Dbfetch

ID   CP000690; SV 1; circular; genomic DNA; STD; PRO; 187422 BP.
XX
AC   CP000690; AAOO01000000-AAOO01000076;
XX
PR   Project:PRJNA15753;
XX
DT   12-MAY-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence.
XX
KW   .
XX
OS   Acidiphilium cryptum JF-5
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acidiphilium.
OG   Plasmid pACRY02
XX
RN   [1]
RP   1-187422
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Han C., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Magnuson T., Richardson P.;
RT   "Complete sequence of plasmid2 pACRY02 of Acidiphilium cryptum JF-5";
RL   Unpublished.
XX
RN   [2]
RP   1-187422
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Han C., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Magnuson T., Richardson P.;
RT   ;
RL   Submitted (04-MAY-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 929c0f4202e429ff8aa5edb917d762ee.
DR   BioSample; SAMN02598339.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000181
CC   Source DNA and bacteria available from Timothy Magnuson
CC   (magntimo@isu.edu)
CC   Contacts: Timothy Magnuson (magntimo@isu.edu)
CC        Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..187422
FT                   /organism="Acidiphilium cryptum JF-5"
FT                   /plasmid="pACRY02"
FT                   /strain="JF-5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:349163"
FT   gene            complement(42..3290)
FT                   /locus_tag="Acry_3292"
FT   CDS             complement(42..3290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3292"
FT                   /product="error-prone DNA polymerase, DnaE-like"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, alpha subunit; PFAM:
FT                   PHP C-terminal domain protein; nucleic acid binding,
FT                   OB-fold, tRNA/helicase-type; SMART: phosphoesterase PHP
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3292"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28905"
FT                   /db_xref="GOA:A5FTH3"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023073"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTH3"
FT                   /protein_id="ABQ28905.1"
FT                   /translation="MSTDTAYVELHCTSHFSFLRGASSCDELFAQAAHLGLEALAITDR
FT                   NTLAGIVRAHVAAKANDMRLIVGCRLDLTDGTALLVYPTDRPAYARLSRLLSLGKQRGG
FT                   KAQCRLDWSDLVAYAEGLIGVLVPGEADDACVRNLRRLAQSFGDRAYLALTLRRRPNDA
FT                   LRLFELSNLAARAKVPTVVTNDVLFHARDRRILQDVVTCIRHGCTIDDAGFRRERHADR
FT                   YLKPPAEMHRLFSRYPEALARTQEIADRCLFSLDELRYQYPDENVLPGLTTQEALTQLT
FT                   WEGAAQRYPAGVPAEVVTILRHELRLIETLDYAPYFLTVNSIVRFARSQGILCQGRGSA
FT                   ANSAVCFVLGITSIDPERNDLLFERFISEERREPPDIDVDFEHERREIVMQWVFDTYGR
FT                   DHAALCSTVIRYRTKGALRDVGKALGLPEDLITALNAQVWGWSEGGIEPKHAAELHLNL
FT                   EDRRLKLAIDLARELIGTPRHLSQHPGGFVLTRDRLDELVPIEPAAMDNRQIIEWDKDD
FT                   IDALKFMKVDCLALGMLSCMKRGFDLLAQHKGIELDLATIPAEDPHTYAMIRRADTLGT
FT                   FQIESRAQMVMLPRMKPRTFYDLVIEVAIVRPGPIQGDMVHPYLRRREGKEAVVYPKPE
FT                   LEKVLGKTLGVPLFQEQAMRVAIECAGFTATEADQLRRSMATFKFTGGVSHFRDKLVSG
FT                   MVANGYEQEFAERTFSQLEGFGSYGFPESHAASFALIAYASSWLKCHHPDVFCAALLNA
FT                   QPMGFYAPAQIVRDAKDHGVEIRPVCVNASRWDCTLEPTHDESRLAVRLGLRMVKGVAN
FT                   PHVAKMIAARANHLFASVDDLWRRAGVPTAALVQMAEADAFLPSLKLARRDALWAIKAL
FT                   RDEALPLFAAVANRTEQPVSELQEPVFALKPLTGGGEVVEDYVHLGLSLRSHPVAYLRE
FT                   DLRRERIVSCDQVMSTRDGKFLETAGIVLVRQRPGSARGVMFITIEDETGIANLVIWPN
FT                   LYEKQRLIILSSGMIAVYGQIQREGEVVHLIAHRLTDMSAALASIGRRENVFPMPRGHC
FT                   VGQDPRDTLGRAPGDIFVPDRHIDGIKVKSRDFR"
FT   gene            complement(3287..4855)
FT                   /locus_tag="Acry_3293"
FT   CDS             complement(3287..4855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3293"
FT                   /product="Nucleotidyltransferase/DNA polymerase involved in
FT                   DNA repair-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3293"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28906"
FT                   /db_xref="GOA:A5FTH4"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTH4"
FT                   /protein_id="ABQ28906.1"
FT                   /translation="MPRVVSLFLPNWPIDRYNRDRRASAQRPGQPVSGLVDTAPPSPET
FT                   PLILADRDGNRRIVFAANGVAQDLGLRIGMAVAQAQALIPGLTIRDAEPLADVAGLERL
FT                   ALWALHRYAPIVAADPPDGLVIDATGAAHLRGGEAQMLRDMIARLAAAGVTARAAMADS
FT                   WGAAHALARFLANPVFVALADQSRDILLTLPIAALRLPTEMITGLRRLGFERIGDLADQ
FT                   PRAPLALRFGPQLHRRLDQALGTLAEAIEAARSPDLIEVRQNFAEPIGAAETIARYTGI
FT                   LVTELCTMLEAKGLGARQLDLVFHRVDAHSEAIRVGTALPARNAKRLTRLLCDKIETID
FT                   PGFGIEIMALCAARSEPFGPKQLTSLLADEPETDISDLIDTIANRVGGDRLYRFAPVAS
FT                   DVPERSLSRIAATAPPTKMNWPDHWPRPTRLLPNPEPIETVALLPDHPPVNFTWRGIRR
FT                   RVKRADGPERVFGEWWKRDAELIAVRDYFRIEDDAGERFWVFRAGDGEDNATGSHRWFL
FT                   HGIFG"
FT   gene            complement(4788..5504)
FT                   /pseudo
FT                   /locus_tag="Acry_3294"
FT   gene            5797..7950
FT                   /locus_tag="Acry_3295"
FT   CDS             5797..7950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3295"
FT                   /product="ATP-dependent DNA helicase, Rep family"
FT                   /note="PFAM: UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3295"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28907"
FT                   /db_xref="GOA:A5FTH5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTH5"
FT                   /protein_id="ABQ28907.1"
FT                   /translation="MRTKQENRIVGSNTVKGPKVTTATYLDKLNVEQRSAVVHGIDSAT
FT                   TTHIGAPLLVIAGAGSGKTSTLAHRVAHLIVNGVDPRRILLMSFSRRAAAEMIRRAERI
FT                   SVQAMGGKTGAMTDALTWAGTFHGIGARLLRDYAEQIGLDPAFTIHDREDSADLMNLVR
FT                   HELGFSTTERRFPTKSTCLSIYSRCVNTELSLDDILPTTFPWCSSWEAELQHLFGAYVE
FT                   AKQRQNVLDYDDLLLYWAQMVSEPALAEDIGGRFDHVLVDEYQDTNRLQSSILLALKPG
FT                   GRGLTVVGDDAQSIYAFRGATVRNILDFPGAFSPAADIITLEQNYRSTTAILAAANGVI
FT                   GLAKERFTKNLWSNRTTETLPQLVHVRDDADQARFIVERVLENREAGMTLKQQAVLFRT
FT                   SHHSGALEVELTRRNIPFVKFGGLKFLDSAHIKDVIAVLRWAENPRDRVAGFRVMQLLP
FT                   GVGPTSAAKVMDHMQGAADPIGALGDAPTPPRARSDWTHFIETIRTLRSRSAIWPGELE
FT                   LIRRWYEPHLDRMHDDASVRLADLIQLEQIASGYPSRERFLTELTLDPPDATSDQAGVP
FT                   LLDEDYLNLSTIHSAKGQEFQSVFVLNVVDGCMPSDLGTGQSQEIEEERRLLYVAMTRA
FT                   KDDLHLMIPQRFFVHGQAAYGDRHVYAARTRFIPNAIVHLFDMTNWPPAVAGPTNAKSI
FT                   GPVPRIDLSARIRGMWRSGAQNV"
FT   gene            7943..8677
FT                   /locus_tag="Acry_3296"
FT   CDS             7943..8677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3296"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3296"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28908"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTH6"
FT                   /protein_id="ABQ28908.1"
FT                   /translation="MCNLSSVTKGQQAIRELTRAMLDTTGNLPSLPAIFPDALAPVVRN
FT                   APDGERELTMMRWGMPGPSQLGGAPVTNIRNTTSPHWRRWLPPQNRCLVPATSFSEWAD
FT                   TKPKKTPVWFALDQSRPLFAFAGLWTVWHGKRGTKANPIEGELRLFGFLTTEPNSIVRP
FT                   IHPKAMPVILTTPEEMDVWMRASWSEAAGLQRPLPGTKLVIMNYRRQAAHAALAKVSVT
FT                   MDRARSSPKIRWPMFHSTQADA"
FT   gene            complement(8578..9501)
FT                   /locus_tag="Acry_3297"
FT   CDS             complement(8578..9501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3297"
FT                   /product="putative transposase, IS891/IS1136/IS1341 family"
FT                   /note="PFAM: putative transposase, IS891/IS1136/IS1341
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3297"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28909"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTH7"
FT                   /protein_id="ABQ28909.1"
FT                   /translation="MTLDSQVDCRAIGYKSHGDGFRFEPGANWRHGRLRLSGIGTMRAR
FT                   GEARTPGRVVCADIQRKADGWFLSLVVECEPHRERIGDSVVGLDWGVETMATLCTGPMQ
FT                   FAEVENDRLLVKAQDGLKVAQRELSRPLRGKRSKRAARARKLLARRSRKLANRRKDRNH
FT                   KTTARLVRDHAVIITEDLSVKNMTASAKGTAERPGKNVRQKAGLNRAILDTAPGSWLSL
FT                   LTSKAEEAAGRVILVDPRKHRPSQTDPVSGAVRKKALSERTHILPDGQVIGRDQASAWV
FT                   LWNIGQRILGEERARSIVTETFARAA"
FT   gene            9556..11154
FT                   /locus_tag="Acry_3298"
FT   CDS             9556..11154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3298"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3298"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28910"
FT                   /db_xref="GOA:A5FTH8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTH8"
FT                   /protein_id="ABQ28910.1"
FT                   /translation="MPPQPGGVLARAPPWSRPSGPRRIPRHNGETFVPGRHINDHQKRL
FT                   FMRYRQTDGVALAAAKAGFSTAAGYRLEQERHLPSSPKPPRGRRRPDPLATIFDAEVVP
FT                   LLEAAPGLRAVAIFEEMCRRHPDLAPGVRRTLERRIRTWRALHGPEQEVIFRQTHEPGA
FT                   MGLSDFTDMNELGIIVAGAPLDHRLYHFRLVWSGFEHAHVILGGESYVALAEGLQNALW
FT                   LLGGAPREHRSDSLSAAFRNLTAENVADLTRRYDALCTHYGMTPSRNNRGVAHENGAIE
FT                   SPHGHLKRAVRDALLLRGSTVFVDLEAYRRFIAEIVGRQNRRHAERIDAERAALQKLPD
FT                   QRTADYEETVVTVTSSGGFTLRKVFYTVPSRLIGQRLRVRLYDNRLELFLAATPLMTLP
FT                   RGRPQPDGRHGHVVDYRHVIHSLRRKPMALLNLVYRHQLFPRDAYRRTFEHLLEQTPPR
FT                   DACRIMVELLAIAHERACEAELASVLAADIKAGRQPDLKAIRQRFAPDPASLPALTIPT
FT                   MPLASYDILLQGAAA"
FT   gene            11151..12026
FT                   /locus_tag="Acry_3299"
FT   CDS             11151..12026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3299"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3299"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28911"
FT                   /db_xref="GOA:A5FTH9"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTH9"
FT                   /protein_id="ABQ28911.1"
FT                   /translation="MSETARTVDAQRLTLLLNELRLPAIKQVWPDFAARADKEAWPAAR
FT                   LLATLAEHEVAERDRRRIERHLLEARLPPGKTIATFTFEAVPMISKAQILALCSGDGWL
FT                   ETGANLLAFGPPGGGKSHLAAAIGLALVENGWRVLFTRTSDLVQKLQIARRELALEATI
FT                   AKLDKFHPLILDDLAYVTKDQAETSVLFELISARYERRSLMITANQPFGEWGKVFPDPA
FT                   MTLAAVDRLVHHATIFEMNVESYRRKTAIQRRAGPGRPPTRATINENIRLSLHDNQVAE
FT                   TRLPASNQSD"
FT   gene            complement(12089..12448)
FT                   /locus_tag="Acry_3300"
FT   CDS             complement(12089..12448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3300"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28912"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI0"
FT                   /protein_id="ABQ28912.1"
FT                   /translation="MALVMRRVTLKLYPSATQATEMERVCDLHRALYNAALQERIDAWR
FT                   LSKTSIGYAAQCKSVTQIRRDDTAYLGLNAQSLQVTLKRLDMAFSHFFRRVKAGETPGF
FT                   PRYKGRDRFPGWGYM"
FT   gene            12472..12888
FT                   /locus_tag="Acry_3301"
FT   CDS             12472..12888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3301"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3301"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28913"
FT                   /db_xref="GOA:A5FTI1"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI1"
FT                   /protein_id="ABQ28913.1"
FT                   /translation="MAEQAKFSKLYHCVYALNYHLVLVTKYRRKCITGPMLGRFREIAA
FT                   ARCEGWGGKLIEVNGEPDHVHLLISLPPNLDLSRFVNNLKTTTSRLIRKEFAAEVDTVY
FT                   RKPVFWSRSYCVISCGGAPLSVIKQYIEQQAAPE"
FT   gene            13271..14263
FT                   /locus_tag="Acry_3302"
FT   CDS             13271..14263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3302"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28914"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI2"
FT                   /protein_id="ABQ28914.1"
FT                   /translation="MRVLRNYGLLDLRCAASGPHPRKEGPMSAGSFRAALVAFSTVIVP
FT                   AAAQAEPPATTVQYQVMVSAGLAARKPFEAWFVLDKSSDPRVPGYSIPAGATIRFVFPK
FT                   SFTPKPGGVLGAVMLKGWSQGAISTKFITALDPTNPRVVAIHFAAPIAPGSVENPGLKA
FT                   IHLRTNEINPTTAGSYPITIQFVDAGALSGKTTAIAHITKKPVPNIAAYNQLHPGKDED
FT                   WQHVRAGHAAHLPIDFLATLPNECRSSFSLKSTGDRTLNILSDGKPIGSISANGVPVVL
FT                   TPQPFGPGFARLGVVEVHAKAGSTAGMAEITAALNGGTHYTIHLIVEDR"
FT   gene            14557..15813
FT                   /locus_tag="Acry_3303"
FT   CDS             14557..15813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3303"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3303"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28915"
FT                   /db_xref="GOA:A5FTI3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI3"
FT                   /protein_id="ABQ28915.1"
FT                   /translation="MNTLPPRSPETRPDNSPLSSGVEKQQASRPPSRWRRVVGGAIVIL
FT                   VIAAGAGWLWRGYSRAFTVQVAPIREHVVEQVFGLGAIGADVQSALGFQVAGVISRIDA
FT                   NEGNVVKAGQVLAQLDARDVAAQLALAKAGVQQARAAIDKADADISNASANLANATAIA
FT                   TRREALSRNGFASAEEAQNYITAERVAEGNLQVAKVEAETARAGLAEALAQEAFEVATL
FT                   GNYTLRAPYDGWVVARNLNLGASVAPGQAVFTVVDPRTIWVVGYVDERLAGRLHVGQKA
FT                   EIVLRSEAGRRFPGHVARIEIQSNATNEERLVDVAFDKLPSDIHLAEQAEIYVTTGVLA
FT                   RAALVPQSVVTGLADGKGTVWTVQDGRLRQHQVSFGPELLDGDLPVVAGLAQNAKVVTG
FT                   PAIGLRAGRAAKVAKGPAS"
FT   gene            15810..16952
FT                   /locus_tag="Acry_3304"
FT   CDS             15810..16952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3304"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3304"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28916"
FT                   /db_xref="GOA:A5FTI4"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI4"
FT                   /protein_id="ABQ28916.1"
FT                   /translation="MNLALRDVRRNKLRFALTILGVGMLIGVVIAMAGIYEGAVTDALS
FT                   MPRALKADLWVVQPRTFGPFAEPSRIPRDARELVRRIPGVAAAGAVTYQTVQTMADGKP
FT                   VRLLLEGYEIGRPGGPMKLTAGHGLTESHYQLVVDGSSGLKLGQAVRLGPFHDPYTVVG
FT                   LTHGMVGSGGDPVGWVTLLDAQALQFGVPPALERREAASGRKPPTTTDINAVLVRLAPG
FT                   AAAPIVARDIARWKHLAAVPETEEERYLTAFVIEKMQRQLGMFMAILVTVTAVIITLII
FT                   YTLTMDKLRAIATLKFIGAPDRVIVGMIVQQALVLGIGGFVIGLALVEEIKGTFPRRVQ
FT                   IEPRDLLIILVIVTIVCLAGSVLGVRAAVKINAAEALANG"
FT   sig_peptide     15810..15911
FT                   /locus_tag="Acry_3304"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.944 at
FT                   residue 34"
FT   gene            16945..17709
FT                   /locus_tag="Acry_3305"
FT   CDS             16945..17709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3305"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3305"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28917"
FT                   /db_xref="GOA:A5FTI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI5"
FT                   /protein_id="ABQ28917.1"
FT                   /translation="MDEHLSSVRPPRIELRGVCKHFGRAATRVDALVDITLTVHAGEMV
FT                   GLRGPSGCGKSTLLNVIGCVTEPSGGWMRLDGEPVYENRFLRRDLRRLRLTRIGFIFQT
FT                   HNLLPFLTATENVAEAMELAGTGHANARKRAEALLDYFDMRQVHAYPSELSGGMAQRVA
FT                   IARAIANGPHIILADEPTAPLDSVRADGVMNLLERIAKDQLAAVLVVTHDESIFHRFDR
FT                   LIAMRDGRIEGEELPGHPALTSSMTGLGRDAS"
FT   gene            complement(18027..18344)
FT                   /locus_tag="Acry_3306"
FT   CDS             complement(18027..18344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3306"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28918"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI6"
FT                   /protein_id="ABQ28918.1"
FT                   /translation="MTKEELTVWALANGWRLIAGHPSLTKPGAPNDPIVRLVRKATVVN
FT                   LEVRKPAGKWEKVAGESYADIVAGAEDELPRGLGFEKVPSITLLMQENRDAMVFARFSG
FT                   R"
FT   gene            complement(19016..20407)
FT                   /locus_tag="Acry_3307"
FT   CDS             complement(19016..20407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3307"
FT                   /product="replication protein C"
FT                   /note="PFAM: replication protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3307"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28919"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI7"
FT                   /protein_id="ABQ28919.1"
FT                   /translation="MENFRPESGPGPKLRGVRGARRLTLGMVATERLADDFGTLSEGGQ
FT                   VDPGRVLAAFKAAAPYLRFGPRVTQAIDWLFRFTQVQDWQEGARPIVWPSAAMQMEALC
FT                   LSEAQVKRLNRLLAHLGLITMRDSPNGKRYGRRDPRGRIVEAYGFDLSPIAVRQAEFRE
FT                   IAERGRARFEALKQLRRRATIAVRGIQQIVETAAELGIAEGWVRQADEARRLVARIRRI
FT                   EELDEVTLGVTTLENRQADLRGRLEAAMGALKEAGQAPVESTNMSPKGLTDEPHITHTN
FT                   QTLDPTDHVSASRKRNSTSGGAGTSAGGSTRTGRNGDGKEAGHRPTGSRATKPEIPPDG
FT                   TVFRMTPDELVRLAPRLRAYLAKSSPGWPEIVEAADWLRHDLGVSKPLWGDACLAMGRE
FT                   QAAVALAIVSTKPSDHFRGSPGGYFHGMVARARAGELNLARSIWGIRAASGMPRPASAS
FT                   GVGAV"
FT   gene            complement(21035..21919)
FT                   /locus_tag="Acry_3308"
FT   CDS             complement(21035..21919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3308"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3308"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28920"
FT                   /db_xref="GOA:A5FTI8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI8"
FT                   /protein_id="ABQ28920.1"
FT                   /translation="MIWEVAVDASDLKMFEAVARLGSMKRAAAELNTVQSNVTARIKAL
FT                   ENDLGISLFQRHARGVTITGPGQRMLPFAGQITKLLADARAAAKDDGTPNGPLKIGSLE
FT                   TTTAMRLAPLLSNFTLAYPEVQLVVTTGTTAQLVTELLEYRLDGAFVAGPVEHPDLDRQ
FT                   VVFIEELVLVTSPSVTDPSSLTKCGTLRTIVFQYGCSYRQKLEAVLSGMGIANARPLEL
FT                   GSLDAMIACVSAGVGVTLLPRRVVAHAASEGNVSAHALPQIHANVETLFIRRKDTYVSS
FT                   AMRAFLELCDTQT"
FT   gene            22010..23197
FT                   /locus_tag="Acry_3309"
FT   CDS             22010..23197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3309"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF1228; major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3309"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28921"
FT                   /db_xref="GOA:A5FTI9"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI9"
FT                   /protein_id="ABQ28921.1"
FT                   /translation="MDVSGVRNQTGSQTGRAWMGIFSGFCASLVGIGMARFAYTPLLPA
FT                   IIGAHWFQPSAAAYLGAANLAGYLAGALAGRPLATRMTAPSALRTMMFLATSSFFACAY
FT                   PLGFSWFFVWRFCAGLAGGVLMVLAAPTVLPHLPSSRRGLAGGVIFMGVGVGIAASGTF
FT                   VPLLLNQGLQRSWVGLGAISLLLTLASWVGWPAEEIVPRSKPHKIPGTVALRALYVEYA
FT                   LNAVGLVPHMLFLVDFVARGLGNGIRTGAEYWVLFGLGAVVGPILSGHLADRLGFARFL
FT                   RVSYLVEAAAVLLPALGGGAAWLMLSSAVVGAFTPGIVPLVLGRVHELLAHHPAGQNAA
FT                   WSKATVSFATFQAAAAYGLSYIFAQTGDYRQLFIIGAVAMLLAFAIDVLAGGKIQ"
FT   gene            23194..24246
FT                   /locus_tag="Acry_3310"
FT   CDS             23194..24246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3310"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3310"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28922"
FT                   /db_xref="GOA:A5FTJ0"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ0"
FT                   /protein_id="ABQ28922.1"
FT                   /translation="MNIHELLGIEWPIIQAPMAGTSTPDLAAAVSNVGGMGSIGVGAMT
FT                   AQDARTAIAAIRERTEKPFNVNVFCHRPARREAVREQAWLERLRPEFARFGAAPPAEIH
FT                   EPYKSFLLDRAMLDVLLEMKPNVVSFHFGLPDAGWIKALRDAGIILFSTATNGREARLA
FT                   AAAGVHAIVAQGYEAGGHRGMFDPDEEDEQLGIFVLVRQLVKTLNIPIIAAGGIMDGAG
FT                   IAAALRLGAAAAQLGTAFIAAQESAADAGYRAMLFSEAAEHTVMIRAISGRPARCLENR
FT                   LTSLGSDIPASEIPDYPITYSAGKALHAVAKAAGESGYGAYWAGQGAPRARALPAEKLM
FT                   AELIAEMQLA"
FT   gene            complement(24631..25020)
FT                   /locus_tag="Acry_3311"
FT   CDS             complement(24631..25020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3311"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28923"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ1"
FT                   /protein_id="ABQ28923.1"
FT                   /translation="MADIWPSVSTSGTSWVRGRRRATSLVCRRADAGCLILYAQDLLGR
FT                   GRAEWYFVEMRHRHLIHEEYTLAAIDDIISRGRWNDWSELRDAARADPKVLERITRVCM
FT                   ANVGDPYAQRYFFWMNYAQEHRSAA"
FT   gene            complement(25326..25595)
FT                   /locus_tag="Acry_3312"
FT   CDS             complement(25326..25595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3312"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28924"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ2"
FT                   /protein_id="ABQ28924.1"
FT                   /translation="MSDERPPLSPTEKIRDQLREALAAVNGLELEHSFGKLLDALHEAA
FT                   VNGVQLTEAHNQIIGLIRRRVETTWPETVFGYRGELEAPPDDEV"
FT   gene            25710..26090
FT                   /locus_tag="Acry_3313"
FT   CDS             25710..26090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3313"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28925"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ3"
FT                   /protein_id="ABQ28925.1"
FT                   /translation="MIYSPPARYAGPAIFAGHSMQKSIQTDDIPNIRLQVDTSIATLRK
FT                   LDDLRCRLGLSTYAEVIAAALKHEYAALEARRRLASAPTPPPPSSFSKRAAPEPVVPAA
FT                   PRPQVQARPAPQRVLALGGRER"
FT   gene            26164..28842
FT                   /locus_tag="Acry_3314"
FT   CDS             26164..28842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3314"
FT                   /product="CRISPR-associated helicase, Cas3 family"
FT                   /note="TIGRFAM: CRISPR-associated helicase Cas3; PFAM:
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3314"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28926"
FT                   /db_xref="GOA:A5FTJ4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ4"
FT                   /protein_id="ABQ28926.1"
FT                   /translation="MLLPNSWQNVLAFWGKSYTREDKLFAYPIVAHSLDVAAAGSHLPM
FT                   PLKEFDKRTVYFLLSLHDIGKFSRPFQAQESDLWPSRVLGPWPGRVAGPRHDALTAALL
FT                   EVFADEGLLDPVFPLGRRGSGWHPSKRSGLIRTIAGHHGRPIDVPDHLEPAVCRQCLDA
FT                   AREFVQAMLDLFQPSPLPPPQSRRASARMQWQIAGFLTLADWIGSNEIWFPRDGTHSDL
FT                   DPHDYFREVALPRAAQAGADAGLTPSKARTFTGFSALFPKVDTPSPAQSWAETVPLPEG
FT                   AVLAIIEDLTGSGKTEAALTLASRIMASGEAKGIFFALPSMATANSMFQRLTDTYLRLF
FT                   EKGSRPSIALTHGKAGLDPRFRALISASPSSASEPREGEAIPSEAECAAWLAEDRRRSL
FT                   FADVGIGTIDQALLAVLPVRHAPLRLHGLQGKVLVVDEVHAFDSYMDRELQALLEFHAA
FT                   LGGSAILLSATLPLRMRQSLTDAFRRGAGQEAPRQVTSMHYPLATMVGSEAHTEYSLGV
FT                   RAGLPRSVTITRVGTEAEALSRVVDAARLGAAVVWIRNSVDDALEAAAAVRMQNIDPIV
FT                   FHARFAHCDRQSIELEVLRRFGKESVGQARAGVLIATQVVEQSLDLDFDLLVTDLAPVD
FT                   SLIQRAGRLWRHNRGTRVVGRPEMVVLSPEPSMDADAGWLDPLLPRTNNVYRNPALLWR
FT                   GARALFAKSDLVTPGDMRPLIEAADNVADTPPGLKMAADGAWAKHLSHRAFAAGAVLDF
FT                   DEGYTLQSGAWDRETRTPTRLEEREQATLRLARVKDGKVVPYAGLAGDLRQAWTLSEVR
FT                   VQRYRIAACPPPAGYSEAANEARSQWGRWERESPHMLLAILEVTKQEGQLMLKGEKPDG
FT                   HPVSAIYDAVDGLRLLPASAG"
FT   gene            29133..30722
FT                   /locus_tag="Acry_3315"
FT   CDS             29133..30722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3315"
FT                   /product="CRISPR-associated protein, Cse1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3315"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28927"
FT                   /db_xref="InterPro:IPR013381"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ5"
FT                   /protein_id="ABQ28927.1"
FT                   /translation="MFNLLTNPWLPIVRQDGTKSVIAPRGITEDISANPVIAVDWPRAD
FT                   FRLATMELLAGLIATACPPADEDDWLDAWEAPPSPEKLDGALAPLSHAFSFDGPGPRFM
FT                   QDLADLDADEEPVENLLIEVAGNSGPLVHPGRTKRMGRPAAAISLYTLQSWSPSGGRGN
FT                   RTGLRGGGPMVTMVAPGRHRSLWHHIWANVPLGRKPEPVDFPRIFPWLSPTITSVNDEV
FT                   VTPDDVAHPLQVWWGMPRRIRLSFVQLPSPAPCDLTGALDSSVVTGWRQRPHGPQYVGW
FT                   GTRHPLTPTYQNKAGEEILSVHPNPGGVGYRNWIGLVLRSPDGLRRPAPIVSTWRNDRY
FT                   RGTEEAKGARLIAGGYDTDNMKARGFMETEVPLVLASSKEVQERLDALATSLVRASERA
FT                   SYQLRKAVQQALYHPGAKVKATAHGIALLGDRVWLETESAFFSALHRAMSLDDTAPERV
FT                   AWQARLRGLALRIFDDTVPIDPLDRNNVRQVRARFFLGLGLSGYGKDGQSFFQILEMPL
FT                   PAQEKKSKGKAS"
FT   gene            30719..31258
FT                   /locus_tag="Acry_3316"
FT   CDS             30719..31258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3316"
FT                   /product="CRISPR-associated protein, Cse2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3316"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28928"
FT                   /db_xref="InterPro:IPR013382"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ6"
FT                   /protein_id="ABQ28928.1"
FT                   /translation="MIRYRSAAHDWWRDLVPRAGYPGDRAAVAKLRRASTISEAITEEA
FT                   SIALFRRVGATSAEDLPRVALAAAILARVSKEPDGPNAPRSVARVLGPQKTDDVSTAIL
FT                   SPLRFKRLLAVDEPEEQLIAFRRMVAIARGSLPVRDLADALLDWSETRRRRWVFDYWNA
FT                   SEIASTPTTDTPEEPV"
FT   gene            31258..32370
FT                   /locus_tag="Acry_3317"
FT   CDS             31258..32370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3317"
FT                   /product="CRISPR-associated protein, Cse4 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3317"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28929"
FT                   /db_xref="InterPro:IPR010148"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ7"
FT                   /protein_id="ABQ28929.1"
FT                   /translation="MTQFLQVHLLTFFPPSNMNRDDTGRPKTAMVGGAMRLRLSSQALK
FT                   RAWRTSTIFSEALKGYMGERTQRLGEEILKTLQAEGVSEVQALAVARAVAGQFGKLNED
FT                   ETPARIQQLAFISPDERKAAFDLARRYAAGELPLPEKAKGKRGKANKTEGEEEVEAPEI
FT                   LLLRESDTAADIALFGRMLADKPAFNREAAAQVAHAITTHRISVDDDYYTAVDDLKRPS
FT                   EDAGAGFIGETGFGSGVFYTYMSINIDLLIRNLGGGDQARDLAATAIAALVEAAATTAP
FT                   SGKQNSFAAHGRAGYILAERGKAQPRTLAGAFAKPVEGGDIMDASIGRLEEFREAIDKA
FT                   YGPTADATKVMRVGGEGSLADIIVFAREGV"
FT   gene            32372..33121
FT                   /locus_tag="Acry_3318"
