttc tgattatctt ttcaggatcg ttcagccatt tatttccatt     24300
     atggttatcg aatattcaat tttatttttg acaaaatata agccgatttt tgttgaaata     24360
     tttatttgtt cgacggtgtc catcctgaca atcataataa gtcttgtttc tttaatactg     24420
     ttatcatttt tttctttcaa attatacggc gccgagcttc ccaatccatg ggagtgacaa     24480
     atcgagatca aatcgtatcg ttctggttgt cgatcaaggg ctgaattttg ttccttggta     24540
     aagcttgcaa ggcagccgcg aagcaagagc ctgaaggagg catcatgagt ttagaccatt     24600
     ccagaacgcc cggccggcgg aaccgcacgc ggctgatcgc cgcctcgttt ggcgcggcga     24660
     tttcgctctg cgccctgcaa tcggcgcagg cattcaatgg cccctcggcg atcaagatcg     24720
     acggcggccc gctcggcccg ctccaactca gcggcggcgc cgatggctac atgtacgcgc     24780
     tctccggcac cggcaacagc acgaacagcg gtcttctgac caccgacaag agtaccggcg     24840
     ccgagttcat gaacgggcag atcgaggtcc agaagaccag cggcctcgtg cagttcacca     24900
     tccaggtcgg ctcgaacaac tcgctgaccc tgggcaccaa gcccacggcg acctcggtgc     24960
     agaccttctc caccggcccg ctctacgccg gatatatcac gctcgcgccg accaagaact     25020
     tctcgatctc ggtcggccag atcggttcgc tcgaaggtta cgagtccggc atcgactgga     25080
     acaacgccaa cgtgctgacg accgacctct tctatgtcga aaattcgcag agccgcggcg     25140
     tttcggcgac ctacacgatg ggaccggtca gcgccagcgt gaccttcggc gacgggttcg     25200
     acaccggggt gttcaacttc ctgcagggat tggtcaccta cagcttcaac gacaacaacg     25260
     cgctttcggt gttcggcgcg accaatctgg gtcataccgg cctgctcgcg aatacctatg     25320
     gcagcgccac aacgccctac aaccagtcga ccgtcggctc caatggcgcc aactatatca     25380
     actccacgat gatcggcggc tattacagct acacgcatgg caacctcaac ctcgtgccgg     25440
     aggttcagta tgtgtatgcg aagcctgacc agaaggttgg catcagcaag ttcacgagca     25500
     atttcggcgc ggcgctcttc gccgattacg cgttcggcaa aagcccctat tcgctgggcg     25560
     gctgggtcga gtatttcagc tcgaacggcc ccggcttctg gttcctcaac cccggagcgc     25620
     agggctacgg cctgtcggtc acgccgacct ggcagaacaa gaacctgttc gtccgcggcg     25680
     atctcggcct gctgcatctg accaaggtcg gctatgctgg cagcaccggc tacggtgcga     25740
     acggcaccgg gcgcaaccag gccaccttcg tggtcgaggc cggcgtgctg ttctgattcc     25800
     accctcggcg caatcgcgga aaaatggtga tcagcaaatc acgtgtccgg cggctattat     25860
     ccaggctctg gaacatcatt gtttcggctt ggagagaatc gcgccatccg ctttaaccga     25920
     gctccgtaga tttaccggcg gcgcgtggaa acaggacgtt tgagcatttt tgtgagtatc     25980
     gatactcagg ttgaacctca ccctggcggg gcgccggaag gcgtcaggcg gcagggaccg     26040
     gcgccgggac ttgcgcgcct gccggagatg gcgtgatcat cccgcatggg atccgcatcg     26100
     ccagagaacc ggcccgaccc ggacgcgctg ctcgcccgcg cgaacagtga cgggcgcggg     26160
     cagctcaaga ttttcctcgg cgcggcccca ggggtcggca agacgtggga aatgctggcc     26220
     gcggcgcggc ggcgcttcga gacgggaacg gatgtcgtcg ccggcctggt cgagacgcac     26280
     gggcgcgccg aaacggcgga acagctcgcc gacctgccgg tgctgccgcg gcggatcgtg     26340
     ccctatcgcg gccggctgct ggaggaattc gatctcgatt ccgcgctgaa gcggcggccg     26400
     gcgctgctgc tggtcgacga gcttgcgcat gccaacgcgc cgggcctgcg ccatgccaag     26460
     cgctggcagg acgtcgcggc gctgctggag gcggggatca atgtctggac cacgctgaac     26520
     gtccagcatc tcgaaagcct gaacgaccag gtggcgcgga ttaccggcat ccgggtggcg     26580
     gaaacgctgc ccgacacggt gctcggcctt gccgacgaca tcgagctgat cgacctgccg     26640
     ccggaggaat tgcggacgcg gctgaagcag gggctggtct accggccgga tgtcgcgcgg     26700
     cgggcgctgg gcggcttctt ccggccgggg aatctcgccg cgctgcgcga gatggcgctg     26760
     cggcgggtgg cgcagcatgt cgatcgcgac atcgccgcct atatgcgcgc gcaggcgatc     26820
     gcagggccct ggcctgcggc ggagcgggtg atggcggtgg tcgaggccgg cgaggcggcg     26880
     gagcaggtgg tgcggcacgc gtcccggctg gccgaggcgc tgcgcgcgcc gttcttcgcc     26940
     ttccatgccg agcgggcggc gaccggcatg gccgtgcaac cggcgctcga tctcgcgatc     27000
     cagcttggcg gcaccgtcga gacgacgacg aacgcggatg tgttcgccgc cctgctcgat     27060
     gcggcggcgc ggcagaacgt cgcgcatatc gtgatcgcgc gcggccgtgg tcggtggcgg     27120
     tggcggcgcg gccttgcctc gcggcttgcg cggggcgcgc gggcctatgc gctgcatgtg     27180
     gttcccgatc ccgcggcgag ccggccggcg ccgccgcatc gcgcgccgcc gccgaagctg     27240
     atgcctttcg gtatcagcct cggcatcatg atcgtcacga cgatcggcgg gttcgccttg     27300
     cgcggcgtgc tgccggccga ggcgatgggg tatgttttca ctgcgatcgt cgtcggcatg     27360
     gcgagcctgt atggccgcag cgtcggcatc ttcgcggcgc tgaccggctt cgtgctgtgg     27420
     aatttcttct ttctcccgcc gatctacacg ctttcggtga ccaacccgcg ggatgtgacc     27480
     gcgctgttcg cgtttctcgt cgtcggcgtg ctgaccggct cgctggcagg gcgggtgcgg     27540
     gcggaggcgg agaccgcgcg cacgcggatc gaggcgctgc ggcggatcac gctgttcggc     27600
     cgcgcgctgg cgcaggtttc ggacgaggcg gggctggccg cggtggtgga agcggaggcg     27660
     cgggcgctgg ccggcgaggc ggtgctgctc ctcgcacggg gcgacgggct gccccgcgcc     27720
     ggcgggttcg acgaggcggc ggtggcggcg gcggaattcg cctggcgcaa tcgcgtggcc     27780
     accggcatgg gcacgacgac gctgcccgca tcggcctggc ggttccagcc gctggcgacc     27840
     gaggcagggg cgatcggcgt gctcggcgtg cggcccgaga cccccccggc cgagccggtg     27900
     atccagacgc tcagcgcgct cgccgaccag gccgcgctgg ccgccgaacg gctgcggctg     27960
     gccaccagcg cggcggaggc gcgggcgcat gagtcgacgc agcgcctgcg cacggcgctg     28020
     ctctcctcgc tctcgcacga cctgcgcacg ccgctgaccg cgatccgcgg cgcggccgag     28080
     acgctggcgg aagcggatgg cgagctgccg gaagcgacgc ggcgcgacct gctggccagc     28140
     atcgtcgagg atgttgggcg gatgacgcgg tttctcgcca acatcaccgg gatggcgcgg     28200
     atcgagacgg gcgagatcgt tgcccggcac gagaaggtgg atcttgcgcc ggtggtggaa     28260
     cacgcggtgg cgcgggtgaa ggaggcgttc cacaccgcgg tcaacattcc cgaagacgcg     28320
     gccacggtgc gcgccgatcc ggcgctgctg gaacaggtgc tggtcaatct gctggagaac     28380
     gcggtgaaat acgggcccga gggcggggcg atctcggtgt tcgcgcggcg cgcgggggac     28440
     agcgtcgtgc tgtcggtcgc cgatgagggg gtgggaattc cgcccgagga tctgccccat     28500
     gtgttcgaca gtttcttccg ggtggtgcgg ggcgaccgcg tggcgcccgg cacggggctg     28560
     gggctggcga tcgcgcgggc cttcgtcgag gcgatgggcg ggacgatcgc cgccgagagc     28620
     ccgcggcgcg acctgccggc ggacggactg ccgggaacga tcatccgcgt ggagctgccg     28680
     gtgccatgac cgaggcgaag cggatcgaga ccggccgcgt gctggtggtg gatgacgagc     28740
     cgcagatcca ccgcttcctc aagccggcgc tggaggcggc gggatatgtc gtgctgcggg     28800
     cggagcgggg ggcggaggcg ttgcggctgg cggcgacgat ggtgccggac gtgatcctgc     28860
     tcgatctcgg cctgcccgat ctcgacggcc aggacgtgat cgtgaagctg cgggaattct     28920
     cggatgtgcc ggtgatcgtg ctttcggcgc gggaccagga ggcgcagaag atcgcggcgt     28980
     tcgacgcggg agcgaacgac tatgtcgaga agcccttcgg cctcggcgag ctgctcgcgc     29040
     gcatccgcaa cgccttccgc ctgatcgcga ccgggcaggg ggtgccgacc gaggcgatcg     29100
     agatcgacgg gctgcggatc gacgaggcgg cccgcagcgt cagcctcgac ggcgccgaga     29160
     tccatttcac caagaccgaa ttccggatcc tggcggcgct tgcgcggcat cgcggcaagc     29220
     tggtgacgca tgacgacatc ctgcaagctg gctggggcga tcttcaagag tatgatcgtg     29280
     catatgttag aatatacata agatcaatcc gccaaaaatt aggtaaattt gctgataatc     29340
     acttgaaaac aaaatcaggt ctaggatata ttttgatata gatataatct atatgaattt     29400
     ttttcagaaa aatacctgct tacccagcat tttcagccaa tttcagcagc cggtatggca     29460
     tgggcggtgt gtgagcggcg gcccatccga ggcgtgggat catgctggcg aggtcgtaac     29520
     ggcgattgaa gcggtattcg aactcggcaa ggtatcgggg cacgtgcttg ctgctgatcg     29580
     cccggtaggt gccgacgatg gcggatttga tattgcccag tgccgtgttg acccatttga     29640
     acgtcggact tcgagcggcg gccggcccac tgccggtacg gatcacgtca tgcgcgcatc     29700
     cagcatcgct gacgtggccg aaataggcga ggccatcgct gaccacggcg tcgaagccga     29760
     ggggcccgaa gtaacggaac gctccgcggt gtagcataag cggacaaagt gggaacatca     29820
     ggctgcgtgg gtggtcgtgt cgtggattgg ccggagcggc cgcaatccgg catggttttc     29880
     cgacgatttc tgtttggcgc tccagatgta gtcgccggtc aggttcacat gctcccagcc     29940
     gatcggcgag agatgcctga ggagggttcc gggcacatcc tcgacctggc gtagggcctg     30000
     tatggcttgc gcgagatagc gtgtgttcca gaggatgata gcggtgacca ggaggttcag     30060
     gccagatgct cgatgtgtct ggttctcgaa ggtccggtca cggatttcgc cgagccggtg     30120
     aatgaagacg gcgcgggcca ggctgttgcg ggcctcgccc ttgttgagtt catgactgct     30180
     ttcacggcgc aggcccggat cttccagcca gtcgagggtg aacagcgtcc gctcgagacg     30240
     gccgagttcg cgcagtgccg cggcgacggc gttctgtcgt gggtaggcgg cgagttgccg     30300
     caggatcacc gacgcggaca ccgtgccggt gcggatcgag gtggcgatct tcaggagatc     30360
     gggccaatgg gtgcggatga gatcgacgtt gatgcggccg gcgatcatcg gcgcgagcgt     30420
     cggataggct gccggtctgg caaaactgta gagacgccgg tctttcagat cgggaattct     30480
     cggcgcaaac acgtatccaa gtagggcgca cagggcaaag acatgatccg acaccccgcc     30540
     gccatcggta tggtgccggt gctgacgtgg cggcgcatcg ccgtgatgat cgagcaggcc     30600
     gtcgaggaca tgcagggctt cgctggcggt tgcggcgatc accctggtat ggaacggcgc     30660
     gtagcgatcg gagagatggg tgtagaattt cagacccggt tcggggccat agtgcgcatt     30720
     gatccggctc gcatcacggc cagaaccgcc ggcgcggaag aactgcccgt ccgaggatga     30780
     ggcggttccc gacccgaaga gagcggcgag cggctcgcgg ctctggtgtt cgaccaggcg     30840
     gcgcagcgcc agggcgtagg tctcgtcgcg gatgtgccag tcagcggtcc aggcgagctg     30900
     gcccagactg gcgatgctgc aagcttcggc catccgggtc aggccgagat tgaggccatc     30960
     ggccagcagc cccgccatca gaacccgggg gtcagcggcg gcttcgccgg tgcgcagatg     31020
     ggtgaagcaa tccgggaagc cggtccagcc ggccacttcc gtcagcaggt cagtgatccg     31080
     gatgcggggc agcgcggcat agagctttgc tgccagcgct tcggcctcgg gcggagtcga     31140
     tttttcgatc ggtgtgattc tcagcacgcc cttctcgatc gtcacatcgg gaagcagccc     31200
     gccccgggca cggatgtcga tctcggccag ccgcgcatcc agccaggtcc gcctggtcgc     31260
     gatgaagcgc tcgaagtcgg tctcgacagc gaccggaatg ctggactctt tttgcaggac     31320
     ctgaaatgtt tccctggaga tcagccgctc ctcgaaggcc cgatattgcc ggctgccggc     31380
     aacccagaca tcgccggcag caaggcgctg acgcaattcc gccaggacgc agagttcgta     31440
     ataacgccgg tcgatgccgt gtgccgtgag gacatgacgc gcccagcgcg gccggacaaa     31500
     ggcggtcggc gctgacttgg gcagcgtcga ggctcccgcg ctgttcatgg cgcgcagcat     31560
     ggcgatcgcg cgcatcaacg acgccgcggc gggaacaccc tgaaactcga aagtggccag     31620
     aaacgccggc gcccagcgcc gaatgccggc ataatgttcg ctcagcacct cgtagggatc     31680
     gaaatcttcc gaacgaacca gagtttccgc ttccataacg gtcgagcaga accggtccca     31740
     gggtatcacc ttgtcaatcg ccgcgaaggg atcgccctgg ccggcgcgcg cggccatcag     31800
     ggcggcgccg atcctcgcat aaagccggac cttctcgttg atcgcccggc cttcggcctg     31860
     gaacgcccgg gcatgtcggc cttccgcctt gcggaacatc gcgccgatca gccgttcgaa     31920
     cagagtgatc gcctgatccg tcaggcgggc cgacagatcg agatcgatcg cggtgagcac     31980
     ggcatgccgg cgccggcgct cgtagccagc aacatgctgc accgtggtcc ggccggcctc     32040
     gcgaacgagc tgggcgagcc gggattgatt gatccggcga ccgcgcgccg gatcaatgcc     32100
     gattgcccgg atgtgctcca accgctcgat caccccgagc atggatgccg gctttgccga     32160
     ttccgggatc tggcgcagcc aggccagcca gctctggctg gtgtccagac gccgctccgt     32220
     caacgcatcc agccgacgcc gctgatcggc ggacagaccc tcggtcagca gacgctcgat     32280
     ttcccggcgc gcgcggtatc gaacctcgat gcagagccgc tcgagctgcg ccgggcgagg     32340
     tagaagaacc ccgcgaccgc ggcactcttc cagcaccaaa gccgccagat cgaccagccg     32400
     gtcggtttcc agtgcatgcg ccagcagcca gtcggcaagg tctgccgcca cgcgcggccc     32460
     ccatggccgc aacccgaggc gatcctgcaa agccgctgaa tgccggcgtc gattttgatc     32520
     caccctcaga taagcaccga gggaatccgg caagacgtcg atctgtgtgg cgacgaacga     32580
     gaccagggca ggatcgggta tctcgccggc atggagcggc cggccgggat accgcaggta     32640
     acagagcatg agagccagac cgagacgatg gtgatcgccc cgaccgcgcc ggatcattgc     32700
     aagatcagta acagacagcg tgtagtgacg aattatgccg cgtcgatcag tcggcgggtc     32760
     gaacagctgt gcgatctgtt ccccggtcaa tatccgtcga tgacccactg gtccctccct     32820
     cctgcctgtt gaggatagga gaccagccga tccgtgccag agagtcgacc agcgtactcc     32880
     gcgaaatgcc gaaagtgcgg cagaccgacg ctttcgtggc accagcgtcc agcgccgcga     32940
     tcaccgccgc cagcttctcg gcatcgatcg ccaccggtcg gccaccacgc ctgccgcgcc     33000
     gacgggcggc cgccagacct gcctgcacac gctcctggat cagcgaacgc tcgaactgcg     33060
     ccagagcgcc aaaaacatga aacaggaatt ccccctgcgg cgtcgtggtg tccatctgct     33120
     cggtcagcga ccggaagcca acgccacgag ccctgaggct gttcaccgtc tccagaagat     33180
     gcggcagcga ccggccgagc cggtccagct tccagaccac aaggcaatcg ccggatttca     33240
     gataggccag tgccgcagcg agacccggcc gatcgcgccg gctgcccccg gcacgatcct     33300
     cgaacagatg ccgctcatcg accccggcac cgagcagggc atcgcgttgc aggtcgagca     33360
     cctgtcggtc attgtcggtc gagacgcgca tgtagccgat cagcatgtac ggaaatcccc     33420
     ttcgagacgg tttccgtata ccataccatt ccgacggtgt tttccgtaca tgattcggca     33480
     ggaaatccgg gatttttcgg cgggtctcgg accaccgacg gaaaacatgt gttttccgtc     33540
     atcgcgcgat cccggcctca gaaccgcgct ctccgctcaa acccacagaa aacctcgatc     33600
     ccaaccagtc aacgttccca ctttgtccgc ttatgctaca gcctagggcg tttcgttact     33660
     tcaggcccga gggcagaaag atccatctcc cgtcagaaac gcggcattac ccctaccatc     33720
     cgccgcgaat tggggtcgcc gcacgattgg ttcaaaattg cacgttaagg gaaaagctaa     33780
     caaaatcagg ggctttcaaa aacgcccgtt tgtgcatgaa aatgccgaac acggcgaaat     33840
     ctggtttttt ccttttcata accctctttc aaaatcgggt cgaaaggtaa gcgccatacg     33900
     aaatggcgct taccgtgcag tttctgacaa atcgtgcgac gaccccaagt tcaaacgcgc     33960
     cgcacatgag ttcgctggct atatcgccag caacgccggc agcctgatca actatggcga     34020
     gcggttccgt tcgggcgagc gcatctcctc cagcttggcc gagagcacag tcaatgccgt     34080
     catcagcaag cgcttcgcca agcgtcagca gatgcaatgg accaagcgcg gtgcccacct     34140
     gcttctgcag gctcggaccc gaacgctcga cggcacccta cggcctctgt tcgagcgctg     34200
     gtacccaggg ctcgctaacg acaacggaaa tggcgcaact caccccgccg cggcctgatc     34260
     accccacact tcctgatggt ctcctgagat aggggtccat ccgcaaccgc acaccttcca     34320
     gcagcgctgc gagatgccat ggttcgatta gctgaccatc tgccccggcc tgccggcgca     34380
     cggcgtcgag ccggaaccgg aaaaggaacg cactgctcaa agggtgcatt gtcagggctt     34440
     ggtccagccg ggcgaagctc gccgaggccc gttccagggc ggcgaatagc cgtcggggcg     34500
     gttcagtgag ctccggccta tcgaagatat ccatttcttc gcacctttcc tcatctcgtt     34560
     tgtggcgatt tttttatggc tttaaatcaa ttatatagag cgtttttacc gaaaaatttg     34620
     atcatagaac ttgataacca ttttttttca tgtgccaggc gtcgccatca ccgcccggct     34680
     cgccgcttat ccgatgacca gcccaacgcg cccccgagat tccgtggttc cgggtgtttg     34740
     aaatagcggc gctgaggcgt ctgccacggc gctttgggcc cgcaatcctc gccaggccag     34800
     ctttgcatcc agccgcaacc tgttctggct gattgggagg gatcggcctg tggttgttgc     34860
     catctgctgg ccggcgatct ggcaaccttt acaaacgacc gtttatcgat ctcatattca     34920
     attgtaaaaa tagcatccga caggagtgtg accgccgtga agccgccaaa gcgtcgaaat     34980
     gtccccgcga caggccggct gatcggctac gcccgcgtgt caaccgatac ccaaggtgcc     35040
     gatccgcaac tcgatgagct gcgcgccgcc ggatgcacca ttatccacga agagcacgcc     35100
     tccggcgctg atcgcggccg gccggtatta atgcgcctgc tgaaggaaat ccgccccgga     35160
     gaaactctgg tggtggtgcg gcttgatcgt ctcgcccgct ctgtcagcca cttgcttgcc     35220
     gtcatcgagc agctggaaac cgcaggggcg catttcagga gcctgcgcga tccgatcgat     35280
     accacaacac cgcaaggcat gttttccctg caggtgctcg gcgccgtcgc gcagctcgag     35340
     cgggcactca tcgccgagcg cactagggcc ggcctgcttg ctgcccgcag ccgcggacgt     35400
     atcggcggca atccgggcct gcgcgcgcgt gacccggaag ccatccgcaa gatcaaaaag     35460
     agtcgcgatg cagggtatct caacacagtg ctcgcccagg tcgacgcctg gctaccgacc     35520
     gtccgcagga tgcggcccga ccagccctgg ggggatgttg tccgggttct caaccgcggc     35580
     caggccacac cagcacatca cgcttccggc agaatctgga ccgtcgagcg actgcgccgc     35640
     accgttcatc ggctcgttgc agaaggtttg gctgaccgca ccctactggg tcgtgctcct     35700
     ccacagcgga gtgatgaccg actggtacgc ctggttgctg gcatcaagac ggcggcacct     35760
     ggccataccc tgcagcagat cgccactcag ctcgaggcca tgcgtgagcg cacccctcgg     35820
     ggtggcacac gctggcatcc atcttcggtc aggcacttgc tcatcagggc cgagcgcctc     35880
     ggcttactcg ccacacctat cgaccacacc gccactacgc tccagtcttg agcctcccga     35940
     tttagctggc aggggcacaa tctccttgtt acacttagtt agctatgacc tcctctccgc     36000
     caaatatcga gacaaccagc gcgagtcaga tctatcaaca tgcctcgctc caaccgagcc     36060
     atccgcaata ttccgcttct gacgcgtggc tcgaaccggt gcagttggct ctgttcccag     36120
     agcaggtcag cctcacccgg atccgccccg aacataacga aaagcggtac tatccggaat     36180
     tatgcatgaa ggttggcgag catagcgtag tccattgatt cgatgtaaga atttgttgtc     36240
     gagacaaatc ttcaccacga cggaacgcga tgctcgcctc ggttgcaaat accccaattc     36300
     tccctggtct gtcacctgtc gccggcaaat cgatcgaggc ccgcttcgac ggcgagatgc     36360
     tgtcctctga cggcggtctg ctggcattgc gcgaggtcga gaagcggctg gggattgccg     36420
     cgcagttggc agcctgcatc gatgatccgc gcacgccgga gcgcgtccag catgggctcg     36480
     acgagatcat tcggtttcgc atgttgatga tcgcggccgg ttacgaggat ggcaacgacg     36540
     ccgaccggtt gcgcaacgac ccgatgttca aactcgcgat ggagcgtctg cccgaggcgg     36600
     gcgatctgtg ctcgcaagcg acgatttcac gcaccgagaa tttgcccggt cctcgcgcgc     36660
     tgctgcgcat gggcctggcg atggtcgagc attattgtgc gagtttccgc accataccca     36720
     accgggtcgt gctcgatatc gacgatacct tcgatgccgc tcacggcgcg cagcaactct     36780
     gcttgttcaa cgcacaccac gatgagtacg gtttccagcc gattgtggta ttcgacggcg     36840
     acggccggat gctcgccgcg gtgctgcgtc cggcgtgccg gccaaaaggt agccagatcg     36900
     tcaaatggtt gcgccggctg atcgacgcca tccgcagcca ctggccccgc accgcgatca     36960
     tgctgcgcgg tgattcgcac tactgcacgc cggaggtgct gcggttctgt cgggcgcgtc     37020
     gcctcgatta catcttcggc gtcgcaccga ccacgacgct gcgcaagcac gtcatcgcgc     37080
     tggaggccag caccacggcg cgcgcgcaac aagctccggg agagaaaatc cggcggttca     37140
     aagagttcaa tgatggcgca gcaagctggg accgcgtcga gcggatcatc gcccgcgtcg     37200
     aggccgggcc gatgggggtc gatacccgct tcatcgttac cagcctgaag gcaggttccc     37260
     cgcgcaccct gtatcaagag atctactgcg cgcgtggcca ggccgagaac catatcaagg     37320
     cgtggaagac ccatcttgcc gccgaccgga cctcgtgctc gcgggccagc gccaaccaga     37380
     tgcgcctgtt tctgcatatc ggcgcctact ggctgatgtg gagtttgcgc tccctgatgc     37440
     cgcgccggtc gcgctggcgt ggtatccagt tcgataccct gcgcctgcgc ctgatcaaac     37500
     tcgccgtccg cctcgaaacc ctgaaacgct cgatccgtct gcatctgccg cgctcaatgc     37560
     cagaccaggc gatcctcggc tatgccctgg ccagactgcc caggctggtc atctgatcac     37620
     aggggcgttt gccccgtccg gtcccgatct ctgccacatc caacgccaac acatcataga     37680
     gcccaccaaa accagccaag ttcggccggt aagccatcac gcccgcacga cgtcaggttg     37740
     aacagaccgc ctgagaaaaa tcagaggaaa tgcgctcgtg aataatcccg gctatcatat     37800
     cgagatcgtt acagacctgt tcggcgccgt aggcctcgca cgaacctggg ggcggatcgg     37860
     acgttccgca cgctcccggt ttgaccccct gcccgacctc ggcaccgcca tcgatgcact     37920
     ccgccatctg gctcgcacca aacgccgtcg cggctatcag aaccgctaat ctgtcaaagt     37980
     caggttcagg cgcaatcgaa acgcaaatct tgccgagacg cttctcggct acaccgcgca     38040
     gcccagatac cttagttggc agagcctcat gatttaccgc cccgccgttg cacgtcgtgt     38100
     ctgccgctcc tgctcgggct gctcggctcg ttccgcccgc cggatttcag caccactctc     38160
     ggccgcgcgt tgccaatagc cgcgcgcctg gtcgcccgcc tgggcgtcat cagaccgccc     38220
     tgcggcctgc cctgccttct gctcggctcg cagcgccatc aaatacccgg aaatcttctc     38280
     ggcatcggca gccgcccgga agatctctcg cgcgtcttgc tgcaaggctt tgatccagct     38340
     tccgacatag gccgcatgct ggcccggatc atgtccgacc cccagcttgt ccgcgatcat     38400
     cagcgaggcg atctccgccc ttagctcctc ccgcgcatag gcttccgatc cgaacggagt     38460
     gccaaggtcc ggccggttca gccgcgaggg atgccctgtg gcgtggccgt tatgccgata     38520
     tcggcataag gggcataatg ccgtgattcg gattatgccg catgacctcc gctggaggtc     38580
     ggtttgcccg gcattggcca tgcggctgtt cggcataatc agagcccttc caggaacgcg     38640
     aggagttggt cgtcgggccg gaaccggctc gacggggtgt ctggggcggc gacgcgagcg     38700
     agcgcttttt ccttcagccg catgtctgcg tggatataga tctgggtggt ctcgacgttc     38760
     tcgtgaccaa gccagagcgc gatcaccgct ggatcgacgc cgtggtggag caggtccatc     38820
     gcagtgctgt ggcgaagcgt atgcggcgtg acccgcttgg agccgatgct cgggcacgtg     38880
     agcgatgccg tcaggcaatg cttgcggacc agatgttcaa gggcatcgcg gctgagccgt     38940
     tcgccccgga tcgacgggaa cagcggtttg ctcttgttct tgtcgtcgcc gatccacgcc     39000
     gccagaagtt tgaccgtctc gcgccgaagc ggtgtggcgc gttccttccg acccttgccc     39060
     atgcagcgga tgtgcgcacc gctctcgagc acaacgtcgc cacactgaag gccgaccagt     39120
     tcggaagccc ggagaccggt ctgcaccgcg agcagcagca gcgcgtggtc ccgccgtccc     39180
     gcccatgtcg tgcggtccgg cgctgccagc aacgccgcga tctcgtcgct atcgaggaac     39240
     gtcaccgtcc gcttcacata gcgcttgttc ggcatggcga ggatgcgttg gcattgcagc     39300
     agccaggtcg gatcgctcat cgcgacgtag cggaagaacg atcggatcgc ggcgagccgg     39360
     gtgttgcggc tgcgcgcgct gttgccccgc gccgtctcgg tgtggacgag gaagtcggcg     39420
     atcagatcag cgtcgatgtc ttcgatcgtc agcttgaccg gcggcttgac gtgtcgggca     39480
     ctcgcatacc gcaacagcag ccggaacgtg tcgcgataac ccgcgaccgt atttcggctc     39540
     gcttccatct ggacgcacag tcgatctgtg aagaagcgct ggatcagcgc gggcaaggcg     39600
     gcggcgctca ttggactgcc tcccggccat cggcggtcgc tcgcgccatc gccagatcga     39660
     gcagctccgg aaccgcttcc agataccagt atgtgttgga gggatcgcta tggcccagat     39720
     aggtcgtcaa ccggatcatc tcgcgcgccg ggtctttgcc ggtgcggtac cagtcgatca     39780
     tcgtcttcac cgcgaagctg tggcgaagat cgtggatgcg cggtccccgg ccatgcttgc     39840
     agtatggctg atgggtccgg agtccgatct gctggcaggc ccgcgcgaag ttgtatcggg     39900
     cagcacagtc ggtgaggcgt gtggccttgt cggtgacgaa cagcggcttg gccggatggc     39960
     cgatcagccg atcgcgttcg gcaagatagt cgatcagctg cgtgacgacg ctcgggtcga     40020
     gcggcagcaa ccgctctttg ccgagcttac cttgtctgac gcgcagcacg ccatgctcgg     40080
     cgtcgaggtc gtcacgatcg agggccagtg cctcgctgat cctgagcccg gtgactgcga     40140
     taagcccgaa cagcgtcgag caggtcagcc cacgcagacc gtagatggat ggcaactcct     40200
     tcgccgccac gatgatcgat ccgatctcgg tctcgctgta gatatgcgga cgcgaccgct     40260
     ggacggaacc cggcagcagg cctcgcggcg gcacttcatg cgccggatcg aagctgctca     40320
     gccattgcgc gaacaggcgc acgacgctga gccttgccgc tcgggtcgag gtgcaggcct     40380
     cagccaacgt ggcgtgccag cgaaggaaca gcgccgtatc gatgtaagcg gcgccttcgc     40440