FT   CDS             32372..33121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3318"
FT                   /product="CRISPR-associated protein, Cas5e family"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas5 family;
FT                   CRISPR-associated protein Cas5"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3318"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28930"
FT                   /db_xref="GOA:A5FTJ8"
FT                   /db_xref="InterPro:IPR010147"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ8"
FT                   /protein_id="ABQ28930.1"
FT                   /translation="MKRFLTFTLFAPIASFGAIAVGERRESWSRPARSAVLGLVGACLG
FT                   IEREDAEEQAALERDFGFALLCGTSGGPLADFHTLQVGRPARGQTFRTRAEELNSNTVD
FT                   TILTRRDYRVSAWHLAALWVRSVVDPRWALEDLADAMKQPAFTPYLGRRACPLGLPLAP
FT                   QIIDADSPASALDRRWASGPEAEFRPSLAGTIQDLFVARDRWVGDEGANNLLRSEERRD
FT                   APISRTLWQFGLRTEVIEAFSPTENRS"
FT   sig_peptide     32372..32434
FT                   /locus_tag="Acry_3318"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.975 at
FT                   residue 21"
FT   gene            33127..33804
FT                   /locus_tag="Acry_3319"
FT   CDS             33127..33804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3319"
FT                   /product="CRISPR-associated protein, Cse3 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse3 family;
FT                   PFAM: CRISPR-associated protein, CT1974"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3319"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28931"
FT                   /db_xref="InterPro:IPR010179"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ9"
FT                   /protein_id="ABQ28931.1"
FT                   /translation="MWLSKARLNHDQKAVAALASVLVPEDGSARVAATHHLVWSLFAGD
FT                   ADRKRDFLWREERPGHFLILSPDRPGDGGGLCTVESKEFTPALSAGDRLGFSLRANAVV
FT                   SRGEPGSGRGKRHDVVMDVLRHHPKGERASHRLGLVTEAGAAWLVRQGERHGFVIEGQP
FT                   ACDGYEAIRVLRGRGEKPLTFSQIDFAGVLSVTDPARFIAAIGHGFGRARAFGCGLMLI
FT                   RRV"
FT   gene            33797..34759
FT                   /locus_tag="Acry_3320"
FT   CDS             33797..34759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3320"
FT                   /product="CRISPR-associated protein, Cas1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3320"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28932"
FT                   /db_xref="GOA:A5FTK0"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019851"
FT                   /db_xref="InterPro:IPR033641"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK0"
FT                   /protein_id="ABQ28932.1"
FT                   /translation="MSDQAPGLPPPRPIPIRERSSILFLERGQLDVIDGSFVVVDQRGI
FT                   RTVIPVGGITCLMLEPGTRVSHAAVCLAARAGTLLIWVGEAGVRLYAAGQPGGARSDRL
FT                   LYQARLALDDEARLRVVRRMYSIRFQEEPPQRRSVDQLRGIEGVRVRELYKLMAQRHGV
FT                   SWAGRRYDPQNWGGADLVNRCLSAATAALYGISEAAILAAGYAPAIGFLHSGKPQSFVY
FT                   DIADLFKFETVVPEAFKVVAAVQSGRGQIDGMAIGEPVGAVRRRCRDAFRRTNVLARII
FT                   PAIEDVLAAGGLAVPEAPEEAMPVAIPPPEPTGDAGHRG"
FT   repeat_region   complement(35116..37280)
FT                   /rpt_unit_range=35116..35145
FT                   /note="CRISPRs"
FT   gene            complement(38112..40184)
FT                   /locus_tag="Acry_3321"
FT   CDS             complement(38112..40184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3321"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28933"
FT                   /db_xref="InterPro:IPR004322"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK1"
FT                   /protein_id="ABQ28933.1"
FT                   /translation="MVKSAVVQIARPAPARRRSGLRLRMLGRTIANEYFYRGGSAARRG
FT                   PTGADVASRRISPDEWHDYTLAISCARRAMSKLKRDAIMASRRHDRPDDDDLVEMIEKR
FT                   RHLRAEVKKRIGAGLVLEPDISCGAFVDGVKLRGFRSSLDPILKLFVSKLCKGRYTRRG
FT                   SRLPSISSSRDKASIFPCPSKALALDDEYVTFNPMMRGVFRVDLDRDFASTEECQEKIR
FT                   ELRLPAPNIITGVSTSGGKLRRPHVYFVVKHSVCFTGNGRNGAKALFKLIGTILTERLA
FT                   PLGADRFATNTLRGKNPLCERLTTAVVYSEPYSLGFDPHGCESLADLLDLGQYRGKFSN
FT                   FGAAEDMLLRDGRRGSNAVFRTVGRLCARLVHEFHPESPRRSARYRANLVGTDHALEDF
FT                   EDAVLRGAQQYFEDCEQLRRQCAKSARYFFTRYDARIASANRRRGAMAAEPEYLAALSK
FT                   REKQQAGGRYAALKCKEATLIRLAVAAEEIGHLAEDIGVSELARASGVSRMTIYRHRHE
FT                   LERGRYLLAEMRENGAAQGDHTIHAGPTSDCNIQCLDKRDTGKSGSLEEMGTPGAEHPE
FT                   GVTQSRRQFIKRRGSRFMGSKSGKVRVHALNPVFILEIPGGSGAKRPRIVRIRDDVDEL
FT                   AYEAAVEPTIRFIDDFGRERMGNEPVIYAHNGAVAWKNPDFADRRNLNSANRRSS"
FT   gene            complement(40187..41011)
FT                   /locus_tag="Acry_3322"
FT   CDS             complement(40187..41011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3322"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28934"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK2"
FT                   /protein_id="ABQ28934.1"
FT                   /translation="MIDGQEHDVAAEIRIPLIEGAFFAARDRLASELATSGFDPHVAAA
FT                   GANQIGEAILESPTQNEDAAWLIAAMAPAGIARRLAGTDARNTRAALIRDGIAPDIARA
FT                   VVQIAPVSPRGPQAALRQLTRVADAMRVGMDAVVEAMRGRLVDSLAARGIVPKVAREIS
FT                   AALPKAAMRADLHLSEAIANQAAYVLETHPKLGAMSAVHGVIAYRRLGESAAMNQLIHD
FT                   LRYAPAVAAAPEPMPAGVMEAIELSQRAVDANLANANRVYVEALDDSPKPGS"
FT   gene            complement(41008..41421)
FT                   /locus_tag="Acry_3323"
FT   CDS             complement(41008..41421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3323"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28935"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK3"
FT                   /protein_id="ABQ28935.1"
FT                   /translation="MSARARKTGGLLLGILRVEGAPAQTRYELFPDEQGLIRWRRAMLR
FT                   RNWREWVAPAIDSAIAEGQLHDVRLLISDPEMLTDRQVDEVSLLYKIAVTFEAIPNMTV
FT                   LRDEPVAVRDQLSLFGDESEAVEADPLMAGPSP"
FT   gene            41657..42250
FT                   /locus_tag="Acry_3324"
FT   CDS             41657..42250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3324"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: regulatory protein, MerR; Resolvase,
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3324"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28936"
FT                   /db_xref="GOA:A5FTK4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK4"
FT                   /protein_id="ABQ28936.1"
FT                   /translation="MLGVSITTLRRWEAAGKLVADHTAGGHRRYDIAKLRPDLFHAEDE
FT                   ADRRTIAYARVSSHDQKDDLERQKQVLELYCARQGWKFEIVADLGSGMNYRKKGLKKLL
FT                   GAIIDGSVGRLVIAHKDRLLRFGADLVFAICEAKNVEVVILNQGEDTTFEEDLAKDVLE
FT                   IITVFSARLYGSRSHKNQKLLDGVKRAVEESAAC"
FT   gene            42244..43443
FT                   /locus_tag="Acry_3325"
FT   CDS             42244..43443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3325"
FT                   /product="transposase, IS605 OrfB family"
FT                   /EC_number="2.1.1.37"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase, IS891/IS1136/IS1341 family;
FT                   transposase, IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3325"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28937"
FT                   /db_xref="GOA:A5FTK5"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK5"
FT                   /protein_id="ABQ28937.1"
FT                   /translation="MLIAHRIALDPTNAQRTYFARASGTARFAWNWALAEWQRQFTARK
FT                   DDPSLPAPSDASLRRRLNGLKREEFPWMFDVTKCAAQEAIIDLGSAFRNFFEKRGRYPR
FT                   FKKKGVSDSFCAANEAGTFRTDGEKIKLPVVGWVRLHEALRFTGKLKRVTVSREADRWY
FT                   ASIMVETNDIKPVVQPLPAVGVDLGVTTLATLSRGEAIPGPKAHKALLQRLRRASRALT
FT                   RKRKGSSNRRKAKAKLARLHARISAIRKDATHKATTMLAKTYRRIGIEALNVRGMARNR
FT                   HLARSIMDGGFFEFRRQLEYKAKFYGAAVVVADRWFPSSKTCSCCGSVKAELALSQRLF
FT                   HCDECGYEAGRDHNAARNLENMAASFAVSACGEDRSDAVRKPRVKRASMKQEPDSKLAA
FT                   "
FT   gene            43830..44450
FT                   /locus_tag="Acry_3326"
FT   CDS             43830..44450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3326"
FT                   /product="Holliday junction DNA helicase subunit RuvA"
FT                   /note="PFAM: DNA recombination protein RuvA, domain I;
FT                   SMART: Helix-hairpin-helix DNA-binding, class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3326"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28938"
FT                   /db_xref="GOA:A5FTK6"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK6"
FT                   /protein_id="ABQ28938.1"
FT                   /translation="MITQLTGIPRRIGDQECVIDVHGVGYGVHVPSATLDMIEGEAGPV
FT                   TILIQTRMSDSEISLYGFATPADLQTFRKLVGVQGVGPATALNLLSQLAPEELWRAIRE
FT                   ADQKALTAVKGIGPAAAKRLISELESHAAKLAAEMPAPAARLDLGLSADQLAQSLQRLG
FT                   HAPSAARAAAQFALNGAKPGDTEQELVARALQAAAGMTTGAAA"
FT   gene            44507..45445
FT                   /locus_tag="Acry_3327"
FT   CDS             44507..45445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3327"
FT                   /product="Holliday junction DNA helicase subunit RuvB"
FT                   /note="TIGRFAM: Holliday junction DNA helicase RuvB; PFAM:
FT                   AAA ATPase, central domain protein; Holliday junction DNA
FT                   helicase RuvB, C-terminal domain; Holliday junction DNA
FT                   helicase RuvB, N-terminal domain; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3327"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28939"
FT                   /db_xref="GOA:A5FTK7"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK7"
FT                   /protein_id="ABQ28939.1"
FT                   /translation="MSPALRPQGLADFVGQADTMRNLATFIRAALIRGVSLDHVLLNGP
FT                   PGLGKTTIAQIIAHEMNCNLKTIIGPAVQRAADLAAVLTTMQPNEVLFIDEIHRVQPAA
FT                   AEILYGAMEDFTLDILIGEGPQARSVRIDLPRFTLIGATTRSGSLPAPLRDRFGIHLGL
FT                   EFYSPEDLVRIVTRSAGMLGIGMMPEGAMEIARRSRGTPRIANRLLRRVHDFAVVAGVV
FT                   AITDTIADMALSSLAVDRRGLDKLDRRYIDWIDTVHGGGPVGIDTLATGLGEARETIED
FT                   VIEPFLVASGIITRTSRGRVLTPKAYEVEAR"
FT   gene            45445..45996
FT                   /locus_tag="Acry_3328"
FT   CDS             45445..45996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3328"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28940"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK8"
FT                   /protein_id="ABQ28940.1"
FT                   /translation="MQHRRDQRLMGTVDQLAPLFTTTVQNDIFLIGIDMGDPAHPAGAA
FT                   ILFSGDDEFYGQISDAMPASALSDLAVVFHAADKRIATMMRSSGRRALPREMPDGIASQ
FT                   DLKASPGLVAHRPPFAIIRGANEASGTVLVHLLIQAAGTAEWRTALRVSSGWLGRLAGL
FT                   AEEASRYPGQALVAQHHSPF"
FT   gene            complement(46324..46656)
FT                   /locus_tag="Acry_3329"
FT   CDS             complement(46324..46656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3329"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28941"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK9"
FT                   /protein_id="ABQ28941.1"
FT                   /translation="MSRSTSPTAAPALRGVGPNLILNGNGFYVSYNDFDRGIYGGDTTA
FT                   LVLGQMERFFILNGDHRGQYAPPDRARLRCLSRLFPGQHGAHELPQRPAALPRHGWGGD
FT                   ADPVKG"
FT   gene            46722..46973
FT                   /locus_tag="Acry_3330"
FT   CDS             46722..46973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3330"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28942"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL0"
FT                   /protein_id="ABQ28942.1"
FT                   /translation="MCHRFEIDAEYRRRRARLLAEKGTGFRSLGVGGADATTPHGRLML
FT                   TVLGGMVEFDREWILVLDVRMGPKPKLPLYQRHKALRR"
FT   gene            47613..48353
FT                   /locus_tag="Acry_3331"
FT   CDS             47613..48353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3331"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3331"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28943"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL1"
FT                   /protein_id="ABQ28943.1"
FT                   /translation="MLSNYFDPPPMPTECSVTDGFACASRHASLQAPYPAHLRGVFVDG
FT                   SPRRMHRAPSLTAVTLLALSAFTPARAAELYHLNQRNSTIRFSVGTLGFFRARGHFAQF
FT                   DATLLIDPAHPTSTRVSVTIPTASVVTPWAQESAMIRSPDFFDVARYGKIRFTSGNVTA
FT                   TAPGHYAVHGQLTLRDVTRPVILAAHLVKTATDPTAGDTIDDFTITGTVRRKAFGIVAD
FT                   PVFIDNRVHIVIHARILVLASGHG"
FT   gene            48346..48891
FT                   /locus_tag="Acry_3332"
FT   CDS             48346..48891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3332"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3332"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28944"
FT                   /db_xref="GOA:A5FTL2"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL2"
FT                   /protein_id="ABQ28944.1"
FT                   /translation="MAEAWRPAQRRLHWWTAGLVATGFAIAWIMVAVPLRDLLVKFLLF
FT                   QLHKTIGLTVFALVVWRLGLRNRHGRPAEADGLSIAERRAAAAGQALLYGLLLAVPVLG
FT                   YLTACSAPSGFPTLFLGVIPIPSVIGPDPHLFDLLAPIHRWSAIILIALAVGHALQAIR
FT                   HHRRGRLLLRQMWRAPPR"
FT   gene            49942..50958
FT                   /locus_tag="Acry_3333"
FT   CDS             49942..50958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3333"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28945"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL3"
FT                   /protein_id="ABQ28945.1"
FT                   /translation="MDVLAREDLPFPQSLPEFQRIFPNDAACAAYLESARWNGGFACPR
FT                   CGVVGEPFRFEARPGVLRCRACRKDVSLMAGTVMERSHTPLSTWFWAAYLIASQTPGMS
FT                   AVQFQRQLGLSRYETAFGILHKLRAGMVRPERDKIGDTPQEHVEVDETWVGGRTRGDGR
FT                   GVHHKVLVACAVEVRHRKPGTKLDNRKDGRYAGRVRLAVVPDRSANSLCGFVENAVAPG
FT                   SLIVTDDWSGYAGLGRRGFDHHAIAECGDPEVAEEFLPIVHLVFTNLKTWINGIHHGVS
FT                   AKHLQAYLNEFTFRFNRRLYPFNAFRSLLGIAGRAAAPTFDELYSGEWTHPTFSGCG"
FT   gene            complement(51404..52369)
FT                   /locus_tag="Acry_3334"
FT   CDS             complement(51404..52369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3334"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3334"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28946"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL4"
FT                   /protein_id="ABQ28946.1"
FT                   /translation="MDITKVLENVDKNQIHKIINYLPIPIFIIASNYRFVSVNKPMCNF
FT                   FDCTIEAFLRKTDDFIIPKKNIDASRKITDEIFSSGQPYEDEEILTDGRGEQHIFLIYK
FT                   RLIHLQQAGYETPFVITVLMDVTRFREAEKNATHRALHDTLTGLANRSHLNQRLKEAVT
FT                   VSTANAQGFAILLLDLDGFKSINDRFGHQAGDQILCVVAKRLTDTIRRNDVVARLGGDE
FT                   FCIVQANVDHPDQAHELADRVVHAVSRPIPFGSIELTISASVGIALFPEDGDGPDALLR
FT                   KADLGLYQVKGNGRAGYLRHALDARSLQSDGRNHATNEWN"
FT   gene            53072..53572
FT                   /locus_tag="Acry_3335"
FT   CDS             53072..53572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3335"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28947"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL5"
FT                   /protein_id="ABQ28947.1"
FT                   /translation="MSGIMPPPLPSPSQSFASALRAFLDTLIAVAAWRGEDFRQVWVVE
FT                   SAKAIRSAMEQGPIWATMEDLIPDDDDLLSKVAFDVLETEMLYVAFRYRRLLPEESRKV
FT                   VASVEERFAGVQEGDPTAPGAVDDIETVKGSIERQIKKLPKWLQRVLEVLMELLKLTKG
FT                   MIH"
FT   gene            53885..54379
FT                   /locus_tag="Acry_3336"
FT   CDS             53885..54379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3336"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28948"
FT                   /db_xref="GOA:A5FTL6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL6"
FT                   /protein_id="ABQ28948.1"
FT                   /translation="MVSRAAAAACFGIALAMAMARYASLYRAMQIVGGLYLIWLGVGAS
FT                   RAKPGSAETGAVSARPAGLTRGILTGAVLNLGNLKIVVFFTSIFVALLPASAPLWVRLA
FT                   ATAIVGAQEAAWYILVAMLFSRPRAQVAYRRAGVWIERVVGMVLFGIGADIVVASVKSG
FT                   V"
FT   sig_peptide     53885..53956
FT                   /locus_tag="Acry_3336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.890 at
FT                   residue 24"
FT   gene            complement(54386..55231)
FT                   /locus_tag="Acry_3337"
FT   CDS             complement(54386..55231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3337"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3337"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28949"
FT                   /db_xref="GOA:A5FTL7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL7"
FT                   /protein_id="ABQ28949.1"
FT                   /translation="MTIPPWAITAVLAGAALHAAWNVAIRGGADRRSATIGLILGGAVI
FT                   AGATLPFLPRPRAAAWPHLLATALLHIVYFNLVAEAYARGAVSLIYPVMRGTAPALTAL
FT                   IATIFLGETLGGAGWCGLLLISAGVGLLARRRGEAGEGRALMLALANAIIIALYTANDG
FT                   VGVRLSEAPLAYALWTFVLPAIPAILILARFSPTRLRAALKPGPLLRGFGGGACSIASY
FT                   ALALWAMTQAPIGAIAALRETALLFGVLFAWWFLHERPGSRGLTAIAIIAAGATVLRLG
FT                   "
FT   sig_peptide     complement(55172..55231)
FT                   /locus_tag="Acry_3337"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.979 at
FT                   residue 20"
FT   gene            complement(55335..55895)
FT                   /locus_tag="Acry_3338"
FT   CDS             complement(55335..55895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3338"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain; Resolvase
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3338"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28950"
FT                   /db_xref="GOA:A5FTL8"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL8"
FT                   /protein_id="ABQ28950.1"
FT                   /translation="MISIQTPAHSVALTGAFMSASLHHRQAAFGGWLQKVSGAKRGRQE
FT                   LARLLDHLRAGDVVTVTRLDRLARSTRDLLDIAERIKEAGASLRSLAEPWADTTTPAGR
FT                   MVLTVFAGMADFERSLIVERTSTGRIAAKARGVRFGPQPALATDQIAHARQLIEADGKS
FT                   VAEVARLLGVHRATLYRALEKRQ"
FT   gene            55948..56460
FT                   /locus_tag="Acry_3339"
FT   CDS             55948..56460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3339"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3339"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28951"
FT                   /db_xref="GOA:A5FTL9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL9"
FT                   /protein_id="ABQ28951.1"
FT                   /translation="MAQAEAPGAVFAEVARRHDISRGQLWNWRRLVRAGELSLASAPAQ
FT                   FLPVRMSPELSAAAMIAGPEDTDRASVAAPRNQGRLEVRLAGGTRVVIEGMVAPAVVTA
FT                   PRIRTGTAVNICSARRMPAPSRLAATGWSTACGKQVFRSEKVRPKLKMRLIRRLNPEMV
FT                   GYSQKVA"
FT   gene            56496..56885
FT                   /locus_tag="Acry_3340"
FT   CDS             56496..56885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3340"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28952"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTM0"
FT                   /protein_id="ABQ28952.1"
FT                   /translation="MGTVRVMFRPRRQSPVVPVRLRRRAFFEGVFDMSALSMLSGHLSV
FT                   STAARVSAGQIAVALETGHLSAIGDSHARALVAGVFSEHDPDLILRATSEAGGTPATAN
FT                   ALYLESLADGMPCCPGWEHLMREIL"
FT   gene            57023..57577
FT                   /locus_tag="Acry_3341"
FT   CDS             57023..57577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3341"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28953"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTM1"
FT                   /protein_id="ABQ28953.1"
FT                   /translation="MLAYEHRISHDIDLFIHDAQWIGFLTPRLHDDAGRFPLYEEASNF
FT                   LKIKLPEGEIDFIVGMSLLGLADESYPGVPFALEPVAEVLAKKLFYRGASLTARDLYDW
FT                   WAVSSATPDVFPAAQVVSLLGSKVSGVETGLKNLSRSKAALGVWDALITSAKPKLTEAI
FT                   AWAENQLMVGPTLNVARTGRP"
FT   gene            57759..58571
FT                   /locus_tag="Acry_3342"
FT   CDS             57759..58571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3342"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3342"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28954"
FT                   /db_xref="GOA:A5FTM2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTM2"
FT                   /protein_id="ABQ28954.1"
FT                   /translation="MARLWIFSDIHAEFRRGKAPIGGLTPPEHADIAVIAGDVDHARHA
FT                   VATTRRLIGAHLPIVMVAGNHEHYGALQTVPRGISLMKQAALEDGNTFVLENDVVEIPV
FT                   RGERVRFIGATLWVDFGLFCEPGRHAEYGRRGLSDFTEIISEDPSLFAIRPVDMMRWFS
FT                   ASRAFIKRELGRRLDGPTVVVTHHCPSIRSVAQRYLNDPMTPCFASNCDDLLDLGPDLW
FT                   VHGHTHDSFDYQAGRTRVICNPHGYVYGGELENRSFNPALAIDVGQSP"
FT   gene            58568..59284
FT                   /locus_tag="Acry_3343"
FT   CDS             58568..59284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3343"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3343"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28955"
FT                   /db_xref="GOA:A5FTM3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR017056"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTM3"
FT                   /protein_id="ABQ28955.1"
FT                   /translation="MSRMTGPTKAAPLGGILFYGDPHGEWRPLVRAVLEHRPAAVVILG
FT                   DCGLDVPLRQKLASVWDLVPRWRWIIGNHDVDSIAEYEFLVESHPDGDLGGKWAELDGE
FT                   IVAGLGGVYAAKVWYPKFGGDHDDPPKFRTRQEMIKQTARADRFKGGVPRSSRATIFPE
FT                   DHEALRRIRAAILATHDAPTSHRHGFAAIDELAREMGAGLVVHGHHHHSYVGQTADGIP
FT                   VRGLDIAEPWLWKEGE"
FT   gene            complement(59338..59736)
FT                   /locus_tag="Acry_3344"
FT   CDS             complement(59338..59736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3344"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28956"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTM4"
FT                   /protein_id="ABQ28956.1"
FT                   /translation="MPPGPLAYRLDRRELRLITPLSCHVLNRAKPVGQDRIGGDCLGLL
FT                   SETYVEVDPGCLGRLLQPLPLNAYTVGHGEQLIERVRPHVAHDHAAERVADIVNENGYS
FT                   GVPQAPPWKLASERICQITKTVSLIQYK"
FT   gene            complement(59936..60745)
FT                   /locus_tag="Acry_3345"
FT   CDS             complement(59936..60745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3345"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3345"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28957"
FT                   /db_xref="GOA:A5FTM5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTM5"
FT                   /protein_id="ABQ28957.1"
FT                   /translation="MAEDIERDLKPKPGVPLVRALDRGIALLRAFSLTKPRQTLTELTK
FT                   AAELDKGTTRRLLQTLIIAGLVDHDERSGLYALSVGVLEIASAVHTGRELREVAAPYLS
FT                   DIAELCHMTTFLWVHHDGMAVCTERVRSAQPSIDAPWFGVGARTPLNCGAGPRVLLANI
FT                   TPEERESALRKPLVARTPVSQTDPDELRQAAERIRAAGYELAVDDFVPGLAAIGVPVFD
FT                   RSGAFAGSISITSLTSQIVDNGKPRFLAELQKAALEIGRKLIEPHRL"
FT   gene            60944..61801
FT                   /locus_tag="Acry_3346"
FT   CDS             60944..61801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3346"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3346"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28958"
FT                   /db_xref="GOA:A5FTM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTM6"
FT                   /protein_id="ABQ28958.1"
FT                   /translation="MVFDGRSLSRAKKLPLLSDEVVALSVKGLRKVYRKRGFFGVEHEV
FT                   RTAAGVSFSLSRGETLGIVSESRSGKSTAARCCMRSIEPNGGRIALGDLILSVLSASEV
FT                   RRQRKHIQMAFPEPFASHNPRQIVARVIAGGPVAHSVSRHTTLQKAREMVASVGLPGRA
FT                   IDCYRNELSAGQRVGIARAPALEPDVLVVDETVIALDASVRAQILKLIKDIQSRQSLTI
FT                   LLVTDDLRVAAEICDRIVVIHPGKVVEAGEAFQSSPLPNMNTPVNCSPPCPADGASATD
FT                   QQEP"
FT   gene            61818..63128
FT                   /locus_tag="Acry_3347"
FT   CDS             61818..63128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3347"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /note="TIGRFAM: acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase; PFAM: peptidase
FT                   M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3347"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28959"
FT                   /db_xref="GOA:A5FTM7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR033687"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTM7"
FT                   /protein_id="ABQ28959.1"
FT                   /translation="MSLDPALREKILASVESGFAEQIAFTEELIRFASVRGAEHACQDF
FT                   VFRALRERGFAMDRFAMDRDAIAAHPGGSPWSEQHSDAPIVVGIHYPQEEKGKSLILQA
FT                   HVDVVPPGPAEMWTNGAFNPVVEGDWLYGRGGADMKAGHAANFFCLDALRRIGLQPAAT
FT                   VYVQSVVEEESTGNGALMTHLRGYKADAVLIPEPEEEMLVRANVGVLWFRVEVRGRPVH
FT                   VREMGNGANAIDAAYRVISELRKLEQEWNDAKTGREHFADVEHPINLNIGKIEGGDWAS
FT                   SVPCWCRIDCRIGLYPGVNAAEASKEISDRVAAFARSDAFMGNNPPSVTFNGFHAEGYV
FT                   QAPGTEAEAVLARAHEGSTGKPLQSFMTPGYLDTRVYALYDKIPALCYGPISENIHGFD
FT                   ERVSIASLKRITGTMALFVAEWCGVEPIKTWPRCHGG"
FT   gene            63145..63894
FT                   /locus_tag="Acry_3348"
FT   CDS             63145..63894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3348"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3348"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28960"
FT                   /db_xref="GOA:A5FTM8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTM8"
FT                   /protein_id="ABQ28960.1"
FT                   /translation="MALSDGMSRAEVDRIEAKDFALGIGPLRPRNAATLILLDGHGSTA
FT                   RILLGRRHRGHAFMPGKFVFPGGRTDLSDGRVAVAAPLHPQEESRIAGSGYRATSALAQ
FT                   AVALSAIREAYEEAGMLLGRAEVFQTAITAWRDFAAQGVKPALDRLRFVGRAITPPGRV
FT                   RRFDTRFLAAFRHDVVVELPGGGPSGELEELVWLPIDEAKRADVPAITLTMLDELQRRL
FT                   ADDPELKPGVPAPIYRMHRSRFVRHLV"
FT   gene            64143..65307
FT                   /pseudo
FT                   /locus_tag="Acry_3349"
FT   gene            65524..67017
FT                   /locus_tag="Acry_3350"
FT   CDS             65524..67017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3350"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3350"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28961"
FT                   /db_xref="GOA:A5FTM9"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTM9"
FT                   /protein_id="ABQ28961.1"
FT                   /translation="MLITFGGLALFFAIIVIYLQISFRRDRDFGDYAVAGRSFGAFFQS
FT                   MSFLNTWYPGAIFIAFGGLAATAGVISFYLLMYSLLTIVVMYVISNRVWLWGKEFNLYT
FT                   QPDLFALRYDSKNLRLMIGVIGIVSQFPWIILGMKALGMMFYYMALKKIDFDVAVILGV
FT                   ILMVIRQFWTVQMGMRGVVISDMLQGVVSYIGGSLLLIGLIGWLMIDRHASFAALPDHL
FT                   FEIPGFGSKQGPLYVFALIFTSALGGWCWPGIFVRLFTADSVGAMKKAAAISAPISLIF
FT                   GAAVLILAMLASTIPAVAKAPDAVWFIVNQQAGGLVLLSIAGIIILASTMGNIDGNIQS
FT                   TGAQIANDIIGDFTNLDEKQKVLAAKIGMVAITLLGAWIATMKIPQLFNVAVIGYQGII
FT                   QLAVPQFLGIFWLRGNRAGAYAGTIVGFVLAVVLTLHYPAYVGPLWGLTSGFVALAVNF
FT                   AVYVACAYIFPHTPEEERRVRGLFGDVAGQDVSVAANVR"
FT   gene            67234..67698
FT                   /locus_tag="Acry_3351"
FT   CDS             67234..67698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3351"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28962"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN0"
FT                   /protein_id="ABQ28962.1"
FT                   /translation="MRLCHSPFSRRHHPLFVRAVQDQIEQLWFRPSARPPDPSAAQSLE
FT                   SFRRFTAASEAGDLVAVRSESGGQVRFWLTNIDGLSRARGLLFTEDWPEFGDHAWLLAT
FT                   GRNAFCPDGQDRLVIPTAAVIRFIEEFPHGVAIDASSSRAALLSPDMASG"
FT   gene            67707..68312
FT                   /locus_tag="Acry_3352"
FT   CDS             67707..68312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3352"
FT                   /product="restriction endonuclease"
FT                   /note="PFAM: restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3352"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28963"
FT                   /db_xref="GOA:A5FTN1"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN1"
FT                   /protein_id="ABQ28963.1"
FT                   /translation="MARSRSRRRRSGSEPFAALAGLVALAMAGKVLAAIQHDGEQFGAV
FT                   LRGLELPAMVALLIIVGLLVLAFQIRRRRRRAYREAMLRIGGSDPLSLSPVQYEHFCAF
FT                   LLEHYGWKTETTRASGDFGADIIARRGGEVMVVQCKRYAQPVGVKAVQEAHSAASFYGA
FT                   GRTAVMACRGFTRAAHALAGKTGTTLVQVGENDAAAFR"
FT   sig_peptide     67707..67808
FT                   /locus_tag="Acry_3352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 34"
FT   gene            complement(68322..68723)
FT                   /locus_tag="Acry_3353"
FT   CDS             complement(68322..68723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3353"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3353"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28964"
FT                   /db_xref="GOA:A5FTN2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN2"
FT                   /protein_id="ABQ28964.1"
FT                   /translation="MIDQESSADLLIHFGQLIRKVRISFGVRQADLAAMVGTRQATISE
FT                   LERGRLNIHLDLALNLMRHLGIEIREPEAHSDDAQITEEAMSVPDIDNIIPPPSRRTPC
FT                   NPEAGLPTSSAPSDQNGDPADDPPAEPAP"
FT   gene            complement(68839..69462)
FT                   /locus_tag="Acry_3354"
FT   CDS             complement(68839..69462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3354"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28965"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN3"
FT                   /protein_id="ABQ28965.1"
FT                   /translation="MLSTSGYRRLVGDLADARCIWPVNRRLYLNREASPAAGPDEAAEH
FT                   LEPGAIVSLQRVLGAHGILNNPSAYVTAVVPLRTGHPPPTLGHRATEAGVFVFKGIPAA
FT                   VLAAGEEEDRLEALNRPFPGRMPIATPEKALIDWIYLGSSPRSDMLLPPIHDIDLETLD
FT                   RERLGRLAKAAGPAVEAAVSAWMEKADQHVHYDDREDDGPIPGF"
FT   gene            complement(69561..70400)
FT                   /locus_tag="Acry_3355"
FT   CDS             complement(69561..70400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3355"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28966"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN4"
FT                   /protein_id="ABQ28966.1"
FT                   /translation="MTVSSLIRGTPNDADVARELLQYEVVRSIFVKSTEREIALKGGFA
FT                   MRALFGSARHTKDIDLQHDARRANLARTQTLIRSAIRNAVATGILEDVRISEPKQTDTV
FT                   ARWKIGGRTVGGSQVALTIEVSRRPMPGDDCLTRMEMQPPAEIGGALVMVDTYSADAMA
FT                   GAKTIALLSENRLAPRDLWDLDILITMRAEPPPHMIDHLRTERARQALFDKLDTMSWKL
FT                   FREEVLPTLPAGVAEALDRDAFEEMKVRVALAVEKWLADGDRSPDRRPDNQEPGPTP"
FT   gene            complement(70677..70916)
FT                   /locus_tag="Acry_3356"
FT   CDS             complement(70677..70916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3356"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28967"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN5"
FT                   /protein_id="ABQ28967.1"
FT                   /translation="MLQFELRAFPNEAMGPEDRTFVQAPSDQAIRARAGRLAVRINGPV
FT                   DIARAGGADWNDRYLTTANPSEYHAAGYRFERLT"
FT   gene            71007..71858
FT                   /locus_tag="Acry_3357"
FT   CDS             71007..71858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3357"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28968"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN6"
FT                   /protein_id="ABQ28968.1"
FT                   /translation="MRGAATARQSGSTRRDSSFGAPAFRAFGPGARSPPESGGGRSLDR
FT                   IAHRPRLCRRRAVIPGWLMLQNLEIDPRGALEGPVLQTPRFVNRHRALDPGRGDDETPD
FT                   RLHELCQARLSCLSGDRQRPKCQPFARSRIFAVCPELSGDCGARRPLASDPVPITCPER
FT                   GLHVEKGSPDKPVLLPADRQQKRTDDLGGDLASNSLIRSAAGIPFLDPTDEGFGIAGGG
FT                   VHSSEQGACGGPDAHCLPVVPPADYLAEIHRGTPSNASRSLLTNRVTNKPATGLPGAEA
FT                   FA"
FT   gene            complement(71903..73144)
FT                   /locus_tag="Acry_3358"
FT   CDS             complement(71903..73144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3358"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3358"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28969"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN7"
FT                   /protein_id="ABQ28969.1"
FT                   /translation="MREFPGSLTLMPEEGRAGYGHLLDLSFSLAAESAELGGMMRAPTR
FT                   RAIARLVRAMDCYYSNLIEGREARPKDIQRALSENYSSDPAVRDKQVEARAHIKVQERI
FT                   DDGAYDRLGLGTELIRSIHKDFYLHMPESFRSVELNGVRHRVVPGEFRNLYVVVGRHEA
FT                   VAPEMVPGFMAHFEAGYRGVGPAFSLIAAAASHHRLAWIHPFLDGNGRTARLYTHAWFR
FT                   RFTKGADLWSVSRGLARTLGDYRSKLARADYPPQGGTDGRGTLSASGLAEFCAYFLETA
FT                   LDQVRFMRDMLAPDTLLPRLRLFVQHEAEAGRLDPRAFAILELAYLRGHVPKGEVETLL
FT                   GVSERHARRIVTPLVEQGLLESEGRSAPFTIGFPLEEADLVFPRLFQMPAAATQAKFLD
FT                   AVRSDDAVDDMPAP"
FT   gene            complement(73293..74399)
FT                   /locus_tag="Acry_3359"
FT   CDS             complement(73293..74399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3359"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28970"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN8"
FT                   /protein_id="ABQ28970.1"
FT                   /translation="MLLCDQVVAMRNRILAVPGALQAATSSIQRIVSVADTLPSAPRFI
FT                   LANDVTEALITSSIDYPEALTGCIDAIRIPWRCAWFEWDDDFARDTWRRAHVRQRVQDD
FT                   NFMPKRVGFIVETDEGGRRGEISVLWPVPESDGKGGLTSNYDGMVMSNLPTVHFDLDRQ
FT                   DLDARVMVGAASLERATGIPIPEIGFNNELEPGRARYLDRIRATMMMDWSNSGVAKLIT
FT                   HLGHYNPVEFVSNAVADIWSEYCMLVPAAAMMNARQAVRTAPVDRTRLNKARLKSGRSP
FT                   LLDHQVVSMNVSPEERAERRRVAAGGAARPRATHWVRGHLVHRGGTIFWRRPHIRMGVG
FT                   DVPVGRTVRVHGQPEIRPEVDDMPAPGQ"
FT   gene            74540..75703
FT                   /locus_tag="Acry_3360"
FT   CDS             74540..75703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3360"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28971"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN9"
FT                   /protein_id="ABQ28971.1"
FT                   /translation="MSGQSQSGQSGQTSQARPEAADREHYVWHHMRQPNGFTCGSTCVR
FT                   MLSSILLAGEPDPPRLHPEVIAGMMGTSPRTGTTEIEMKRGLDLYGIPHERMPPTADGA
FT                   GPGRMEDLIGWLKAGNMAMLRCLFFGMKHWILATHADARGIHVLDPAAQSPGILSPDRV
FT                   ASLIQPRGWEFWKIPANAPCRELHFGRLPRPGIATEVMQDAVVGLLLDHGDLDRRMIPP
FT                   EAAGWLVGQLMRSERSYGLWDGNRLLATHIASGCQPWKVLEDAGFTVDEATMERLRAQL
FT                   ARLPGAVYHSLATAVHPDVEENGGRWLVDAAPGLFGFAGVHGIERADEAAGGRAGDTLL
FT                   ELRHDEMRYFVREAPNFDGVAALEEVVTGPTRGPSDEDAQGPGPSPG"
FT   gene            complement(75757..76203)
FT                   /locus_tag="Acry_3361"
FT   CDS             complement(75757..76203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3361"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28972"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP0"
FT                   /protein_id="ABQ28972.1"
FT                   /translation="MLRPLLRQVEDAKVLSSDACGAEGISICLTDARDTETGAPFIACR
FT                   LNEGGVVAVSGYGMIFVAPPWRGLGLGAELSLYSRMLEDDDGHGAHLYSPGGLAAAISG
FT                   YELGCRIGADLGYHDRLADVMIDAGLMRRRYGLDRPRGSPSPEA"
FT   gene            complement(76365..76922)
FT                   /locus_tag="Acry_3362"
FT   CDS             complement(76365..76922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3362"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28973"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP1"
FT                   /protein_id="ABQ28973.1"
FT                   /translation="MPNYYSTVAVHEPLPLALLSTLEREILGAAFQDAQPDGELIHLFA
FT                   SETAGGFLEMRLSELRKAFENLPDRATGVGRTLAAPLEAAAAGGSGDDDMVTVDIDEDA
FT                   WLSVLQDISARMPQQMIRVTAAWTCSKPEPQATGGSAMLVTPKSIFRGSTDSLMAQFID
FT                   EASQEIGHLDEVTPEPGPEPQP"
FT   gene            77163..77720
FT                   /locus_tag="Acry_3363"
FT   CDS             77163..77720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3363"
FT                   /product="nucleoside 2-deoxyribosyltransferase"
FT                   /note="PFAM: nucleoside 2-deoxyribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3363"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28974"
FT                   /db_xref="GOA:A5FTP2"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP2"
FT                   /protein_id="ABQ28974.1"
FT                   /translation="MMRSDKPRVYLAGPDVFRADSDTHGAHLIQLCAAHGVTGVYPADN
FT                   DMVAGIDTMLRAGQPPSEVARAIFRANADRLRTCDAVLANIDPFRSPGADNGTAWEMGM
FT                   AYGLGLPVFAYTSDLRTTREKISNWHCAPFSVQDGITRDRDGMMVEDFGEVDNLMLTCS
FT                   VVGERVHPDFLSALRAAAAHLA"
FT   gene            78680..80134
FT                   /locus_tag="Acry_3364"
FT   CDS             78680..80134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3364"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3364"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28975"
FT                   /db_xref="GOA:A5FTP3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024023"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP3"
FT                   /protein_id="ABQ28975.1"
FT                   /translation="MASFLKPEAFEPDPRAMRLLPFRFERISDDVVIISNFVGELMFAT
FT                   DNEMSRLVSLDLKPGDGLFERAREKLLVSVGSERAPLELLALRLRSRLAFLRNPTPLHI
FT                   FVVTLRCEHSCPYCQVSRQSSDRNQFDMSDETAMRAIDVAMSTPGDSLKIEFQGGEPLL
FT                   NFDLIQRVVDVASKEAVSLGKSVQFVIASNLAMLDDDILDFCKQRSVLISTSLDGPADL
FT                   HNRNRPRPGGNSHELAVRNIQRAQGVLGRDRVGALMTTTEASLDRAEEIIDEYLALGLE
FT                   GIFLRPLSPYGFAMKTRQFSKYDGEAWFRFYVRGLKYILEINKSGRRFPEFYASLLLRR
FT                   MLTDRADGYVDLRSPMGAGLGTLVYNYDGDVFASDEGRMLAEMGDRTFKLGNLASADYA
FT                   KLALSEKLIDLASRSLTQSAPQCSSCAFEPHCGADPVYHHATQGDPVGIKRFSEFCGRQ
FT                   KRIIGFLANLLEKSPDDAAILRGWAS"
FT   gene            80122..81303
FT                   /locus_tag="Acry_3365"
FT   CDS             80122..81303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3365"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3365"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28976"
FT                   /db_xref="GOA:A5FTP4"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024032"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP4"
FT                   /protein_id="ABQ28976.1"
FT                   /translation="MGVVTPLALAGRAITICWSNVSANRFIVRVQDPASCAQGPADAAL
FT                   IRSVDDAENAKRSGFKSAVGIGLSTDKATGFDQLILLDGRFDYLSDGDILRVHPNTNHI
FT                   RTLYRRASQHNAFLVTERCNHWCLMCSQPPRNVSDGWIIDEIAECFPLLNPQPRSLGFT
FT                   GGEPMTDWERFINLLSLAKDQLPSVALHVLTNGRAFAKPPIAVAWAALRHPSLTAGIPI
FT                   YAAAGHLHDYIVQSMGAFDETVMGILRLKDQGQRVEVRVVLHALSVPRLVETAIWLGRN
FT                   LPFVDHVALMGLEQTGFAIANQDQLWIEPTEYAAQLAEAVLILQSAGIRVSVYNLPLCL
FT                   LPRPVWPASVQSISDWKNGFLPECEECAKRGDCPGFFSSGRKAVGRKVRPIKL"
FT   gene            81684..83159
FT                   /locus_tag="Acry_3366"
FT   CDS             81684..83159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3366"
FT                   /product="AAA ATPase, central domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; ATPase
FT                   associated with various cellular activities, AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3366"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28977"
FT                   /db_xref="GOA:A5FTP5"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP5"
FT                   /protein_id="ABQ28977.1"
FT                   /translation="MTKASGNPTDDISGLLEDGIGVFDDAGELHVPLRRGRGGTPVAGT
FT                   RGDWGLEDPPAPPIVPAPGMNDRVSNWAARNIIAPAILAIIQPTGLDREQAGRVHDAVR
FT                   RLIPAGLPPGALNLHGAVKLLFGMEFRSLPLKTRCETLEMLLAWMGLTEEVGLEIFGED
FT                   IWRALPFHWNQRVAELDTSDDAVAPAEVAAGATDPRRDVATGVIVVREIGNSDNDSAKR
FT                   ADKAVTSLVQKPLPLFRSNRLDTFRERMVADFPHAATAIDDLYWDLTTRDHVAWTPRIL
FT                   VGNPGVGKTSFVEAACLVLEIPYLKYPCGGDTDSVSFRGASRKWSTTSPSLPLSLIASH
FT                   QIANPVIILDEIEKAGTSRYNGNLLDVLLGMMDRKQASGWYDPHVEAPIDLRHVNWLAT
FT                   ANSTKDLPPAIRDRFRMVSRIADPSAEHGPHLVKALLRQVVAERGPGAAMIEPLGLDEI
FT                   EAITGIWGGGSVRQLQTVLEHWLRQRDRSASRH"
FT   gene            83313..83666
FT                   /locus_tag="Acry_3367"
FT   CDS             83313..83666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3367"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28978"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP6"
FT                   /protein_id="ABQ28978.1"
FT                   /translation="MFNILQFSDHGYFAPQKIAKELKTSSEDVARSAGLGRDAVQRANR
FT                   VQSDRTQRRLREMVEILNKSTPRFGSLLMAYAWYRSQPLPGFSGQTPMQLVMHGRANEV
FT                   LEYLDAVDAGIHA"
FT   gene            83663..84184
FT                   /locus_tag="Acry_3368"
FT   CDS             83663..84184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3368"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28979"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP7"
FT                   /protein_id="ABQ28979.1"
FT                   /translation="MTAASYKGLLYRAINPIYAADPMSGEGARLYGGRFNPRGVPAIYC
FT                   SISVMTALREANQAGALQPTTLVSYDAEIERVFDARDVSAVEAEGFSPGTLASQTWRDE
FT                   MKAGKQSQTQVFASRLIAKNYCALLVPSYVAGATPSDLNLVLWKWGSSTPSRLVLIDDQ
FT                   GRLAVPPLPA"
FT   gene            complement(84188..86872)
FT                   /locus_tag="Acry_3369"
FT   CDS             complement(84188..86872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3369"
FT                   /product="sigma-70 region 4 domain protein"
FT                   /note="PFAM: sigma-70 region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3369"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28980"
FT                   /db_xref="GOA:A5FTP8"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP8"
FT                   /protein_id="ABQ28980.1"
FT                   /translation="MHSIYILFLSQLQRVSRLKHMNASGTTLRDALDEIELARPTAQAV
FT                   SENPDSPLMTMSVANVLDLRNALLSREVSFRGFSVPILKQIFSHLDEAGYSHAGAARAQ
FT                   MNARQQDDARVAALAAVFRVLALVPFPEALLEADPAIRLRRILEDFVAARDSKDDWRAG
FT                   VHTLADLLSDWKGIMTRLQQADNFGAKSTTDLKLLVDGALLRATEAVASVVSKKDVATE
FT                   RLNLAGILAGDIPVPLQHMIGRADLDKVRDALPAFLAEPAHHLLGGSHGRKNRATELPG
FT                   FPGVIMRNEKQAQILAMRYGFFDKPATLDVVSNTVGITKERVRQIEVEAVKHLGREPSR
FT                   QKVEPIIEAHLPQLIEILTDGTGYLPDEASGEINRKAMIAHGVPGTVVLGLEALFPSAS
FT                   DLANRYGTRQGNGWLLGLDDKARGRAQATSKLLSTRLRGRRNAILVSDAMEAAGATTSE
FT                   ISAAVAMVPGAAIVGRHIIRDIDQLNERRAYQLYDLAIKLDDGAPFDLTRLCEAYAAAT
FT                   PEENNMPNCVPRAIAGAKGMFLNVIDRIWFPLQEKLPERPAGHAPLPYTIRPDMSQTSI
FT                   WRRPFGENTVAHFLHGQITRHGPIRTLDLAELTLPENYGSRSETLSGAQPIMKMNPNFV
FT                   HLSPGIYGLVEQLPKLTDPRRALPEVLLADRIVRAYTDARRVSPAAARIYPIWDMAFEY
FT                   RLARWAAEHANKKVAGALFDVVDPRMWPIAEDEITRWQAVKAEMSDRKQHHQTEQPDEY
FT                   ALPPADRFLASMITLWWMGEISWTLIGRTTNQRDMHTPASHLALLARFGLARAPKHWQD
FT                   RHLPTADLRPTLEAVIRDAVHADGISWRNPEMRALLSRDAGPGGWVDNDAVSRALQRPG
FT                   DPQLSVYGRTKVRRGRVLQPVNG"
FT   gene            complement(87261..87539)
FT                   /locus_tag="Acry_3370"
FT   CDS             complement(87261..87539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3370"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28981"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP9"
FT                   /protein_id="ABQ28981.1"
FT                   /translation="MNTKIWATKQRVKSMSSMPMPARLVWTDGHDRAPGGFRHADRVHG
FT                   RDARGAVVKAVTDSSVVGPSRASPKAIRPGFRRIASAMEAAQYCCLA"
FT   gene            87871..88137
FT                   /locus_tag="Acry_3371"
FT   CDS             87871..88137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3371"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3371"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28982"
FT                   /db_xref="GOA:A5FTQ0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ0"
FT                   /protein_id="ABQ28982.1"
FT                   /translation="MIKDAQAFGALVQARRKSLGLTQRQLALAINSGERFIVDLEAGKT
FT                   TCQLGKALAAANAVGIELADTGARGASTERRGEQELDLPEVDL"
FT   gene            88134..89282
FT                   /locus_tag="Acry_3372"
FT   CDS             88134..89282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3372"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3372"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28983"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ1"
FT                   /protein_id="ABQ28983.1"
FT                   /translation="MSDHTPVFYETLLVGMIHTDTRGSCFTYDESWLSRTGSFQISLTM
FT                   PLGRPAVEHHVIMPWLANLLPEGDAISTIARRSGIATGDILSLLMVVGRDTAGALSIGQ
FT                   PRSREGRHYMTIAGQDALERLIEDLPRRPLLSGDDGVSMSLPGAQEKLPVVLNDNDIAL
FT                   PLNGAPSTHIIKPNNRRLPGSVQNEALCMVLARRVGLDVADVTTGQAGKRSYLLVERYD
FT                   RIQRGGVWRRLHQEDFCQALSLPPASKYQHNRTGILGPGLADLFRTVRTFMTARDTIRL
FT                   LDAVIFNVLITNVDSHAKNYSIMLTGRARLSPLYDLMAGDAWSEVTQNLPQDIGGKNRG
FT                   QYINHLHWRRMAEESGLSAGAVVRRVIQMATALPSMLDQAVD"
FT   gene            89444..89701
FT                   /locus_tag="Acry_3373"
FT   CDS             89444..89701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3373"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3373"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28984"
FT                   /db_xref="GOA:A5FTQ2"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ2"
FT                   /protein_id="ABQ28984.1"
FT                   /translation="MRLYFLVLDELGYLPFAQTGGQLLFHLISRLYERTSIIVTTNLAF
FT                   GEWPSVFGDAKMTTALLDRLTHHCEIIETGNDSWRFKNRA"
FT   gene            89814..89999
FT                   /pseudo
FT                   /locus_tag="Acry_3374"
FT   gene            90016..90147
FT                   /locus_tag="Acry_3375"
FT   CDS             90016..90147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3375"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28985"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ3"
FT                   /protein_id="ABQ28985.1"
FT                   /translation="MEAGKRRLAGDTARAATTGEVQDLRREARALKITGKPRSLSEC"
FT   gene            90683..93145
FT                   /locus_tag="Acry_3376"
FT   CDS             90683..93145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3376"
FT                   /product="Phosphoketolase"
FT                   /EC_number="4.1.2.9"
FT                   /note="PFAM: D-xylulose 5-phosphate/D-fructose 6-phosphate
FT                   phosphoketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3376"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28986"
FT                   /db_xref="GOA:A5FTQ4"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR023962"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ4"
FT                   /protein_id="ABQ28986.1"
FT                   /translation="MRLKNPMLTDGDIEAISPYGPARATIHGTPLNPDELERLDAYWDI
FT                   SLYLCLGMLYLRDNPLLRTTLQPEHVKARLLGHWGSDAGQCFTYIHFNRLICKYDLDAM
FT                   YISGPGHGAPAVLSQAYLEGTYSEIYPEISEDLAGLRRFFNQFSFPGGIGSHATPETPG
FT                   SIHEGGELGYSLSHAFGTVFDNPDLITLVMVGDGEAETGPLATSWHGNKFLNPITDGAV
FT                   LPVLHLNGYKINNPTILARISHEELEALFVGYGYTPYFVEGSDRASMHQAMAATMEHCV
FT                   HEIRAAQGEARRTGKAFRPRWPVIVLRSPKGWTGPRLVDNHYLEGSWRAHQIPIADVPC
FT                   NPDHLKLLEDWMRSYRPEIHFDGDGRIIPELRALAPKGLRRMSANPAANGGTIRRPLNL
FT                   PDFRSFQVDVDHPGVRRAGNVPTLGPFLREIIRENHDNFRIFGPDETQSNKLDSIYTAG
FT                   KKSWLGAHFPEDEDGGNLAVAGRVMEMLSEHTVEGWLEGYLLSGRHGLINSYEPFVHVI
FT                   DSMFNQHAKWLEKCNELAWRVPISSLNILITALVWRQDHNGFTHQDPGFLDVVANKNPD
FT                   VVRIYLPPDANCLLSVADHCLRSQNYVNVIVSDKQIHLQYLNMDAAIAHCAKGAGIWDW
FT                   ASNDHGQEPDVVMASCGDVPTVEALAATALLRTHLPDIKIRFVNCVDLFRLVPNWEHPH
FT                   GLTDSEFEELFTATKPVIFNFHSYPWLIHRLTYRRPAQHNIHVCGYGEKGNIDTPLELA
FT                   IRNRTDRFSLAIDAISRIPRFRDSSSDVLEVLLERRQACVQHAHEFGTDPKHISDWIWP
FT                   KADSEGRS"
FT   gene            93356..93748
FT                   /locus_tag="Acry_3377"
FT   CDS             93356..93748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3377"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28987"
FT                   /db_xref="GOA:A5FTQ5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ5"
FT                   /protein_id="ABQ28987.1"
FT                   /translation="MNAGATLPNATLKVLEEEGEPEFSTRDVCAIAKVTAPTLYHHIGS
FT                   ADIPTAEEAFTLLTACVAAIAGEGSLTQKVDAAPDIMWTSTKAASLLCGTASLRKLSTP
FT                   TAAVLEQKRQGAFRSILKSKSNVQSQ"
FT   gene            complement(94167..94619)
FT                   /locus_tag="Acry_3378"
FT   CDS             complement(94167..94619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3378"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28988"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ6"
FT                   /protein_id="ABQ28988.1"
FT                   /translation="MTRVRRFRRTFGNNRRENATAPEGSACKKTFEIAADDKAVERGDR
FT                   HQIHAARLIMAAHGRGHDKIALPLVRRDPYQDRGSEIEVPVVFPQHKLPLRTRQDRKER
FT                   HGRETFGLGILPYPPRGLYSTQRNDSVAEAEQRLKPGWWVFQRLAR"
FT   gene            94823..96502
FT                   /locus_tag="Acry_3379"
FT   CDS             94823..96502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3379"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3379"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28989"
FT                   /db_xref="GOA:A5FTQ7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ7"
FT                   /protein_id="ABQ28989.1"
FT                   /translation="MFFRIKPSGGRRYLQIVENKRVDGKVRQVVRLTIGRMDELEASGQ
FT                   LARLLTSGARHCEQMMLLSAIENEATTLSMRRFGAPLLFGRLWQESGIAAVFEELLAGR
FT                   QFEFPVERAVFATVLHRIMVSGSDRACDKWLEDYDIPGTEELGLHHLYRAMAWLGEELP
FT                   DEEQGDATPFAPRTVKDLVEERLFARQHDLFTDLSVVFMDTTSLYFEGADGETLGARGH
FT                   SKDYRPQLAQMILGVVIDQDGRPICTEMWPGNTADVSVLVPVIDRLRSRFGITRVCVVA
FT                   DRGMISAATIAALEERGLEYVLGARERTDRIVREVVLADERPYIPLCLERAGGDETQLF
FT                   IKEVKVAGKHYIVCRNEAVAIEEAETRRQVVAALDRQLTRGDKALIGNSAYRRFLRPVS
FT                   DAKPGRKSKLFEIDAGKLAEEARFDGVFVLRSNARISPLQAVLRYRDLQNVEQLFRVAK
FT                   ATMRTRPIYHSSAAAIRGHVFCSFLALILHQALDEKLRRAGKRVEWADLLRDLDRLQHG
FT                   EISQNGKRWQLRTEAGVAAATAFKAARIALPPRLQTPQQAVT"
FT   gene            97123..97491
FT                   /locus_tag="Acry_3380"
FT   CDS             97123..97491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3380"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28990"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ8"
FT                   /protein_id="ABQ28990.1"
FT                   /translation="MHSATGHLILITTLTFRPSEIGEAIQSSPEIGRRIEAASRRDADT
FT                   PPTAQDSDCTKQVGQNLDSVVAALIHRGPDAHEVNDVGKQRKLNGGRAGYRWHARAAFD
FT                   HRWHGRCRWCPLRPDLLA"
FT   gene            97955..98353
FT                   /locus_tag="Acry_3381"
FT   CDS             97955..98353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3381"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28991"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ9"
FT                   /protein_id="ABQ28991.1"
FT                   /translation="MKRLTMRNIREAQRLHAGGLSTRKIAASLGVGQSTASDYLKPVEH
FT                   AGLSWPLAAEMTDAALEALLFHPIGGPSRLVEAQPDWPAIHPRDCGAPALHTALLCGFG
FT                   TCPPLVQLLVKTRVPKPGGLTGGASDIA"
FT   gene            complement(98627..99049)
FT                   /pseudo
FT                   /locus_tag="Acry_3382"
FT   gene            complement(99228..100943)
FT                   /locus_tag="Acry_3383"
FT   CDS             complement(99228..100943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3383"
FT                   /product="pyruvate dehydrogenase (cytochrome)"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; thiamine pyrophosphate enzyme, central region;
FT                   thiamine pyrophosphate enzyme TPP binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3383"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28992"
FT                   /db_xref="GOA:A5FTR0"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR0"
FT                   /protein_id="ABQ28992.1"
FT                   /translation="MASTVAEIIVDTLCQAGARRCWGIVGDTINHFTDAVRKSDLRWVH
FT                   VRHEEAGALAAGGEGYLTGELAVCAGTCGPGSLHFVNGIFESHRNGAPVVLIASDVARA
FT                   EAGLRFPQEVDQRKIYEQASVFCEYVSHPDQARRITTLAAQAALTRGGVAVVIVNGDMF
FT                   TETTDDRLEWRVHRPSSVLRPSDDELDALARDLDSAARVTIYAGIGARGAAARVVQLAG
FT                   LLKAPIVHTSRAKEFIEPNNPFNIGMTGILGNRAGVEAIDAADIMLCLGTDFAWTQFYP
FT                   DARYVIQIDSDPTHLGRRAPIRTGLVGDVGATIEALLPRLKTRSDSAHLDRSLKRWAAD
FT                   REGYAKLACAHDDALIHPQTVAQTLDTLAADDAIFTADGGSPMVWLLRHVTANGRRSFL