     gatcggcgaa ccgggtgaag cggcgaagga tgcgctcaga ggtaccaaga tcgtagccga     40500
     ggctgcgccg gacgttcaga tagcggtcga gctggatggt gaggctcatt gcgcgcctcc     40560
     cgccgccggc cagggctggg cgatcgaccg cagcccgtcg atgtcgagcc gcgcatatat     40620
     catcgtcgac gaacgcgagc ggtgccgcaa cacatcgccg acctcgtcga gcgatgcgcc     40680
     cgtgttcacc agccgggtcg caaggctatg acgcagcagg tgcgatccca cataaggcgt     40740
     caccggcttc tggccggtcg ccttcaaggc atccttgagg atggcgttga cgatctgccc     40800
     gtccttgaac ggtcgatgcg gcgcgcgatg ggtgacgaac atcgtgcggc aggtcgccgg     40860
     ccctcgttcc tcacgaagat agcggctcaa cgcgtcgccg acctccacgg tgatcggcag     40920
     gcggtcgtgc agcttgccct tgccgcgcac cagcagttcg cccgcacgcc agtcgatatc     40980
     gtcgagctgg atcgcgatga cctcggccgc gcgcaggccg agccgggcca tgagcagcag     41040
     catcgcatag tcccgcgcac cgtgccgttg attgtcgcgg acagacgcga gcacggcctc     41100
     gacgccattg ggcgacaggt ggcgcggcag tctcgcgccc caacgcctgg ccgtcttcgg     41160
     cacgctcagc gccagattgg tcgccgtagc cccgcatccg aacagatact gaaggaagat     41220
     gcgaacatgg gtcgcaatcg tcttgtcgcg acgtgcgccc gccagcacat gctcgatgaa     41280
     gccgattgca tcggcgggac gcaagcggcc cggatcgacc atcgtctcgc cgaagcgatg     41340
     gtcaaggaac cggtcggcga agcgcagcgt gtggtagatc gtacgctggc tgaggccccg     41400
     ttgcttaacg agataggtct cgaagttagc caacaatgcg gcacgcgcga tccgcgcttc     41460
     ggtcagcggc accggctgcg ccacgccgat atcgatcaga tgcccggcga accggcgcgc     41520
     aagattatgc gggcagacgg tctggccatg ctttcgcggc accatccgtc ccagtcgttc     41580
     ggcctgattg agcgtcaaag cggaaggctc gatcccttcc gcgtccatca cttgcccgag     41640
     cttcctgatg atcgaccggt aactcttgat ggtggccgct ttgtaattgg ccacggcgaa     41700
     gctttcaccg aacgaggcca ggtacggatc gacgcaggtt tccagatttt cagacatgat     41760
     cttcgtgctc catgttgtcg gagcgacgaa gattatgccg aatggacgca gcacgatcat     41820
     gctgccagcc gtgccttctc gacggcgcgc ggcataattc ggattacggc attatgcccc     41880
     agctcatgca gcgccgtgct gtaaaaccga tccgccgcct tgaattggtc gcgctcgggc     41940
     atcgtgaccc gatcttgcgc cagggtgtaa aaggcccggt cgcccggccg gtagatgatc     42000
     ggcaccccgg aattgctcat gatgtgctcg gccgccgcgt gccgttccca ttccgccagg     42060
     gcgggccggg cctcgatctt cggcatgccg gcgatctgtt cggcattgaa cacaacggcc     42120
     gaaaacaccc gcggccgttc cagctcgacg ctgcggtaaa cctgattgcc ttcggcatcc     42180
     ttcaccggcc gtccctgctc gtccttcacc ggcacccggt caaacttctt gaaatactgg     42240
     atcagcgtgc ccttttcgcc cttcatcacc tgggcatcga ggctctgcgc ctgcttgtag     42300
     gtggtccagc gcggatcgct gtagcccttc atctcggcca ctgccatcag ccagattgcg     42360
     ttgccgccct ggtaatcctt gccggtgatc gcgttgtagg gaatgaaccg gaggccgctg     42420
     ggctcccacg gcttcaccca gggtgcggtg ccatcctcca actgcttgac gatcgaggcg     42480
     gcaaccgtct gggcataatc accagccatt ggtggcctcg ttggtattct ccacgtccgc     42540
     attggactcc caggcattcg cctcatcgag tgccgtttcc tcaaccagtc ccagctgctc     42600
     gacctcagcc gggtcgatct ccaccatgac gcccggccgc atcagatcgg ccagatcgcg     42660
     cgagatgatt ggttgcttcg ggtccatcgc tgtcctcctt ctcaacgtgc tctgtatcgt     42720
     ccagcgcaat cggacggccc tacctcggcc ccctaccctt ccccggcacg cgcgggaggg     42780
     ctgcgcaagc caaccttgtt gcacaagcca tcggtcggat cggactcata ggatatggtc     42840
     ggagcagtgt tgcggtgcgg ctcgggatct tctgccatgc ccgcaaaccg aaccgggggc     42900
     attagcgctt gccccggatc gcggcgatca tccggcgatc caggcccgcc atgtcgatct     42960
     ccccccgaat acaccgctca ttcacggcct caagctccgg gtgatgaaca taaccctggc     43020
     ggctatcgcg cgacaatcaa cgtgagaatc cagcgtcaat caggatgaga atgcggctgg     43080
     agaggcaccg gcggagggcg tagcccggag ccggtgcctc cccagccggg cggcgtcctt     43140
     gccagggcgc cgccgtggtc gcggccgtct gggccgcgga ggataccccc tcacaacggg     43200
     gagaccttcg tgcccggccg ccacatcaac gaccaccaga agaggctttt catgagatat     43260
     cgacagacag acggcgttgc cctggcagcc gccagggccg gcttcagcac ggccgcgggc     43320
     taccggctcg agcaggagcg gcacttaccg tcatcgccga agccgccgcg cggccggcgc     43380
     cgcccggatc cgctggcgac gatcttcgac gctgaggtgg tgccgctgct ggaagccgcg     43440
     cccggcctca gggccgtggc gatcttcgag gagatgtgcc ggcggcatcc cgatctcgcc     43500
     ccgggtgtcc ggcggacgct cgagcggcgt atccgcacct ggcgcgcgct gcacgggccg     43560
     gagcaggagg tcatctttcg ccagacccat gagccaggcg cgatgggcct gtccgacttc     43620
     accgatatga acgagctcgg catcatcgtc gccggcgccc cgctcaacca ccggctctat     43680
     cacttccgcc tggtctggtc cggcttcgag cacgcccatg tcatcctggg cggcgagagc     43740
     tacgtcgctc tcgccgaggg gctgcagaac gccctctggc ttctgggcgg cgccccgcgc     43800
     gaacatcgca gcgacagcct ctccgccgcc ttccgcaacc tcaccgccga gaacgtcgcc     43860
     gacctgaccc gccgatatga cgcgctctgc gcccattacg gcatgacccc gtcgcgcaac     43920
     aatcgcggtg tcgctcatga gaacggcgcc atcgaaagcc cccacggcca tctcaagcgc     43980
     gcggtccgcg acgcccttct cctgcgtggc agcacagtct tcgtcgatct cgaagcctac     44040
     cgtcgcttca tcgccgagat cgtcggccgc cagaaccggc accacgccga gcgcatcgac     44100
     gccgagcgcg ccgccctgca gaaactcccc gatcagcgca ccgccgatta cgaggagacc     44160
     gtcgtcaccg tcacctcctc cggcggcttc accctcagga aggtcttcta caccgtcccc     44220
     tcccgcctga tcggccagcg gctccgcgcc cgcctctatg acaaccggct cgagctgttc     44280
     ctcgccgcca ccccgctgat gacactcccc cgcggccggc cacaaccgga tggcaggcac     44340
     ggccacgtcg tcgactaccg ccacgtcatc cacagcctgc gccgcaagcc gatggcgctg     44400
     ctcaacctcg tctatcgcca ccagctcttc ccgcgcgatg cctatcgccg gaccttcgag     44460
     catctgctcg agcagacacc gcccagggac gcgtgcagga tcatggtcga actcctcgcc     44520
     atcgcccatg agcgcgcctg cgaggctgaa ctcgccagcg tcctcgccgc cgatatcaaa     44580
     gccggccgtc agcccgacct caaggccatc cgccagcgct tcgcacccga tcccgccagc     44640
     ctgcccgcac tcaccatccc gaccatgccg ctcgccagct atgacatcct gctccaggga     44700
     gccgccgcat gagcgagacc gcacgcaccg tcgacgccca gcgccttacc ctgctgctca     44760
     acgagctcag gctccccgcc atcaagcagg tctggtccga cttcgccgcc cgcgccgaca     44820
     aggaagcatg gcccgccgca cgcctcctcg ccacgctcgc cgagcacgag gtcgccgagc     44880
     gcgaccgcag gcgcatcgag cgccacctcc tcgaagccag gctgccgccc ggaaagacca     44940
     tcgccacctt cgccttcgag gccgtgccga tgatctccaa ggcccagatc ctcgccctct     45000
     gctccggcga cggatggctc gagaccggcg ccaatctcct cgccttcggc ccacccggcg     45060
     gaggaaagtc ccatctcgcc gcagccatcg gcctcgccct cgtcgagaat ggctggcgcg     45120
     tgctgttcac ccgcacctcc gacctcgtcc agaagctcca gatcgcacgt cgtgaactcg     45180
     cactcgaggc caccatcgcc aagctcgaca aattccacct gctgatcctc gacgacctcg     45240
     cttacgtcac caaggatcag gccgaaacct cggttctctt cgaactcatc agcgcacgct     45300
     acgagcgccg ctccctgatg atcaccgcca accagccctt cggcgagtgg ggaaaggtct     45360
     tcccagatcc cgccatgaca ctcgccgccg tcgaccgcct cgtccaccac gcaaccatct     45420
     tcgagatgaa cgtcgaaagc tatcgccgca aaaccgccat ccaacgacga gccggaccag     45480
     gacgcccacc cacacgcgcg acaatcaacg aaaacatcag attgtcgctc cacgacaatc     45540
     aagtcgccga aacacgcttg ccagcatcaa accaatccga ttaacgttcc gaggtcgcga     45600
     tcactttctc atcctgatcg ccgcgcttct catcctgatt gtcgcgctac aggcggctat     45660
     tcgctgcacg ggcctgctcg atcgcgcgcc agcgctgcat catctcggat tccgaaattt     45720
     tgctgaccag ccggtccatc ccgcggcgcc tctttacgac cggaagtaga ggttaagaag     45780
     aagcgcagcg aagttcaagg aacctcaaag gttcatctcg gctctgcgga tgtctgtctt     45840
     ggaaaaatca tcacctttga acagcagcgc cgcccgataa gatttggcag cgccataggc     45900
     aaagcaatcg cccatattca aggcggccgg atgccgcccc ttcccgaaat cggcataagc     45960
     ctggatcgcc agatcatact ctcgctcgcc aagagaaatg acctcgatcc cgagtgcgct     46020
     cataaagctc ttcacctttt gccgggcgcc gtccatcgaa aggccgaagc tgcggcagag     46080
     cccggccgtc gcctcccaca tggcaaccgg cgagacgaga cgggtgcgtt cctgggccag     46140
     aagatccgcc agcatgtcgg catcctcctc gccggcgatc atcgcgatca gggccgaggc     46200
     atcgatgaag atcattcccc ctcccccgac agatcatcga aaaatgcctt gtctgccttc     46260
     aaccctgtgg gcggcggcag cggattggct tcgcgccact cacgcaggcg ctcgcgcaag     46320
     ggcttggctt cgcgggttcg gtcaagctcg gcctgcaccg caagccgcac ggcatcctgt     46380
     ttggttaaac cccgctcttt cgccagtttg gcgacaagct cggcggtcgc attatcgcgg     46440
     atataaaggg gcatgggcgc ctcaagatat tcaaatattt aattttagat atatgaatat     46500
     ctgcactgac acaaggacat tcaccacaaa atcgcctgct cgcccgccaa cacaaagaac     46560
     acgagggccg cccctacggc caaaatccaa agctgacgtg tgcaggcagg cttgtgccgc     46620
     ctcatgcgcc gcctgtgcgc ggcagacagg acagcctgcc gcgattgccc ccggaacctt     46680
     tccagggcct ccaaggccgc cagagcgcgg ccagaggcgg cccctgccct cgtcatctcc     46740
     atgatcgcac tcgtgagcga aatcatgccc ggcactggct cgccggcaag ctgcacatgt     46800
     cccgccagga ttaccaatgg gcggacgggc acttgcgtca cccggcggat cacgtcgcga     46860
     tgggtctcgt tctgcagaag cgggttatag accctctgcg cggcgccatc cggctttttc     46920
     agggtccatt gctgggcatg ggcgtgcccc atcaactccc cgcgccaagt ctttgtttcg     46980
     aggcaataga ggcagtcgcc ggccgccgcg acatgatcga tctgatgcgt cccgcgccga     47040
     tcttgcaagg tgatatcgtg gatcgcaggc acccctgccc tctccaacgc acgcgcgacg     47100
     cgcttttcgc cggccgcgcc ggcgcgctgt gcatgggtct ctgtggcctg gtcggtagga     47160
     cgcgtgatga tcgcggcagc tgccgcgccg gtcgccacca tgccactcac caactcgacc     47220
     agcaagacaa tcataattac atgtttacat gatgacgtgt tttcataatt gcattattca     47280
     tcgcgtacct gcgggtaatt gtatttcacg aaaagcagat tcaacgcttc cgccaccaaa     47340
     cgctcttgcg gcacccgctt gcccttctcg tcacgggtgc ggaagctgat ttcttccaac     47400
     gtctcccaat aggcgggtgg gagatgatgc gtcttggcgg tcttgtttgc cctggacggt     47460
     ggcacatagg aaccgccttg cggctctacc ttctgcggta ggggaggtga aacaaccgcg     47520
     gcctttggct ccgccgaggg ctggcggggt gccggtaagg tttccggctc gcttgattta     47580
     agcgctgatg caaggagaga aggcttccgg ctcataattt catgctttca tgcttacctg     47640
     taatcatgct tccttgttca gttaagaacg cgaaaagctc tgcgatttcg cgggccgccc     47700
     tgcccttcgg ctcgtattcc tggggggatt gccccaaggc tggagcatct tcgtaagctt     47760
     tcaaccgcga catatggatt ggggcaacgg gcaccttgaa ccgctcggcg atggcggcgg     47820
     catcttctcc tgcacgccct gccgcgttgg gatgcacttg gttgagcacc acaaaagccg     47880
     gcggattgcc cgccatcaca agcagccgtt tcagcggttc caaagtatcg atcgcgaaga     47940
     tctgggcctg ggtcggaatc aacacgagat cggcatgctt agcagcctct gttgaggcgc     48000
     tatccatttt gccgggggtg tcaataaaga cccactccat cccgagtttg cggtaagcat     48060
     caagcgagcg gcggattgca ccaggctgga tcgaggccac atccggcccg tcaccctggc     48120
     gccggtcaaa ccaatctact gcgttggttt gcggatcgag gtccagcaag gcggatttct     48180
     ttccggcgcg atgcgccgcg accgcaaggg cggtagcaat cgtcgtcttt ccggtcccgc     48240
     ccttctgggt gcagaaagca actgcaagca tgtttacatc ccttcatgaa accctgcttt     48300
     catgctgaca actaagcatg ttcgcatttc attattccca cgctatcgct gattatgcaa     48360
     gcatggtttc atggtgtcat ggaactatta ttccatgatt acatgtaggc atgtataatg     48420
     attaggcgac gggttaaacg ctgctatcga gcctattgca gatatataca attttttgta     48480
     taaacctcct atgcctgagc gttcaaagct aatcgaattc aggggcggtg ccctcgatga     48540