FT                   TSLLHGTMANAYPQAMGMAAAFPGRQVIAMCGDGGMTMLMGDLLTLVQEKLPIKLLVFN
FT                   NGSLGFVEMEQRVEGLIDSFTELKNPDFAKLAEVCGISGWRVDTGPELEPAMRRWLAAE
FT                   GPALLDVHVNRVELVMPPKVEIGQVASTALFGVRAVLDGRSREVVQLLRDNFLR"
FT   gene            complement(100957..102585)
FT                   /locus_tag="Acry_3384"
FT   CDS             complement(100957..102585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3384"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3384"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28993"
FT                   /db_xref="GOA:A5FTR1"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR1"
FT                   /protein_id="ABQ28993.1"
FT                   /translation="MLDLLKRAIIPLAALVLSVILLVKSWIWLGLLCLAIVALGIHDFT
FT                   QRRWTITRNFPVAGRIRWLFYQLRPYLRAYIVEDDLHGTPYSFEARNLVHLRARGETDT
FT                   HPFGTERDVGAKEHHWISHSIAPESEPDESPRVLVGNEQCNRPYSASVLNISAMSFGAL
FT                   SANAVRALNLGAKRGGFYHDTGEGGLSDYHLEHGGDLVWELGSGYFGARDANGCFDPEK
FT                   FRDTAAHDAVKMTEIKLSQGAKPGHGGLLPAAKVTSEIARVRQVPEHKDCLSPRGHSAF
FT                   STPIEMMEFVALMRELSGGKPVGLKLCIGQPHEPFAMVKAMLETGIRPDFIVVDGAEGG
FT                   TGAAPLELSDWVGMPLLEGLVLMRNALVGAGLKDEVRLAASGKVYSGMGLARNISLGAD
FT                   WCNAARAFMFSIGCIQAQRCHLGTCPTGVTSQSPGRQRGLIPEVQGERAARFHAHTLKA
FT                   LSEIVASVGFKHPTDLQPHHIMHRIGPEKAAPIDEIHTFLPKGILRDAPDETIYADWWR
FT                   AARADSFRPAIDLIRIRASARGTAH"
FT   gene            103176..104042
FT                   /locus_tag="Acry_3385"
FT   CDS             103176..104042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3385"
FT                   /product="MltA-interacting MipA family protein"
FT                   /note="PFAM: MltA-interacting MipA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3385"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28994"
FT                   /db_xref="GOA:A5FTR2"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR2"
FT                   /protein_id="ABQ28994.1"
FT                   /translation="MNRFSELLGSRKPIWLLAPFAVTCSATPARAQTPSPLAEWQYSSG
FT                   IQLQRLFEPKIPTWQVELGLGTQFAPAAPGLNRYRIQGGPGIDIRYKNRFFLSTGEGLG
FT                   VNLFSFRHISFGTAISYDLGRSPHVDGEALNGLGTIHPAPELKVFATTVLTEGFPLTIR
FT                   VDIRKQFGASFGYIGDVGAYMPMPGSSKTFSWFLGPTVTLADARYMNTYFGVSHAQAAS
FT                   SKYHYYHAHGGFRSAGIGISANYFVTPHVIINLNAAYERLLGSAAKSPITQTVNEGVVS
FT                   LSALYKF"
FT   sig_peptide     103176..103271
FT                   /locus_tag="Acry_3385"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 32"
FT   gene            complement(104254..104646)
FT                   /locus_tag="Acry_3386"
FT   CDS             complement(104254..104646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3386"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28995"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR3"
FT                   /protein_id="ABQ28995.1"
FT                   /translation="MLRTNARVTPLQAVIRYRDLLEVEALFRAAKASFDTRPIFHQADA
FT                   AIRGHVFCSFLALTLAKELNRLCGARGFQPEWQKLLNDLDRLQQATIEKGGKVITTRTH
FT                   VTGQVGNVFKAASIALPHNISEHPAD"
FT   gene            complement(104711..105934)
FT                   /locus_tag="Acry_3387"
FT   CDS             complement(104711..105934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3387"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3387"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28996"
FT                   /db_xref="GOA:A5FTR4"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR4"
FT                   /protein_id="ABQ28996.1"
FT                   /translation="MARRTAPAIPDDLLDQLLAGGDAAAALNSGDLVNALKKALAERVL
FT                   SAEMDYHLSDEAEAENSRNGYGRKSVLTGTGKIEIAIPRDRAGSFDPQLIAKYQRRFPG
FT                   FDDKIISMYARGMRIREIAEHLREIYGMDASAELISTITDAVLDEVTAWQQRPLDPVYP
FT                   LVFFDAIREKIRDEGVVRNKAIHIALGVMADGTKVELGMWIEQNEGAKFWLRVMNELKN
FT                   RGVEDILLAVVDGLKGFPEAITAVFPETIVQTCIVHLLRNSMDFVSYKDRKAVATALKD
FT                   IYRAVDARAAEAAFAAFEAGPWGQKYPAIGQSWRRVWQEVIPFFGFPGDVRRIIYTTNA
FT                   IEALNSKLRRAIRARGHFPSDEAAARLLYLILNRSEKEWVMPPREWAMAKAQFAVIFGD
FT                   RFVRALAA"
FT   gene            106073..106405
FT                   /locus_tag="Acry_3388"
FT   CDS             106073..106405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3388"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28997"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR5"
FT                   /protein_id="ABQ28997.1"
FT                   /translation="MPATRRSHPPPPLQHRRFPTIPLARHPAPTPPLSHHPARPPPPLQ
FT                   HRRFPTTPLARHPAPTPPLSHHPARPPPPLQHHRLPHYQHQPHFHPTHHLFRHPFLTTP
FT                   YPRYCV"
FT   gene            complement(106903..107499)
FT                   /locus_tag="Acry_3389"
FT   CDS             complement(106903..107499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3389"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28998"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR6"
FT                   /protein_id="ABQ28998.1"
FT                   /translation="MHDQFACSCRFRVLNIVERRVMTSTTARAQQAPGEKIRRFKEFND
FT                   GAASWDRVERIIARVEAWPLGGDTRFIVTSLKAGSPRTLYQEIYCARGQAENHIKAWKT
FT                   NLAADRTSCSRASANQMRLFLHIGAYWLMWSFRSLMPRRSRWRGIQFNTLHLRLIKLAV
FT                   RLETLKRSIRMHLPRSMPDQAILGYAPARLPRLVS"
FT   gene            107764..108847
FT                   /pseudo
FT                   /locus_tag="Acry_3390"
FT   gene            complement(108998..109234)
FT                   /pseudo
FT                   /locus_tag="Acry_3391"
FT   gene            109594..111663
FT                   /locus_tag="Acry_3392"
FT   CDS             109594..111663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3392"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain; Recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3392"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28999"
FT                   /db_xref="GOA:A5FTR7"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR7"
FT                   /protein_id="ABQ28999.1"
FT                   /translation="MHEKIGPHHLERKALLYVRQSSAHQVLHNRESSALQYAMRDRLTV
FT                   LGWSSIETIDDDLGRSAAGGVTRAGFDRMVAEVCLGKVGAVAAREVSRFARNSRDWQQL
FT                   IEMCRVVDTVLIDQETVYAPRQSNDRLLLGLKGSLNEYELDLLRQRSLSARYEKARRGE
FT                   LLVAAPVGFMKAGDRLEKDPDRRVQEAITLVFDKVAELGSARQALLWFLEHSLDLPARR
FT                   ANGDVVWRRPTYATIHRMIENPVYGGAYAYGKTRVTPRHDAIVPRSSSRRKRRGDWLAL
FT                   KPGAHEGYVSWERAEAIRTMVSDNIPASRHHGAPKHGDALLAGLLRCRRCGRKLTVRYT
FT                   GTNHNIPRYSCWRGLLDNGEPRCIAFGGLRVDDAIEEALLRVVEPGAIAAAAAAEAQAA
FT                   GRRDQVREALVRDLEAARYQADRAFRQYDAADPANRLVAAELETRWNRALAQAAEVEAR
FT                   IAEHDAAAPNSSSLAVLDAARLGTNLRAVWAAPTTDSRLKKRIVRTVIHEVVADIDDTA
FT                   SEIVLLVHWIGGAHTELRLPTRRRGQRNSTASEIIAAVRHLALIASDDLIAGILNRNRL
FT                   LTGHGNRWTRERVTALRSHHKIQVFRPAPDGIEPQLNLTDAARLLGVAPKTLRLAAEAG
FT                   VIEGDHPLPDGPWIFRRSELAKPAAAQITHRARQNPKHPAGSHPDQKNLSLSTT"
FT   gene            complement(111675..112499)
FT                   /locus_tag="Acry_3393"
FT   CDS             complement(111675..112499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3393"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3393"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29000"
FT                   /db_xref="GOA:A5FTR8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR8"
FT                   /protein_id="ABQ29000.1"
FT                   /translation="MAPGRLLYKGERGGPFHKILAPSHKREAVAHLQSLFEVSQRRACD
FT                   ALGVDRTTVRYQSRRPDDAEARERIRVLAGERRRFGYRRLHWLLSREGISMNHKKFRRL
FT                   YREERLQVRRRGGRKRALGTRSPMTIPQGCNQRWSLDFVSDALTCGRRFRIFAVVDDFS
FT                   RECVRLIADTSISGARLARELDMAITERGARPLMVVSDDGTELTSMSILRWSKERNVEW
FT                   HYIAPGKPQQNGFVESFNARLRDECLNETLFTSLPQARSVLAAWRHDYNPVS"
FT   gene            112521..113435
FT                   /locus_tag="Acry_3394"
FT   CDS             112521..113435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3394"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3394"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29001"
FT                   /db_xref="GOA:A5FTR9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR9"
FT                   /protein_id="ABQ29001.1"
FT                   /translation="MKTEIAVLGIDLGKNSCSLAGLDGTGAVIKRRRMRPETVVTFTKE
FT                   LPPCVIAMEACCGAHHLARLLAAQGHDVRLMSPEYVRPYVKAQKNDDRDAEAIAEAATR
FT                   PTMRFVSMKTEEQLDMQTLHRARDRLVGERTALINQLRAILLERGVTVPQGRSKLERSL
FT                   IEMFDGDEAEPPATLTPRLRALIADMRAEWRELDRRITAFEDEFVARTREDEAARRLIS
FT                   IPGIGVMNATALIAAIGNGETFSRGRDLAAWLGLVPRQITTGGRPRLVGISKRGNKYLR
FT                   KLLIHGARAALPSLLTSSTPLGG"
FT   gene            complement(113781..114083)
FT                   /locus_tag="Acry_3395"
FT   CDS             complement(113781..114083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3395"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3395"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29002"
FT                   /db_xref="GOA:A5FTS0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS0"
FT                   /protein_id="ABQ29002.1"
FT                   /translation="MKSSRFSEEQIIGILKEQESGMSTAEVCRRHGISSATFYKWKAKF
FT                   GGLEVSDARRLKQLEDENARLKRLLADAVLDNAMLKEIASKTYGPPRLQVVFSMN"
FT   gene            complement(114946..115974)
FT                   /locus_tag="Acry_3396"
FT   CDS             complement(114946..115974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3396"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3396"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29003"
FT                   /db_xref="GOA:A5FTS1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS1"
FT                   /protein_id="ABQ29003.1"
FT                   /translation="MARVLVTGGTGFLGAHCIIQLLAAGHEVRATVRDLRRKDAVEAML
FT                   RQGGAEITTDQVALFAADLTADAGWNEAIANCDYILHVASPYPRSIPKDENELIRPARD
FT                   GTLRVLRVARDANVKRVVLTSSFAAIGYGNGHTGIFTENDWTDPDDPTIQPYQRSKTLA
FT                   ERAAWAFMNREGGALELAVVNPTGILGPLLGPDLSTSIHLIKRMMEGSTPGCPDLWFGV
FT                   LDARDAADLHLRAMTDPAAAGERFLATAGHFMSVTQVAQTLKDRLGNAACAVSTRQLPN
FT                   WLLRAAALFDPEVRPLLPELGKRKNATAAKAQRLLGWTPRSPEDAIIATATSLVELKLL
FT                   KS"
FT   gene            116044..116397
FT                   /locus_tag="Acry_3397"
FT   CDS             116044..116397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3397"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3397"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29004"
FT                   /db_xref="GOA:A5FTS2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS2"
FT                   /protein_id="ABQ29004.1"
FT                   /translation="MRIGDIARRSGLSASRIRFYERQGLIPVAARSENGYRDYPMSVLE
FT                   TLDMIRQAQSLGFTLDEIRAELVQGGGEPPVGKQILLALHEKLKVLEQHINQMTHRKQR
FT                   IVSLIEKYEASHS"
FT   gene            complement(116499..116723)
FT                   /locus_tag="Acry_3398"
FT   CDS             complement(116499..116723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3398"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29005"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS3"
FT                   /protein_id="ABQ29005.1"
FT                   /translation="MGRKNALFAGNDTGAEHWALMATLIGSAKLSGVEPLAWLTEILER
FT                   IVAGHTKANEIDTLLPWAWKTQAALPAAA"
FT   gene            116928..118475
FT                   /locus_tag="Acry_3399"
FT   CDS             116928..118475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3399"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3399"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29006"
FT                   /db_xref="GOA:A5FTS4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS4"
FT                   /protein_id="ABQ29006.1"
FT                   /translation="MPVERIAMRDVREIVRLRMAGLSTRQVGIRVGVAASTVRLTLRRL
FT                   EAAGLDGPGALALSEAALERRLFEGSAGKRPGHRRVDEPDWGRIRRELQRKHVTLSILW
FT                   DEYIAEHPDGYRYSRFCELYRSWEARLPVTMRQTHASGEKLFVDYAGDTVPVVIDRLTG
FT                   ETRAAQIFVAVLGASSFTYAEATWTQTLPDWIEAHNRTLAAIGGVPALLVPDNARVAII
FT                   RACLYDPQVNRTYTDMARHYGTAILPARPRRPRDKAKVEVAVLLAERWLLGKLRNRAFY
FT                   SLAELNAAIAEFCRWLNEERVVRRLGATRRHLLETLDRPALKELPAEPYVLAQWRRRRV
FT                   GIDYHVEIEKHFYSVPYRHARAEVEARFTVRTVEIFLRGERIAVHARGSGNGKHTTIAE
FT                   HMPSSHRRYGDWTIARIHQEAARLGPSVATLCTLILERRPHPEQGFRACIGILRLARSV
FT                   GADRLDAAAERALTIGTLTYGSVKSILDHRLERAAGTASPDPTPIRHPNIRGGGYFH"
FT   gene            118493..119239
FT                   /locus_tag="Acry_3400"
FT   CDS             118493..119239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3400"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; IstB
FT                   ATP binding N-terminal domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3400"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29007"
FT                   /db_xref="GOA:A5FTS5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS5"
FT                   /protein_id="ABQ29007.1"
FT                   /translation="MLNHPTLDQIHQLGLAGMARAFTELHANPETPSLSHAEWLGLLLD
FT                   REITVRRDKRLSTRLRHAKLRHDGAIEDVDYRSARGLDRALFQKLIQGEWIDAHDNLVL
FT                   SGPTGVGKSWLACALGHKACRDDRSVLYQRAPKLFTELALARAEGRHGRMIRTLGTVNL
FT                   LILDDFGLAPLDASARHDLLEIVEDRYGRRATIITSQIPPAHWHELIGDPTYADAILDR
FT                   LLHNAHRIELTGESLRKTRKQTPKTA"
FT   gene            complement(120006..120416)
FT                   /locus_tag="Acry_3401"
FT   CDS             complement(120006..120416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3401"
FT                   /product="Uncharacterized protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3401"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29008"
FT                   /db_xref="InterPro:IPR018988"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS6"
FT                   /protein_id="ABQ29008.1"
FT                   /translation="MNFDTKVAILILNDLAVWQKLNVTAFLATGIAAAAPEAMGEPYED
FT                   ARGRQHARLLGQPIMIFAANTEVLQRAYGQAIERNVIRAVYVRAMFSTGHDAANRAVFK
FT                   AEPADVPDLVGLALRGLKKDVDKAVKGASLHA"
FT   gene            complement(120451..121296)
FT                   /locus_tag="Acry_3402"
FT   CDS             complement(120451..121296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3402"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC protein, arabinose-binding/dimerisation"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3402"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29009"
FT                   /db_xref="GOA:A5FTS7"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS7"
FT                   /protein_id="ABQ29009.1"
FT                   /translation="MNSMSDRICLTHDTASGIEAVHARFMAHAYDLHRHDDWLVGVTES
FT                   GVQDFICRGARRRSTPGRVILIEPQEAHDGQAGDASGFAYSMIYLPRSWLRAGLMDAYG
FT                   GDPGFAASLCDDPLLAHSIRAACGVLFHSSERLIRDAALDAVLDRLRPHLGRPRRDAPG
FT                   GGAARVARLARELLHDTMARDIGANSLAKAAGAASRFQLARAFRAAYGTSPHSYLMQIR
FT                   LLRARQLLATGMRPATVAVECGFADQSHLGRRFRRAYGLTPAAYRALCTNVPDCKAKVG
FT                   "
FT   gene            complement(121975..122688)
FT                   /locus_tag="Acry_3403"
FT   CDS             complement(121975..122688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3403"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3403"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29010"
FT                   /db_xref="GOA:A5FTS8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS8"
FT                   /protein_id="ABQ29010.1"
FT                   /translation="MTQRKALKIIPQPMRRQVEDGLRKAIIAGVFPAGAHLSDRLLCET
FT                   FGASRSIVREAVRLLEAEGLVVVHPNRGPFVASISATEAEEIYELRAALEGLAGEGFAR
FT                   RATTGERAALRHIYEELAASGPATSRETLLDIKRRFYDVLTAGCRNAYVSRILGQLLNR
FT                   NSQLRATSLSAPGRLPHTVAELGRIVDAIDRRDAAAAGAACRDHVHRAAEAALRIIGER
FT                   EATCVASSFATAEGI"
FT   gene            122849..123253
FT                   /locus_tag="Acry_3404"
FT   CDS             122849..123253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3404"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /EC_number="4.1.1.44"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3404"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29011"
FT                   /db_xref="GOA:A5FTS9"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS9"
FT                   /protein_id="ABQ29011.1"
FT                   /translation="MSEDKALFDKGLPIRRAVLGTDYVDNSLARADEFMMAFQRATTAW
FT                   AWGWAWGDDTLDRKTRSLMNLAMLTALGKAPEIKLHVKGALNNGLTVDEIKAALLHATA
FT                   YCGIPAGLDAFKAAHEVLVAEGVLPQKKSA"
FT   gene            123256..124173
FT                   /locus_tag="Acry_3405"
FT   CDS             123256..124173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3405"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding"
FT                   /note="PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3405"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29012"
FT                   /db_xref="GOA:A5FTT0"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT0"
FT                   /protein_id="ABQ29012.1"
FT                   /translation="MAQRVAFIGLGNMGWPMAARLVGGGCEVTGCDAVEGRAEAFAREV
FT                   GGTAAADADAAARGAEFIVTMLPNSALVESVVAAMRPSLGAGALLIEMSSGIPGVTRRI
FT                   AAGLEAAKVAMIDAPVSGGVARAKTGDLSIMTGGSADDCARAETLLRLMGTTITHVGDI
FT                   GAGQAMKALNNLVSAGGFLIGVEALLIGQRFGLDPAQMVDVLNASTGMNNSTQKKFRQF
FT                   VLSRKFNSDFSLDLMAKDLSIALEVGRDGGIATPFAALCREMWASAGAALGKGQDHTAM
FT                   ARFSELLAGGMLADAEMGDKPPEG"
FT   gene            124229..125566
FT                   /locus_tag="Acry_3406"
FT   CDS             124229..125566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3406"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3406"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29013"
FT                   /db_xref="GOA:A5FTT1"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT1"
FT                   /protein_id="ABQ29013.1"
FT                   /translation="MASYADTARPDALAVPIEERRRAAIRGAFFSEYIDMFDIYVPIVV
FT                   LTPVLFFFQPAHLPPGEEALLASLVFITTLLGRPIGAFLFGLVADRIGRRMASIYSVSG
FT                   FGLITLLIAALPGYQSIGVASYWLLVLLRFLDGICLGGGYTGAMPLAMEYSRKSERGFA
FT                   GGLILAAFPAAYVTINLVAMAVFALVPLHGLDSPYAQWGWRIPFVIGAALAGMLVLYYV
FT                   FKVSESEIWITETAEGTQKLPLTDLIAGRSGRNLLQVLLLMTGFWLTQNLITIFIPATL
FT                   LFHFLHLSKFQLTSTLLISYALLFFSYIGSGMLGQKVGRRRFFVVAGPLIATVGAAIMY
FT                   VLVGVPGLSLPMIIVLVCVLSILVTSPWGVIVTYINERFATDVRATGFGVGFSLSVIIP
FT                   SFYAFYMSWLGYLMPFRYTPVVLLVIGGLIGMVGALLGPETRDVDF"
FT   gene            125577..126365
FT                   /locus_tag="Acry_3407"
FT   CDS             125577..126365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3407"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3407"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29014"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT2"
FT                   /protein_id="ABQ29014.1"
FT                   /translation="MNQPEILAVRYGTRKTEKSEIYYDYARYGEADGEAVMDYYFWILR
FT                   DGTETIVIDTGFSAASGAARKRDTTIAPAAALARLGIDPASVRDVILTHAHYDHTGNLD
FT                   LFPNALITMSRTEYAFISGPFADRVPLAVAMDSDDNRGIVRLHEAGRIKLVGPRHEFRP
FT                   GVELIELPGHSPGQMSLVIARPDGPVILSSDAVHYYEELEKDRPFTVMSGLLDMYRSLD
FT                   AIRVMRETPGAVLVPGHDPEVMRRFTLVDPADPGFAVRIG"
FT   gene            126362..127243
FT                   /locus_tag="Acry_3408"
FT   CDS             126362..127243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3408"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3408"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29015"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT3"
FT                   /protein_id="ABQ29015.1"
FT                   /translation="MSAANTFFCDKVAIVTGAGAGIGAATARLLAARGANVVVVDIDGA
FT                   AAERVAATLPSPAMAVAADVATEDGVAHYMEAAAARFGRVDLHHLNAGVIGKFTAFPDL
FT                   DVADFDDVVGVNLRGPFLGLRAAFRQYARQDSAGAIVVTASIASLRGSHDLVAYQASKH
FT                   GALGVMRCAAMYGGPLGIRVNAVAPGLVPTELFAAQKSAQGGGNDMAQRGTTVPLRRTG
FT                   TPEEIAAVVAFLLSDEASYVHGEVISVDGGSAIVSTVRPAGGAGAWNTEAVDRRTELTR
FT                   WRQDGTEDTNHG"
FT   gene            127236..128147
FT                   /locus_tag="Acry_3409"
FT   CDS             127236..128147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3409"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding"
FT                   /note="PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3409"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29016"
FT                   /db_xref="GOA:A5FTT4"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT4"
FT                   /protein_id="ABQ29016.1"
FT                   /translation="MDDGKPIGFIGLGNMGGRMTRRLIGRGYRVLGHDRAANLAAELGA
FT                   EPAGSIGAVMEQAAVILLSLPDSRVVEAVVEGDNGILAHCRAGQMVVDLSTSAPASTIR
FT                   LHALLAERGVQFVDAGISGGAAAADKGTLTLMVGGDATVIEGLRPIFASFAAKVVAMGS
FT                   SGAGHTAKLINNMLNAVSLAATAEAMVAGKKAGLDLRVLLDVINASSGVNFASLNRFPR
FT                   IVEGDYLEGGLTGKLMTKDIVLYVERARELGVASLNSAGPLASFGLATALGYGDQISNR
FT                   VVDAIGDVSGGVRLHDQERTIA"
FT   gene            128144..128524
FT                   /locus_tag="Acry_3410"
FT   CDS             128144..128524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3410"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3410"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29017"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT5"
FT                   /protein_id="ABQ29017.1"
FT                   /translation="MKIIEGRAAGAPSQARSDSFTGTVWADPVLSMPGELSINTVFFSP
FT                   GARTFWHMHERGQILNVLAGRGLVCTEGGRPQPIRAGDTVWIPAGERHWHGAAPDSYMI
FT                   HTATSLGRTDWQGPVAERDYAP"
FT   gene            128521..129273
FT                   /locus_tag="Acry_3411"
FT   CDS             128521..129273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3411"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3411"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29018"
FT                   /db_xref="GOA:A5FTT6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT6"
FT                   /protein_id="ABQ29018.1"
FT                   /translation="MTLSERQSTLKARFTAERGTWGPGWDSMLRLDPDFLESYLNFSMV
FT                   PWKAGPLEPKVKEFVAIAADAAATHLYAPGIVRHIKAALAHGASRSEVMEVLELTSTLG
FT                   IHAANIGVPILLEVLQEAGLRLGPKPFDARQERLKAEFTEARGYWHEFWAGILELDPDF
FT                   FEAYIDFSSVPWRSGVLEPKVKELIYCAFDASATHLYVPGLKLHMKNAIGYGATAAEIM
FT                   EVLEIVSVIGIHAATTAAPMLEAALAAL"
FT   gene            129513..129839
FT                   /locus_tag="Acry_3412"
FT   CDS             129513..129839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3412"
FT                   /product="NIPSNAP family containing protein"
FT                   /note="PFAM: NIPSNAP family containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3412"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29019"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT7"
FT                   /protein_id="ABQ29019.1"
FT                   /translation="MIHELRIYHCMPGRLPDLLKRFETVTLGLWDKHGIRQAGFWTTLV
FT                   GESNMDLTYLLAWETLAERESKWTAFQADPEWLAKRAETEKNGQIVASITNQILVPTAF
FT                   SAVR"
FT   gene            complement(130005..130247)
FT                   /locus_tag="Acry_3413"
FT   CDS             complement(130005..130247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3413"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29020"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT8"
FT                   /protein_id="ABQ29020.1"
FT                   /translation="MPPTTVLAYGHPKGGTPSMLAAPLVALDLPLRVLVRVRDDGQTVI
FT                   AFHPIGAMLRRSGVPNALADKLDAAQQILLKAVSP"
FT   gene            130412..130687
FT                   /locus_tag="Acry_3414"
FT   CDS             130412..130687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3414"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3414"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29021"
FT                   /db_xref="GOA:A5FTT9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTT9"
FT                   /protein_id="ABQ29021.1"
FT                   /translation="MARNHKPEEIIGKLREAEIVLAQGGTVADACRRIGVTEQSYYRWR
FT                   KEYGGLKLDQARRMKELERENARLKRLVADLSLDKAILTEATRGNF"
FT   gene            130732..131580
FT                   /locus_tag="Acry_3415"
FT   CDS             130732..131580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3415"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3415"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29022"
FT                   /db_xref="GOA:A5FTU0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU0"
FT                   /protein_id="ABQ29022.1"
FT                   /translation="MSVSERRVCRVLGQHRSTQRKVPRGADDEAALTGDIIALARQYGR
FT                   YGYRRVTALLRDAGWHVNRKRVERIWRREGLKVPQRQPKRSRLWLNDGSCIRLRPEYPG
FT                   HVWSYDFVEGRTHDGRKFRILSVIDEASRECLALPVARRLRSEDVLGALAELFVTRGPP
FT                   AHIRSDNGPEFIARAVRQWLGKVGVKTLYITPGSPWENGYCESFNGSLRDELLNGEIFY
FT                   TLAEAKILIETWRRHYNTVRPHNSLGYRPPAPETATPPRPPSGSASLHRQPAMAAETTM
FT                   H"
FT   gene            complement(131823..132533)
FT                   /locus_tag="Acry_3416"
FT   CDS             complement(131823..132533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3416"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3416"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29023"
FT                   /db_xref="GOA:A5FTU1"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU1"
FT                   /protein_id="ABQ29023.1"
FT                   /translation="MRLTETKIAKVLAAHRIRRVTAHDALAILRRPALTVAPGTADAAR
FT                   VHITAVAERLNLVNRQIKTVLQRIDGLVEQLAGPETEPGQDTEQRDAAILRSLPGVGRI
FT                   VLATLLAEAHQALQARDYQALRTLTGVAPVTKRSGRSCRVEMRQACSGRLRTVVYHWAR
FT                   VATQQTPAVAAATPPSEDVATLTAAPSEPLPIACWALHASCSPTDPCSIPRRCPPIAQN
FT                   QLDHWWEVPPHSRL"
FT   gene            complement(132767..133174)
FT                   /locus_tag="Acry_3417"
FT   CDS             complement(132767..133174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3417"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29024"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU2"
FT                   /protein_id="ABQ29024.1"
FT                   /translation="MKLPQSQVPICYLASGCRAGVPHGHWKATTFTGALRLSGMTAPFV