     tctaagggac tttccgatat ccgcccgccg tgaagccggc caccaactgg accaggtcca     48600
     acaaggtcat gatcctgacg attggaagcc gatgcgaacg atcgggcaag gtgtgcgcga     48660
     aattaggatt cgggatgagg caggagcatt ccgtgtgatt tatgtcacaa agttcgcaga     48720
     cacaatttat gtcctgcact gctttcagaa gaagacccag gcaaccagta aaccggactt     48780
     ggaattggca acaaagcgat accgggatct agtgaaggag ctaagctcat gagcaacgaa     48840
     cgatttacaa gcgtatggga cgcgatcgag gacacaccgg ccgaagccga aaatatgaag     48900
     cttcgttcag cgctgatcat ggcgttgaaa gagcggatca cccgcgaagg cttgagccag     48960
     agccaagcgg ccaagctttt cggcgtcacg caacctcgca tttccgatct gctgcgcggc     49020
     aagataaacc tctttggcct ggataccttg gtcaacatgg cggtcgcagc cggtttgcat     49080
     gttgagttga gggtgctgga agcggcgtga ggcgacagac gctcgcagaa cgccaaaacg     49140
     ccatcacgct tacatgtaaa catgtcacta tattttcatg aaacatgacg gaaaagccta     49200
     ttttttatgg gcgctggcac cacgtagccc ccagatcgta cggtctaaat gcaagccacc     49260
     gtcacgcgcc cgctcgacca ttccatgaaa atatccgccg gggctcgacc ggaaatggcc     49320
     cggcggcttg gcagaaacca aggcgagagc gattgcggct tgttctcgcc ccattgccag     49380
     gcatgcctcg ccccaaagcg gtttagacac gccgaggtca tgccggagcc aatcagcggc     49440
     atccacgatt tccggccaag aaggggaggg gtgtcgtaga taaggcacca atcggggggc     49500
     caaacgaacc aactcgtccg gggtcaattt cagtgaggaa ccccgatcct gcctttcctg     49560
     cctttcctgc ctagctggcg gcttcgtctg tgccgttcta cccggcaggt cgccgcgact     49620
     acattccttc aatgcgatta ctgtatcctt attaggataa aggatttggt ttgtagttgt     49680
     aatgtggggc acatcagcgt gccccttggg gcacatttcc acagattcag aaatgcttgt     49740
     ttgctcccga gaagcgccag caagcgccat ctctagcgcc cggcgcgcat caaccgcgat     49800
     cgcttccaga gcctccacgg caggcttgag cctctggctg ctatccaaag ctttgagccc     49860
     acggcttgcg gcctgagcgg ccgttctaag gggcgcgggc agatcaattt cctgctcccg     49920
     aaatgtctcc cacgtctgcc gcaagctcgc acgggcgatc gaagcgcgcc ggcgcaactt     49980
     ggctacagca gcgcgttcct cgcggccggc ttctgccaaa gcgcgaaact cctcgatacg     50040
     ctgtgcgata ggggagaggt caaagccata cgcctcgata atccggccag accgatctct     50100
     atggccgtag cgtttgccgt tggggctatc tcgcatggtg acaaccccca gctcggccag     50160
     atggcggttg aggcgttttg tctgggtctc cgtgatcccc agttcagccg ccatcatggc     50220
     cgcgctcggc caaacaatgg gccgcgctcc aggttgccaa tcctggggct gtgtgaacct     50280
     gaaaagccaa tcgatcgcct gcgccgcgcg tggcccgatg ccgaggaacg gagctgctgc     50340
     tttgaacgca gccagcgcct gaccgggggt gacatcaccc ccggcaaact catcggcaag     50400
     gcggccggtg ggcagcatag caggggttaa acggcgcaag ccggttggac gtgcgggaag     50460
     ggaagggggc acgtgccccc gctccgcctg gtggggcagt tgcatggaaa ctcctacggg     50520
     tatgggtgaa acccgcccgg taggggctga aaccggcacg cgactccccc ttgcaagcta     50580
     gggcttgcat ttttgagggc tctgaggcat tttggctgag cgttattcga tttcgtgacc     50640
     acagtttgcc gctgtcggac acggttacag ccaaaaacct atgtcgtttg cagatcccgt     50700
     cccttgtggg cgggattttg cttttctagg tgtgtttcgc ggtcattcct cctgtgtcaa     50760
     agaaaagcat agcccgcgac tcgcgctggc taatccgggc acctgcgatg atggctgccg     50820
     tgcttgaata gagcaacgtc atcacgcggt aagcttgggt ttcgaggaag cgtcctatgc     50880
     gatgagacaa gtttacccac tgttttgaat cgcaggacat tggtcgagtc atgtgcgcga     50940
     atcgggaaaa ccgatgcgaa cagcagatgt caggcataag gatcggatgt gcatgggcaa     51000
     gctggaggag tcggcaaaga tgccgataca gagccctaaa aggagaactg gcgaactgtc     51060
     ggccatcgat ggccgcttgt tgaaagcccc tgagcgatcc gtattcgggg acaatgtgag     51120
     agccggccga aatgcgctcg gtctttcgct gaccgacatg gcgcatctca tcgaggcgga     51180
     tcgcgcctat atcggtaagg ttgagcatgg aaagatcaac gtttccattg atcgcatgtc     51240
     ctcgatcgcc gctctcttta acgtgcatct ccatgaactg ttgcaacccg aatttgcatt     51300
     gagctataaa aacatacgat ctgagtcttc gcaaacacat ccgagcaagc agcttacggc     51360
     tcccgctaaa ggacggcgac gatctaaaga cgaatgaatt atcatcccgg ccattttgcg     51420
     ctgcgcggca aaggcggggg aaaatccaac aagaaacatg acgaggatgt aattgcgtcc     51480
     tcatgtttaa gcccatgtct atctcgacgt cccgctaggc ccggacacct ggctaggaga     51540
     ttcgagttca tcctctgcga tgttctcctt aagcattttg atacgccgct gggcagcttg     51600
     acgaactgcc cgcgcgcaga actcagccag agattcattc gccgtcagat acccgagaag     51660
     ttcgggatat acgtccaacg aacggatcgc gatctcaagc tcgactgctt cccgcaaaaa     51720
     ctccgatcga tcttctcgct ctcggagcag gtccgagata gccgccaacg cgaccgttgg     51780
     cagcaaaacg ttgatcgccc gcgcatccat tttccgacgt cccatacgcc gattgtaagt     51840
     atgccgcgcc gattcctgca aaaacatatc ctttatgtga tatttaatat gattaattga     51900
     ctaatatagg tcggtttggc aatatacaat ttatgaaaaa ttacagcatg gtagccagat     51960
     cgagccggaa ggacgggaaa tgctgatcac cccggcccat ttcctcgctc tcgcgaatcg     52020
     ctgcgccccc gaggtcgcac cgggcacgct ggcggcggtt gccagcaccg agtcggggtt     52080
     caacactttg gcgattcagg acaacaccac gcgccagagc atgcggccat cggatgtgcg     52140
     tagcgcgata gccgtagcca gacggctgat tgctgacggg cattcagttg atctcggcct     52200
     catgcagatc gatagcgcga acctcccccg cttgggcctg actgtcacca cggcctttga     52260
     tgcctgtgca tcggtacggg cgggcggcaa gctactgacg caggactaca agcggccgga     52320
     cgggcagggc cgccaggcgg cgctcctagc tgcgctatca cgctacaaca cgggatcagc     52380
     ctggcagggg ttccagaacg gctacgtcag ccgcgtggtt tcaaccgcca aatatgttgt     52440
     gcccgaaatc gaccccgccg atagcgtgca agcccccaag gccagcccgt catcagcctc     52500
     ctcttctccg cacccgcctg cctgggatgt gttcccgaac tcgatcggtc cggctggctt     52560
     cgcgtcggcg catgcggtga cgctccaagc gtcccgcgct tctggcccca gcggcctcgc     52620
     tcaaccctca aaacaggaaa ctcgcggtga aacaaaggct cactaagctg cgcgatcgcg     52680
     tggcaaattt cgcggctggg acggtttcaa aaatagatcg aggggcatgg atccagccag     52740
     ccgtccttgt gacggtcggc ttcctcctgc ccgccgtggc ccatgcgcag gtcgtttctg     52800
     gcggcaccag cccgacaacc atcatcgaca acatcgcgac attcatcctc ggcccattcg     52860
     gcgagggggt tgccgtgctc gccgtggccg cagtcggctt catgtgctgg accggccgca     52920
     tgggcttcca tgcgatcggc tggctcgcgg ccggcctggt gctggtgttt ggcagctcct     52980
     acctcgtgac aaccttcgtg ggcggcggct gagccatgac cgagcggcag cgcgatccgc     53040
     tatttgtcgc cgcgacaagg cccgcgctgt ttctcgggct gccgatcgag atggccgtgg     53100
     tgatcatcat gatcgccgcc atgatcgtca tctttggaca caaccccttt tatctgacgc     53160
     tggtgctgcc gctctggttc ggggcgcgct gtctcgttcg atacgactac aacgctcccc     53220
     gtgtggcctg gctgtggttc cgcaccaagg ccaccggcgc cggtgaaaat caggcttggg     53280
     gcggggcgtc ccccgcgccg ttcccgatga aggtccagca gggcaggggg atgcgcgatg     53340
     ccggttaatc gaatcagggc ggaacgcagc gctgaacgct atttgccgta tctcggacat     53400
     gttcggccgg acatcctgct catggatgac ggcagcgttc ttgccatggc tgaaatcccc     53460
     ggcgctccct atgagctggc agccgatgca gatcgcgccg cgagcctggt cacggtcaat     53520
     gcgctctgca agaacgtcgc agatgacaat gtgacactgc actcggcctt tgtccgcgga     53580
     cctggggcgg ggcaactcgc acatgcggtt atgcccaatg agttcgcggc ttcgctcgat     53640
     cgcgcctatc gcgagcgcgt ccttgctggg cgcctctatc aaaacacctg gtatctgacg     53700
     gtgattgtct ccccccgcaa tccgctgggc ggcaaggcgg gcggcgccac ggcctcccta     53760
     ttcggtggca aacgggaacg ccagaagccg cacgcgaccg ccgagggcat ccgccagcta     53820
     gaggaggttt ggcaaaccat cagccaaacc cttgccccct atgatgttcg ccggctgggc     53880
     ctgcggccag ccgccaatgg ccagttctat ttcagcgaaa tcgccgaggc gctgcgcctg     53940
     atcctgacgg gcacggcggc gccggtgccc ctggtcagcg gcccgctcgg tgccgccctc     54000
     tacaccgatc gcgcgatctt cggccgccgc gtctttgaac tgcgcgggcc gggagtgtct     54060
     cggttcggcg cgatattcgg ttatcgcgaa tatccgtctg agacctatgc cggcatgtat     54120
     gatggggtct tttccctgcc gtgcccggtg gtgatggtcc atactttcga ctttcacgca     54180
     cggcatacct ctgaaaagcg gcttggcctg aaagccgccc agatgacggc cgcgaatgac     54240
     aaagccaggt cgcagatcag cgaccttgcg gacgcacagg atcacctcgc ctccggcaag     54300
     atcgccatgg gcgagcacca cttctcgctg acggtctatg cggacacgat cgaggagctg     54360
     gatcggctgt ccggcttaac ccgcacggtg atcgccaata gtggcggcgt cgtcgcgcaa     54420
     gagagtgccg ggctggaagc ggcctatttc gcgcaactac cgggcaacag aaaatggcgc     54480
     acccggccgg ggaccatcac cacacggaat ttcgcggcct tctctggctt cgaggctttt     54540
     ccgcgcggcc aacgtgccgg caagtggggg ccggccatgg cgcgcttccg caccacggcg     54600
     ggcacggcct atgattacgt gccccatgtc gaggatgtcg gcatgacggc gatcttcggt     54660
     aagatcggcc agggcaaaac cacgttcatg ctgttcctgc tggcgctgtt cccgcaatat     54720
     ttcgcggcgc gcaacggcgc ggtggtgttc ttcgacaagg accggggcgg cgagttgctg     54780
     tgccgtgctg tcggcggccg ctatctggtg gtgagggcag ggcgggatag cggcctggcg     54840
     cccctcaagg cgctcgacaa cacccctgaa tcggtcgcct tcctggttca gtggctcacc     54900
     gccctgatcc agcaagacgg gcacggcccg ctcccgcccg aggatgacgc tcgcctgacc     54960
     cgaggcgttc aagccctgct gcgcctggcc ccggacatgc gctcgctggc cgggctgcgt     55020
     cagttcctcg actggcgcaa tccgatgggg gcaggcgcgc gcctcgaacg ctggtgcaag     55080
     ggcgggtcgc tcggctgggc ctttgatggc gaacgtgatg acgtgtcgct tgaggcaacc     55140
     acggtcgggt ttgatctgac ggccatcctc gacaatggga ccgtctgtgc tccggccgcg     55200
     aattacctgc tctatcgcat cagccaggcg ctcgatggcc gccgctttgt gttgtcctgt     55260
     gacgagttca atttctatct gctcaatccg ctgttcgcca aaatctgggc ggatttcatg     55320
     ctcaccgtcc gcaagagcaa cgccgtggtg cttctggcga cgcaggagcc cgcgccggtg     55380
     ctcgattcac cgcagggcga tagcatcttg cgccagtgcc aaacgctcgt gttctgccca     55440
     acgcctggcg cggaagaaca tctctaccgc aaacggctca acttcaccgc cggcgagttc     55500
     cgcgccatcg ccgaggacat gctgcccaac tcacggcaac tgctcatcaa gcggcatggc     55560
     ggctccgcga tcatcgattt cgacctgtcc gcactgcctg agttcgtcgc gatcctgtcg     55620
     agccgcaaat cctcggttgg gtttgtcgaa cagctacgcg ccacccacgg cgacgatccg     55680
     gcggcctggc tgccggcgtt catggcgcgg ttccacgagg aagttgaata ggaggaccaa     55740
     atgctcaagc cctctcgccg gctcggaatc gccagcgcga tcgccatcct cggctttgct     55800
     tcacccacct tggcgcaagt cccggtgatc gatagcgcct cattggcgca aattgtcaac     55860
     cagctaaatg aagccaagca gcaatattct gaactcgtca gccaatataa tgagctgaaa     55920
     tcgacctata acgcactctc gcagaacgtg aatccgaacc aatgggcgca acagctcgat     55980
     caatcggcca tgcaggacac ggtgcccaac accagcatct tgccaaacat gctcgacggg     56040
     atcagtccgc cctcctcgct gagcggcaat gtcggctcgc tcgcgcaaca atattacaat     56100
     atgaacaagg tctatatccc ggccggctcg gatttcggtt caaagcagat ccaacagggc     56160
     gcgaatgaga ccgcgaattt cgaggcgatc gccacgcaaa atctgcaatc gctggaagcc     56220
     cgcgagcaag agctgccgca gattcagagc cagctgaaca gtgccacgac gattcagcag     56280
     gtcgcctcaa tccaggcccg cctctccgct gaacagaact atgtccaggc ccaacaggcc     56340
     caggcgcaaa acctgcaact attggcgttc gaggagaacc gcgcaggcca ggaagcagcc     56400
     gcacaagaaa acgcacaggg cggcgaacaa acgctctcaa cgctgtgcgg cgatgcccaa     56460
     actctcggcg gggagccttc ggcatgtcag ggacaatgaa actcatcatc tacgccctga     56520
     ttggtgccgg cgtgatcgca ggtggcgggg cttactacgt gtacgtcatt gcaccgccag     56580
     cggtgcaaaa cagactcgtc ccactgccga atagtggtcg tgagacgaac tctcaaatcg     56640
     acgccagtat cagggccagt tgtttggcgg cgggcaacaa cgccgttcca gcttgcaagc     56700
     cttatctcgc tgaaaagacc tcaaaataat gagcgtcccc aacacgacca tcaatatctt     56760
     tgagtttatg tataaccagt acagcaccgg gttcctgcaa tcgctgaata gcgatgttgg     56820
     ctccgcgttg tcggcggcat taccgcctct ttccgctgcc ctggtcatct gggtcatcat     56880
     cctcggatac ctcatgatga ccggcagcct ggatatacgt tacggcatct caaaggtatc     56940
     aacgatggcg atcgtggtgg gcattattgc ttcaacgtcg ctttatgatt cctacgtcca     57000
     gactcttttc atgaagtcgc tgccgagctt tgtcgccagc accttttcat ctgggaatac     57060
     gagcaacatc ccacaaagcc ttgatcagac cttcaataat ttttgggttg ccggacaaat     57120
     tatctacaaa aaggcaaact gcgcgacctg cgtgctcgaa ccatacgtgc ttggcatcga     57180
     aatcgagctg gttcttgtcg tcttttttat cgcccttgcc ctcgtgttcg cggtgtatct     57240
     catctcgaca acactgacgg gccttctcgt cgccatcggg ccattcctgc tgatcggata     57300
     tctctttgaa gccacaaagg gcatcccgga acgctggctc ggcaagctga tcggcctggc     57360
     gatcctgttg ctcctgataa cggcgcttct atcgctgttc accggcggca tgactgattt     57420
     tctgaacacc aaggtctcga ccacgttcac cgccgacccg gtgcaaaccg aaatcatcat     57480
     cctcggcgaa atcgccgcct ataccgccat cacggccttc atcacgatca tgcttcccgg     57540
     catcgccgcc tatattggcg gcggtgtgga cttcaatatt tccgggatcg tgaacccagc     57600
     caactggttc aaataatgaa gggctcacgc atgttgtctc gcctgattat cctcatgtgc     57660
     gcagccggcc tactggcggg ctgcgcggcc agtgacccgc tagcgacggc tcacgggccg     57720
     atgttcgccc tcaatcccgg tcattggtcg ccaagcgcgg cacagttggc gcgaccgccg     57780
     caggtgcccc actcatgaac gcggacatga aaaacacggc tttgccgatc gataacgaac     57840
     ggctcgccgc ttatttccag gatgtcgaat ctttccaggc cactgagaag cgcacagccc     57900
     gccgttgggg ccgtgtgggc tgggtggtgg ccggcgtgtc cctggcggtc aacgtgaccc     57960
     tcgcgggggc gatcgtgatg atcctgcccc tcgaaaagct cgtgcccgcc ttcatcatcg     58020
     tgaagtcaga cggcaccacc agcaccacca tgaatttcaa cagccttccc agcgatgaga     58080
     aggcggcgat gaccagggcc gcgatctggc aatatgtccg tgcccgggaa agctatgact     58140
     tcgccgacgc gcaatatcgg tatgatgttg cctcgttgat gtccaacccc acggtgcaag     58200
     gcacctacca aagctggttc ctcgataaag ggccaggcag caccagcccg caggtcacgg     58260
     ttggtaaaaa ggggcagatc agcgtcgcga tggtgagcat gtccatggtg cggccgaatg     58320
     tcgcgctcgt gcgcttccgc cgcaccgtga cgatgtacgg ctcagttccg cagacttcga     58380
     catggacggc aacggtcggc tttgaaaacg tcgcaaccct gccggtttca gcccgcctcg     58440
     cagaccccag cgggctcatt gtgaccaact accaggccca aaaggattcg ccatgacatg     58500
     cgcgcgcaaa ctcgcggcca gcgggttcct ctggctcggc atgatgggga cggccctcgc     58560
     catacagtat ccccatccgg ggcacgaaga cccccgcgtt cgctatgtgc cctatcagtc     58620
     cggcaacgtc accgacatct ggaccgcgcc aggcgcggcg ctgacggtcc agttcggcag     58680
     gaatgaaaag gtcgtctccg tcgcggaaag cgatagcgcc tatctcaagg tcgtcccggt     58740
     ccagaattac cttttcatca agccaaccgg cattctgccg gcacagccga tcgcggtcct     58800
     ctgcaagacc agcgacggca agctccggca ttactttttc cagttcgaga ccgtgaacaa     58860
     gcacctcggc gccggcgaga atgtcgatta cgccgtggtg ttcacctatc cgcaccaggc     58920
     gtatgagcgc cggcttgcca agcggaaggc ggccgaagcg aaggctgtcc agaaggaggc     58980
     caggagccgc cttgatgaag cgcgcgcggt catgaacgcg gcgacggtcg atcaatatca     59040
     ggggccgcgc aattacgaat atgtcgctcg tggcgatcat cagctggcac ccgccgaggt     59100
     ctgggacaac ggctattcaa ccgtgttcac cttcccggcc atgcagcgca tcccggccat     59160
     tttctacgtc cagccggacg gcaaggaggc aacggccaac tattcggtca acgggaatac     59220
     ggtcgttgtg ccgggcaccg cgccagaatg gcggctgcgc gatgggcata cggtcctcga     59280
     catttatgac ctcaaataca acccgaccgg cgccacgcca ggcacgcaca cgatcagccc     59340
     ggatgtcgag cgcgagatga ggacattcaa caatggcaaa tgaggacacg cccgaccgcc     59400
     cttatgggcc gatacgtcac accaacgcgg cgccgtcgcc ggttgaacag gaacaatctg     59460
     cggtcgccag ccagcagcgc ctcagcgggc gccagatcgg cggcattctt ctggcctgcg     59520
     cgctcggcgc tggcgtcgtg ctcgtggtga cccggctcac cgcacatcat gagccaaagc     59580
     tcgcccataa ggccgccgtg acaggcggga ccgagggccg gccattcgtc aacaatgcca     59640
     gcagcggcac gacgccttcc tcgaaacctg ccggactccc cctgccgcca aagcagaacg     59700
     cggggtttca caatccgttc ctgacgaatc agcaggaatc cccagccatg aaggcgctca     59760
     aggcaccgat catggcgttc aaccaaactg gcggtggatc atccgcgcaa cctgccagca     59820
     ataccgtggg ccagaatggc gctccctccg cgggatctgc gaaacctacg gccttcgcga     59880
     acaagctcga tgcggatcaa ttcagtgcgg ccgatgcctc gatgatcgcg catccgaatt     59940
     tcacgatcgc ggccggcacc atcattccct gcacgctgca aaccgcgatc aattcgaccc     60000
     tgccgggctt cgtcaaatgc gtgttgccgc agccggtgcg ctcgatgact ggcacggtga     60060
     cgttgctgga taaggggacg caggtgctgg gcgaggttcg cgagggcctg gtgcaaggcc     60120
     aggaccgact tttcatcctc tgggaccgcg cggtgacacc gcaaaacgtc gctattcagc     60180
     tcgcctcgcc ggcggccgat cccctcggcc gggctggcgt ctcgggggcc gtcaacaacc     60240
     atttcctcga acggttcggc gcggcgatca tgatgacgat catcggcggc tcgttgcagg     60300
     tcgcggcgaa cgccgcccag aacagcgccg gcaacacgta tctggaatat atgaactcca     60360
     gcacaaacca gatcgccaac accacactgc aacacacgat cgacattccg cccacactga     60420
     ccaagcacca gggcgagaat gtctcgatct tcgttgcccg cgatctgaat ttctccaagg     60480
     tctataagct gtcggttgtc tcgccatgag ggagggctgg cgcacccgcc tggatcgcct     60540
     gacgcaggca gggcagcggc tcaatcgcca tgtcgaaaag accgtcgtca aatacgttga     60600
     atggcaagat cgtcgccacg cgcgccggcg gcagaaattt ctcaggcaag gctggctcta     60660
     cagcacgctt ctagggctgt ggctcgtcct gatcatcttg gaattgctcg gccatcaatc     60720
     agccgcggtc atccatagct cggccggcct cggcctgatc ttcctggctc ttaaaatctg     60780
     gcactcggcc atggtcatca gggctaaaaa gcggggggaa ttatgaacgg caccgatttt     60840
     tccgatgacc tcgtggcgga aagcccggcc gcgccgctgc tccgcttcct gctcgccccg     60900
     ctgcaaccct ggctgaacga tggggccact gaggagctgt gcatcaaccg gcccggcgag     60960
     tgctgggtgc gccagcgcgg cgtttttgag cggttcaagg tgcccctcga tcgctcggcg     61020
     ctggaggata ttgccgtgct cgccggcgcg ctgcgccgtc aggatgtcgg ccctacctcg     61080
     ccgctttgct ccaccgaact gccaggcggc gaacggctgc aaatctgcct gccgccggcc     61140
     gtgcccaccg gtacggtcag cctgacaatc cgccggccgg gctcgacggt cgcgccgctc     61200
     tcctccgtca cctccaggta tcagtcggac ggatggaaca gttgggcgga aaaccgggac     61260
     acccggaatt tcgcggaagc cctggactac tacgattccg gcgatcttga gggcttcctt     61320
     gcggcggccg tgcgctgccg catgaccatc ctgctctgtg gcgccaccgg ctccggcaaa     61380
     accacgatga gcaaaacgct gatctcggcg atccccatgg cagagcggat catcacgatc     61440
     gaggacacgg cggagcttgt gatcccgcaa ccgaatcatg tccggctgct ctactcgaaa     61500
     gacggcctct ccaccgcgaa aatcgacgcc gaggcgctgc tgcaggccag cctgcgcatg     61560
     cggccagatc gggtgctcct gcaagagctc cgcgacgatg cggcatggac ctatgtgaac     61620
     gaggtggttt ccgggcatcc gggctcgatc accaccattc acggcgccaa cccggcccag     61680
     gcgttcaaga agctgttttc gctcatcaag ggatccccga agggcgctag cttcgatgac     61740
     gccacgcttt gcgatctgct tgcggcggct gtcgatctca tcatcccgtt cgagacttcc     61800
     ggcaccacct accggatcgg caaggtctgg tttggcccgg acgcgaccag gcgcggcgaa     61860
     acagccgccg ccctcttgcg ggccgcctga tgacctggcg cggcgtgatg cggctcctcg     61920
     ttgggctggt gctcggcctg gtgttcttct ccgtcctcgc cacgatgatc ttcctcattg     61980
     gaaccggact gttctggcat ttccggcatc cgttctggca atggtggctc tatcttttcg     62040
     aggccagcgg agatcctact gtacgggtct ggctggtcat cagcggcgtg ccggccttcg     62100
     cgatcccctt cctcgccggg gtcgttcagc ttgtgcgcgg ccggcgcgtc accggctggt     62160
     cactgcgccg cgatcacgcc ccgacaaagc ccgtcgatgc gccgatccgt gccccaaccg     62220
     acaaccatgg tcatgcccgc tggatgacga tggaggaggc ccgcgccagg ttcccggggc     62280
     cagccccgga atatggcggg cttgtcgtgg gcgaagcgta tgaggttcac cgcgacagcg     62340
     ttgccagtat gccgttcagg ccgaaggatc gttcaacctg ggggcagggg ggcaaggcgc     62400
     ccctgctgat cgatccatgc gagattggct cgacccattg catgatgttc gccggatcgg     62460
     gcggctacaa gacgacgacg gccgtctcca cgctgctgac atggaccggc tcggccattg     62520
     tccttgaccc ctcggtggag ctggggccga tgttgcgcca ggcgcgtgag gacatgggcc     62580
     acaaggtcta tatgctcgat ccccgcacgg cccgcgaagt cgggttcaat gtgctcgact     62640
     gggtcgatgt ctcctccccc ctcgcggaaa tcgatgttca ggccgtggtt gagtgggttt     62700
     gcggcgatac caaagcaggc ggcgatgaaa acgcctcctt cttcaagaac agcggcaagg     62760
     agctggtgac ggcgctgctc gcgcatatgc tctgggacga acacctggaa ccgcacgaaa     62820
     agaccttgcg cgccgtccgc gcggccatcg ttacgcccga aaaggagctg cggaacgtct     62880
     tggcccatat tcacaagaac tcgcaaagcc gcctcgcccg cgatctggcc ggtagcttga     62940
     aggacattgt ggatgagacc tttagcggca tctacaagaa cgccacccag gacacggcct     63000
     ggctttcaac cgccgcctat gcggatctcg tctccggcaa tgcgttccgt tgcgctgagc     63060
     tgacgctcgg caagaccacg gttttcatca acattcccct caaggcgctc gatgccaccc     63120
     cggccgtcgc ccgcgtcatc accggcgcgc tgctgaacgc ggcctatgaa gcggatggcg     63180
     tgatcgaagg ccgcgtgttg ttcctgctcg atgaggccgc ccggcttggc cccatgaaaa     63240
     tcctcgaaac cgcccgcgac tgcgcccgga aatacaagat cacgctgttt ccgttttatc     63300
     agtcgatcgg ccagcttcgc gagctgttcg gccagaacgg cccggccaag tggtttgaat     63360
     cggtcagctg gtatggcttc gccggcgtca aaaccaaggc cgttgccgag gagctggctg     63420
     cggcgatcgg cgaatatggc gtgctggcct ggtcggaagg ctcgaacacc ggcaactcgg     63480
     caaagggcct ggaagcaggc acgcgctcga ccggccagac caaaacctat catgagctga     63540
     aacgccaact catccgggcc gaggaaatca tgcacgacat gagggatgat gagcagatca     63600
     tcttcccaaa atccggccgg ccgctgcgct gcggccgggc catttatttt cggcggcctg     63660
     agatggccgc acgtgtgggc gagaaccgct ttgccgtcaa cgcaacttaa cccaggggcg     63720
     ggcaagacgg gtagggaagt gccaaattga atatctgcac acgatccaag aatgtcgttc     63780
     gcgagccgag taagcgttgc cgaaagcagc cgtttaccac ttcggctaca cgaacggcta     63840
     aacaccgcag acggacaagc tccgattgct caggccggca atctctcgaa gggcgattat     63900
     ggtttggaat cccttgacgt tcggatcatt atggaacacg tcgcgggcga acctctcgta     63960
     agcgcccacg ccgctgactt ggagcaaaag cacgaagtcg gcttcaccgg tcgcatacca     64020
     ggcgcatttg acctcatcgc gcccccgcag tttcgcctcg aaggcgtcga gagcagcgat     64080
     gccctcgcgt tcgagtgaaa ccagcacgtg gatggtcagg ggcgttccga gcaccgcagg     64140
     gtgcacaatg gatacatcgg caacaatcac gccgcttcga cgcaagcgcc gcaaccgacg     64200
     caaaaccgca ctctcggaaa gcccgacttg gtcggccagc accctggccg aggtctgatt     64260
     gttgacctgg agcttcgaaa gcaaagcccg atcgaactga tcgagatcga cggtttccat     64320
     cggctacgcg tccaaaaatg acgatatccg tcttatcacg cctgaattta ggcgccaacc     64380
     gttagatgaa aacgggcatg attatggtta tgaacgcaac aaccgaaact ccccgcacct     64440
     ccggcattgc ctcggatctc gcccgcctct cgccggatta cgcgccgacg ccgctactcg     64500
     agctgcctgc cttggccaga aggctgggcg tcgcccaggt gctggcgaaa gacgaagggt     64560
     gccgcatgct cggcagcttc aagtcgctcg gtggcaccta tgccgggctt cgcgcactgg     64620
     cgcgtgctgc gaacacggac atcgccgcgc tgatcgccac acgtccgggc gggcagccta     64680