FT                   YDGPMNGAVFRAYVEQMLVPTLTPGDLVIMDNLPAHKAAGVRNSIEQAGATLLFLPPYS
FT                   PDFNPCMDGSCRSRCRIGFGERVGCGHVCGV"
FT   gene            complement(133352..134554)
FT                   /locus_tag="Acry_3418"
FT   CDS             complement(133352..134554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3418"
FT                   /product="Serine--glyoxylate transaminase"
FT                   /EC_number="2.6.1.45"
FT                   /note="PFAM: aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3418"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29025"
FT                   /db_xref="GOA:A5FTU3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU3"
FT                   /protein_id="ABQ29025.1"
FT                   /translation="MHTGRHFLQIPGPTNVPDRVLRAIDMPTIDHRGPEFGRLGLEVIE
FT                   GCKAVFRTGNPVIIYPSSGTGAWEAAILNTLSPGDRVLVAETGHFATLWGRMAAKLKLE
FT                   VETIPGDWRHGADPGEIGARLAEDRGHVIKAVMVVHNETSTGVTSRIPDIRRAIDAARH
FT                   PALFLVDTISSLGSIDYRHDEWGVDVTVGGSQKGLMLPPGLGFNAVSDKALAAARGNSS
FT                   RRSYWDWHEIIAANADGYWPYTPATNLLYGLRESLAMLQEEGMDSVFARHDRHAAATRA
FT                   AIRAWELEILCVDPYAYSSALTAVVMPEGHDADRYREVVLNKFDMSLGTGLAKLKGCVF
FT                   RIGHLGHFNDLMLMGTLAGVEMGFALAGVPYRKGGVGAAMAVLEHTVPPGKHHMKDEDA
FT                   A"
FT   gene            complement(134578..135570)
FT                   /locus_tag="Acry_3419"
FT   CDS             complement(134578..135570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3419"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3419"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29026"
FT                   /db_xref="GOA:A5FTU4"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU4"
FT                   /protein_id="ABQ29026.1"
FT                   /translation="MKLASLLLNKMMPVWLVVCGVLGYLAPHVFVAFAPYVIYYLAAVI
FT                   LMMSLTLTIEATKQVFTRPKPLISGFVIKWITVPLAAIIAAHLIYANQPQLAAGTILDG
FT                   ATPAGVTSNLFTFLSNGAVALAISLTFIHTLLSPLLTPAFTTAFAHKYVAVSFFALFHQ
FT                   MLVMVLLPLIIGIGARYTLGAQRIRLVQPVLPMISALLLYALALGLVAKAQPAIARNLD
FT                   WVPIIAIVTSILTIINLAVGYLLARLLRLDESNSRAIMFDVGIYNSGLGAVLASLNFGA
FT                   FAALPALMNAMLNMVIGSMLASYLGSKPIDQEQSDSAVSRPVTSQLGAE"
FT   gene            complement(135694..136479)
FT                   /locus_tag="Acry_3420"
FT   CDS             complement(135694..136479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3420"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3420"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29027"
FT                   /db_xref="GOA:A5FTU5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU5"
FT                   /protein_id="ABQ29027.1"
FT                   /translation="MSAFTQESEDLVYEVRGQIGYITFNRPASRNALTFAMYERLAAIC
FT                   GDTGDLRALVLTGGGEKAFAAGTDINQFRAFRTPEDALAYERRIDAVLQALETCPTPTI
FT                   AAISGACTGGGAAIAAVCDLRIASESAKFGFPIARTLGNCLSAENYARLAALIGAARVK
FT                   DLIFTARLIGAGEAERIGLVSEVLPDHETLLARASALAETMTRHAPLTLRVTKDALNRI
FT                   SRLSRIEANDLILTCYMSEDFREGMDAFLTKRQPDWKGR"
FT   gene            complement(136476..137726)
FT                   /locus_tag="Acry_3421"
FT   CDS             complement(136476..137726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3421"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3421"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29028"
FT                   /db_xref="GOA:A5FTU6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU6"
FT                   /protein_id="ABQ29028.1"
FT                   /translation="MTNGKAANATGPLAGLRVLDLSHVMAGPVCGMMLADMGAEVIKVE
FT                   KVPGGDDTRRAVPPSVAGESAAFMMMNRNKRGIALNLKSPLGRDALLRLIDSSDILIEN
FT                   YRKGALDRMGFGYEAMHARNRGLIYCSISGFGRTGPYAERGGFDLIAQGMSGVMSVTGE
FT                   GPGRAPVKVGPPIADIGAGMLAAMGILAALNYRNQTGEGQMVDTSLLEAGITYLYWHAA
FT                   ISFATGSSPGPLGSGHPLMAPYQAFRTSDDPITVGAANEGNWRRLLAVLQADDLAADPR
FT                   FTTNAGRMENLSELEARLEAIFRQKTSAEWLVALDKAGVPAGPVLTVQQMAEDPQVKAR
FT                   SMIVETEHAVAGRTRALGLPVKFSTTPANVRRPAPAYGQHTREVLREAGFSEVEIDGMI
FT                   DSGAAQAAMPERKEAAE"
FT   gene            137854..138498
FT                   /locus_tag="Acry_3422"
FT   CDS             137854..138498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3422"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3422"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29029"
FT                   /db_xref="GOA:A5FTU7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU7"
FT                   /protein_id="ABQ29029.1"
FT                   /translation="MRTMVHEDVVTFIRERLIEGEIAPGARIPERDLCAALNVSRTPLR
FT                   EALKVLAAEGYVVLLPNRGARAAKLTVQDVRDLFQLSAALESAGGELACQRITDREIAT
FT                   IAEQHATMASYFARGDMQAYYACNRAIHEAIMAASGNAAMINVYESVSARIRRARYIAP
FT                   MTEAHWREAFLEHEAMLNALTRRDGPMLAMILKTHLRHKAQEVERAGFAAD"
FT   gene            complement(138642..138950)
FT                   /pseudo
FT                   /locus_tag="Acry_3423"
FT   gene            complement(138980..139636)
FT                   /locus_tag="Acry_3424"
FT   CDS             complement(138980..139636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3424"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3424"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29030"
FT                   /db_xref="GOA:A5FTU8"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU8"
FT                   /protein_id="ABQ29030.1"
FT                   /translation="MSSDKVKPTIRVWDPFIRFGHWAIVLAFAISYVTAEDEGDNVSAL
FT                   HVWGGYVIGAILAIRIIWGFAGPRYARFADFIYNPITVVRYLVCLIRGNAKRYIGHSPA
FT                   GGVMVIALMLSLLGTIGTGLVVYGAEGKGPLAQSPIVLIQRAYANGDTEYARPGQRGTV
FT                   VGENGNEELFENLHNFLANLTLTLIGLHVLGVGAASVVHRENLVQSMLTGRKRLE"
FT   gene            complement(139958..140659)
FT                   /locus_tag="Acry_3425"
FT   CDS             complement(139958..140659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3425"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3425"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29031"
FT                   /db_xref="GOA:A5FTU9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTU9"
FT                   /protein_id="ABQ29031.1"
FT                   /translation="MKAFDWQLQKNGYIPMSGQIVDASLVSAPKQRNTEVEKEAIKAGK
FT                   TGREIWPNEPNKAAQKDMDARWTLKMGGKIRYRSDGTSLPQIALPVFGYKSHIAVDRRF
FT                   GFIRESALTSAVQADGRMLPRLVTTGNTSSGVWADSAYRSQKNETGLALRMLVSRIHRR
FT                   KPAGKPMPHNIVRANAAKSAIRAHVEHVFAHQKNRFGLFIRTIGIARAMAKLILANIAY
FT                   NFDRLVFHQRA"
FT   gene            complement(140686..141402)
FT                   /locus_tag="Acry_3426"
FT   CDS             complement(140686..141402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3426"
FT                   /product="Arabinose efflux permease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3426"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29032"
FT                   /db_xref="GOA:A5FTV0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV0"
FT                   /protein_id="ABQ29032.1"
FT                   /translation="MTGDACAVLEQPRNPSLSLQAAFGATVRLIVQPLFAGQMIVATVA
FT                   RDFSLGGAETGLTAAASLHGYAVGLVCLVPLADIIETRRFMIRLLAAEAVALLICATAQ
FT                   SFVVLLAAAFAAGTASCAIQVLIPLIATVTPDARRGWVVGNVVSGLMLGILLSRLLPAF
FT                   ISGSWGWRPFYAFAACATAVAIGIINTTAPEHRPRSRESWLRFMIRDRLPLIRFLRFDL
FT                   GGPTPDENTIWLFGTN"
FT   gene            complement(141399..141842)
FT                   /locus_tag="Acry_3427"
FT   CDS             complement(141399..141842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3427"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29033"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV1"
FT                   /protein_id="ABQ29033.1"
FT                   /translation="MPVTGQENPIDPSTPLGALAEFYRAFNARDVDMMVRNWLQTEEAS
FT                   MDNPLGGIRRGWQEIGPVYERIFTGRAAVTVEFFDYSLHELSDAFLAVGRERGRLVAGD
FT                   TTLDLKIRTSRWYVRVDGRWRQLHHHGSMEDAELFARYQAAVR"
FT   gene            141934..142869
FT                   /locus_tag="Acry_3428"
FT   CDS             141934..142869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3428"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3428"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29034"
FT                   /db_xref="GOA:A5FTV2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV2"
FT                   /protein_id="ABQ29034.1"
FT                   /translation="MNDYPNYWNNRVPSLSDYETFVAIVEAGSLTAASRRMNRSLQSVS
FT                   RALANIERDTGANLVRRTTRSMQPTDAGLVFYGRIKEALSDIAAAHTEAAELTREIAGT
FT                   LRIGSSTLFGPTYVVPTIAAFMRRHPAVAIQLVLEDSFQDLLKAELDLAIRIGELSDSR
FT                   AMATRVGALRRVAFAAPEYLLKHGRPKVPGDLRAHCCVIRTLTKSPQRWTFESAGKPET
FT                   IPVAACFSSDNAGACNEAVAEAVGIGIAPLWQIAGMLETGRVELILTEYEPPPTPVHVV
FT                   WPQASLLPTRTRAFIDFLAARLRSGLRALR"
FT   gene            142902..143147
FT                   /pseudo
FT                   /locus_tag="Acry_3429"
FT   gene            143385..144269
FT                   /locus_tag="Acry_3430"
FT   CDS             143385..144269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3430"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; NmrA family
FT                   protein; Male sterility C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3430"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29035"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV3"
FT                   /protein_id="ABQ29035.1"
FT                   /translation="MHVFVTGATGFIGAAVAADLLAAGHSVTGLARSAEKAKALAETGA
FT                   EVLMGNVNDLDLLARTCGKIDAVAHLAFNHDFTRFKENCEDDRKVIHAMGQTLVGTGKP
FT                   MVVTSGIPAAPGRASVETDSHPGSDVMPRAASEEAAHEALAAGANMGIIRLPQVHDTAH
FT                   FGLITFFAQVARQKGFVGYAGDGSNLWPATHVSDAARVYRLALERAAPGAVYHAAAEAG
FT                   VPAIEVSEALAKGMGLPVRALDDAEVEGYFGPLTHFSRFNILASSDWTREVLGWQPTGP
FT                   GLLEDLRRIEDFA"
FT   sig_peptide     143385..143438
FT                   /locus_tag="Acry_3430"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.853 at
FT                   residue 18"
FT   gene            complement(144451..144894)
FT                   /locus_tag="Acry_3431"
FT   CDS             complement(144451..144894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3431"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29036"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV4"
FT                   /protein_id="ABQ29036.1"
FT                   /translation="MRIGITRACVVADRGMISSDTIAALEALGMEYIPSVRERTSRVIR
FT                   DVVLNDMASIVPLALDRQHGDTQLWVKEVWIGKGKAAQRYIVPVNEAEAEKDRDDRQAI
FT                   VDGLQAQLKKGAGVRWEFSPGNGPPASLAFPAQCARPHRQEQP"
FT   gene            complement(145475..146626)
FT                   /locus_tag="Acry_3432"
FT   CDS             complement(145475..146626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3432"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29037"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV5"
FT                   /protein_id="ABQ29037.1"
FT                   /translation="MDHPEMSAQQRLMIALERAAGAFARLDQALSMHPLRGAFLYRFRL
FT                   DAVRRQAMVDGQLIEPWHLAALLEGVRLRMDPWLSLAERGDIFDAARHALSMHQWIVEP
FT                   DFDQEGEIQVAMKAIERDVERASPLLGAAHAAHAWLAGGGRRAPLRGALIRFWQQSGLL
FT                   HLPVPITGPQALAGDLPFDRESWIPLLLHALANEAAAAQDLLRDLDRAWQVARASIGKR
FT                   RKNSRAAKAIDILAATPIISAKSLADRLGMNVANAHALLGELLEAGLVVELTHRSKRRL
FT                   FGLSGMGRMRDYVAPPRRPQPGRGRGRPRIEREMPQPAPPAELPPAPSGGVLPRLAFDF
FT                   SDLEEAMAAADAAIRETRISLDRIRQAGRPEADHQRLGVGETR"
FT   gene            146712..147503
FT                   /locus_tag="Acry_3433"
FT   CDS             146712..147503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3433"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29038"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV6"
FT                   /protein_id="ABQ29038.1"
FT                   /translation="MPSFSPSRDAIEVQLATSRDLADLAYEIRYEAYRASGYIGERADG
FT                   LFSDKEDTRANAQTAVVFRDGIPSGTVRTLLLDPGSDNPDFHYIPALDMFGPEIRELLA
FT                   VRGTAARPATAIEATKLALASHAERDIAVLQALFRTVRYLVHAHDTNVVFNAVKHHHMP
FT                   FYRRLGYRKIEDPRPYPGLAVQTGLMACFREEFADTVDRVPFMSGLSVTDPTCQALLAG
FT                   HRVQIFSTGRPEARPALETPNRLGRAAPAPDPDADQEPGPG"
FT   gene            147715..148842
FT                   /locus_tag="Acry_3434"
FT   CDS             147715..148842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3434"
FT                   /product="phage integrase domain protein SAM domain
FT                   protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3434"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29039"
FT                   /db_xref="GOA:A5FTV7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV7"
FT                   /protein_id="ABQ29039.1"
FT                   /translation="MPDDTEFAPQDRPDAPSAGSLVPSPPPLAGDGHAVRRWFSEIEDE
FT                   PVPVADGTLAGARSAASAYARRAKADNTRRAYRAAVRVWCLWCDRHGLTPLPASGADVA
FT                   AFLADERGRGVSTETLKLRRAAIRYLHRLAGCPVPTDDACVAETMAGIQRDAASRGEIR
FT                   RKKVAATATVIRRLLAPIGDTELTDLRDRALILVGFAGALRRSELAGIRIEHLTPSERG
FT                   LRLTLPQTKGSQAEAVTVALPYGDTELCPVHALERWRVAAGLQRGPLFRRIWSPPSGRK
FT                   GRERTAPPGPVIGERALTPQSVALIIQRRAMAAGFGRRDLGGHSLKRGALTTGMERGVH
FT                   PARLKRLGRHKSYDVLGEYLEFGDLFDGHPLDGVL"
FT   gene            complement(148857..149345)
FT                   /pseudo
FT                   /locus_tag="Acry_3435"
FT   gene            complement(149342..149917)
FT                   /locus_tag="Acry_3436"
FT   CDS             complement(149342..149917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3436"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29040"
FT                   /db_xref="InterPro:IPR011979"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV8"
FT                   /protein_id="ABQ29040.1"
FT                   /translation="MVTTTVSKAATRTPSGPKANKPSHKAPKTSRALKVPMTSPGSPAA
FT                   KGGTDVSYLEYFYQAPMRQIEMIRRGIPALTVKRIAGDLRIEQDTLLRALNLSVATLNR
FT                   KVAQAKNLPADESERIAGIARLVGQVEAMVKESGDPEGFNAAEWLSRWLREPLPALGGQ
FT                   MPIKLLDTMAGQALVSQALSRIQSGAYA"
FT   gene            150068..150529
FT                   /locus_tag="Acry_3437"
FT   CDS             150068..150529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3437"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29041"
FT                   /db_xref="GOA:A5FTV9"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV9"
FT                   /protein_id="ABQ29041.1"
FT                   /translation="MAQNKPPRFIAELEVAQGHASFSIHVSVRAASAAPEDTASTHLLP
FT                   AGDPQRAILTEAISALRQTPEGARVELRTNSDYLTDGILRWRSGWERRNFQTAKGRPVA
FT                   LADVWKTLFAEVDARQVRAVLGTSTTKSREATHHAHDAISVADHAQQMS"
FT   gene            150680..151297
FT                   /locus_tag="Acry_3438"
FT   CDS             150680..151297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3438"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29042"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW0"
FT                   /protein_id="ABQ29042.1"
FT                   /translation="MNSISPSPLVRNQQLVVNLFGGPCAGKSSLAAILFGRLKREHYEA
FT                   ELAVEFAKDLAFENRRDALKCQIYVLGNQYWRIQRAFSGGAQIVVTDSPCLLSCAYQTS
FT                   PGIEAAALEAHFAYPSLNLFVDRSERYSAYGRVHERDQAEQIDERIIGILNRFSIPFTR
FT                   VSIEHGEQQAVAMVLEQARRAAETIGAEPLSSFDHDNAPLPC"
FT   gene            151956..152618
FT                   /locus_tag="Acry_3439"
FT   CDS             151956..152618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3439"
FT                   /product="plasmid segregation oscillating ATPase ParF"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3439"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29043"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW1"
FT                   /protein_id="ABQ29043.1"
FT                   /translation="MKRIALVQQKGGAAKTTLCVHLAVAADQAGTRTAIIDTDPQASAS
FT                   AVWGQARGDRTPPVAPVLAAELKEAMDAAEADGFQLIFVDTPPHTAPALEVVARNIDLA
FT                   LVPVQPSILDVAATQATLDLLRANRVPSVAVLTRTSPRPDEEIVETVRALRDLELPLLN
FT                   TRIVERKVYRRALTQGQAVGEFEPTSKAAREIRQLWKEIAVLDAIQLKPATAQKRRS"
FT   sig_peptide     151956..152033
FT                   /locus_tag="Acry_3439"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.619) with cleavage site probability 0.598 at
FT                   residue 26"
FT   gene            153446..154381
FT                   /locus_tag="Acry_3440"
FT   CDS             153446..154381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3440"
FT                   /product="plasmid encoded RepA protein"
FT                   /note="PFAM: plasmid encoded RepA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3440"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29044"
FT                   /db_xref="InterPro:IPR006881"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW2"
FT                   /protein_id="ABQ29044.1"
FT                   /translation="MINRLDQNVAQLVLDYGSERAREIVGPRYRALVDIANEVLTDERQ
FT                   QIGISYSGFCLTSLPHKRLSDSAVWQRKGHKVTLLVEPGVMRSKGRTVLYGVPFGARAR
FT                   MILLYLQTQAIRTNSREIELGRSMRTWMERMGIAIGGETTRALREQAARISACSLKFFW
FT                   EGDGAEGWTRGGIVSSGLRFKSVVDDDDQGKLWDDRVVLDETFWRALKDHPVPLQEAAI
FT                   RALAHRSLALDVYIWLAWRCHEIKGPTDISWISLDAQFNTTGRPLKYFKPLFTDALRAA
FT                   MAAYPDCRLDVEDRGITLRPSRPPVLKLMT"
FT   gene            complement(154742..155326)
FT                   /locus_tag="Acry_3441"
FT   CDS             complement(154742..155326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3441"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29045"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW3"
FT                   /protein_id="ABQ29045.1"
FT                   /translation="MRGVGFLDRHSSPSFRLLIAVGFLDRGSAPVIQAVDRLWPALRCF
FT                   GILLIFLGFSGQLGNPTPATGVSGPPPSRAIAGMWDFSTFGSHADVAGKILCWSGNPTL
FT                   GPLGSVWEAIEITNYFRLAGFMTPMVKKSHAPLVLQFRPVGNSHAMPGRVISVGKSHKF
FT                   RRRRSATRNARSGNPTFPTPARQTLQHHESI"
FT   gene            complement(155465..156511)
FT                   /locus_tag="Acry_3442"
FT   CDS             complement(155465..156511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3442"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29046"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW4"
FT                   /protein_id="ABQ29046.1"
FT                   /translation="MRAARTGKESTGFFRIGEASEVGGLVLGGDYCAEHESGIEELRRE
FT                   FGISSKAPPGIERYRISGLSSRSALVFCDRPDLDQSILCCSHPSNVAQLVGKPGITGGL
FT                   ATRHEGFDLVAANRLVAFLPTWRDKDDRVRVLPVHSKAADREAWKAYNAGIIGAWSERS
FT                   FMVRALGEDARRDLEAVYNALLGCDIALSATRALTPFGRGGLAIVIASRIQPADLDRLR
FT                   EQDEDQDLLDATFKATGLPARFAERRGTDPLFGPNAKPAYFGIRPTWTREFIERRKADP
FT                   AARPTEDDLTVWLNPMEQRHHNFGWFSVDALRRWFDGEGPVVKAWVEQQRVGFPDQPAP
FT                   DGLAPGCG"
FT   gene            complement(156542..159727)
FT                   /locus_tag="Acry_3443"
FT   CDS             complement(156542..159727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3443"
FT                   /product="Superfamily I DNA and RNA helicase and helicase
FT                   subunits-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3443"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29047"
FT                   /db_xref="GOA:A5FTW5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW5"
FT                   /protein_id="ABQ29047.1"
FT                   /translation="MSTTQRRRPPTQFIGATDDDVPEVAEIVAESRKAEIGTGQPIRVA
FT                   GSQHAAPAAPAGQPAQDDESVLTVLPAQPANPAEQPVELSPSQKKGLAVLDAWIAAEVL
FT                   TPETVKDLKDIVSGRERDMAALDLVYGDALPWEEGYPETEFPNLRAGYLAYDVIFGSIP
FT                   EAKAAVRLEEVYGQSFGDGGAGSGVSILATLRVAPNGTLDLKDGVSPFSVSAYGWGLVR
FT                   ALNRDLGAMPGWKHAAADISKSFRDLFDDRFKDKPIDKAAILEIYYWMLDSLGFDEKLV
FT                   SRPSRESDVVSKPAKVIGYYQRVSPDGTPVPKQRMPDALIMNSFFLSDLLDARRDLAKG
FT                   IEQPLLDRYLGVKEQVRRINILEDPKAINTLLRPGLFPEGKWPHAGRNQLVAMQQSIIN
FT                   YALHPAQVRRNKVIGVNGPPGTGKTTLLKDAAAALIVRRAIAMSDFIHPSHAFRVFGSG
FT                   GARSSGRADPSLFELDPKLIGFEMLVASSNNGAVENVSTEWPDNGAIADDATTRYYPGT
FT                   ASRLHERESWGLVSAALGNSANRAKFRDQFWFDEDWGLRNQLALAAGRSPVIVDKKTGA
FT                   KRIPASFEAHRPARGRHAALERWNRERDRFLQLLDTVRKSLSDVNKAATGELDQSDPFH
FT                   FHTSSPWLSGADHRQREDLFEAAIDLHRAFMEGAATEVGSNLSAAMELLAGRFNGRKPK
FT                   VVQSVLSTLFIAVPVLSTTFASVRRMLRDVEEPMIGWLFIDEAGQATPQSAVGAIKRSR
FT                   NALVVGDPIQVEPVVTLNEPMVVEIAKAMGIDHEVDMAPWGSVQTFADGASEVFAEYPC
FT                   EGGARRVGMPLLAHRRCAEPMFSISNQIGYGGLMVNAKRPSPSAIRDACGPSRWIDVHD
FT                   PVDEKWSEQEGMVVFNLLRDIVARGGKLDLYIISPFRIIESRLRDMVIQNHAGIGISFA
FT                   EARELTRRIGTVHKVQGREAEGVIFVLGHQGEAFKRARGWAGGRPNIANVAVTRAKEVL
FT                   YIVGNRADWSEAGYFHTVEQVMDEFTRQHGVAAGDALAVPPAPIREEQTEAPAPVLEDH
FT                   ESIFDLDLGLGLG"
FT   gene            159926..160303
FT                   /locus_tag="Acry_3444"
FT   CDS             159926..160303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3444"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29048"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW6"
FT                   /protein_id="ABQ29048.1"
FT                   /translation="MSSNSDQKIDFSATFGLSKSVPAMIEARDHLGRHFPTRPWEDILL
FT                   GAVQPPAPIEVVHYSTGAVAIFWTRGASIVCLLYQGDGCVFHGQGSDGRDCARLGTMSY
FT                   VEEVLPRSVMLEILAVCRQKG"
FT   gene            160447..161007
FT                   /locus_tag="Acry_3445"
FT   CDS             160447..161007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3445"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29049"
FT                   /db_xref="InterPro:IPR025433"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW7"
FT                   /protein_id="ABQ29049.1"
FT                   /translation="MNSRTIITSSALIMMLAAGSALAQTSAGGQAGVGASVGVGANAGA
FT                   GGLVGSTLGAARSTAGNVGSAVGSTAAGVTSKVGAQANGMARSAEATSADFSAATISKA
FT                   RLATRQISVLEAREHREIRTAKTASRRRAIETRARAERARLIKSHGLSVSEYDRIVSEA
FT                   RSNPSLASRIGLSVSAGAGAQMK"
FT   sig_peptide     160447..160518
FT                   /locus_tag="Acry_3445"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 24"
FT   gene            complement(161163..163016)
FT                   /locus_tag="Acry_3446"
FT   CDS             complement(161163..163016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3446"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3446"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29050"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW8"
FT                   /protein_id="ABQ29050.1"
FT                   /translation="MAIHLVGETIDAKRAHHRAQSGDLIPLVRGVYVDHDGDAETAILA
FT                   HAVRIAHYLYPNAYLSSASAVLLAPTPDGRLFISGRRNQRTRLRALEIIQNEAPAHPST
FT                   AIAVIGDDLGELRIAASSPRQRFLEAFRLRSEHASAITAEMRAQMAARLVAEHGTPQAA
FT                   ADAVWALARENEWYREGEGAERFLLAKPGGAAPVNKAALNLLVAWHGDLVGRLTHDGFE
FT                   WRWKPERRTGPALIRGTTPGKLPAFIESLLPEGWLAQVLHERDERDALRRGRRYMSNIA
FT                   IVEDRDQLATLPADVLSTPLSSFAADGRFTGVYAGPGRGEIEDTFEQNLARIFARSETP
FT                   RLSGVQIKAPMSLTKDGSLVPAIDQPFTHILKPTGAAGFDMLPIVEWLCLELGRAAGFE
FT                   TPDAALIAMPDGMPPSLVVERFDIRRGPHDLRRLAMEDFCSVLDLPTSAKYDGTIERMA
FT                   RALRPLSTDPAADLNILFRRAVFAWLIADGDMHLKNLAVLKTADVGAKTFTTVRFAPLY
FT                   DAVTTRVFPSLAGDRMALKLNGKDDRLTRQDFLRLARTIGLTVEDAEAALEALTTRITE
FT                   RLVTLQLPAFAVEFADAKAVRDKVEAIATARCLALRRRGQP"
FT   gene            complement(163196..164137)
FT                   /locus_tag="Acry_3447"
FT   CDS             complement(163196..164137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3447"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29051"
FT                   /db_xref="InterPro:IPR031618"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW9"
FT                   /protein_id="ABQ29051.1"
FT                   /translation="MARIRFRSAALPAAVILLGLTGCANLQGAPGKAASAKPVPPDMVG
FT                   IHINDGDSMFPVQTGDAARQAIPSLKAMSRMHRDGSGTSKEAAKEMVELPVIRDTALRY
FT                   GAEGGVAWATRIIDGELRANAARLSQIYDFSRLVTYQPGGVQILPPVISESRNLYQSSD
FT                   FGRTIRVADTYYDIVRQARFVPSAPLWYGYLYRTWQAPHRPFEAGLPHNSEEEAVWKHY
FT                   VKAGWRAGVQEGETIFRLDLDRLNRDFTGMIRYRKLNDEGKVSAPVVQAKTLGVTGTGQ
FT                   NMREGDRVVKIIAEPSLSVPHPRTSPIKATPN"
FT   sig_peptide     complement(164051..164137)
FT                   /locus_tag="Acry_3447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.644 at
FT                   residue 29"
FT   gene            complement(164140..164691)
FT                   /locus_tag="Acry_3448"
FT   CDS             complement(164140..164691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3448"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29052"
FT                   /db_xref="InterPro:IPR031817"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX0"
FT                   /protein_id="ABQ29052.1"
FT                   /translation="MVRIRSKAVLAVLALVAGMPALAHADVMTTEAQAVQAEAESNLAR
FT                   AFTEASQALSQLDNGPVDPQQVATPKGVAIAAPAAPVQAALPKIDLARLPAQLRRPVTI
FT                   RWNGPVEGAIRKLAAQINYTVLPPTHTPATPPTIVLVKNKVPAAIVLQDIGARIRTYGK
FT                   LVVSPAARTIQFDVNQAAGT"
FT   sig_peptide     complement(164614..164691)
FT                   /locus_tag="Acry_3448"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.875 at
FT                   residue 26"
FT   gene            complement(165544..166482)
FT                   /locus_tag="Acry_3449"
FT   CDS             complement(165544..166482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3449"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29053"
FT                   /db_xref="GOA:A5FTX1"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX1"
FT                   /protein_id="ABQ29053.1"
FT                   /translation="MPDDALDAPDDEHIDPLDFVRWLIGLRPTLSSSTWRSYKAASAFY
FT                   LYDSMHPSARAAAAILDGVSADDGEVAASEGVKGTKFFRLEDYNKLLQFCLDRGRGESA
FT                   RTMFHFARAAIRTGMRPSEWATCDMRTSKNPDAPFGRNVWLFVCNAKASNGRANGLVRV
FT                   LDLSPLSRIDIEPIRYTMALFQRQAAKEGTEPTIRRLRQSINHIGAATGMSAKYSPYSF
FT                   RHQAIANWKTIYSPVEVAALAGHSVPETATEHYGRKRDGWTGKGTGGIMIRPSRVDVER
FT                   IMSRIRSDNPAPFMRPDGSLAVVPEDMPTPQ"
FT   gene            167207..167761
FT                   /locus_tag="Acry_3450"
FT   CDS             167207..167761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3450"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29054"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX2"
FT                   /protein_id="ABQ29054.1"
FT                   /translation="MTATAAIPVDRPSYHEGKRLYRRLVAGDLSHLAPVLASLQPLVGA
FT                   AAAGLAARLIEAGVDADELLVRAALAHHVRRPGYLERMAAPDSMRHDLDGNPVEPVSAR
FT                   HRDHAAATRKAMGPSLAKARQQARRRTEREARSRWRATPAPVVEVKQAGRRRLAAPAGA
FT                   GQGAVASLRDRLGIAARLSLG"
FT   gene            complement(167766..168089)
FT                   /locus_tag="Acry_3451"
FT   CDS             complement(167766..168089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3451"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29055"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX3"
FT                   /protein_id="ABQ29055.1"
FT                   /translation="MAAESAALTPAEASASLAALSQQLAGKFVVSQPSERTARKAVDTL
FT                   QSAAPGSFWIAFSRQELKLLWLAITNGAPEYGNALGMTPREVEMFGRAANRIGRAAGEE
FT                   VLF"
FT   gene            168288..168647
FT                   /locus_tag="Acry_3452"
FT   CDS             168288..168647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3452"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3452"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29056"
FT                   /db_xref="GOA:A5FTX4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX4"
FT                   /protein_id="ABQ29056.1"
FT                   /translation="MIAPTRPADLIWRSTTMPKLSPLSREEMMRLRTQLADDVEAGGLP
FT                   LSLAVRRMRKAIGFTQVQFAKAMRLTTRQIWEIENGKANPSLETMNKLAHPFGFRVGFI
FT                   SRHRAAAMEEADRAP"
FT   gene            complement(168714..169349)
FT                   /locus_tag="Acry_3453"
FT   CDS             complement(168714..169349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3453"
FT                   /product="Uncharacterized protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3453"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29057"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX5"
FT                   /protein_id="ABQ29057.1"
FT                   /translation="MLAAKVGRIIVAAGTNGAGKSSIVGPLIRSLGGAYYNPDEQARSF
FT                   MAIGLGTEQANARAWGLGYEGLQRAIDQNLNFAFETTLGGASITMELLRALALERRVLI
FT                   FYVGLASVDLHIQRVAERVARGGHDIPERKIRERYDNSRTNLLKFIGTRAEMRVWDNSH
FT                   QSADGSPAPREVFRVQNREMLIPKGGELSATVAWAQPLVAKALSISPG"
FT   gene            complement(169336..169698)
FT                   /locus_tag="Acry_3454"
FT   CDS             complement(169336..169698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3454"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3454"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29058"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX6"
FT                   /protein_id="ABQ29058.1"
FT                   /translation="MSKSAVIEASAARSSFAKLGEQARRAPVEVTRHGKLEFVVISPDL
FT                   YEAVKAAGTVPVGELARMQESFNQMFQDMQSDRSEAAYERLEALTAEDLPKAAVDAYRR
FT                   TRRRAPGHRSGSGVGR"
FT   gene            complement(170187..170666)
FT                   /locus_tag="Acry_3455"
FT   CDS             complement(170187..170666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3455"
FT                   /product="protein of unknown function DUF805"
FT                   /note="PFAM: protein of unknown function DUF805"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3455"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29059"
FT                   /db_xref="GOA:A5FTX7"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX7"
FT                   /protein_id="ABQ29059.1"
FT                   /translation="MTFTESVKRGSVGWSRYSGRASRSEFWWFFLFATLVRGAFAFIRL
FT                   VLMPPPIGQGVPMLVLVTLVSLILLVPTIPLEVRRLHDVGRSGWLIVVFYVLFAALIMV
FT                   SEEWMRLLSRHQETHWQGEILLVLTVFTGVTWVRVISLLASRGGPRPNRYGPASE"
FT   gene            complement(170868..171578)
FT                   /locus_tag="Acry_3456"
FT   CDS             complement(170868..171578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3456"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3456"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29060"
FT                   /db_xref="GOA:A5FTX8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX8"
FT                   /protein_id="ABQ29060.1"
FT                   /translation="MSAVLEAEGLQTYYGKSHILHGVSLKVNQGELIALLGRNGAGKTT
FT                   TMRSVMGLTPPRDGNVKLFGKDVTKAASHRIANAGVGYVPEGRKIFGHMTVHENLLVPP
FT                   ETKGPWTIETIYKLFPRLEERKTSKGGRLSGGEQEMLAIARALLLNPKFLILDEPSQGL
FT                   APVIVQEVMRTIGRMKGEGMSILLVEQNAHLALQLADRAYVLSDGEVVYDGSAAELGAD
FT                   TERMEHLAGVSHVD"
FT   gene            complement(171575..172339)
FT                   /locus_tag="Acry_3457"
FT   CDS             complement(171575..172339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3457"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3457"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29061"
FT                   /db_xref="GOA:A5FTX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX9"
FT                   /protein_id="ABQ29061.1"
FT                   /translation="MSLLKLEHVGRRFGALQALKDISLAVEPGELRAIIGPNGAGKTTL
FT                   FNLISGFFPPTEGQIIFDGQPITAVSPNDLVRRGIIRTFQITQVFLSLSVYENIRVAVE
FT                   TAMGLQLRPWISRAARAKVDEKVDELLQVTRIANKADRIVGEMSHGDQRVVEIGIALSR
FT                   HPRLLLLDEPTAGMGDEETHHMTDLIRRLNKDQGITMLFVEHDMAIVFGIADRITVLDN
FT                   GTFLAEGTAAEISANPRVQSAYLGTAIEETAA"
FT   gene            complement(172336..173322)
FT                   /locus_tag="Acry_3458"
FT   CDS             complement(172336..173322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3458"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3458"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29062"
FT                   /db_xref="GOA:A5FTY0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR035568"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY0"
FT                   /protein_id="ABQ29062.1"
FT                   /translation="MSTALDTKPATRPAPSIGGREISAAIIWLALLFVPIWLPAIGGFT
FT                   DLASRVLVYAMAATGLNLLLGYTGGLSFGHAAYFGLGAYGTGLFIIHVIPSMPLALIAG
FT                   TLLGGIGGILVGPMVMKRKGIYFAMITIAFGQMFYFLAVRWNTVTGGEDGLTGFSRVPL
FT                   HLGGEAINLGPARFYYVVLALFAVVMLVVWQILRSPMGHAFVATRENTTRLRFLGVAVD
FT                   KQVWVAFAISAFITALAGSLNAMLTAFASPDDLQWQLSGSFVVICVLGGMRSFWGPFLG
FT                   AVIYIAAQDYLSSVTQNWMSFIGLIFVLSVLFFPQGLLGFIKGRARS"
FT   gene            complement(173319..174188)
FT                   /locus_tag="Acry_3459"
FT   CDS             complement(173319..174188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3459"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3459"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29063"
FT                   /db_xref="GOA:A5FTY1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR035568"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY1"
FT                   /protein_id="ABQ29063.1"
FT                   /translation="METLLVYSAFNGLVVGIFYALMALGLSLILGLNGIINFAHGTFMA
FT                   LGGYLAFTLEPYIGFWGGLLVAPLLAVVVGVVTERVLIRPLYGRDPLFSLLLTFGLAMI
FT                   MQDMIRTIWGSIGQPFALPNYLNSPLSSSMFFLTGFRIVVILITVLVTGALFAVLRFSR
FT                   IGIRIRAGNADLETISSLGVNIFFLRAVNFGIGIFLAGVAGILAAGQLGLSPTIGDSLI
FT                   MPAFVAIIVGGVGSLMGSVLGGLIIGIASGLTAAFYPVAQEVVIYVIMAVVLVIRPRGL
FT                   LGQEGLFE"
FT   gene            complement(174309..175562)
FT                   /locus_tag="Acry_3460"
FT   CDS             complement(174309..175562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3460"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3460"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29064"
FT                   /db_xref="GOA:A5FTY2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY2"
FT                   /protein_id="ABQ29064.1"
FT                   /translation="MKSLNPGSLDRRGLLKAAGATGASSLILPNISWAASEKPVKIGMI
FT                   DPRTGTYAAAGFSEIHGATMAIDEINKKGGILGRPVQMFVEDSESLPGPGVTKAQKLVA
FT                   EDKVNFLMGAVNSATAESLSQFALQHNMLYIDTGGHVDDVTGSKCHWTTFRTCSTTWML
FT                   TAGDFETLFKKFGKKWFFITPDYAFGHAEHRDYVKQLQKAGGKSVGNALAPLGTTDFSS
FT                   YLIRARAAKPDVLICLQAGDDLVNLLKQAVQFGLDKQMAIAGALQEMEVLESLPKAALL
FT                   GWWTFEWYWNQPGVPHVADFVTAYKRRFGDKVPTARSWFGYVSAHSIALAANQAKTLDS
FT                   LKVVKALEGMELPPEIALQPGKVHYRAGDHQMMANMFPGYVPKDASYPNLFKVADVVPS
FT                   EKIALSPAAAGCKMTYPS"
FT   sig_peptide     complement(175458..175562)
FT                   /locus_tag="Acry_3460"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.995 at
FT                   residue 35"
FT   gene            complement(175768..176991)
FT                   /locus_tag="Acry_3461"
FT   CDS             complement(175768..176991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3461"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3461"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29065"
FT                   /db_xref="GOA:A5FTY3"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY3"
FT                   /protein_id="ABQ29065.1"
FT                   /translation="MIARLIIDYHLRRLIKTGTVEIFWPDGSWTRYGDGQFPRAALEIK
FT                   SAATARRLVINPDLAMGEAYMDGTLKPVECTVYDVLRVFMSNTELYDRGTFIMRIRRIF
FT                   RRIYRTFSQANSKIRSMRNVKHHYDIGNDVYQIFLDSDLQYSCAYYPNGDETIDIAQIA
FT                   KKRHILAKLILDRPNLNVLDIGCGWGGMALTMAHDYDANVIGITLSEEQIMVARQRAAD
FT                   AGLAHKCQFYLCDYRTIFDKFDRIVSVGMFEHVGVPNYSAFFEVINRCLKADGVALLHA
FT                   IGRLDPPASTNPWISKYIFPGGYCPSLSEVIAPIEKSGLLYNDIEILRLHYSKTLYQWR
FT                   HNFCANQKRIIDLYDDKFYRMFEFYLAGSQLAFEYANHIVFQIQLSHSIDTIPLIRDYI
FT                   TDFEKLHV"
FT   gene            complement(177004..178908)
FT                   /locus_tag="Acry_3462"
FT   CDS             complement(177004..178908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3462"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; Cl- channel,
FT                   voltage-gated family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3462"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29066"
FT                   /db_xref="GOA:A5FTY4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY4"
FT                   /protein_id="ABQ29066.1"
FT                   /translation="MPFIHRQTPRRIQLGDFTTDRGIFRLIGFGACAGLFGVIAGWILL
FT                   RMIGLINDLAYYGVWSTRMLAPGGAAPGGHPALWTILVPAGGAVAIGLMARYGSEKIRG
FT                   HGIPEAIEAILLGGARLDLRVAILKPISSAISIGTGGPFGAEGPIIMTGGAAASLMAQC
FT                   FTLTDAERKTLLVAGACAGMTAVFGTPVAALLLAVELLLFELKPRSIIPVATACITAAI
FT                   LRRLCMTPAPLFPYAGGVIVDPLHALGWLGLGLAAGLGSALLTVLVYAAEDGFETLPIH
FT                   WMWWPVLGGLVVGIGGVFDPAALGVGYPDIARLLAGTLAGGAAIRLVLVKGVIWSVALG
FT                   SGTSGGVLAPLLIIGGALGAVLAPVMPHAAPGFWAVLGMAAMMGGTMRAPLTSTLFAVE
FT                   LTGNHLILLPVLAASMASMAVTVLLMKRSILTEKIARRGHHLTREYSIDPLAVTRIRDI
FT                   MATKVDTLAADLPVGAAIERFLSHAAAHRAFPVTAPDGLVLGLVSRADILDWIGDEVRR
FT                   DLPLRAMIAGREVTTAAPDEMADTIAVRMLTRNAPRIPVVDAEGRLLGIVSRADLLRVH
FT                   QRVMLAETRRERFFLQGLFSSRKNRIQNVPGMQNAEPQMIPILVNQNGAQNDVDTELR"
FT   gene            178997..179431
FT                   /pseudo
FT                   /locus_tag="Acry_3463"
FT   gene            complement(180267..181043)
FT                   /locus_tag="Acry_3464"
FT   CDS             complement(180267..181043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3464"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29067"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY5"
FT                   /protein_id="ABQ29067.1"
FT                   /translation="MNRACVVADRGMVSADTIAALDALGMEYILGARERTSRVIRDVVL
FT                   KDKAAMVPLVLDRQHGETQLWVKEIRIGKGKAAQRYIVTVNEAEAKKDREDRQAIIDGL
FT                   QAQLKKGDKALVGNSAYRRYLRSRGNAFEIDPGKLAEEARFDGLSVLRTLFRAAKASFD
FT                   TRPVFHQADAAIRGHVFCSFLALTLAKELNRLCGARGFQPEWQKLLNDLDRLQQATIEK
FT                   GGKVITTRTHVTGQVGNVFKAAGIALPHNISEHPAD"
FT   gene            complement(181079..181648)
FT                   /locus_tag="Acry_3465"
FT   CDS             complement(181079..181648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3465"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29068"
FT                   /db_xref="GOA:A5FTY6"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY6"
FT                   /protein_id="ABQ29068.1"
FT                   /translation="MSGYRSRSSRFPNVFGRDRAPRWRLLTGAAIAGLLAASAVALAQP
FT                   WGAGWGGGMMGGMGGMMGIGVGLMWQGLYGTPRRDWISSLSPDPFVHPIPMAITAAAGL
FT                   VLLTALICFVVVTVGTLASRPVVASEVTEIPFGNAPVAEDSRWVRLMDRLGLWTLVAFL
FT                   LILAVYGPLFAVLLSHQVSIPPNTAY"
FT   sig_peptide     complement(181517..181648)
FT                   /locus_tag="Acry_3465"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 44"
FT   gene            complement(181717..182976)
FT                   /locus_tag="Acry_3466"
FT   CDS             complement(181717..182976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3466"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3466"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29069"
FT                   /db_xref="GOA:A5FTY7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY7"
FT                   /protein_id="ABQ29069.1"
FT                   /translation="MANAAAHIRGIAANRCQFTLQALQVFFVGLVIGMERAVLPTLAHE
FT                   FGVAPGAFLFLASFVLSFGLVKGALNLVAGGLADRFGRKPVLIAGWIAAIPIPLLIWAA
FT                   PNWWWIVIANVFLGISQGFTWTMTVTSQIDLAGSHQRGLAVGINEATGYVAVGLAGACA
FT                   ALLAEAVGARDALLIFGMATIGLAFATITRVRDTLAWVKAEHAEAGAGASQDHTLTLGA
FT                   IFVRISLRDRVGRAICQGGVVNKIADTLVWVMFPLFFKARGAKLVEIGWLTGTYAMVWG
FT                   VSQLWTGHLGDRVGRRAPVIAGFFLLAAGIAITAAGRDASLWLPGAIVMGIGMALLYPN
FT                   LIAAMSDQAAPLIRGKALGTYRYWRDTGYALGAVALGLIAQFAHATLPALWISAVLVAG
FT                   SGLWLMRDLPRPRSPVRDRD"
FT   gene            complement(182982..183713)
FT                   /locus_tag="Acry_3467"
FT   CDS             complement(182982..183713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3467"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3467"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29070"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY8"
FT                   /protein_id="ABQ29070.1"
FT                   /translation="MILRQFLHTDPTAASYLLGCVGKGAGVVVDPLFPIEPYLHAASAS
FT                   GSPIHLVIDTHLHADHRSAGRALAEAAGAEYAIHESAEVGYACRRLADGERLEIGNVVL
FT                   EVLHTPGHTPEHLCLTVTDRTRADEPWSVLGGHTLMVGDVGRTELATDAARGARDLFAS
FT                   LVRLKALPDHIEVLPGALAGSVCGRGLSGKPVSTIGFERRHNPAFRIDDAERFVAFMLE
FT                   NIPPAPDGAAELRAWNAGFTA"
FT   gene            183799..184464
FT                   /locus_tag="Acry_3468"
FT   CDS             183799..184464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3468"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: Rhodanese domain protein; regulatory protein,
FT                   ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3468"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29071"
FT                   /db_xref="GOA:A5FTY9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY9"
FT                   /protein_id="ABQ29071.1"
FT                   /translation="MKSSSGPKQQIFSHLAEIAAALAHPHRIEIIELIAQGERSVEDLA
FT                   ERIGLSLSNTSRHLQVLRRARLAAPRREGKNMFYSLVSETEVVTLLGSLGRVGERNIAE
FT                   IDQVLQAYFRARDCLEPVSRLALLERLRDGSVTLLDVRPADEFARGHLPGALNIPLDQL
FT                   DAALGGFTENVQVVAYCRGPYCVLSYDAVAQLRARGVRAIRLEDGYPEWKAAGLPVET"
FT   gene            complement(185034..186230)
FT                   /locus_tag="Acry_3469"
FT   CDS             complement(185034..186230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3469"
FT                   /product="putative transposase"
FT                   /note="PFAM: putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3469"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29072"
FT                   /db_xref="GOA:A5FTZ0"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTZ0"
FT                   /protein_id="ABQ29072.1"
FT                   /translation="MGASLEVADIFRAAGPVYRATHAGQLSLHQLKVMSAIEHCRTAAL
FT                   GGHVEACEDCGHRRIAYNSCRNRHCPKCQGAAARSWLTARKADLLPVGYFHVVFTVPAA
FT                   IADIAFHNKAAVYDLLFHAAAKTMLTIAADPRHLGARIGITAVLHTWGSALTHHPHVHM
FT                   IVPGGGISLDGERWVSTRPAFLVPVRVLGKLFRRLFVTGLLALFDAGKLAFFGGLAPLT
FT                   DRRAFLRHLSPVRHKRWVVYAKPPFGGSEAVLAYLSRYTHRVAISNRRLLAFNETGVTF
FT                   RYKDYRRDGADRYQVMTLAAGEFIRRFLLHVLPRGFHRIRHYGLLAGITRKANLAHARE
FT                   LLAVAASPPDDNRPEEVLDTRPPCPCCGGHMIIVETFARWSQPRAPPQRTSSAGIHSP"
FT   gene            complement(186235..187143)
FT                   /locus_tag="Acry_3470"
FT   CDS             complement(186235..187143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3470"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3470"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29073"
FT                   /db_xref="GOA:A5FTZ1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTZ1"
FT                   /protein_id="ABQ29073.1"
FT                   /translation="MNESIRTAAISPLRQRLIDDMNMRRFSRETHRNYLRDVGRFATFL
FT                   GRSPDTATAEDLRRFQIEQRDAGVPTPTMNSIVSALRFFFTQTIDRPDLARKLIRTPHP
FT                   RNLPVVLSRDEVARLLNATTCLKHQAALSVAYGAGMRVAEVAALKVSDIDSERMLIRVE
FT                   RGKGGRYRNAILPADLLILLREWWKIGHQQGVMHAQGWLFPGQQVTKPISTRQLHRVVV
FT                   EAARAAEITKRVGPHTLRHSFATHLLEDGVDIRVIQALLGHSHLNTTALYTKVATRTVR
FT                   AVISPLDRLGIVTADQERPAG"
XX
SQ   Sequence 187422 BP; 35559 A; 57996 C; 58055 G; 35812 T; 0 other;
     tcctactccg gtcagatcct tcgacggaaa cgggatgcac attacctgaa atccctcgac        60
     ttcaccttaa tgccatcgat atgtcgatcc ggaacaaata tatccccggg cgctcgtcca       120
     agcgtatcgc gcggatcttg gccaacgcag tgtccgcgcg gcataggaaa aacgttttcc       180
     cgccttccaa tactcgcgag agcggccgac atatcggtca ggcgatgggc gatgagatgg       240
     acgacctcac cctcccgctg aatctgcccg taaaccgcga tcatgccaga ggacagaatg       300
     atgaggcgct gtttttcgta gagatttggc cagatgacga gattggcgat cccggtttca       360
     tcttcgatgg tgatgaacat gacgcccctg gccgaaccag ggcgttggcg gaccagcacg       420
     atcccggcgg tttccaggaa tttgccgtct cgcgtagaca tgacctgatc gcaggatacg       480
     attctctcgc gccgcagatc ctctctcaga taggcgaccg gatgcgaccg gagcgataag       540
     cccagatgaa cataatcctc gaccacctcg ccgcccccag tcagtggttt caaggcaaat       600
     accggttcct ggagttctga aaccggctgt tccgtgcgat tggcgacggc cgcgaacagc       660
     ggcaacgcct cgtcgcgcaa cgccttgatc gcccacagtg catcgcgccg agcgagtttc       720
     aacgatggca ggaacgcatc ggcctcggcc atctgcacca gcgcagccgt cgggacgcca       780
     gcgcggcgcc agagatcatc caccgaggcg aagaggtggt tggcgcgggc tgctatcatt       840
     tttgcaacgt gcggattggc gactcccttc accatgcgca gacccagacg aacggcgagc       900
     cggctttcgt catgggtcgg ctccagcgtg cagtcccagc gcgaggcgtt gacgcagacc       960
     ggtctgatct cgacaccatg gtcctttgca tcgcgcacaa tctgcgctgg cgcatagaac      1020
     cccatcggct gtgcattcag cagggcagcg cagaacacgt ccgggtggtg gcatttcagc      1080
     caggaggatg cgtaggcgat cagcgcgaag gaggcggcgt gggattccgg gaaaccatag      1140
     ctgccgaagc cttcgagttg cgagaaggtg cgttcggcaa attcctgctc gtagccgttg      1200
     gcgaccatgc cgctcaccag cttgtcgcgg aaatgcgaga caccgccggt gaatttgaat      1260
     gttgccattg agcgacgcaa ttgatccgcc tcggtcgcgg tgaagccggc gcactcgatt      1320
     gccacacgca tcgcctgttc ctgaaacagc ggcacgccga gggttttgcc gaggactttt      1380
     tcaagctccg gcttgggata gaccaccgct tccttgccct cgcgccggcg cagataggga      1440
     tgcaccatgt cgccctggat cggaccaggc cgcacgatcg cgacttcgat gaccaggtcg      1500
     tagaaggtgc gcggtttcat ccgcggcaac atgaccatct gcgcgcggct ttcgatctgg      1560
     aacgtaccca gcgtatcggc ccggcgaatc atcgcatagg tgtgcggatc ctcggcggga      1620
     atggtggcga gatcgagctc gatccccttg tgctgggcaa gaaggtcgaa cccgcgcttc      1680
     atgcaggaga gcatgcccag agccaggcaa tcgaccttca tgaatttcag ggcatcgatg      1740
     tcgtccttgt cccactcgat gatctggcgg ttgtccattg cggcaggttc gatcggcacc      1800
     agctcatcga gccgatcgcg ggtaagcacg aaaccgccgg gatgctgcga taggtgacgc      1860
     ggcgtgccga tcaactcccg cgccagatcg atcgccagtt tcaggcggcg gtcttcgagg      1920
     ttgaggtgca gttccgcggc gtgtttgggt tcgatcccgc cttccgacca gccccagacc      1980
     tgggcattca gcgccgtgat cagatcttcc ggcaggccga gcgccttgcc gacgtcgcgc      2040
     agcgcccctt tggtccggta gcggatcacg gtggagcaga gggcggcgtg atcgcggcca      2100
     taggtgtcaa acacccattg catgacgatc tctcggcgtt catgttcgaa atcgacatcg      2160
     atatccggtg gttcgcgccg ttcctcggag atgaatcgtt caaacagcag atcgttgcgc      2220
     tccggatcga tcgaggtgat gcccagcaca aagcagaccg cgctattggc cgccgagccg      2280
     cgtccctggc agagaatgcc ttggctgcgg gcgaagcgga cgatggaatt caccgtcaga      2340
     aaatacggcg cgtagtcgag cgtctcgatc aggcggagtt catgcctgag gatggtgacg      2400
     acctcggctg gcaccccggc aggatagcgt tgcgcggcac cttcccaggt caattgtgtc      2460
     aaggcttcct gcgtggtgag accggggagc acgttttcat cgggatattg gtatcggagt      2520
     tcgtcgagcg aaaacaggca ccgatccgca atctcctggg ttcgggccag cgcctcagga      2580
     taacggctga agagccggtg catctcggcc ggcggtttca gatagcgatc ggcatggcgt      2640
     tcccgccgaa acccggcgtc gtctatcgtg cagccgtgac ggatgcaggt aacgacatcc      2700
     tgcagaatgc ggcggtccct ggcgtggaac agcacgtcgt tggtcaccac ggtcggcacc      2760
     tttgcgcgcg cggccaggtt cgacagctcg aatagccgca gtgcatcgtt gggccggcgt      2820
     cgcaaggtca gcgccagata ggcgcgatcg ccgaatgact gggccaggcg gcggagattg      2880
     cgcacgcagg cgtcatcggc ctccccaggc acgagcaccc cgatcagacc ctcggcatag      2940
     gccaccagat cggaccaatc gagacggcat tgggccttgc cgccccgttg cttacccaaa      3000
     gacagcaggc gggacagccg ggcataggcc gggcggtcag tcggatagac cagcagcgcc      3060
     gtgccatcgg tcaggtcgag ccggcagccg acgatcagac gcatgtcgtt cgccttggcc      3120
     gcgacatggg cgcgcacgat cccggcgagg gtattgcgat cggtaatggc caatgcttcg      3180
     aggccgagat gggccgcttg ggcgaataac tcgtcgcagg agctggcacc acgcagaaaa      3240
     ctgaaatgcg aggtgcagtg cagctcgaca taggcggtat cggtgctcat ccgaatatcc      3300
     cgtgcaggaa ccagcgatgc gagccggtgg cgttatcctc gccatccccc gcccggaaca      3360
     cccagaatcg ctcgccggcg tcatcctcga tccggaaata atcccgcact gcgatcaact      3420
     cggcgtcgcg tttccaccat tcgccaaata cccgctcagg tccgtccgcg cgtttgacgc      3480
     gccggcggat gccgcgccac gtgaagttga ccggcggatg gtcgggaagc aatgcaacgg      3540
     tctcgatcgg ttcggggttt ggcagcaggc gcgtcggccg gggccaatga tccggccagt      3600
     tcattttggt cggcggcgcg gtcgccgcga tccggctcaa ggatcgttca ggcacatcgc      3660
     tcgccaccgg cgcaaaccga tacagccggt cgccgccgac ccgattggcg atggtatcga      3720
     tcagatccga gatgtcggtc tccggttcat ccgcgagcag cgatgtcaac tgcttcggcc      3780
     cgaacggttc ggaccgtgcg gcgcagagcg ccatgatctc gataccaaag ccgggatcga      3840
     tcgtctcgat tttgtcgcat agcagtcggg tcaagcgttt ggcgtttcgc gccggcaaag      3900
     cggtgccgac gcggatcgcc tcggagtgcg catcgacccg atgaaacaca agatcgagtt      3960
     gtcgcgcgcc gagccctttg gcctcaagca tggtgcaaag ttcggtgacc agaatcccgg      4020
     tatagcgggc gatggtctcc gcggcaccga tcggttcggc gaaattttgt cgcacctcaa      4080
     tcagatccgg tgaccgcgcc gcttcaatcg cctcggccaa agtgcccaac gcctgatcca      4140
     gcctgcggtg cagttgcgga ccgaaccgca gggcgagcgg tgcgcgcggt tgatcggcca      4200
     gatcgccgat ccgttcaaac cccagccggc gcaaaccggt gatcatctcc gtcggcaagc      4260
     gcaaggcggc aattggtagt gtgagcagga tgtcgcgcga ctggtctgcc agcgcgacga      4320
     acaccgggtt cgcgagaaac cgcgccagcg catgcgccgc cccccagcta tccgccatcg      4380
     cagcgcgagc ggtcactccg gcagcggcca agcgggcgat catgtcccgc agcatctgtg      4440
     cctcgccacc ccgcaggtgg gccgccccag tcgcatcgat gaccagcccg tccggcggat      4500
     cggccgcaac aatcggcgcg tagcggtgca gcgcccatag cgccaggcgc tcgagccctg      4560
     ccacatccgc cagcggttcc gcgtccctga tcgtcaagcc gggaatcagg gcctgcgcct      4620
     gggccaccgc catgccgatc cgcaggccaa gatcttgcgc cacaccattg gctgcgaaaa      4680
     cgatccgtcg attgccgtcc cgatcggcga ggatcagtgg tgtctcaggt gacggtggtg      4740
     cggtatccac gagccccgac accggctgcc caggccgctg agccgaggcg cgccggtccc      4800
     gattgtatcg atcgatcggc cagttcggca gaaacagcga gacgaccctg ggcatcgcat      4860
     gcctccactt caaaatcggc actctcgccg gcccggcacc ggatcaactc gacatgccag      4920
     cgcgcccgcc cgatccccgg caccggtagc ggcgccgagg gcaggacgct cacccgccat      4980
     cgcgtggttg cggcggtcgg ttgcccgaaa tcactggcat cggcctggcg tcgccagcgt      5040
     cgcagcgcga tccccggtgt gccggaactt tccgcagcca attgcaatcg ccgtgaatgg      5100
     gtcatcgaaa gccggccaag ctcagcgacc acgccgccca gcccaccatg gcgcaaaccc      5160
     tcctcgaaac aggtcagcac cgatgtttca tcgcctgcct cgacatagat cacccggtcg      5220
     gccgacagac cggcctgggc gatggcgggt gcgaacagat ccgggcgcgt caggcaccac      5280
     aacaccggtc ctctggtcct cgccatgatt ccggctgcaa acaacgctgc cgccgcgcca      5340
     tcgatcgccc cgttgccgcc gcccgcgacc tcatgcagtg cccccgaggc tagcccgcca      5400
     ccgggcagcc gcgcgtcgag ttcatccacc ccgaacggca gaatagccgc cgtgcgcttc      5460
     ttgccggctt cgatccgccg gattttctct cgtaacgcat tcatggcggg cgtcggttgc      5520
     acttcctgga tcagcctttc agggagatga ttatgttcgc tatttgttct tatcgttcgc      5580
     tgagagtcaa cccaggaaaa cgggcgccag cgctatgatg caggatgccg ggcgggagcg      5640
     ccccgagtca tacaatgaga tcgcgcgtgc atctcgctga caatgaaccg ttcaatggcc      5700
     gcgcgcctgt actgagccga cctatcaaat tttttgtgag accaacggtg tgcgcccgcc      5760
     catgctcctt gggcaatccg gtctacgggt taacagttgc gaacaaaaca ggaaaatcgg      5820
     atagtcggtt ccaacacggt gaagggaccg aaagtgacca ccgcgaccta tctggacaaa      5880
     ctcaacgtcg agcaacgaag cgcggtcgtc cacggcatcg attccgccac gacaacgcat      5940
     atcggcgcgc cgctgctggt gatcgccggg gcaggatccg gcaagaccag cacgctggct      6000
     catcgggtag cccatctgat cgtcaacggc gtcgatcctc gccgcatcct gttgatgagt      6060
     ttctcacgcc gagccgctgc cgagatgatc cgccgcgctg aacgcatctc ggttcaggct      6120
     atgggcggga agacaggggc aatgaccgat gctctaacct gggcgggcac cttccacggc      6180
     atcggggctc ggctgctgcg ggactatgcc gaacagatcg gattggatcc ggcattcacg      6240
     atccatgacc gggaagattc cgccgatctg atgaaccttg tccggcacga actgggtttc      6300
     tcgacgactg aacgacggtt cccgaccaaa agcacatgcc tttcgatcta ttcccgctgc      6360
     gtgaacaccg aattgtccct cgatgatatt ctgcccacga cttttccatg gtgttcgtca      6420
     tgggaggccg aactgcaaca tctgttcggt gcttacgtcg aagcgaaaca gcggcagaac      6480
     gtgctcgatt acgatgacct gttgctctac tgggcgcaga tggtcagcga accagcttta      6540
     gccgaagata tcggcgggcg tttcgatcac gtcctggtcg acgagtatca ggacaccaac      6600
     aggctgcaat cttccattct gctcgcgctg aaacccggcg gtcgcggtct gactgtggta      6660