     ccctggtctg cgccagcgac ggcaaccatg gcctggcggt cgcggccgca gcgcgcttcg     64740
     ccggggctag cgcccgcgtc tacctgcaca gcagcgtacc ccaatcccgt gccaagcgga     64800
     tcgaggcgca aggcgccgag gtgatctggg tccagggcac ctacgacgac gcggtgcacg     64860
     aagctgccga ggcggcccgt aacgaggttg ggattctcgt ggccgacacc acggacgatc     64920
     cgaacgaccc ggtggtgcgc gacgtgatgg cgggctacgg cgtcatggcc gccgaaatcc     64980
     gcgcccaggt ggaagccgcc ggtcacgcgc ggcccacgca cctgttcgtc caggctggcg     65040
     tcggcggcct cgccgccgtc atggccaaag gcctgggcga ctggcttgcg gcaccgggcc     65100
     ggatcatcgt cgtcgagccc gagactgcgc ccgccgtggc cgccgctctt accgcaggca     65160
     cgatcatccg tgtccaaggt gacctggaga cgaccgcgga aatgctgtcc tgcggcgagg     65220
     ccagcgcccc cgcactcgaa accctgcgac ggcaccgcgt ggaagcgatc accgtctctg     65280
     aagccaccct cgacgaggcc ccgctcctcc tgcgcgactg cggcggccca gcgacgacgt     65340
     cttccggcgc cgcaagcctg gcgggcgccc tcgcacggcc cggcctcccg gcggatgcca     65400
     gggtgctgat cctcgtcacc gaaggggtgc cggcatgatg accgacgacg ccttctgggc     65460
     cgaactccgc gcctggcgcc gcgactttca cgcccacccg gaattcggct tcgaggaacg     65520
     gcggacgagc cgcctggtgg cagagcgtct gcgttccttc ggcatcaccg acatcgtcga     65580
     aggcgtcggc ggcaccggcg tagtcgctac gcttacccgg ggtagcggca accgcgccat     65640
     cgccttgcgt gccgacatgg atgcgctgcg catcgaggag aagtcagacc tcgcctatcg     65700
     gtcgcaggtg cccggcgtga tgcacgcctg cggccatgac gggcacacca cgatgctact     65760
     cggcgcagcc aagctactcg ccgccgaagg cggcttcgac ggctccgtcc gtttcgtgtt     65820
     ccaaccagcc gaggaatggg gcaagggcgc gctcgccatg ctcgccgacg ggctcaccga     65880
     acggttccca ttcgaggaga tctacgcgct ccacaacaag gcgggcctgc cggttggcaa     65940
     gttccaggcc cgcgtaggga caaccatgtc ggccgaggac aattttgaga tcgtcctgcg     66000
     cggcatgggg ggccatgcct cgcgcccgca agacggtcgc gaggtgctcg tcgccgcctg     66060
     cgcgctcgtg gtcaacctcc agacgatcgt atcccgccgt gtggcgccga ccgactcggc     66120
     cgtggtgtcc gtgaccgagc tgctgaccga cggcacacgc aacgccctgc ccagcacggc     66180
     ccgcatcctg ggcgacgcgc ggagcttcca aacggtggtg agcgagacga tcgaggcgga     66240
     actgcgccgc atcgccacgg gcaccgccgc tagctacgac gtaggctgcg acgtgaccta     66300
     cacgcgcgag ttcgtgccga ccgtcaacga tcccgtcgcg accgcggcgg cgctcgcggc     66360
     cgcccgcacc gtgctgggcg aggagaacgt tacactagcc gatcaaccag gcaccgggtc     66420
     tgaggacttc gcccgcttcc tgcagcacgc gccgggttgc tacgccttca tcggcaacgg     66480
     cgagggctcc gtcccagccc accaccccga attcgacttc aacgacgacg cgctgccgac     66540
     aggaacgggc ttctttgtcc agatcgtccg cgaccggctc gcgacccggc cgacgcagcc     66600
     gtgaccggcc cccgcatcaa cgccgaacgc ttgctcggcc gcctccgcac gctcggtaac     66660
     attggccgcg acgagggacg gctcacccgc ctcgccgcct cggacagcga ccgcgccggc     66720
     cgcgacgccg tggtgggctg gatgcacgac gccgggctgg aggtcatggt cgaccgcatc     66780
     ggcaacctgt tcggcatctg gcacgccggt gacgccaatt ccgcgccgct catgctgggc     66840
     tcgcacatcg acacggtcat cgacgccgga atctacgacg gatgctacgg cgtggtgggt     66900
     gggctagagg tggtccaaac gttgagggag gccggcgtga agccggaccg gcctgtcgtg     66960
     atcgcggcct tcaccaacga agagggcgtg cgctacgccc cggacatgat ggggtccctc     67020
     gtctatgccg gcggcctcgg cgtggccgag gcgcttgcca ccgtcggcac cgatggcacg     67080
     gtgttgggcg aggaactcgc ccgcatcggc tatgccggcc cgcacgagcc cggcttcctg     67140
     cgcccgcatg cctatctgga gctgcacatc gagcaggggc cgattctgga ccgcgaaggt     67200
     gttgcgatcg gcgccgtcga gaacctgcag ggcatctcct ggcagcgcgt gacgatcgac     67260
     ggcgtggcga atcatgccgg caccacgccg atggcgatgc gccgcgacgc cggacaagcc     67320
     gccgcacggg ttgtgacttt cctacgcgac ctgatctcgc aaaccaacgc cccgaccgtc     67380
     gcgacggtgg gctgcatggc gttcgagccg aacgccatca acgtcatccc gtcccgggcc     67440
     gtgttcactg tcgacctacg cgaccccgac gaggatcgcc tgcgcgcggc agaggcgacc     67500
     ctcgcgcgat acctcgaaag tctggccgac gccgaagggg tcactgtcgt cgtcgaacgt     67560
     ctcgcccagt tcgacccggt gaccttcgac ccggccatcg tcgcggccat tgaagccgcg     67620
     gccgccgaga atggcctacg ctcccgccgc atgacgtcag gagccggaca cgacgcgcag     67680
     atgatcgccc gcctctgccc cgccgcaatg atcttcgtgc ccagcctcaa gggcatcagc     67740
     cacaatccgc gggagcacac acaagctgcc gatctgcagg ccggggccaa tgttctgctc     67800
     gacgtcatcc gcaagctcac acacgtagcc tccggcgagg cacgatcctt ctcgcaacag     67860
     aactcaaagt tgggcttcgc ttacgacgat tcgttcacaa aagagggcat ctgaagcgat     67920
     tgagttaact cgagcggccg cttgttgaag ctgggaaaca acagcggaca gttcgcttcc     67980
     cacccaaacc ggacataaat gaagcccacg ttaaaacgaa ttcgcgacca gcatttcccc     68040
     ggcttgcgtc gtgtatcggg gggagagatt ttgccggcgt gcgccccatg atggggatgt     68100
     ggccgtcgaa gcgatccgca gggttccgcg cccgaaccgg gcgttgatcg catccatagc     68160
     tttcattgcg gcggccgatt ggtcacggtc gaagctggcg aacagaacgg cctggcgccg     68220
     cgccggcgcc agatcctgca acatcacccc cgccttgaaa taccggtatc caggatgcca     68280
     gacggcccgc aacagcctga tcgcctcgcc gatcaacaga ccggtatcgg ccgtgggctc     68340
     gatcttgccc tggcgctgcg ccgaatacca cgggtcaccg ttatgggggt tggtatgggt     68400
     gaagaccgtg atctggcccg cctcaagccc ctcggcgcgg agcttctccg ccgcgcgcgc     68460
     ggcgaaggta cagatggcct cgcgcagttc agccggcctg tcgatcatgt gtccgaagct     68520
     gcggcttacc gcgattccct tccgtgttgg cgccattagc gatagcggca ggcaggaggc     68580
     gcccctcaac tctgtctgta ccctagcgcc ggtgacggtc agcatgtcgc gcaccgcgcg     68640
     cggatccgcc cgcacgaaat ccgcgatcgt ggtgatcccc gccgcggcga gttttgcccc     68700
     gacctggccg ccgatgcccc agacctcggc gataggcagc cgttcgtagt gccgcgcccg     68760
     gagctccgga tcgcgtaggt cgcacacgcc accgagcgcc gtctcctttt tcgcgatctt     68820
     gttggcgagc ttggcgatcg tcttggtcgg gccgatcccg acacaggtgg ggatcttggc     68880
     gatctgtcgg acatcgcgcc ggagatcgcg acagaaccgg tcgagatcgg ggataccatc     68940
     gagatcgagg aacatctcgt cgatcgaata gggctcaacc tgcggcaccc gttcagtgag     69000
     cacgtcgtag acccggcggc tcatgtcgcc gtaaagggcg tagttgctcg accgccattc     69060
     gacggccctg ctctccgggc gcttgcggaa caggtgccag ggctcgccca tcttgatccc     69120
     gagcgccttg gcctccggcg ttcgggcgat ggcgcagccg tcattgttgg acagcaccac     69180
     aagcgggcgg gagcgcagtt ccggcgcaaa cgcctgctcg gctgagcaat agaaggaatt     69240
     gccgtcgatt agcccgaaag tcggcattgc gatcagacct gagttcgcac caggccggtg     69300
     atcaccgccc agatttcggc gtcatcgccc tcgacgggga ggggctcggt gccggcgcgg     69360
     ccggagagca gttgccactg cccgttgcgc caggcgagct gcgcgaccag cacgtcgccg     69420
     gccagcatca ccaccgcgac cttgccgggc gccggcggtg tggcggcatc ggcgatcagg     69480
     atatcgccgg agaagatgcc gcggctggtc agcgcatcgc cggctacgcg cacggggtag     69540
     cggctgggcc ggcggagatc gaggatctcg gacagatcga tcggtccctc caggctatca     69600
     cctgcggggc tgacgaaacc tgtggtattc ccgcctgtgt agcttcccat gtacacctcc     69660
     atcggtcaga acatatggag aacatttcag gagagcaaga ggcgccatgt gcggacgttt     69720
     tgcagccttc cagccggttg aagcgatccg caagctgttc ggggcggtca attcagcgcc     69780
     ggcagatgca cggccgtcct ggaatatcgc cccgtcacag cgggcgctgg ttgtccgccg     69840
     acatcctgaa accggcgagc ggcgcatcga cctcctgagc tggggtctgg tgccgcactg     69900
     gaccaaggat ctcaaggagg cccgccggcc gatcaacgca cgtgctgaga ccttggcaac     69960
     ctcgccgatg ttcaagccgg cgttcgcgtc ccggcgctgc ctggtgccgg tcgacgcctg     70020
     gtatgagtgg caggtgacgc cagacggcaa gcggccgttc gcctttgccc gcacggatcg     70080
     cgcgacgatg gctttcgccg gcctctggga aagctgggtc acgccgggta cggggaaagt     70140
     gctccgcacc ttcaccatca ttaccacgtc cgccaatgcc atggccgcgc cagtgcatga     70200
     ccgcatgccg gttatcctcg atgcagacga ttggccgctc tggcttggcg aaaggacagg     70260
     ggagccggct gctttactcc ggccggctcc ggatatgatg atcgaggcat ggcccgtcgg     70320
     gcgatctgtc aactcgcccc agaataacgg cctggaactc ctttcgctgc ttgctgaaca     70380
     taaagacttg tatctaacca atccggcaga tggttgattg gcagtgccgc tccagtgaca     70440
     gcatcatcga tgacgatatg ggcataaagg acgtgctgcg cggcggtccc gatgaaggat     70500
     cgttggcaaa aaaaatcccg aaatcctcat acagttacgc accggacttc tgcatctgaa     70560
     tcccccgctt atggcctatg gggaggatgt ggtgcgaaat tcttgatttt tggaaatcct     70620
     ccccttaagc cgtagcagtc atacctctat cagaggaatc gtttagagag tttgaaccgc     70680
     ccgaccaaac caaggccgat aaggccagtg ccaagtagaa gaagggagcc gggttctggc     70740
     actggtgttg gtgtcggtgt caggggtttt gatacaagat catagttatt ttttgttcca     70800
     acccagttaa tcttgaaatc tgggctgtac cctgaaaata aaccagatga taatgtaaca     70860
     tagaatgtat aattaatgct gctgtctgct ggcaatgccg gaccttgtgg tgttgtttcg     70920
     gccgcaaagc agtaaaagtt tccctttcca ttacagccgt ttgcgttcaa tcctcccgat     70980
     aattctgtga atcccgatgg ggctgcagca cttgcgaaat ttgatggggg attaagagca     71040
     aaagactgta caccataccg cccaccctct gcatcggaag ggccatttat gcccgctata     71100
     ttaagggtga actgatccgt taagggattg gctgttgctg attcggacag cgtataggtt     71160
     atgccatcgg cgatcaggct ggcgtgcgct ccggccgttg taagccccag tacgacgatg     71220
     gcgctggcaa tatggcgaaa cttcaacatg aagaacgttc cttgcctatc cggttgttac     71280
     ccacacccac taaatgtagg gtgtgtccat tccccggaat aaagctcgtc aaaggttggt     71340
     gcggctgccc tacccgcgat tccgagcagc gagcggaacg cgttgaaggg atagaggcgc     71400
     cggttgaacc gaaacgtgaa ttcattgagg taggcttgta gatgtttggc gctgaccccg     71460
     tgatggatgc cgttgatcca ggtcttcagg ttggtaaaga ccaagtggac gatcggcagg     71520
     aattcttctg ccacctccgg gtcgccgcat tcggcgattg catggtggtc gaacccgcgc     71580
     cttccgagac cggcatagcc gctccagtcg tcggtaacga tcagcgatcc gggagcaacg     71640
     gcgttttcga cgaatccgca gagcgaattg gcgctacggt cggggacaac agcgagacga     71700
     acgcgtcccg cgtagcgacc gtctttccga ttgtcgagct tggttcccgg tttccggtgg     71760
     cgcacctcca cggcacaggc gacgagaacc ttgtgatgga caccccgtcc atcgcctcgg     71820
     gttcgtcctc caacccacgt ttcatccact tcgacgtgtt cttgcggcgt gtcgccaatc     71880
     ttgtcgcgct cggggcgcac catcccggcg cgcagcttat gaaggatgcc gaaggcggtc     71940
     tcgtagcgcg acaggccgag ttgccgctga aattggacgg ccgacattcc gggcgtctgg     72000
     ctggcgatca agtaagccgc ccagaaccaa gtcgacagcg gcgtgtgact gcgttccata     72060
     acggtcccag ccatcaggct tacgtctttg cgacaggccc ggcagcgcag aacgcccggg     72120
     cgcgcctcga aacggaacgg ctcgccaacg acgccgcacc ttgggcaggc gaaccctcca     72180
     ttccagcggg cgctttcgag ataggcggca caggccgcgt cgttcgggaa aatacgctgg     72240
     aattccggca gagactgcgg gaacggcagg tcttcacggg ccaggacatc catgcccaac     72300
     actagatcta gtaggtatgg gagtcaaccg gataggcaag gtttgaactg accgcattca     72360
     aagcggcaga aagtacagga agggccaagg ccggcgagca aaaggtcatt gagactgatc     72420
     ggaaaggctt ggctggccca agatcccgtt cgctgcatca gaccatgcgt ggcctccgag     72480
     gtcgcgtgac gcgctgatca tagatatcaa tctgaaagac cttggcggcc gattgaaata     72540
     aaattctgtc agaaaatttt acacatctga gtgctggttc ttttaatgaa aaataagtca     72600
     ttggaattat ttggtaaatt gatatggccc gaaacttgct gggaaaaaac tgtctaaccc     72660
     cccattacac aaggatgtat ttgtcatgtc tctcaaattt gccacgatcg cggcctgcgc     72720
     cgtaggggga ttgatgatgg gctcaggcgt tgcccacgcg accccctcgc tcgatttctc     72780