     ggcgacgacg cacaatcgat ctacgcgttc cgtggtgcca ccgtgcgcaa cattctcgat      6720
     tttcctggag cgttcagccc ggcggctgat atcatcacgc tggaacagaa ttaccggtcc      6780
     accaccgcga tccttgccgc ggcaaacggg gttatcggcc ttgccaagga gaggttcacg      6840
     aaaaaccttt ggagcaatcg cacgactgaa acgctaccgc agcttgtcca tgtccgcgac      6900
     gacgccgacc aggcacggtt catcgtcgag cgcgtgctcg agaaccgcga ggccggcatg      6960
     acgctcaaac agcaggccgt tctgttccgc acatcgcatc acagcggcgc cctcgaggtc      7020
     gaactgaccc ggcgaaacat ccccttcgtc aaattcggtg gactgaaatt tctggattcc      7080
     gcgcatatca aggatgtcat cgccgtcctg cgctgggccg agaacccgcg cgaccgcgtc      7140
     gcgggcttcc gggtgatgca attactgcct ggtgtgggtc cgacctcagc cgcaaaagtg      7200
     atggatcaca tgcaaggcgc cgccgatccg atcggtgccc tcggcgatgc gccgacaccg      7260
     ccgcgtgccc gcagcgattg gacgcatttt atcgaaacca tccggactct gcggtcacgc      7320
     tccgccatct ggcccggcga acttgagttg atccgccgct ggtacgagcc gcatctggac      7380
     cgcatgcacg acgatgctag cgtccggctc gccgacctga tccaactcga gcagatcgcc      7440
     agtggctatc cttcacgtga acgcttcctg accgaactga cgctcgatcc accggacgcc      7500
     accagcgatc aggccggggt accgctcctc gacgaggact acctcaatct ctcgactatc      7560
     cattccgcca agggccagga attccagtcg gtcttcgtcc tgaacgtcgt ggacggctgc      7620
     atgccctccg atctgggcac cgggcaatcg caagaaatcg aggaggaacg ccgcctgctc      7680
     tacgtcgcga tgacgcgggc caaggatgat cttcacctga tgatcccgca gcggttcttc      7740
     gtgcatggtc aggccgccta tggtgatcgg cacgtctacg ccgcgcgcac acggttcata      7800
     ccgaatgcca tcgtccatct gttcgacatg acgaactggc cgcctgcagt cgctggcccc      7860
     accaacgcca aatcaatcgg cccggtgcca cgcattgatc tcagcgcgcg gatacgcggc      7920
     atgtggcgct cgggcgcgca aaatgtgtaa cctctccagt gtcacgaaag ggcagcaggc      7980
     aatccgcgaa ttgacccggg ccatgctcga tacgacaggc aatctgccgt cccttcctgc      8040
     tatcttcccc gatgcgctgg ccccagtggt tcgcaatgca cccgacggcg agcgcgagct      8100
     gacgatgatg cggtggggca tgccaggtcc atcgcaattg ggcggcgcgc cggtgaccaa      8160
     tatccgcaat accaccagcc cgcattggcg gcgctggctc ccaccgcaga accggtgcct      8220
     cgtgcctgcc acgtcgttca gcgaatgggc ggacaccaag ccgaagaaaa ccccggtctg      8280
     gttcgctctc gaccagagcc ggccgctctt cgcgtttgcc ggtctctgga cggtttggca      8340
     cggcaaacga ggcacgaagg caaacccgat tgagggtgag cttcggctct tcgggtttct      8400
     cacgactgaa ccaaacagta tcgtccgtcc gatccacccg aaagccatgc ccgtcatcct      8460
     gacgactcct gaggaaatgg acgtctggat gcgggcgtcg tggtccgagg cggcgggact      8520
     gcaacggccc ctgcctggta ccaaactcgt cattatgaac taccgccgcc aagccgctca      8580
     cgcggctctg gcgaaggttt cggtcacaat ggaccgggcc cgttcctcac ccaagatacg      8640
     ctggccgatg ttccacagca cccaagctga cgcctgatcg cgcccgatca cctgcccatc      8700
     gggcagaatg tgagtgcgct cggacagcgc tttctttcgg accgccccgc tgaccggatc      8760
     ggtctgcgat ggcctgtgct tgcgtggatc gaccaagatc acccgacccg cagcttcttc      8820
     cgctttcgag gtcaggaggg ataaccagct accgggcgcg gtatcaagga tcgcccggtt      8880
     caggcccgcc ttctggcgga cattcttgcc cggcctctcc gccgtcccct tggcggaggc      8940
     cgtcatgttc ttcaccgaaa gatcctcggt gatgatgacc gcgtggtcgc ggacgagccg      9000
     cgcggtggtc ttgtggttcc ggtccttccg ccggttcgcc agcttgcggc tgcgcctggc      9060
     cagcagcttc cgcgccctgg cggcccgctt cgagcgcttg ccccggaggg ggcgggacaa      9120
     ctcgcgctgc gccaccttga ggccgtcctg cgccttgacc agcagccggt cgttttcgac      9180
     ctcggcgaac tgcattggcc ccgtgcagag cgtcgccatc gtctcgacac cccaatccag      9240
     cccaacgaca gaatccccta tccgctcgcg gtgcggttcg cactcgacca caagcgagag      9300
     gaaccaacca tccgccttgc gctgaatgtc ggcgcagacc acccggcccg gtgtccgggc      9360
     ctcgccacgc gcgcgcatcg tgccgatgcc cgacaggcgc agccgcccgt gccgccagtt      9420
     cgcgccaggt tcgaacctga agccgtcgcc gtgggatttg taccctatcg cgcgacaatc      9480
     aacttgagaa tccagcgtca atcaggatga gaatgcggct ggggaggcac cggcggaggg      9540
     cgtagcccgg agccggtgcc tccccagccg ggcggcgtcc ttgccagggc gccgccgtgg      9600
     tcgcggccgt ctgggccgcg gaggatacct cgtcacaacg gggagacctt cgtgcccggc      9660
     cgccacatca acgatcacca gaagaggctt ttcatgagat atcgacagac agacggcgtt      9720
     gccctggcgg ccgccaaggc cggcttcagc acggccgcgg gctaccggct cgagcaggag      9780
     cggcacttac cgtcatcgcc gaagccgccg cgcggccggc gccgcccgga tccgctggcg      9840
     acgatcttcg acgctgaggt ggtgccgctg ctggaagccg cgcccggcct cagggccgtg      9900
     gcgatcttcg aggagatgtg ccggcggcat cccgatctcg ccccgggtgt ccggcggacg      9960
     ctcgagcggc gtatccgcac ctggcgcgcg ctgcacgggc cggagcagga ggtcatcttt     10020
     cgccagaccc atgagccggg cgcgatgggc ctgtccgact tcaccgacat gaacgagctc     10080
     ggcatcatcg tcgccggcgc cccgctcgac caccggctct atcacttccg cctggtctgg     10140
     tccggcttcg agcacgccca tgtcatcctg ggcggcgaga gctacgtcgc cctcgccgag     10200
     gggcttcaga acgccctctg gcttctgggc ggcgccccgc gcgaacatcg cagcgacagc     10260
     ctctccgccg ccttccgcaa cctcaccgcc gagaacgtcg ccgacctgac ccgccgatat     10320
     gacgcgctct gcacccatta cggcatgacc ccgtcgcgca acaatcgcgg tgtcgctcat     10380
     gagaacggcg ccatcgaaag cccccacggc catctcaagc gcgcggtccg cgacgccctt     10440
     ctcctgcgtg gcagcacagt cttcgtcgat ctcgaagcct atcgccgctt catcgccgag     10500
     atcgtcggcc gccagaaccg gcgccacgcc gagcgcatcg acgccgagcg cgccgccctg     10560
     cagaaactcc ccgatcagcg caccgccgat tacgaggaga ccgtcgtcac cgtcacctcc     10620
     tccggcggct tcaccctcag gaaggtcttc tacaccgtcc cctcccgcct gatcggccag     10680
     cggctccgcg tccgcctcta tgacaaccgg ctcgagctgt tcctcgccgc caccccgctg     10740
     atgacactcc cccgcggccg gccacaaccg gatggcaggc acggccacgt cgtcgactac     10800
     cgccacgtca tccacagcct gcgccgcaag ccgatggcgc tgctcaatct cgtctatcgc     10860
     caccagctct tcccgcgcga tgcctatcgc cggaccttcg agcacctgct cgagcagaca     10920
     ccgcccaggg acgcgtgcag gatcatggtc gaactcctcg ccatcgccca tgagcgcgcc     10980
     tgcgaggctg aactcgccag cgtcctcgcc gccgatatca aagccggccg tcagcccgac     11040
     ctcaaggcca tccgccagcg cttcgcaccc gatcctgcca gcctgcccgc actcaccatc     11100
     ccgaccatgc cgctcgccag ctatgacatc ctgctccagg gagcagccgc atgagcgaga     11160
     ccgcacgcac cgtcgacgcc cagcgcctta ccctgctgct caacgagctc aggctccccg     11220
     ccatcaagca ggtctggccc gacttcgccg cccgcgccga caaggaagca tggcccgccg     11280
     cacgcctcct cgccacgctc gccgagcacg aggtcgccga gcgcgaccgc aggcgcatcg     11340
     agcgccacct cctcgaagcc aggctgccgc ccggaaagac catcgccacc ttcaccttcg     11400
     aggccgtgcc gatgatctcc aaggcccaga tcctcgccct ctgctccggc gacggatggc     11460
     tcgagaccgg cgccaatctc ctcgccttcg gcccacccgg cggaggaaag tcccatctcg     11520
     ccgcagccat cggcctcgcc ctcgtcgaga atggctggcg cgtgctgttc acccgcacct     11580
     ccgacctcgt ccagaagctc cagatcgcac gtcgtgaact cgccctcgag gccaccatcg     11640
     ccaagctcga caaattccac ccgctgatcc tcgacgacct cgcttacgtc accaaggatc     11700
     aggccgaaac ctcggttctc ttcgaactca tcagcgcacg ctacgagcgt cgctccctga     11760
     tgatcaccgc caaccagccc ttcggtgagt ggggtaaggt cttcccagat cccgccatga     11820
     cactcgccgc cgtcgaccgc ctcgtccacc acgccaccat cttcgagatg aacgtcgaaa     11880
     gctatcgccg caaaaccgcc atccaacgac gagccggacc aggacgccca cccacacgcg     11940
     cgacaatcaa cgaaaacatc agattgtcgc tccacgacaa tcaagtcgcc gaaacacgct     12000
     tgccagcatc aaaccaatcc gattaacgtt ccgaggtcgc gatcactttc tcatcctgat     12060
     cgccgcgctt ctcatcctga ttgtcgcgct acatgtaccc ccagccaggg aagcggtcgc     12120
     ggcccttgta tctcggaaac cccggcgtct cgcctgcctt cactcggcgg aagaaatggc     12180
     tgaaagccat atcgaggcgc ttgagcgtga cctgcaggga ctgcgcattc agcccgagat     12240
     aggcggtgtc atcgcgcctg atctgggtga cggacttgca ctgcgccgca tagcctatgg     12300
     aggtcttgga caggcgccat gcgtcaatgc gttcttgcag ggcggcgttg tacagcgccc     12360
     gatgaaggtc gcagacgcgc tccatctcgg tcgcctgcgt ggcggaagga tacagcttca     12420
     gcgtgacgcg gcgcatgaca agtgccatag tcttatgata aacttggtta catggcagaa     12480
     caagctaaat tttctaaatt atatcattgt gtttacgcgc taaactatca cttggttctt     12540
     gtgacaaagt accggcgcaa atgcatcaca ggcccgatgc tcggccgctt ccgtgagatc     12600
     gccgcggccc ggtgcgaggg gtggggcggc aaactgatcg aggtgaacgg tgaaccggat     12660
     cacgtccacc tgctgatctc cctaccgccg aacctcgacc tcagccggtt cgtgaataac     12720
     ctcaagacaa caacctcccg gctgatccgc aaggagttcg ccgccgaggt ggacacggtc     12780
     taccgaaagc cggtgttttg gagccggtca tactgcgtga tttcgtgcgg gggcgctccc     12840
     ctgtccgtca tcaagcaata catcgagcag caggcggcac cggaatgagc gcgctttgcg     12900
     cgcggcggct ttcaccacca accaaatcgc ttcgcggttc tggttggagc actagccgca     12960
     agttcggtag caaagggtga gcgttacgat ggggacgaac catgatgcat gatgattgaa     13020
     cttcaccggc ggtcgcccca ggccgagaaa agttgtcagc ctcgcgccaa tcgagggcgc     13080
     tccgccgtat tggccacgct cacggaagcc gacattgccg cgatagcacg cccataggta     13140
     gtctgccaga gtggctgact gcgacccatg gtgatccaga atgggtattt tgtcctgtct     13200
     gatttcagat agcccgccac taccgtggcg gaggcttcag agagcttgat tcaggtcaat     13260
     tcgcccaagt ttgagagtgc taagaaatta tgggcttttg gacttgcggt gtgctgcgtc     13320
     cggcccgcat cctcggaagg agggaccgat gagcgcaggc agtttccggg ccgcgttagt     13380
     ggcgttctcg acagtgattg ttccggcagc agcgcaggct gagccaccgg cgacgacggt     13440
     gcaatatcag gtaatggtca gcgccgggct tgcggcgcgt aagcccttcg aagcgtggtt     13500
     tgttctcgac aaatcttccg atcctcgtgt gcctggctac tccatccctg ccggagcgac     13560
     gatccgcttc gttttcccaa aatcgttcac tccgaaaccc ggcggcgtgc tcggagctgt     13620
     gatgctgaaa ggctggtccc agggcgccat ttccacgaag ttcatcacgg cgctcgatcc     13680
     aacgaaccca cgtgtcgtgg caatccattt cgccgcgccg attgcaccgg gatccgttga     13740
     aaatcccggc ttgaaggcaa ttcacctgcg cacaaacgaa atcaacccaa cgacggccgg     13800
     cagctacccg atcacgatcc agttcgtcga cgccggggcg ctctcgggta agacgactgc     13860
     gatcgcccac atcacgaaaa agccggtgcc caacattgcg gcatacaatc agctccaccc     13920
     aggaaaagac gaagactggc agcatgtgag agctggccat gcagcgcact tgccaatcga     13980
     tttccttgcg accttaccga atgaatgccg ctcatccttc agtctgaagt cgacgggtga     14040
     ccgcacactc aatatcttaa gcgatggcaa gccgattggc tcgatctccg cgaatggcgt     14100
     gcccgtggtg cttacgccac agccgttcgg accgggcttc gcgcggctcg gcgtcgttga     14160
     agtccacgca aaggcaggtt cgacggcggg gatggcggaa atcacagcag ccctgaatgg     14220
     tggcacgcat tacacgatcc acctcattgt cgaagaccga taaagcctct gccccggggc     14280
     gccatttgga gaccatttag tattggtttc gtaatgtttg ccagcggctt caggctctct     14340
     tgtcggtgtg gccggctgcg gctgtcggcg gaatggcttt tctgatctgc gcttgatccg     14400
     aatcaatgcg tgcggcttgg agcgcggata aatggaatgc agatttcccc gactggtggg     14460
     tgcgtgcctc cgttcagagc cgatgcctga tcggcggcgt tgcaccgccg tgtgttgcct     14520
     gtatgccgca ttctcggttg ccggcaggaa aaggccatga atacccttcc gccacggtcg     14580
     ccggaaacac ggccggataa ttcgccgctt tcgagcggcg ttgagaaaca gcaagcgtca     14640
     cgtccaccca gccgatggcg acgcgtcgta gggggggcca tcgtcattct cgtaatcgcc     14700
     gccggcgccg gatggttgtg gcgtggctat tcacgggcat tcaccgtcca ggtcgcgcca     14760
     atacgcgaac acgtagtcga gcaggtattt ggccttggcg ccataggggc cgacgtgcaa     14820
     tcggccctcg gtttccaggt cgctggagtg atctcgagga ttgatgcgaa cgagggtaac     14880
     gtcgtcaagg ccggtcaggt tcttgcgcaa ctcgatgccc gtgatgtcgc tgctcagcta     14940
     gcgctggcca aggcaggcgt acagcaggct cgcgccgcaa ttgacaaggc cgatgcggat     15000
     atttctaatg ccagtgcgaa cctcgccaat gccacggcaa tcgctactcg tcgcgaggct     15060
     ctgagtcgca atggcttcgc ctcggccgag gaggcgcaga attacatcac tgccgagcgg     15120
     gtagccgagg gcaatcttca ggttgccaag gttgaggcag agactgctcg cgccgggctt     15180
     gccgaagccc tcgcgcagga ggcatttgag gtggccacgc tcggcaatta cacgctgcgc     15240
     gcgccctacg atggatgggt ggtcgctcgc aatctcaatc tcggtgccag cgtggctcct     15300
     gggcaagcgg tgttcaccgt ggtcgatccg agaacgatct gggttgttgg ctacgtcgac     15360
     gaacggctcg ccgggcgcct gcatgtcggc cagaaggcgg agatcgtgct gcggtcggag     15420
     gcgggtcgac gctttcccgg tcacgtcgcc cggatcgaga tccagagcaa tgcgacgaac     15480
     gaggagcggc ttgtggacgt cgccttcgac aagttaccgt cggacatcca tctggccgag     15540
     caggccgaga tctacgtcac gacgggtgtg ctcgcacggg cggccctggt tccacaatcc     15600
     gtcgtaaccg gactggcaga cggcaagggc acggtgtgga cggtgcaaga cggacggctt     15660
     cgccagcacc aggtgtcgtt cggacctgag cttctcgacg gcgacctgcc agttgtagcc     15720
     ggcctggccc agaacgcgaa ggtcgtcacg ggaccggcaa tcggacttcg tgccggtcgc     15780
     gcggccaagg tggcaaaagg gcctgcatca tgaatctcgc cctgcgcgat gtaaggcgca     15840
     acaaacttcg cttcgccctg actatactcg gcgttggcat gctgatcggc gtggtgatcg     15900
     cgatggcagg catctacgag ggtgcggtca cagacgcgct gagcatgccg cgcgctctca     15960
     aggccgacct gtgggtggtt cagccgcgga cctttgggcc gttcgccgag ccttcgcgca     16020
     tcccgcgaga tgcccgcgag ctagtccgac gcataccggg cgtggccgcg gccggtgccg     16080
     tcacctacca gacggtacag accatggctg acgggaaacc agtacggctg ctgttggagg     16140
     gctatgagat cggaaggccg ggtggcccca tgaaactcac ggccgggcac ggactaaccg     16200
     aaagccatta ccaactcgtc gtcgacgggt cctccgggct gaagcttggc caggccgtgc     16260
     ggcttggacc cttccacgat ccgtacaccg tcgttggcct cacccacggc atggtgggct     16320
     caggtggtga tccggtgggt tgggtgacgc tgctcgacgc acaggcgctg caattcggtg     16380
     tacctccggc gctggagcgc cgcgaggcgg catcgggccg caagccgcct acgacgactg     16440
     acatcaatgc cgtcctggtg cggctcgcgc ccggggccgc ggcacccata gttgctcgcg     16500
     atatcgcccg ctggaagcac ctggcggcag tgccggagac cgaagaggag cggtacctaa     16560
     cagccttcgt aatcgagaaa atgcagcgtc aacttgggat gttcatggcc atcctggtca     16620
     ccgtcacggc tgtgatcatc acgctgatca tctacacgct gacgatggat aagttgcgtg     16680
     caatcgcgac cctgaaattc atcggcgcac cggatcgcgt cattgtggga atgatcgtgc     16740
     agcaggcgct tgtcctcggc atcggcggct tcgtgatcgg gctggctctg gtggaggaga     16800
     taaagggcac ctttccacgc cgggtacaga ttgagccacg ggatctgctg atcatcctgg     16860
     tcatcgttac catcgtctgc cttgccggct cggtgctcgg cgtgcgtgct gcggtcaaga     16920
     tcaacgcggc tgaggcattg gccaatggat gagcacttgt catccgtgcg cccgccgcgc     16980
     atcgagttgc gaggggtctg caagcatttc ggccgggccg cgacgcgggt tgacgcgttg     17040
     gtcgatatca cactcacggt gcatgcggga gagatggtgg gcttgcgggg gccatccggt     17100
     tgcgggaaga gcacgctgct caacgtgatt gggtgcgtga ccgagccatc tggcggctgg     17160
     atgcggcttg acggtgagcc agtgtacgag aaccgcttcc tgcgtcggga cctgcgccgg     17220
     ctgcgcctca caaggatcgg cttcatcttc cagacacaca atctgctgcc gttcctgact     17280
     gcgaccgaga acgtcgcgga ggcgatggag ttggcgggaa ccgggcacgc gaacgcgcgg     17340
     aaacgtgccg aggcgttgct cgattacttc gacatgcgcc aggtgcacgc ttatccgtca     17400
     gagctttccg gcggcatggc gcaacgcgtt gcgatcgctc gcgcaatcgc caatggtccg     17460
     cacattatcc tcgccgatga gccgaccgcg cccctggact cagttcgcgc cgatggcgtg     17520
     atgaaccttc tcgaacggat agcgaaggac cagctggcgg cagtgctcgt ggtcacgcac     17580
     gatgaatcga tcttccaccg cttcgatcgg ctgatcgcca tgcgagacgg acggatcgaa     17640
     ggtgaagaat tgccggggca tccggccctc acctcatcga tgacgggcct cggacgtgat     17700
     gcttcctgac ccggcgaggt tgggtgcttt tcgaccgtcc gctttcgcgg tgggtgaatt     17760
     tcgacatcag tgtctttgtt gggtcgcttt gagccaacgc cgatcctcgc ctgaatgccg     17820
     gctttccttc ggttgggagc cgcaaccttc cattccgcct tttggcccat tcgggaccca     17880
     aaagcgcccc ggcggctctg cgcccactac cgccgtcgaa gccttgatat tgtttgatct     17940
     cagttgccgg gccgatgggt tatctgcatg ccaacaggcg gcagcaagct acgcagaggc     18000
     gcgtgatcag gatctcgaga ggggctctat ctgccgctga atcgtgcgaa taccatggcg     18060
     tcgcgatttt cctgcatcag cagcgtgatg ctcgggactt tttcgaagcc aaggccacgc     18120
     ggcagttcgt cttccgcgcc tgccacgata tcagcgtagc tctcaccagc cactttctcc     18180
     catttgcccg ccggcttgcg tacttcgaga ttgactaccg tcgccttcct cacaagacgc     18240
     acaatgggat cgttcggcgc gcccggcttt gtcaggctgg gatggcctgc gatgagccgc     18300
     cagccattcg ccaatgccca gacggtcagc tcttccttcg tcactgcgga tatcctccat     18360
     ggtatgaacg aggctcagga acgcggtgat cgcttcccct tgctcgcttg catcgatcgc     18420
     tcttgccaca acgccatgtc tgctgccttg ctgaatacca ctcggacgcc ggtgctaccc     18480
     cggctcatcc ggattttgcc cccgttccgc gccttgtgct cggcgagcca gttcataaat     18540
     tccgaatcct cgccggtcct gccttcgaac tcgagcacac cgacgatttc ttcctccttg     18600
     cggcgcttta ccatcttgca tgctttcctg aagtttctcg ggggcgcttc gatacgtcgt     18660
     tcaaagcccc gcatacagag ccgcggcgat ttgcacctct gtcacgctgt gactggatgt     18720
     cggcttctta cgccctcttt ccgaaagcca ccagtccgcg ctcccggccc atctaggccg     18780
     tggaacaacc gaggctcagc tttttgaccc ggatcaagta gatcacgagc cgaccaggag     18840
     gccgtcggag atgatcggtc cattgttctg atcgctgccg gttcagtggc ggcacttacg     18900
     gcgctttctc ctcgaccaag aatctggaca agaaatgccc gttcgcatga ccctgtctcg     18960
     cacgcaatcg caccgccggg gacatcaggc ggagcccctt catcagattt catgcctaga     19020
     cagcccccac gccactcgcc gacgccggcc gcggcatccc gctcgccgcc cggatccccc     19080
     agatcgaccg cgccaggttc agctcgccgg cacgcgcccg ggccaccatc ccgtggaaat     19140
     aaccgcccgg cgagccgcgg aagtggtcgc tcggcttggt cgagacgatg gccagtgcca     19200
     cggccgcctg ctcgcgcccc atcgccaggc acgcatcccc ccatagcggc ttcgagacgc     19260
     cgaggtcatg acgcagccag tcggccgcct ccacgatttc cggccatccg ggcgaggatt     19320
     tcgccaggta agcccgcaat cggggcgcca gcctgaccag ctcgtccggc gtcatgcgga     19380
     acaccgtgcc gtccggcggg atttcaggct ttgttgcccg actgccggtc ggccgatgcc     19440
     cggcttcctt cccatcccca ttcctgccgg ttctcgtcga gcctccagcg ctcgtgcccg     19500
     cgccacccga ggtcgagtta cgttttctcg atgcagatac gtgatccgta ggatcaagag     19560
     tctggtttgt atgtgtaata tgaggctcat ccgtgagccc cttggggctc atatttgttg     19620
     attcgacagg agcctggccg gcctctttca gcgcgcccat cgccgcctcg agcctgccgc     19680
     gaaggtccgc ctgccggttt tccagcgtcg tcacgccgag cgtcacctcg tccagctcct     19740
     cgatacggcg gatccgcgcg accaggcgcc tcgcctcatc cgcctggcgg acccatcctt     19800
     cggcgatccc gagctctgcc gccgtctcca cgatctgctg gatcccgcgc acggcgatcg     19860
     tcgcccgacg acgcagctgc ttcagcgcct cgaagcgggc ccggccacgc tcggcgatct     19920
     cccggaactc ggcctggcgg accgcaatgg gcgagagatc gaagccatac gcctcgacga     19980
     tccggccgcg cggatcccgg cggccgtagc gcttgccgtt cggactgtcg cgcatggtga     20040
     tcagcccgag atgagcgagc agccggttca gccgcttcac ctgcgcctcg ctcaggcaca     20100
     gcgcctccat ctgcatcgcc gccgacggcc agacaatcgg ccgtgcgccc tcctgccagt     20160
     cctgcacctg ggtgaagcgg aacagccagt cgatcgcctg cgtgacccgc gggccaaacc     20220
     gcagatacgg ggctgccgcc ttgaaggcgg ccagcacccg gccggggtcg acctggccac     20280
     cctcgctcag cgtaccgaaa tcatcggcga gtcgctctgt cgcaaccatc ccgagcgtga     20340
     ggcgccgcgc gccgcgcacg cctcgtagtt tgggacccgg ccccgattcg gggcggaaat     20400
     tctccatctt gatcctccat cagtgtcgga tcgcgacggg caaagccctc ccttgagcgg     20460
     aaacggcaat ttccacttgg caggatggct tccgatgagt atgttcggga ctgcgacatc     20520
     accgaacggc tcttgaagcc cgtagcgaaa tcagtgaaag cccgcccggc aaggcgggct     20580
     tttgcgtgtc taggcggttc tgggtggggc gcccctccat tcctcgatga gcagttggag     20640
     cgcctggccg cggctacgca gacctttgcg ctccttgatg gcgtcgatca ggctgatcgt     20700
     ctcgttcggc aggtggacga gcacacctgt agcgccgcgc gcgcgttgcc tgcgcctgta     20760
     gcgtgcgctc gcatcatcgc cggcaatacg tgtgttcggc atcctgttca ctccaccatc     20820
     tctatggcta gtcagtcacc attcagagat tcccggagcg agtccacaga ttcttgcgcc     20880
     cgagtcgcac ttagcggctg attcgaaacg cttttcccgg aaatttttct ttgcgctccc     20940
     gagtcgcggt cggcgcagat ggccggcctg ggatggcgga tagcatgcga ctcggggggc     21000
     tggtccgccg aaagccagtt agggcgacga tcagctatgt ctgagtgtcg cataattcga     21060
     ggaacgccct catggcgctg gagacatagg tatccttccg ccgaatgaag agcgtttcca     21120
     catttgcgtg tatttgcggc aatgcatgcg ccgagacatt gccctcgctc gccgcatggg     21180
     caacgaccct ccggggcaat agcgtcactc caactccggc cgagacacag gcgatcatgg     21240
     cgtcgagcga accaagctca agtggtctgg cattggcgat ccccataccc gacaaaaccg     21300
     cttccagttt ctgtcgatag gaacagccat attggaaaac gattgtccgc aaagtgccac     21360
     acttcgtcag cgacgagggg tcagtgacgg agggcgaggt aacgaggacc aattcctcaa     21420
     tgaaaactac ctgccggtcc aaatccgggt gctccaccgg ccctgcaacg aaagcgccat     21480
     ccaacctgta ttcgagcaac tccgtcacca gctgtgcggt cgtgcccgtg gtcacgacca     21540
     actggacttc ggggtaggca agggtgaagt tgctgagcag cggggcgagg cgcatggccg     21600
     tcgtcgtctc gaggctgcca atttttagcg gaccgtttgg cgtgccgtca tccttcgcag     21660
     ccgcccgggc atcggccagt aactttgtta tctgtccggc gaagggcagc attcgctggc     21720
     ctggcccggt aatcgtgaca ccgcgtgcgt ggcgctggaa caaggagatg ccgagatcat     21780
     tctccagcgc tttgatcctg gccgtcacgt tggactgcac ggtatttagc tctgcggcag     21840
     cccgtttcat gctgcccagt cgggcgacgg cttcgaacat tttgagatcg gatgcgtcca     21900
     cagcaacctc ccatatcata taatacgatc tcctctatct tataaattcg tttttcacga     21960
     tcactattac ggactacctc accgctgttt gacgcgcagg ggatgagtta tggacgtatc     22020
     aggtgtcaga aatcagaccg gaagccagac aggccgggcc tggatgggaa ttttctcggg     22080
     tttctgcgcg agcctcgtag gtattggcat ggcgcggttc gcttatacgc ccttgctacc     22140
     cgccattatc ggggcacact ggttccagcc ttcagccgcg gcatacctag gagcagccaa     22200
     tctcgctggc tatctggcgg gggcgctggc cgggcggcca cttgcgacgc gaatgaccgc     22260
     cccctcggca cttagaacca tgatgtttct ggcgacatca tccttcttcg cctgtgccta     22320
     tccgctgggc ttttcgtggt tcttcgtctg gcgcttttgc gcaggtcttg caggtggtgt     22380
     gctgatggtt ctggcagcgc ccaccgtatt gccgcatttg ccatcgtccc gtcgcggcct     22440
     tgccggcggt gttatcttca tgggtgttgg agtgggaatc gctgcgtccg gcacgttcgt     22500
     gccgttacta ttgaaccaag ggctgcaacg gagctgggta gggcttggtg ctatctccct     22560
     gttgctgacg ctggcttcct gggtcggttg gccagctgag gaaatagtgc cgcgaagcaa     22620
     gcctcataaa atccccggca ccgttgcctt gcgggcgctc tacgtcgaat acgcgctcaa     22680
     cgccgttggg ttggtgccgc atatgctgtt cttggtagat ttcgttgcgc gcgggttggg     22740
     gaatggcata cgcacaggag cggaatactg ggtgcttttc ggcctgggtg ccgtggtcgg     22800
     gccgatcctc agcgggcact tggctgatcg gctggggttt gcgcgctttc tgcgggtatc     22860
     ttatctcgtg gaagccgccg ccgtactact gccagcccta ggtggagggg cggcttggct     22920
     aatgctttcc agcgccgtcg ttggcgcgtt cacgccgggt atcgtgccgc tggtgctggg     22980
     gcgcgtgcat gaactgctcg ctcatcatcc ggccgggcaa aatgccgctt ggagcaaagc     23040
     tactgtgagc tttgccacat ttcaggcagc ggcggcctat ggcctctcgt atatcttcgc     23100
     gcagacgggt gactaccggc agcttttcat catcggcgcc gttgccatgt tgctggcttt     23160
     cgctatcgat gtgctcgcag ggggcaagat acaatgaaca ttcatgaact acttggaatt     23220
     gaatggccaa tcatccaggc gccaatggca ggaacctcga ctccagactt ggcagctgct     23280
     gtttccaacg tcggcgggat gggctccatc ggtgttggcg cgatgacggc gcaggatgca     23340
     cgcaccgcga tcgccgcaat ccgcgaacgc acggaaaagc cattcaacgt caatgtattc     23400
     tgccatcgac ctgcgcggag ggaagcggtt cgcgaacagg cgtggctgga gcgactgcgc     23460
     cctgaatttg cccgcttcgg cgcggcaccc cctgctgaga tccacgaacc ctacaagagt     23520
     tttctcctcg accgcgctat gttggacgtt ctgctggaga tgaaacctaa tgtggtcagt     23580
     tttcatttcg gcttgccgga tgctgggtgg atcaaagcgc tccgcgacgc aggcataatc     23640
     ctgttcagca ctgcgacaaa cgggcgagag gcaaggcttg cggcagctgc gggcgttcac     23700
     gctatcgtcg cccagggtta tgaggcgggt gggcatcgcg gcatgtttga tcctgacgag     23760
     gaggacgaac aactcggtat cttcgtactt gtgcggcaat tggtgaagac gctgaatatt     23820
     cccatcatcg ccgcgggtgg aattatggat ggtgccggca ttgccgcagc actgcgcctg     23880
     ggtgcggctg cggcgcagct tggcacagcg ttcatcgccg cccaggaatc cgccgctgat     23940
     gcaggctatc gtgcgatgct attcagtgaa gccgcagagc atacagtgat gattcgtgcc     24000
     atttccggcc gcccggcgcg atgtttggag aatcgcctca cgtcgctggg ttctgatatt     24060
     ccagccagcg agattcctga ctatccgatt acctattctg ccggaaaggc gcttcacgcg     24120
     gtggcgaagg cggcaggtga gtccggctat ggcgcatatt gggccggcca aggtgcgcca     24180
     cgtgcccgcg cccttccagc ggaaaaattg atggctgagc tgatcgccga gatgcagttg     24240
     gcatgacggg ccggaaggag aatggcaggc gaccaatctc ggcgcagggg aagccggcac     24300
     tcaggccagc tctggtgtcc tgttcgaact ctcgacacca tgagctcccc ccccttgatc     24360
     cgcaatatct ctgcttctga cggcacgcgt attgaatgtc cgaggtacga caagtcgcgc     24420
     gtttcgagcg gtgcggtcct gatcagctga cggacgccgg tctcgatacc gtcggggctc     24480
     ccgaggatga ggacagggcg tttgacgcgc gctgtttgct aacctgcgac cgactccagc     24540
     tgctccagga ccgcatcgaa ccgatccctg agatctgtga taacgtgatc tgcttgagat     24600
     cgtgccgcgg atgagagcac ccgctcccat tcaggcagct gagcggtgct cttgggcata     24660
     attcatccag aaaaaataac gctgcgcgta tgggtcgccg acatttgcca tgcagacacg     24720
     agtgattcgc tccagcacct ttggatcggc tctcgccgcg tctcttagct ctgaccagtc     24780
     attccatcgg ccgcgcgaaa tgatgtcgtc gatcgccgcc agtgtgtatt cctcgtgaat     24840
     gaggtgtcga tgacgcattt cgacaaaata ccactctgca cggcctcgcc caaggagatc     24900
     ttgtgcatac aggatcaggc atccggcatc agcccggcga cataccaggc tcgtcgctct     24960
     cctccggcca cggacccacg atgtcccgct tgtgctcacc gacggccata tatcggccat     25020
     ccgacctcca gatgtcgtgg ccgcgccggc gcggcttgcc tctgaacatc cgccagaccg     25080
     agcccttcac tacgcctcca ggtgctcgcc gtgctgggcc caggatgccg gtgtgagcgg     25140
     gcggatgctg taacgcgcca ggtcatcgag cgtgacctca acgatccgcg ccgcccactc     25200
     ctttggctgt cgccagtatg ccatctcgga tcctccttca gccgttcatt gcgcagtcgg     25260
     gcgcgtcatc accctgtgac tctagcgggt gggcgcgtaa gcaacgcggc cagcgcccgg     25320
     gctcatcaga cttcgtcatc cggcggggcc tcaagttcac cgcgatagcc aaacacggtc     25380
     tcgggccacg ttgtctcgac ccgccgcctg atcagcccga tgatctggtt atgcgcctcg     25440
     gtcagctgaa cgccgttgac cgcggcctca tgcagcgcat cgagcagctt cccaaagctg     25500
     tgctccagct cgagcccgtt gacagcggcg agcgcctccc tgagctggtc gcgaattttt     25560
     tcggtgggcg aaaggggcgg tcgttcatca gacatatttg tgatttcgag acaaaaaatg     25620
     acgaattaat gcggtgaacg gagctagaag aagaaattcg attttcaaca aaattctgcg     25680
     tcaagagcgg acgcacgccg tgaaaattat tgatttactc gcctccggcg cgatatgccg     25740
     gaccagcgat cttcgcggga cactcgatgc aaaaatccat ccagaccgac gatattccga     25800
     atattcgatt gcaggtcgac acctcgatcg cgacgctgag gaagctggac gatctgcgat     25860
     gccggctggg cctgtcgacg tatgccgagg tgatcgcggc ggcgctgaag catgagtacg     25920
     ccgcgctcga agcccggcgc cggcttgcat ccgctccgac gccacctcca ccgtcgagct     25980
     tctcgaagcg ggccgcgcct gagccggtcg tgccggccgc cccgcgtccc caggttcagg     26040
     cgcggccggc gccacagagg gtgctggcgt tgggtgggcg agaaaggtga gaatgacgct     26100
     ggagcccaag cagaatatta gctattatgg aatagtgatt tatactcttg ggtaaatgaa     26160
     acagtgttac tgcctaatag ttggcaaaat gtattggcat tttggggcaa atcatacact     26220
     cgtgaggata agttatttgc ttatccgatt gtggcgcact cacttgatgt tgctgcggca     26280
     ggttcacacc tgccaatgcc attaaaggaa ttcgataagc gcacggttta cttcctgctg     26340
     tcgctccacg atatcggcaa attctcccgc ccgttccagg ctcaggaatc cgatctttgg     26400
     ccgagccggg ttctggggcc atggcccggt cgtgttgcgg gcccgcgaca cgatgcactg     26460
     actgcggcac tccttgaggt gttcgcggac gaaggtttgc ttgacccggt attcccactt     26520
     ggtcggcgag ggagcgggtg gcaccccagc aagcgatctg gtctcattcg aacgattgcc     26580