     ggttcaggca tggactgcgc aaacgccgaa ttccggtagc gccagctcta atcagcaggc     72840
     cctgccaagc aacccgataa tctctgccac caacgcattc tttaccggga atttcctggg     72900
     tttgccgaac tggcaagaca actcccaaaa tacaaataca ctcaacgact ttaccaataa     72960
     tctgaccgga ttcagtaacg tcaaatatta caatggcaat tctggcacaa cggtactgag     73020
     cactggggga tttggttcgg ccacgctgtt cgacctgact ttcaccctca accacacgct     73080
     gagtgccacc gtcacgcatg atgatggttt cagcctgtgg aatgcaacca acacaggtaa     73140
     tgccctcttt aactatgccc accccactag cgctgttcct gacagcatca gcgttggtcc     73200
     aggcacctat aatctctggt atctcgaggc aaacggtgcc ccggcacagc tgacgttctc     73260
     gaacgtcaag gttccggaac cgggctcact gttgctgctc ggtactggct tggtcggact     73320
     tggtctgatc ttgcgccgtc gccgctcgcg cacggcgtaa tcagccgcaa cgatgctttt     73380
     cgacaggcgg tggcagcacc gcctgttttt tgtgtcctct tctgcggtta caggcgtgaa     73440
     atgtggcccg caccagaacc tgcattatgg aacttcacgg caagtcgccg gcaactcaca     73500
     gtccaattcg gccgtgtatt tctgcgcctt atgaatatcc ctgcagcagc gacaatcaaa     73560
     caatgcgata ccgtcatttc tgccccctca tcctgacagc cactctctga gcttcgacca     73620
     tcggcgccgc cccgagacat tccgcacggc gatggcgaca gcacgccgac tgccgaccag     73680
     aacgactagc cgccggccgc gcgtgatgcc ggtgtagagc aggttccgct gcagcatcac     73740
     gtagtgctgg gtcagcaccg gaatgacgac ggcagggtat tccgagccct gggacttgtg     73800
     gatcgtcgcc gcataggccg gcacaagccc gtccagctcg ccgagaccgt agaccacctc     73860
     ccgtccatcg aagccgacgc caacctcccc ggcctccgca tcgacccggg caataaagcc     73920
     gatatcgccg ttgtagacct cccggtcgta gtcgttctcg atctgcatga ccttgtcgcc     73980
     gggagcatag gtccagccga atcgctcgac ccgcggttcc gccgcgccgt tcagcgccgc     74040
     ctgcagggtg atgttgagtg accgcgcgcc gaccccaccc cgggccatcg gacagagcac     74100
     ctggatgtcg cggatcggat ccagtccaaa ccggtgcgga atccgcgtct tcaccagctc     74160
     cacgatgcgc tcgaccgccg tctccggctc gtcggccgcc acgaaatgga aatcgctctc     74220
     gggatcggcg cggccgagat cggggatctc cccgcgattg acgctatgcg ccacggtgat     74280
     gatccggctc gccgatgcct ggcggaagat ctccgtcagc cgcaccaccg gtaccgcgcc     74340
     agacccgatc agatcggcga gcacctgccc cggtcccacc gagggaagct ggtcgacatc     74400
     tcccaccacc agcagcgctg cctcgtcggg gatcgccctg gtcagcgcat gcatcaacgg     74460
     cacgtccacc atcgaggtct cgtcgatcac cagaaggtcg cattccagag gatggtcgac     74520
     gccgcggcgg aaactaccgc tcgcaggatc tacctcgagc aggcggtgga tcgtcttcgc     74580
     ctcgcccccc gtcgtctcgg caaggcgctt ggctgcccgg ccggtcggcg cggcgagcag     74640
     aatgcggacg gatttcgcag cgaggatccg caggatcgcc cggacgatcg tggtcttgcc     74700
     gacacccggt ccgccggtga tcaccaacag cttcgcggtc agcgccagcc gcaccgcctc     74760
     actctggctc gtcgccagat tcatgccgag atggctttcc acccagccga tcgccttgtc     74820
     cgcatcgatc gatggccagg gcgttgcacc agaggcaaca atccgcagcc gttcggcgat     74880
     accctgctcc gcccgataca agccggccag gaacacacag tcagtccccg ccacctgatc     74940
     ggcgatcacc gtgccctctg ccagttcgag gtcgagtgcc gtcccgatca gcggcgccgg     75000
     cacctcgagc aacgtttcgg cgagcgagac cagttcgccg gccggtaggc cacaatggcc     75060
     atcatccatt gccgtcgcca gcgcatgacc gatgccagca cgcacacgga tcatcgcgtc     75120
     cctggcgatg ccaagcttct ccgcgatcgc atccgctgtc cggaaaccga tccccctgat     75180
     gtcccgcgcc agacgatacg ggttctcgct catcacctgc accgcgtcgg cgccgtaggt     75240
     cttgaagatc cgcacggcgc gggccgtgct caccccatgg ctgtgcagga acaccatgat     75300
     ctcccgcacc accttctgct cggcccaggc attgacgatc cgcccggccc gcaccgcgcc     75360
     gatacccggc acctcgcgca ggcgctcggg ctttgcctcg atcacgtcga acaccgtctc     75420
     gccgaaggct cggatcagtt tcttcgcata caccggcccg atgccgcgga tcatgcccga     75480
     ggccagatag cgctcgatcc cctcggccgt ggtcggcgcc gatgtccgca ggaaccgcgc     75540
     ccggaattgc tggccatgaa cccggtcgtt cacccactcg ccgctcgccg tcagccactc     75600
     gccagcgctg atcgtcgcgg catgcccgat gactgtaacg agatcacggt gcccccgggc     75660
     tttcacccgc aacacgcaaa agccgttctc gacattgtgg aacgtcaccc gctcaaccag     75720
     gccagcgagg acctcgcgat cgggtgtctg agcaggggca gtggcaataa aatggttccc     75780
     catcacccca tgcgacgctg tcttccggcg ccggtcaagt cagtcgcagg cgcgtctgct     75840
     tacgcggcgc ggctccaagg ggaggggcaa aaaaatggcg gccattgagg ccgccaagtt     75900
     tagggaggaa acgtccaaaa aggcgaggca gtgcctcgca caggaccgat atagcgcggc     75960
     aggacgcagt cgtcttatat attttgtgca gtgcagcatt gttgcctgta atgacccgga     76020
     gcaacggggt ggaattcctg gcaccggtta tggaattggc cgtgccagaa agcagcaggg     76080
     acgacagcag ttcctcaagg aattggatcc aaaaccctac cgcccgcggc cacgcttgcg     76140
     gctttcctgt tcaaccggac gttcctcggc ttggcgctgc gcctggcggc gatgcccctc     76200
     cagcgctttc tgtagccgcg cccgggcact ccgatgcgcg gcctcgatca atggccgcgc     76260
     ccgctcccac cccgccgcca cggctgcccg cacggccgga gccgcccgct cgatgcgggc     76320
     cagcgcctgg cccttatcct cgacagcgcg cgccatggtt tcggtcaagc ggctttgcgt     76380
     gccggcccgg gcttgggtgc gcgcaaaacg ctgggacagg tcagagggca agcctgcggc     76440
     ctcgcgcttc tcgtcggccg ccagcccttt gaggaaggcg cgggccgcat tgcggcgggc     76500
     ctcctcgccg atcttcacca gatcgagcgc attggtcttt tcaggctgac gcgcgatatt     76560
     ccgcgtccaa ttcgtccaga tgtcgtgctc gcggatcggg cgcggatcgc ccagcggccg     76620
     gcggcccgcg atctcctgcc gctcagcccc ctccgaggtc agccagtaat cccgttcccg     76680
     gtgccgtgac ccggagacat aggtcttgaa accgtccgtg gtctgcgagc cgccaggtgt     76740
     cacaaagata tgctcggtcg tggtgatgcc ctgggcggtg ttggtggtca tggcatagcc     76800
     gtaggccagc cgcatccggc cggtttcctt gtcggccagc gtgtcccact tcacaaagcc     76860
     ctcgcggcca tggtcgttcc gcagcaccag gccttcgtcg cggatgctgg tgatttcgag     76920
     gatcgagcca ttatcgccga tcgcgccctt gccgccgtcc aacatcgcag cattggtgcg     76980
     ggcgaagagc cggatttttt cgcccgtcgc gatcggcagc gcgtagtgct caccggtgtt     77040
     cttgtcgatc gccgccagcg tcatgcggct ctgccccagc tcgccagagg caagcagccg     77100
     ttgccggatt gcctcgccga tcgcgcgtgc gtcctgattg gtcggtgtgc tgatcgaaat     77160
     cgtaaagcgc ggccgatcta cattcgcttt ccggcgctca tcccagagcg cggcagctcg     77220
     cgcgatcacc tcgccatgcc cgccggcgat gatctcggcc gtgccatcct gccgcttcat     77280
     gtccagcgcc ttgccaacag cttcggcgcc accttttcgc agcaagcccg cgatttcgcg     77340
     cgcccgttcg ttggtctgcc gcacgctgct ttcaatcgac ggcaccttgc ccagcccttt     77400
     ttcgagaagg ccgatcacct ggcccgcctc gatcgactgg cattgcttcg gatcaccgat     77460
     cgccaccata cggaacccgt gccgctcctg gagccgcaac agatcgagca tctggcgcgt     77520
     gccgatcgtg cccagctcat cgatcaccac gacactgcgg ctggacaagt ccagccggcc     77580
     gctctccacc cggttgatga acaccgagac tgccgcgatc gtgtcacgcc cgccggcctc     77640
     ggtgtcggtg tcggtattca gcccggcctc gcgcagctcg cgcgcctggc gccagccgag     77700
     gctgatgccg tgaatgtccg caccctgctc gcgccatgcc gtcaccagcg gcttcaacag     77760
     cgtggtcttg ccagctccgg ccgccccgat ccccaccgag aaccggccgc ccatgccgag     77820
     atgatcgatc atccggcgct gtgccgcgcc atgcgcgccg gtgaaactca gcccgctcgc     77880
     ctcgatcccg cgcttgattt gtaccgggtt gagtgtgccg cgccgatcgc ggccagcttg     77940
     tcccgccagc tcgaccagcg cgctctcctg ctcgacatgg gcgcgcgtcg tcagcctggt     78000
     tgtggtgatc gtcacatccg ggttttccgg gtcatccctc tcggtctcga ccgcgatgat     78060
     ctgcgtgcgt gcggactcac cgttgccgcc agcaccaccg gtttcgacaa ccccgcgcgc     78120
     ccgcaaccgc gcgatcacct gatcaacatc gccgccatcc ttgatgccgg ccgccaccag     78180
     gccacgcgct gcggcaacgc gctcatcctc ggccttgatg accgcccgcc gggcaaactg     78240
     ctcgcccagc acccgcgaag ccgcctcata ggcccgatcc agccgggccg cttcggtcat     78300
     cttctccgct ggcgccgcgt tctgcagaac gcttttgtgc tggtagccgc gtgcctccgc     78360
     ctggcgccgc cagctcgcaa aatcgctcag atcatcggcc ttggcactgc ggctcgcaaa     78420
     ggcgccgcct ttcagcagct tgattcgttc atcgccggtc atgcggtccc aatccgcccc     78480
     cagcgaggca gcataggctt tcgcgtcgga gagggcatcg cgggtccgct tactgaacgc     78540
     cgcccggatc tcctccggca cggcgctgag ccgcgccgcg ccggtggttc ggtccagctc     78600
     tatactcgcg ccggctcgcc ggagattctg ggcaagatgc gcctggtaga tcgcccccca     78660
     ttcatggatg cgaccgtgca tctgcaacgt attcagggac acaacccggc cgctctcggt     78720
     gacgatgaca ttcggcaccg cgacatgggt atgaagctgc ggatccccgg ccaccttcac     78780
     ggagacgatc tcggtttccg tgcggccatc cgctgtctgc cgggcgattt cgattgtggg     78840
     ccgggccgtg tagtggtcaa aggtaatcca cccgatgcgg ccctgctcgg tgccttcctt     78900
     gccgcctttg cccttccggg cctggccaat gacctgctcg atctccgcca tggtcgcggc     78960
     caccgcatcc ttgtgcgcct gggccagctg gttgcgctcc gcctcggtcg gcgcgaaggc     79020
     ccaggccagc gacaccgact tgtcggccga gaaggtaaaa tcaacgtagc cgatcggggt     79080
     tttcgagcgg ttgaccgcgt ttcgccaatc ggccgcatcc agcgccgtgc catccgctcg     79140
     cttgccctca aggatgttgg cccgctcggt ctcggaaagg ccgcgcccgt ctttggcctc     79200
     cagcgccttg tagagccgca caagctcggg atgaggcgcg ggctggcctt gttcggtctc     79260
     ctgggcggac gggccatccg gcgcggcgcc gggagaggcg gatgacaact tcgcctcgat     79320
     ccgcgcccgg tcggcagcgc tcgacgcttc ggccgtcgcc agcgcccgcc gcaagccggc     79380
     ggcgccactt tcgcgcaagg catcggccca atcggcgccc tttgccccgc ccgcgacatc     79440
     agccggcggt tcaagataga ccgcctcgcc gccattggcc tcgatcaagg ccgcggcctt     79500
     ggcggccgcc ttctgcccgg cctcgccaac atcacggcca ttgtggaggc gggcattgtc     79560
     gcgatcggcc agcaggacaa ccggcgtcga gccgctgaat tgcccggccc aggccaccag     79620
     gccgcccgca ttgtagccaa caacaccagc ctgccgcgtt gcctgcacga cactcgcgac     79680
     ggtctcgaac ccttcaccgg caacccgggc ctggtcatgg ccaccgatcg gcaccgctgc     79740
     gccagccggc ggatgcagca gccaggcgcc cgaggccccc agcatccggc ggccgatttt     79800
     tgctccgcct tcggtcagat aggtgcgctg cacgccggtc agccgcaccc ggccatcctc     79860
     atcctggccg aacatcggcg tcagcatcac caccgccgca ccggccgcca cttccgccgc     79920
     atcatagttc ggatgcggcc ggaccagccg cacatggctc atcagccaat catcatcgag     79980
     gccgcgcccg ctgagatagg cccgggctga cgcccgcagg gccgcggcct cgtccacgcg     80040
     cgccgcatgc gctgtccgct gctgcaactt ctgccccgca gacccgtgca agctcggagc     80100
     gtgcagctcg ccagtgcccg gaatcgcctc atcccagagc ttcccggcaa tgctcttgcg     80160
     aaagacgttg cgccgtatct cggcagtacg cgccgccttg gccgcctcgg gatccagctc     80220
     gaccgcctcg gctttgacgc ccagccggcg caccaggctc tcgaaccgcc cgccttcgct     80280
     ggcggcaaag tcggtccatt gacccgttgt ggcgttgacc gaaaccgtcc agctttctac     80340
     tccgcgccag gtcgcttgca ggcgcaaccg gccgccgctg gtccggtagg gcacaccggc     80400
     ggcatcaagc gccgccgcaa cgtcgatcgc ccggggttcc gctggccgat cctcggccgc     80460
     cgggccacgc ggcggcaccg ccggttcacc gccccgcgca atatccgcct gccagtcggc     80520
     cgccagcgcc gcatcccgat catacccggc cacctcctcc atcgggggcg gcacaaaatc     80580
     ttccggccag ggcggcgggc catcggccgc acttcccagc tcgccaagcg ccgccgcttc     80640
     ggcggcaagg gccgcatcgc gatcctccgc ctcgtgcgcc tcaacagcct ctggcgctgc     80700
     ggtctgcgga gtgatcgcgg gggccgcctc gactggcgcg gccggcagat caaatccgtc     80760
     agcccgtttg ccggcaagga ggttttccag ttccgcgcgg gtcggcaacc gcatcggatc     80820
     aagcccaaac acttcggcaa gcggcgtcac cgcgcgctga tactgtttgc ccgcgatctt     80880
     ctcgccatcc gctcgattgc ccgccagcag ctcggcaatc tcgtcacggg tcagcgggcg     80940
     cgacgtgtcg atccccagcg cggcggcaac ggtggggtgc atatcccggc ggggctcggg     81000
     aatggtgcct gggcgggccg cgtccgtcgc ggtggccgcc gcgttatctt ccgccgctgc     81060
     cgtgcctggc tgccaaagcc cgccctcgac ggtcatgccg cgctgataat acgccgccat     81120
     atcctgctcg aaccccggca gtgtcatggt catcaggtga tccgccatct ttccggcggc     81180
     accggatgaa gtggaggccg caccggcgcg gaacgtcagc acgtctctcc gcctgcctct     81240
     gactgcgatc cgtcgtcgtc cggctcgagc gccgtggcca ggccacgcat caccccggcc     81300
     tcaacctctg cccccaaccc gtccagcgtt gtgccgattt gcagaagcgc ggtggtctga     81360
     tcgcgcagcg caccggcgat ccctgccagg gcttcctcaa gcgggctctc ttccgaaggg     81420
     gtcgccagct cgatcaaccg cgccagcatt tggctgtgcg tattctgcgt ttcgatcatc     81480
     agccgcatcg cctggatgac ggcatcgagg cggtcatctt tccggggcga cggggcggct     81540
     tcgggctctg gcatcgggcg gaactcctgt gatcaccgta gcgccattgt cacttgtgcc     81600
     gcaagctcca taggtgcaat ggtctgtaac ttctatcctg aactttccgc ccgcatagtg     81660
     ggccaagtct agaacgggaa ttgtcccgag tgaggaccga tactgcgccg actttgatgc     81720
     gaacagtgcc cggatttatc ccggttaata taccgacctt atgccgatta actgccgagt     81780
     gattgacggc cgatgcaggc cgccgctatc atcgcgtgca atggccaaca caccaccgcc     81840
     tgaaattgat ctcgatgatc ttcgccggca catggtcgag cacggcgcac gctccccgat     81900
     cgttcaatgg atggtcgcaa atcacgatga gttcgcggcg gccgtggcgg tcgccggcat     81960
     ccgttgggag aaggtggcgg cgtatctagc tgaacatggc ttgcgcaccg cacgcggggg     82020
     aataccaagc ggggaaacga tgcggcgttg ctggataaga gcgcggcgca tggtcgccaa     82080
     gcagcgggac ggtcaacgcc aaaccgctgt gcctccggcc gatcaaccgg cacccgaacc     82140
     gaaattcaaa cccttcactt tgagaaacga gggtcggggt ggttccgcag cggaacgcca     82200
     ggccctcggc gatgcaactg caccggctga ccaggcggcc cagccgacac ctaagtttca     82260
     acggtcatgg atgagaaacg aggggcgggg cacctccgca gcggaacagc ccgccccaga     82320
     ccatccggcc gcgctggcgg ccccagaacc tccgccgaaa ccgaaattcg agtttgtaag     82380
     attacgcaat gaggggcggg gcgtgtccgc agcggaacgc cgtaccctcg gcgatccaac     82440
     tgccccggcc gatcctgacg atccaaaatg gaaaggcgac aaatcccgat aggagaattt     82500
     gatgactgag accccctcat cagaaaagaa gcccaccggc acacaaaaac acgcaacccc     82560
     cgtattccgc cccggcagcg cggccgccgc actcaagccg gtggaaatca agccgctgct     82620
     caccagcgag caaacccgct ccgaacccgt cgcgcaaggc atcgatcttg ccgatcgacc     82680
     taagatcata ctcgccgcag gccggggcaa aaccggcaaa accaccttcc tgcgctgggc     82740
     cgtcgaaatg gcacagcatg ccggccgcaa catcctgatg gccgatatcg accccaccaa     82800
     cgcgacgttc tcgacctact tcaagggggc agcccggccc gatacattca accaggaagc     82860
     tgtccgcgac tggctgcaag acttcatgga atttgccatt gtcggcaaac acaccgccat     82920
     catcgatctg ggcggcggcg atacgatcct gcgcaccctc gccgcagaaa tgcccggctt     82980
     cgatgcaatg atcgaggagg cgggcatggc ggtggtgatg ttctacctcg caggcccgca     83040
     tcccgaggat ttaaccccgg ccgccacgct cggcgctttg agctttaagc cccgcgcacg     83100
     cgccttcgtg ctcaatgaag gcgtggcgcc ggccgggcaa tcgcgcgatc aggcattcag     83160
     ccgcgtgatc tcatccaacg tctatcggga cgaaactgcc gccggagcgg tccccctttg     83220
     gatgccgcgc ctgcacgcgg ccgaggcagt tgaaaggcac accgcgagtt tcgtcgccgc     83280
     acgggacggt catacagaac cgccgcttgg ggtgttcaac cgctcgcggg tgggccactg     83340
     gctcaaggcg atggatgagc aattcgccgg cgtcaaatcg tggatgccgt gagcgaggcc     83400
     gtcgatcagg gtggagcaga agccgcgatc cgcgccgcgc aagcggagct ggatcgggcc     83460
     gagcagttgg cccggctcga caatgacccc accgcgcaca cgctccacgc gctccgggtg     83520
     tttttagact cgaccgctac cattgccgca gatcagcggc gcgctatggc ggaacatcga     83580
     cagaacatcg atcaggattt cagcgctgtg cgtcaggcgc gggatggctt ggcgcaaacc     83640
     atcgatcaag cctttcaggc cgcaaaggtg caggccgaag cggcgcatgc ggatctctcg     83700
     cgccagttcg tggcctcctt cgcgaaagag gcagaacagc gcctcaagtc catgtcacgg     83760
     tgggtatggt ggcgcacgat cgcctcgggc gcggcgctgg cgatcgtgat cctcgctctc     83820
     ggctatggcc tgggctactg gcacggcaac gcggccggat acagccaggc cgccgggacg     83880
     attcacgccg ctggagccgt tgagcaatcc gtcctcgcct cacaaggccc ggcgggcttg     83940
     gcacaatggc acaagctcat gcgcgacaac accattctcg acaccatgaa atccgactgc     84000
     tccggcaaga acgtcgcgca tcaggacggc cgcacggctt gccatctctg gctatggacc     84060
     acgccgaatg tcgcaccggc cgcccatggg tagcgggatg gaggagcatt ttaccccctc     84120
     cgcggatcgg tcggctcgct cggccggctt cacctcccag ctcagccggg ttttgctcgg     84180
     cttgcttcgg ggcgccttgc gctttctgct ggtggctgtg ctcgacgtag tgatcctcgc     84240
     ggtgcggttg cgcttggccg cgttcgcgct cggcacgggc ttcctcatga tgacgctctc     84300
     acgcgccagc ctgctcctca atgaccggct gcgcttctgc cagctgcaac tccatgcctg     84360
     ggcgcagggc tggccgatga agcggtatgc gttcaccgcc ctcccgcccc ggcgctaaaa     84420
     ctttgagaag ctaagctcct tcttctatcc gcgtggcttc aattttacac gcttacatgt     84480
     aagcatgctg ttaaaattcc cggcctcccg gtccgcaaga attctagcta aaagaggggc     84540
     agcctcatca atgccaagcc atgccgcaaa atgtcggccc gaggcagggc ggaacgcggc     84600
     tacgagcacc ttgtcgagaa ctggaaggca cgacgacctc gcaacaaagt gcgcgagcgc     84660
     ctcaatccag cagggcatgg ccggcttcat cggaatacgc acctctcagc cgacgcgccg     84720
     ctcttcgcca cgaggtcacc cgcgcagaag gacaatatgt tcctgcacca agacccattc     84780
     acaactgtag cggattacca cacttggatt gctgcctccg gcatcgccaa ctgctgtcgg     84840
     tcgcgccagt cggcgctgac atagttgatc tccatgagtc gccgcacgcc gacgatgggc     84900
     cgcggatcaa agccgtgcca ggtcgccggg ccggcaatga agatcgtgcc agaattgaat     84960
     tccccggatg actggccgac ccagcgcttg tccgcgtcat aaatgtcggt gccccactcc     85020
     gccgcgtcgg gaccaaggaa caggtagatc accatggaga acagcttctc cttgatatcc     85080
     cggtgcggtt ccagccaggc gccgtccagg tcctggatgt attccatgcg cagatagctg     85140
     ccgttggcct gtatgtcgca gatctccgcc atcagcgccg caacgtcggg gcgttgcagc     85200
     gcctgcgcca aggcctcgca gccagggtat ttgcggcgca gcgccggcgt gatgaagcag     85260
     cgcgagtcgt tgtaggtgtt gcgtgtgccg tcggtgaggc cgagcatcgg tggggcaatc     85320
     ggcagggtca ggatgccggt gcagacatct aggggcagta cgtcccgcaa cttccagtgc     85380
     cggtacggcc agtcgccacg ttccgactgg cgcactgcac gcatgaagtg ctgcgcgatg     85440
     tcttccactg cgggaaccgg aggatattgc atcaacggcc ccccggcagg cggcgcggcg     85500
     cccagtcgat cgccttgcgc agcagtggca ccgacttagc gtacgcgctc agactgtggc     85560
     gtgcgtattc tttgcgcacg taccactcag aatcaacgta acagagctgc aggctcttgc     85620
     gctggccctt ctgcggcagg aacccgtgcc atgaatggtc ggagacgcgg aacatcagca     85680
     tgtggccgaa ttccggggca aactcgaagg cgtagtcgtt gcggtttttg ctacgcagta     85740
     cgcgcagtcg gccgcgctca tacggccagg cgcgggtgaa tccgaccaac acggtgatga     85800
     tcttgtgcgg gctatcggga tgtgcgtagc cctcattgta gtgaccgctg gtattgccca     85860
     tcatcacgat gcacgccggc cgcttgctca ggtcgatgtc gaactttgct tccaccaagt     85920
     ggcgaaagcg gtcgctcatc aggtcctgca ccacggcccc gaaatgcgga ccgtgttgca     85980
     ggtcaggcaa ggcatagctg ccgcgctccg gaatggtggg cgcatcgccc agaacctctt     86040
     ccttcaggcg ctgcggcatg gcgttctcga caaagcagta gtcgtacgga tcacgccgta     86100
     acgccgcggc ggcgatcgcg gcttcgtcga gcatcttgaa tggtgcgctg gtgtcggtca     86160
     tccggggatt tcctttcgtg tgaagcgtct gggcgcagac agccttgcgg gggtcgttca     86220
     gaacacaggc agaccgggag cgtcgtttgc cacgccctcg acttccacca gccattcagg     86280
     gcggcacagc gggccgcgca gaatcaggcg caggacattt gagaaacttt cggcgaagca     86340
     cgcttccacg acgttgtagt cgctggagtc gcgcagatag acgatgaagt ggctcagtgc     86400
     ctcgatggac gcgccaccgg cgcgcagcag cgcatcaaca ttgcccagtg cgcgcgcaag     86460
     ctggcgtgtg aagttgccgc gttcgaacgt cacgttgtag tcatgcgtgt gacacagccg     86520
     gtcataggca ttcataggac acctgttccg tcgcgaggcc gatgatggag taagtgtcca     86580
     tcagcaccac gtcacaatgg tggccacagg cgtcttcgat cccggtactg gccaggtagt     86640
     gggtatcgcg ggtgaggccg tgctgctgaa ccagcacggt acgggcagcg accatgtcct     86700
     ggtagaacag gtccatgtcc ttcacgtaga tccaggtgcg aacgcagtta tctgccagcg     86760
     taccgccctg cacctgcacc gccccgatca gccgtttgaa aacatcgcgc ggctgctcgg     86820
     cggcggagtt gggcgcctct gtggtggatg tgcacagctg tgtgctccac aggtggcgca     86880
     gatcgcccct gtacagcagc aggtcaccgg atggcgcgcg ggccttgcat agcggcgtgg     86940
     cggagtccac gtggtaagct agcatcgtga ctttcgctcc gctcagcggc ggttgctgca     87000
     ccatggagac ggcaaccgga cggtccaatg gttcgcgata aaggctgctg tcgcggacca     87060
     atgctgcctg gttgacggca tcactcacat acagccggcg gaaaaccgcg ctgtccggcg     87120
     gcaggcgcaa ggtttgccgc acctcggcat agcgctgccc tagcgcatcg atctgccgag     87180
     ccaagctgag ctgcgcagga gttgcgatca cgatgtagtg ctcggtatcg ccggaattgg     87240
     tgcggaaact gtggcatgac actccgtgtg cggaagccac cagggccact cccgtttctg     87300
     ttacggatac ccggaggctg atcgggaaac gggtaacttc cgcctgctcc gggttggcgt     87360
     actatgggcg aagacggcct agcgtctttg atctggatca aagcaatgct agagcaggct     87420
     gacgctgcgg caaccgcagg ccaagcattt cgatcttgcc atcaccgtca gccgcttcga     87480
     tttccggcgc aacgaggcct gcatcccgcg tgaggcgacc ctcgacggta tctatgtcat     87540
     ccgcaccagc gtgagcgcgg aaatcacagt gaagaggggc cgccgcgctc cgctctctga     87600
     tggccgcttt caagagcgtt ggacaagaat tctcgcacct cgctgcgcgt tggtgatgat     87660
     agcgcgtgga tttgtgcaga acaggggccg ggtctgatgg acgtcggttg acatgctcta     87720
     atgcgcgggt tggctaccgc ctgtccgatt tccgtccggg gctggtccct gtcttactca     87780
     tcacgccgag aaccccaacc acgtaacggt aacgttgaac tacggagagc aattgtttgg     87840
     gtcgagttgt gagcggtcgg cggcggcgcg tagcaaggca agactacggt ataagccatg     87900
     gacaaatttg ctgtagggaa gcagcaggaa tagtgcgagg atagtgccca gatggagcgc     87960
     aagcaggacg cccatagcgg ctgtcgagcg catagcaagc aacaggaggc cggtcatcgc     88020
     agctagccag agcaacccga gcaaggcaag gtcagtgctc atcagccgtg ccacagcagg     88080
     ggcaggatca ctgattattt tcacccagat aagacccgat gtgccgatag tgagcccgat     88140
     gccaccaatc atgccgaaca aaactggtag gctgaatagt gggtagggtg ccggctggtc     88200
     gaagaaatgt gcataaatgg tcgcggtaga ggtcgccaaa aaacagagca agaaaccata     88260
     ggccatggca tgatggaatc gtcgccgcag gatcgagaag cttttatcgt gatcgctaca     88320
     gtcctgatca cctcgcccaa ggttttgaag tgtcgcgata tcgcgcagtg cgtgcaggat     88380
     aacagtcagt ttggcggcct tacccttcct ccccgattct cgccaaaatt tgacgccact     88440
     tacagccagc gcaaaaacag agaacagaag gctcccacca gcgatgctgg ccatcagcac     88500
     ccaggggata acctgataga aggcgcctgg gccactccgg gcatgtgtaa ttccccctgg     88560
     ggggagcgac aataaagtga ctaaaaacac cagcatgatg ctgactaagc aggtaacaga     88620
     tacgactaag ccgttacgtc gaaacaaagg tgcgaatagg ccgggccaaa cgaagcgtga     88680
     gtggctctcg tctctcaact ccgcgaaact ccgcggtaaa ttgatatcga ttggctccgg     88740
     agcctcctga caagcgtagt agcagccacg gcaattgtga caaagataag caaggtaacg     88800
     gagatcgcca tcagaaaatg cgcgctgtag ttccatcgcc ggaaataccg cacaatagct     88860
     atcacaaaac cggcaggcgt tgcagatttc cgcagccctt cggacttcca ctagcgggtc     88920
     aatttcaggc atgccttcct gcctccacgt cgg                                  88953
//