     gggcatcatg ggcgtcccat cgatgtgcct gaccacctgg agcccgcggt ttgccgccaa     26640
     tgcctggacg ccgcccggga gttcgttcag gcgatgctcg atcttttcca gccgtctccc     26700
     ttgccaccac ctcaaagccg gcgggccagt gcacggatgc aatggcaaat tgccggcttc     26760
     ctcactctcg ccgattggat tggctcaaac gaaatctggt tcccgcgcga tgggacccac     26820
     agcgatctcg atccgcacga ttatttccga gaagtagcgc tgccgcgcgc cgcccaagct     26880
     ggtgcggacg ccggactgac cccctccaag gcgcgcactt tcactggctt ctccgcactg     26940
     ttcccgaagg tcgacacacc gtctccggca caatcatggg ccgagacagt gccgctgccg     27000
     gagggggcag tgctcgcaat catcgaagac ctgaccggca gcgggaaaac cgaggcggcc     27060
     cttacgcttg ccagccgtat aatggcatcg ggagaggcaa agggtatctt ctttgccctg     27120
     ccgagcatgg cgaccgccaa ttccatgttc cagaggctga ccgacaccta cctgcgcctg     27180
     tttgaaaagg gctcgcggcc atcgatcgca ctgacgcacg ggaaggccgg tctggatcct     27240
     cgtttccgtg cgctgatatc agcctccccc tcctcggctt cagagccacg ggagggggag     27300
     gcgattccgt cagaggcgga gtgcgcagcc tggctcgcgg aagatcggag gcgttccctc     27360
     tttgccgatg tcggcatagg caccatcgat caggctctcc tcgccgtctt gcccgtacgc     27420
     cacgcgccgc tccggctgca tggcttgcag ggcaaggttc ttgtcgtgga cgaggtacat     27480
     gcattcgatt cctatatgga tcgcgaattg caggcgctgc tcgagtttca tgccgcactg     27540
     ggtgggtcgg cgatactgct ttccgccact ctcccgctga ggatgcggca atcgctgact     27600
     gacgcgttcc gccgtggcgc cggccaggaa gcccctcgcc aggttacatc gatgcactac     27660
     ccgctcgcca ccatggtggg gtctgaagcc cataccgagt attcgctggg cgtccgggcg     27720
     ggcctccccc gttcagtcac cattacgcgg gtaggcaccg aggcggaggc cctttcccgg     27780
     gttgtggacg ccgcaaggct aggcgctgcc gtagtgtgga tccgaaacag cgttgatgat     27840
     gcgctcgaag ccgccgcggc ggtgcgcatg cagaacattg atccgatcgt ctttcacgcc     27900
     cgttttgctc actgcgaccg gcagtcgata gagctggagg tattgcgccg gttcggcaag     27960
     gagagtgtcg ggcaagcgcg cgccggcgtc ctgatcgcca cccaggtcgt cgagcagtcc     28020
     ctggatctgg atttcgacct gctggtgacg gacctggcac cggtggacag cctcatccag     28080
     agagctgggc ggctttggcg ccacaatcgc gggacgcgcg tcgtcggccg ccctgaaatg     28140
     gttgtcctct cgcctgagcc atcaatggat gccgacgcgg gctggcttga tccgctgctg     28200
     ccgcggacca acaacgtcta ccgaaatccg gcgctgctct ggcgcggcgc ccgggcgcta     28260
     ttcgccaaat ccgacctcgt cacacccggt gatatgcgcc ccctgatcga ggcggcggat     28320
     aacgtggcgg atacgcctcc gggcctcaag atggcggcgg acggagcatg ggcaaagcat     28380
     ctgagccacc gtgcgtttgc ggccggcgcc gtgctggatt tcgacgaggg gtatacgctc     28440
     caatccggtg cctgggacag ggaaacccgg acaccgaccc gacttgagga gcgcgagcag     28500
     gcaacgcttc gcctggctcg cgtcaaggat ggaaaggtgg tgccctatgc tgggcttgcg     28560
     ggagacttgc ggcaggcgtg gacgttatcc gaagtgaggg tccagcggta tcggatagca     28620
     gcctgcccac caccggcggg atattccgaa gcggcgaacg aggcgcggag ccaatggggg     28680
     cgctgggaac gcgagagccc ccacatgctg ctcgccattc tcgaggtgac gaagcaggag     28740
     ggccagctta tgctgaaggg cgaaaagccg gatggccatc ccgtttcggc aatctacgat     28800
     gctgttgatg gcctgagact gcttcccgca tccgcgggat gacccgcgtg aagacctgtc     28860
     attggtcttc gcacagaaat gttccctgca agcgcggggc ggctttgttg gcgaaagcca     28920
     acttctgctc gaccaccacg aaagtgtgaa gatctttcat ttccgttgtg tcgaagcggc     28980
     cgagccgtgt aagacgacat taaaagctat ttttcgtagc gaccgaatga gacggagata     29040
     ccggatagcg cggcatattc agtgacgtga tcctgtggcc gtgaaataca ttcttgcttt     29100
     tgtacataat aaaacgcgag gtctaagctt tcatgtttaa cctcttgact aatccatggc     29160
     tccccattgt ccgtcaggac gggacgaaaa gtgtcatcgc ccctcggggc atcacggagg     29220
     atatttccgc gaacccagtc attgccgtcg actggccgcg cgccgatttt cgtctcgcca     29280
     cgatggaatt gctggctggc ctaatcgcca cggcctgccc tccggcagat gaggatgatt     29340
     ggctcgacgc ctgggaagct cctccttcgc ctgaaaagtt ggacggtgcc ttagcgccat     29400
     tgtcccatgc attcagcttc gacggccctg ggccccgctt catgcaagat cttgcggatc     29460
     tcgacgctga tgaagagccc gtggaaaatc tgctaatcga ggtggccggt aattccggtc     29520
     ccctcgttca tccgggacgc accaagcgga tgggcaggcc ggcggcagca atctcccttt     29580
     acacgctgca atcatggtcg ccctccggcg ggaggggcaa ccgtacaggc ttgcggggag     29640
     ggggaccgat ggtcaccatg gtggcgccag gccggcatcg atctctctgg caccacatct     29700
     gggccaatgt gccgctcgga cgaaagcccg agccggtaga ctttcctcgt atctttcctt     29760
     ggctctcgcc aacgatcaca tccgtgaacg atgaggtcgt aacgccagat gatgtcgccc     29820
     accccctgca agtctggtgg ggtatgccgc ggcgtatcag gctcagcttc gttcagctgc     29880
     cttcacctgc cccttgcgac ctgacaggtg ctttggactc gagcgttgtc accggatggc     29940
     ggcagcgccc ccacgggcca cagtatgtcg ggtggggaac gagacatccc ctcacaccaa     30000
     cctatcagaa caaggctgga gaagagattt tatcggtcca ccctaaccct ggtggagtcg     30060
     gttaccgaaa ctggattggt ctcgttctcc gcagcccgga cggcctgcgc cggccggcac     30120
     ccatcgtctc tacctggcgg aatgaccgct accgcggcac ggaagaagcc aaaggtgccc     30180
     gccttatcgc tggcggctat gacacggaca acatgaaggc gcgaggcttc atggagaccg     30240
     aggtcccgct ggtcctggcg agctcgaagg aggtgcagga acgtctggac gcattagcca     30300
     catcgcttgt ccgtgccagc gagcgggcca gctaccagct ccgcaaggct gtgcaacagg     30360
     cactgtatca tccaggcgcg aaggtcaaag ccacggctca tgggatcgcg cttctggggg     30420
     accgcgtttg gctggagacg gagagcgcgt tcttcagtgc tttgcaccgc gcgatgagcc     30480
     ttgacgatac ggcgccagaa cgggtcgcat ggcaggcgcg ccttagaggt ctcgcgctgc     30540
     gcatcttcga cgacaccgtg ccgattgatc cactggacag gaacaatgtt cggcaggtca     30600
     gagcgcgctt tttcctcggg ctcggcctta gtggctacgg caaagacggc cagtcctttt     30660
     tccagatcct ggaaatgccc ctgccagccc aggaaaaaaa gtcgaaagga aaggcttcat     30720
     gatccgttat cgatcggccg cccatgactg gtggcgggat ctcgttccgc gggcaggcta     30780
     ccccggtgac cgtgctgcgg tcgccaagct tcgccgcgcg tcgaccatca gcgaagcaat     30840
     cacggaagaa gcatctatcg cgctcttccg ccgcgtcggg gcgacatcgg ctgaagatct     30900
     tccccgtgtg gcactcgccg cggccatact ggcccgcgtg agcaaggagc ccgacggccc     30960
     caatgccccc cggtcggtcg cgcgcgttct tgggccgcaa aagacagacg acgtttcaac     31020
     ggccatcctc tcgccgcttc gcttcaagcg cctgctggct gtagacgaac cggaagagca     31080
     gctgatcgcc tttcgccgga tggttgccat agcacgcggg tcccttcctg ttcgtgacct     31140
     ggctgacgcc ctgctggact ggtcggaaac ccgccgccgc cgctgggtgt tcgattactg     31200
     gaacgcaagc gaaatcgcct ccacccctac aaccgatacc cccgaggagc ccgtgtgatg     31260
     acccagtttt tgcaggtcca tctcctgacc ttcttcccgc cttcgaacat gaaccgcgat     31320
     gacactgggc gcccgaaaac cgccatggtc ggcggggcaa tgcgccttcg cctgtcctcc     31380
     caggcgctca agcgcgcctg gcgcacgtcc acgatattct ccgaggccct caaaggatac     31440
     atgggagagc gcacgcagcg cctcggggag gagattctca aaaccctgca ggccgagggg     31500
     gtttccgagg ttcaggcgct cgccgtcgcc cgcgccgttg ccggccagtt cggcaagctg     31560
     aacgaggacg aaacgccggc gcgcatccag cagcttgcgt ttatttcgcc cgatgagcgc     31620
     aaggctgcct tcgacctggc ccggcgatat gctgccggtg agcttcctct tcccgaaaag     31680
     gccaagggca agaggggcaa ggcgaataag accgagggcg aggaagaggt ggaagcgccc     31740
     gaaatcctgc tgctccgcga aagcgatacc gcagccgata ttgccctttt cggccgcatg     31800
     ctggccgaca agccggcctt caaccgtgaa gccgccgcac aggtggcaca tgccatcacc     31860
     acccatcgca tcagcgtgga cgacgactac tacacggctg tcgatgatct gaagcgaccg     31920
     tccgaggacg ccggcgctgg gttcatcgga gagaccggct tcggcagtgg agtcttctac     31980
     acgtacatgt cgatcaatat cgacctcctg atccggaact tgggcggcgg tgatcaggca     32040
     cgagacctgg ctgccaccgc cattgctgct cttgtcgagg cggcagccac caccgcaccg     32100
     agcggcaagc agaacagctt cgccgcccac gggcgggccg gatacatcct cgccgagcgc     32160
     ggaaaggcgc agccgcgaac tcttgcgggt gccttcgcca aacccgtcga agggggcgat     32220
     atcatggacg cgtcgattgg ccggctcgag gaattccggg aagcgatcga caaggcttac     32280
     gggccgacgg ccgatgcgac aaaggtcatg cgtgttggtg gcgagggctc tctggctgac     32340
     atcattgtct tcgcccgcga aggagtgtga ggtgaagcgc ttcctcacgt tcaccctgtt     32400
     cgcccccatc gcctcctttg gcgctattgc cgtgggggag cggcgcgaga gctggtcgcg     32460
     ccccgcacga tcggccgtgc tcggtctcgt gggagcatgt ttgggcattg agcgggaaga     32520
     tgcggaagag caagctgccc tcgagcgtga ctttggcttt gccttgctct gcggcacgtc     32580
     agggggcccg cttgccgatt ttcacacgct ccaggtcggc cgcccagccc gtggtcagac     32640
     gttccgcacg cgggctgagg agcttaactc gaataccgtc gacacgattc tcacacggcg     32700
     tgactaccgt gtgagcgcct ggcatcttgc agcactctgg gtacggtcag tggtggatcc     32760
     ccgctgggcg cttgaggatc tagccgacgc gatgaagcag ccagccttca caccctacct     32820
     cgggcgacgc gcatgcccgc tcggcctccc cctcgcgccg cagatcatcg atgccgacag     32880
     cccggcatcg gccctggaca ggcgatgggc cagtggcccc gaggctgaat tccgtccatc     32940
     gctcgccggc acgatccagg atctgttcgt ggcgcgcgac cgatgggtgg gagacgaggg     33000
     ggcgaacaac ctgctccgca gcgaagagcg gcgggatgcc ccgatctcgc gcaccctatg     33060
     gcaattcggc ctgcgcacag aggtcatcga ggcattttct ccaacggaga accggtcatg     33120
     agtacgatgt ggctgtcaaa ggcgcgcttg aaccacgatc agaaggcggt cgcggccctc     33180
     gcttcggttc tggtgcctga agacggctcg gcccgggttg cggcgacgca tcatctcgtc     33240
     tggtcacttt ttgccggaga cgcggatcgg aagcgcgact tcctgtggcg tgaagagcgt     33300
     ccgggccatt ttcttatcct ctcgcccgac cggccaggcg acgggggcgg gctctgcacg     33360
     gtcgagagca aggaattcac accggcgttg tcggccggcg acaggcttgg cttttccctg     33420
     cgtgcgaacg cggttgtaag ccggggagag cccggctccg gccggggcaa gcgtcatgac     33480
     gtcgtgatgg atgtccttcg tcatcatcct aagggcgagc gtgcatctca tcgcctgggt     33540
     ctggtcaccg aggccggagc ggcctggctt gtccgccagg gtgaacgtca cggtttcgta     33600
     atcgaaggcc agccggcctg cgatggctac gaggcaatcc gggtgttgcg tggaaggggt     33660
     gagaagcctc tgaccttcag ccagattgat ttcgcgggag ttttaagcgt caccgatcca     33720
     gcgcgcttca tcgctgccat tggccatggc ttcgggcggg cgcgggcctt tggctgtggc     33780
     ctcatgctga tccgccgtgt ctgatcaggc gccgggtctg ccgccgccgc gacccattcc     33840
     aattcgtgaa cgctcatcta tcctgtttct cgagcgcgga cagcttgacg taatcgatgg     33900
     gagctttgtt gtcgtcgacc agcgtggcat tcggaccgta attccggtcg gcggcattac     33960
     atgcctgatg ctggagccag gcacacgtgt aagccatgcc gctgtttgcc tagctgcacg     34020
     agcgggcaca ttactcatct gggttggaga ggctggtgtg cgcctctacg ctgccggcca     34080
     gccgggtggt gcgcggtccg accggctact ctatcaggca cgacttgcgc tcgatgatga     34140
     ggctcgtctc cgtgtcgtac gaagaatgta ttctatccgt tttcaggagg agccgcctca     34200
     acgccgctct gtcgatcaac tgcgcggcat tgagggcgtc cgcgtgcggg agctctataa     34260
     gctgatggcc cagcgccatg gcgtctcctg ggccgggcgg cgttacgacc cccagaactg     34320
     gggtggtgct gatcttgtca atcgttgtct atctgctgcg acagctgccc tatacgggat     34380
     ctcggaggcg gcaatcctgg ccgccgggta tgcgccggcg atcggctttt tacatagtgg     34440
     caagccgcaa agctttgttt atgacattgc ggatctcttc aagttcgaaa cggtcgtgcc     34500
     ggaggcattc aaggtagtgg cggcagtgca atctggacgt ggacagattg atgggatggc     34560
     gatcggagaa cctgtcggcg cggtccggcg gcgctgccgc gatgcgttcc gccgcacaaa     34620
     tgtactcgca cgcatcattc ccgctatcga ggatgtgttg gcagccggcg gcttggcagt     34680
     gccagaggcg cccgaagaag cgatgcccgt tgctatacca ccaccggaac cgacgggtga     34740
     tgctggtcat cgtggttgag aacgcgccgc cgcgtttgcg aggccgacta ggtgtctggc     34800
     ttttggaagt tcgagcaggc gtttatgtag gaaactatgg gcgcaaggtt cgcgagatgc     34860
     tttgggaaca ggtccgtggc gccattggtg acggcaatgg cattatcgcc tggacttctc     34920
     caagcgatgc tgggttcgaa ttcgacacct gtggtaagaa ccgccgagtg cctgtcgatc     34980
     tcgatggatt ttgccttgta gcctttacgg aggaggcgga aactgctcct cccttacaca     35040
     caggcgagcc ccgccaccgt cggtagttct ttgacattgt gaattcttta gttaaatcag     35100
     atctttacag gaagagtgtt ccccgcaggc gcggggatga accgccgcct gggaggatat     35160
     ggagcgctgg attgatgtgt tccccgcagg cgcggggatg aaccggcggc ggcgcaatac     35220
     tacgcagcgg tgaaagcgtg ttccccgcag gcgcggggat gaaccgcgaa aatggcgttc     35280
     tgggaggcgc tgacgaatgt gttccccgca ggcgcgggga tgaaccgatg tggtggcaag     35340
     tgacgggccg agtctggaag tgttccccgc aggcgcgggg atgaaccgat gcgcaaggcg     35400
     cgcaagcgca agggcaacag gtgttccccg caggcgcggg gatgaaccgg tcattgatct     35460
     gtcgccagtg gccgtcgtcc ggtgttcccc gcaggcgcgg ggatgaaccg cttcgcgccc     35520
     tgatcgacat gcagcgcgag gtgtgttccc cgcaggcgcg gggatgaacc gatctccttg     35580
     tctatctaaa aactagcaca gaggtgttcc ccgcaggcgc ggggatgaac cgttttttga     35640
     acagccggaa ttgattgaac agttgtgttc cccgcaggcg cggggatgaa ccgcgaatga     35700
     ggaattcgcc gcgttctata cgctcgtgtt ccccgcaggc gcggggatga accgtgtcgc     35760
     aatccggagt cggctcgctc cgccatgtgt tccccgcagg cgcggggatg aaccggggta     35820
     tacgtgctac cggcgggggc tggagtagtg ttccccgcag gcgcggggat gaaccgtggc     35880
     cgatgctcgc gcagaaagtg ggcgtgtggt gttccccgca ggcgcgggga tgaaccgccg     35940
     tcaaatcgat ggagcccggt cactgttgtg tgttccccgc aggcgcgggg atgaaccgta     36000
     aagcgcggcg tccccccgcg ccgcaaaagc gtgttccccg caggcgcggg gatgaaccgg     36060
     agcgcaagca cctggcgtcg gagatttggg cgtgttcccc gcaggcgcgg ggatgaaccg     36120
     ggtggaagat ggtttgtcat tcgcagagcc cagtgttccc cgcaggcgcg gggatgaacc     36180
     gccggaaggg acgggctcgc atgccacggg cacgtgttcc ccgcaggcgc ggggatgaac     36240
     cggcagaggc agcagagagg cgatgcaccg aattgtgttc cccgcaggcg cggggatgaa     36300
     ccggatatcg ttgccagacg gcgcacgctc gcaatgtgtt ccccgcaggc gcggggatga     36360
     accgacagac cagaggaggc aagagagcgc gacagggtgt tccccgcagg cgcggggatg     36420
     aaccgatcgt cgatctaacg acaccgccaa cgatgttgtg ttccccgcag gcgcggggat     36480
     gaaccgggcg ccaacggttg cgtcttgttt ctcgtctagt gttccccgca ggcgcgggga     36540
     tgaaccggcg gacccgctat tactgacctg gctcgatcgg tgttccccgc aggcgcgggg     36600
     atgaaccgcg acgccggacg ctcgcgaaat cgcctttgtg gtgttctccg caggcgcggg     36660
     gatgaaccga cgccggttcg cgggcgcaca gtgcttgtgc agtgttcccc gcaggcgcgg     36720
     ggatgaaccg ctcgccgggc tgtggaagaa agccggcccc tggtgttccc cgcaggcgcg     36780
     gggatgaacc gtcgtgcaga tcgtggttga caatccaggc agcgtgttcc ccgcaggcgc     36840
     ggggatgaac cgccgttcgt ctggatcgta gatcgcgaaa tgacgtgttc cccgcaggcg     36900
     cggggatgaa ccggattgtc aggtaatcgc cgagcgtctg ataaagtgtt ccccgcaggc     36960
     gcggggatga accggcgctt cgagcgccgc cgggccacaa ggttgtgtgt tccccgcagg     37020
     cgcggggatg aaccggtgcg gttctgcacc gggccgaacg tggccgcgtg gtccccgcag     37080
     gcgcggggat gaaccgtcag cgtatcgctc gcggcggcaa cgtgggtagt gttccccgca     37140
     ggcgcgggga tgaaccgttt acgttgtatt gggtgcggcg agacgggcag tgttccccgc     37200
     aggcgcgggg atgaaccgtc ctgggtgagc gagacgggca cactcacggg gtgttccccg     37260
     caggcgcggg gatgaaccat ccggcatcgt ttccgcgccg gcattcacgc cgtgttcccc     37320
     gcaggcgcgg ggatgaaccg cctgacaccg gcgacacggc cctcagccgc tcgtgttccc     37380
     cgcaggcgcg gggatgaacc gaacgtgaca acgcccgtcg cctgcgcggt gaggcgttcc     37440
     ccgcaggcgc ggggatgaac cgacgcgggg gcttcgatag gcttggtaag cttcgtgttc     37500
     cccgcaggcg cggggatgaa ccgtatgacc tgcagtcgct ctacggccga accgcgtttc     37560
     cgcgcagacg atcgcctggg ccggacgcaa gagtggcgga ggcgacgaca agcctgaccc     37620
     gcaacgacac tgccctcagc cgcgacgaca gagccacaca cataattcag tttccgaacc     37680
     gcgtttccca tgcggacgag cgcctcggcc gggcgcacga atgacgcggg cgacgacaag     37740
     cctgaccccg gcgacaagcc cctcagccat accgcccggg ccagctcata atccagatcc     37800
     agaaccgaat ttcccatgcg gacgagcgtc atgattccga gagagcacgc tcgcaaaatt     37860
     cggaattttc aggacggtcg gatcgataaa cgatgtgatc gataatggcg tcgcaaatta     37920
     tgaaataagg tggatattcg acggcttcgt tgtctctggc gtcgatcgca tgctgaacgt     37980
     cgatgcggtg ccaatctatc aattcgtcac tatgactcga gtggtctcgg cgccgtcgaa     38040
     ttgccaggaa attcgaattt atcacgcatc agcgatgcag gcgattgcga aattgcacgg     38100
     caccgaaaaa atcaactact gcgtctgttg gcggaattca ggttacgcct gtcagcaaaa     38160
     tctggatttt tccatgcgac agcgccgttg tgggcgtaaa tcacaggctc attccccata     38220
     cgctcgcggc cgaaatcgtc aataaatcga attgtgggct cgaccgcggc ttcatatgcg     38280
     agttcgtcca cgtcgtcacg aattctgacg atgcgagggc gctttgcgcc tgatccaccg     38340
     ggaatttcga ggataaatac gggatttagc gcatgaaccc ggacttttcc gcttttagat     38400
     cccataaatc gcgagccacg acgctttatg aactgacgcc tggactgggt gacgccctcc     38460
     ggatgttccg cccccggggt gcccatttct tctagcgatc ccgatttacc cgtatccctt     38520
     ttatccaagc actggatgtt acagtcggat gtgggacctg cgtgtatcgt gtgatcaccc     38580
     tgcgcggccc cgttttcccg catttccgcg agtagataac gccctctctc gagctcgtgc     38640
     ctgtggcggt agattgtcat cctggagaca ccggaggcgc gcgcgagctc agacactccg     38700
     atatcctcgg cgaggtggcc gatttcctct gcggcgacgg cgagccggat cagggtcgcc     38760
     tccttgcact tcagcgccgc gtagcgaccc cccgcctgct gcttctcgcg cttggagagc     38820
     gcggcgagat actccggctc ggcggccatg gcgccacgcc ggcgattggc cgatgcgatc     38880
     cgcgcgtcgt accgggtgaa gaagtagcga gcactcttgg cgcactgtct gcgcagctgc     38940
     tcgcagtctt cgaagtactg ctgcgcgccg cgcaggacag catcctcgaa gtcctcgagg     39000
     gcgtggtccg tgccgacgag atttgcccgg tagcgggccg accggcgcgg ggattccgga     39060
     tgaaattcat ggacgagccg tgcgcacagc cggcctacgg tcctgaagac cgcgttcgag     39120
     ccccggcggc catcgcgcag gagcatatcc tcggcagcgc cgaaattcga aaactttcct     39180
     cgatattggc cgagatcgag caggtcggcg agactctcgc aaccgtgcgg atcgaacccg     39240
     agactatacg gctcactgta gacgacagca gtcgtcaatc tctcacagag cgggttcttg     39300
     ccgcgcaggg tgttggtagc gaagcggtcg gctccaagcg gggccaggcg ctcggtcagg     39360
     atcgtgccga tcagcttgaa gagggctttc gccccattcc gcccatttcc tgtaaagcac     39420
     acgctgtgct ttacgacgaa gtagacgtgc ggcctgcgca gcttgccacc gctggtggaa     39480
     accccggtga tgatgttcgg cgcgggaagc ctcagttcgc ggattttctc ctgacattct     39540
     tccgttgaag caaaatccct gtcgagatcg accctgaaca cgccacgcat catgggattg     39600
     aatgtgacat attcgtcgtc gagcgcgagg gccttgctcg ggcacgggaa gatgctcgcc     39660
     ttgtcacgac tcgacgagat tgacggcagt ctgctgcccc gacgcgtgta tcgtcccttg     39720
     cagagcttcg aaacaaacag cttgaggatc ggatcgagac tggatcggaa gccacgcagc     39780
     ttaacgccgt caacgaaagc gccgcacgag atgtcaggct cgagtaccaa gccggctccg     39840
     atgcgctttt ttacctcggc gcggaggtgg cggcgcttct cgatcatctc caccaggtcg     39900
     tcatcatctg gccgatcatg acgacgcgat gccatgatcg catcacgctt caacttgctc     39960
     atggcacggc gggcgcagga gatggccagg gtgtagtcgt gccactcgtc cggcgatatg     40020
     cgccggctcg caacatccgc accggtcgga ccgcgccgcg cggcgctgcc accccggtag     40080
     aaatactcgt tggcaatcgt tcgaccgagc atcctcaggc gcaatcctga gcgacggcgt     40140
     gccggggctg gcctggcaat ctggacgacg gcagacttta ccatcgtcag ctccccggct     40200
     tcgggctgtc gtcgagtgcc tcgacgtaga cccggttggc gttggcgaga ttggcatcga     40260
     cggcgcgctg ggacagctcg atcgcttcca tgacgccggc cggcatcggc tcgggcgccg     40320
     ccgcgaccgc gggagcgtag cgcaggtcgt ggatcagctg gttcatggcg gcggactcgc     40380
     cgagacggcg ataggcgatc acgccgtgca ccgcggacat ggcgcccagc ttcggatggg     40440
     tctccagcac ataggcggcc tggttggcga tcgcctcgga gaggtgcaga tcggcgcgca     40500
     tcgccgcctt gggcagtgct gccgaaatct cgcgggccac tttcggaacg atgccgcggg     40560
     cggcgaggct gtcgaccagg cggccgcgca tcgcctcgac caccgcgtcc atgccgacac     40620
     gcatggcatc ggcaacacgg gtgagctgac gaagggccgc ctgcgggccg cgcggcgaga     40680
     cgggggcgat ctggacgacg gcacgggcga tgtccggcgc gatgccgtcc cggatcaggg     40740
     cggcacgggt gttgcgcgcg tcagtcccgg caagccggcg ggcgatgccg gccggcgcca     40800
     tcgcggcgat cagccaggct gcatcctcgt tctgggtcgg actctcgagg atggcctcgc     40860
     cgatctggtt ggcgccggcg gccgcgacat ggggatcaaa gccggaggtg gccagttccg     40920
     aggcgagccg gtcgcgcgcg gcgaagaagg cgccctcgat gagggggatc cggatctctg     40980
     ccgccacgtc gtgctcctga ccgtcgatca tggtgagggt ccggccatga gcggatcggc     41040
     ctcgaccgcc tcgctctcgt caccgaacag gctgagctgg tcacgcacgg cgacaggctc     41100
     atcccggaga acggtcatat tgggtatagc ttcaaaagtc acggcaattt tgtatagcag     41160
     cgacacttcg tcgacctgcc ggtcggtcag catctccgga tcggagatga gaaggcggac     41220
     gtcatgaagc tgaccttccg cgatggccga gtcgatcgcc ggcgcgaccc attcgcgcca     41280
     gttccgccgc agcatcgcgc gccgccagcg gatcaggccc tgctcgtcgg ggaacagttc     41340
     atagcgcgtc tgggccggag ctccctcgac acgaaggatc ccgagcaaaa ggccaccggt     41400
     tttgcgggcg cgcgcagaca tggggtcagc atacgtgcgc gatgtgtaag caacaggcga     41460
     tagtgcgccc tgcggtgcgc ccggcggcga atacccgttg gtcgattaca ggtggcttga     41520
     ataaacttgg atcaggagga gcttgacgaa gcccttcgcc ccacctgggg gttgaacagt     41580
     tttcttgaat actattcaat tatatactat actaatcaca atgaacggat tggttggcat     41640
     tggcgaggct gctcggatgc tgggtgtgtc gatcacaacc ctgcggcgct gggaggcagc     41700
     aggaaagctg gtcgccgacc acaccgcggg cggccatcgc cgctacgaca tcgcaaaact     41760
     ccggccggat ctattccatg cggaagacga ggccgaccgc cgcaccatcg cctacgcccg     41820
     cgtgtcaagc cacgaccaga aggatgatct ggaacggcag aagcaggtgc tcgaactcta     41880
     ttgtgctcgt cagggctgga aattcgagat tgtcgccgac cttgggtcag gcatgaacta     41940
     ccgcaagaag ggcctcaaga agttgcttgg agccatcatc gacggctcag tgggccgatt     42000
     ggtgatcgct cataaagacc gcctgcttcg attcggggcg gatttggtgt ttgccatctg     42060
     cgaggccaaa aacgtcgagg tggtgatcct caaccaaggt gaggatacga ccttcgagga     42120
     agacctcgcc aaggacgtgc tggagatcat cacagtgttt tcagcgcggc tctatggctc     42180
     acgctcacac aagaaccaga agctgctgga cggtgtgaag cgtgccgtgg aagaatccgc     42240
     ggcatgctga ttgcccaccg catcgccctg gacccgacga acgcacagcg gacctatttt     42300
     gcccgtgcgt ccggtacggc gcgctttgcg tggaattggg ctctggcgga gtggcagcgc     42360
     caattcacag cccgcaaaga tgacccaagt ctccccgcgc cgtcggatgc cagcctgcgg     42420
     cgcaggctga acggcctaaa gcgggaagaa ttcccgtgga tgttcgacgt gacgaaatgc     42480
     gcggcacaag aggccatcat cgacctggga agcgcattcc gtaatttctt cgagaagcgc     42540
     ggtcgctatc ccaggttcaa gaagaagggc gttagtgaca gcttctgcgc cgccaatgag     42600
     gctggcacat tccgcaccga tggcgagaag atcaagctgc cggtagtggg atgggttcgg     42660
     ctgcatgagg ctctgcggtt taccggcaag ctcaagcggg tcaccgtcag ccgtgaggca     42720
     gaccgttggt atgcctcgat catggtggag acaaacgaca tcaagcccgt ggtgcagccc     42780
     cttcccgctg tcggtgtcga tctgggcgtc accaccctgg ccactctgag ccgcggagaa     42840
     gccattcctg gcccgaaggc acataaggcc ctgctccagc gtctgcgtcg cgccagccgg     42900
     gcgctaacgc gcaagcgcaa gggctcatcc aaccggcgta aggccaaggc caaactggcc     42960
     cggctccacg cccgtatctc ggccattcgc aaggatgcca cgcacaaggc cacgacgatg     43020
     ctggccaaga cctatcgtcg catcggcatc gaggctctga acgtgcgcgg catggccaga     43080
     aaccgccacc tcgcccgttc gatcatggat ggcggcttct tcgagtttcg ccgccagctt     43140
     gagtataagg caaaatttta tggtgcggcc gtagtcgtcg cggatcgttg gtttccatca     43200
     agcaagacct gttcttgctg cggttcggtt aaggccgaac tggcgctgtc gcagcgactg     43260
     ttccattgcg atgaatgtgg atatgaggcc gggcgggacc acaacgcggc ccgcaacctt     43320
     gaaaatatgg ccgcgagctt cgcggtgtca gcctgtggag aggatcgctc tgacgcggtg     43380
     cgcaagcccc gcgtgaaacg agcctcgatg aagcaggaac cggacagcaa acttgctgca     43440
     taggtctaat cagctatgcg aagttttgcg taggttctgg agagcggtca tccgtcatgg     43500
     atgcagaaac agcggagatc gccggaagcg aagccgcgga gtctatttcg gaaaatctgg     43560
     ctgatgaccc cgaggacagc ctcgaggtgt ccaccatctt ggatgacctg aagatcgagg     43620
     tctgggaagg cgctctgcag gctcgtccgg aggcggagcc tgagttcaca ttcacctgag     43680
     cctgagccac atcaccgccc gaccatcgcg ccaagcacgt cagcaccagg agcgtattca     43740
     gggggtgggt ttccgcccct cctggacgca cgaataaaat tgaaaacact tttcataaat     43800
     tatattatta tgctgcaaag gagaccgcga tgatcaccca gcttacggga attccccggc     43860
     ggatcggcga ccaggagtgc gtcattgacg tgcatggcgt cggttatggc gtgcacgtgc     43920
     cgtccgcgac gctcgacatg atcgagggcg aggcgggccc ggtcaccatc ctgatccaga     43980
     cccggatgag cgacagcgag atctcgctct acggctttgc gaccccggcg gacctgcaga     44040
     ccttccgcaa gctggtcggc gtccagggcg tcggaccggc gacggcgctg aacctgctct     44100
     cacagctcgc tcccgaggag ctctggcggg ccatccgcga ggcagaccag aaggcgttga     44160
     ccgcggtgaa ggggatcggc ccggccgcgg cgaagcggct gatctccgag ctggagagcc     44220
     acgcagcgaa gttggcggcc gagatgcccg ccccggccgc ccgcctcgat ctcggcctca     44280
     gtgccgatca gctcgcccag tccctgcagc gtctcggcca cgccccctcg gcagcccgcg     44340
     ccgccgcgca gttcgcactc aacggcgcga agcccggtga caccgagcag gaactcgtcg     44400
     cccgcgcact ccaggccgca gccggcatga ccacgggagc ggcggcatga gttccacgat     44460
     cgaacggact ccggtccgga cacccgtcgc gctggaggat gacgacatgt cgccggcgct     44520
     ccgcccgcag gggctcgccg atttcgtggg ccaggcggac acgatgcgga acctggccac     44580
     attcatccgg gcggcgctga tccgcggtgt cagcctcgat cacgtgctgc tgaacggccc     44640
     gcccggcctc ggcaagacga cgatcgccca gatcatcgcc cacgagatga actgcaacct     44700
     gaagacgatc atcgggcccg ccgttcagcg ggcggccgat ctcgccgcgg tgctgacgac     44760
     gatgcagccg aacgaggtgc tgttcatcga cgagattcac cgggtgcagc cggccgccgc     44820
     cgagatccta tacggcgcga tggaggattt cacgctggac atcctgatcg gggaggggcc     44880
     ccaggcccgc agcgtgcgga tcgacctgcc gcgcttcacc ctgatcgggg cgaccacccg     44940
     gtcgggatcg ctgccggcgc cgctgcgcga ccggttcggc attcatcttg ggctggaatt     45000
     ctactcgccc gaggacctcg tgcggatcgt cacccgctcg gccggcatgc tcggtatcgg     45060
     gatgatgccg gagggggcca tggagatcgc ccgccggtcg cgcggcacgc cgcgtattgc     45120
     caaccggctg ctccgccggg tgcacgattt cgccgtggtg gcgggcgtcg tggcgatcac     45180
     ggacacgatc gccgacatgg cgctctcgag cctggcggtc gaccggcgcg gcctcgacaa     45240
     gctggatcgg cgctacatcg actggatcga caccgtccat ggcggcgggc cggtcgggat     45300
     cgacaccctg gctaccggac tgggggaggc ccgcgagacc atcgaggacg tgatcgagcc     45360
     gttcctggtg gcatccggga tcatcacgcg gaccagccgc ggccgggttc tcacccccaa     45420
     ggcttacgag gtggaggcac ggtgatgcag caccgtcgcg accaacggct gatggggacg     45480
     gttgatcagc tcgcgccgct gttcacgacg accgtgcaga acgacatctt tctgatcggc     45540
     atcgacatgg gcgatccagc gcacccggcc ggcgcggcaa tcctgttttc cggcgatgat     45600
     gaattctacg ggcagatctc agacgcgatg ccggcgtcag ccctcagcga cctcgcagtg     45660
     gttttccatg ccgccgacaa gcgcatcgcg acgatgatgc gcagctcggg gcgccgtgcc     45720
     ttgccgcgcg agatgcccga tgggattgcc agccaggatc tcaaggctag ccccggcctg     45780
     gttgcccacc gcccgccctt tgcgattatc cggggcgcaa acgaggcttc gggtacggtg     45840
     ctcgtgcacc tgctgatcca ggcagccggg acggccgagt ggcggaccgc gctcagggtg     45900
     tcgtcggggt ggcttggccg tctggcggga ttggctgaag aggcgagccg gtaccccggt     45960
     caggcgttgg tcgcccagca tcactcgccc ttctgagtgt ggctgccctc gtcaaaacct     46020
     ttaatatgcg gcggcatttg ctcgcatatg caaggatatt cggcacgatc gcttgcctcg     46080
     tcacctttcc gagcctgaat atttgcggag aggatctgaa gccatgcctg tgagcggaga     46140
     gagtgggcac gggccttccg gtcgctggat gcaatcgccg gcggtgacga gcgctccgcc     46200
     cgtgactgga tagccgcgcc gaactccgcc ctcggggccc gcccgattga tcttctcgcc     46260
     tccgtgcagg gactcgtgga tgtcgtcgcc tacctggacg cccgccgcgc ttcgatctga     46320
     ggctcagccc ttcacggggt cggcgtcgcc tccccagccg tgtcggggca gggcggcagg     46380
     tcgctgcgga agttcatgag ctccatgttg tcccggaaat aggcgagaca ggcatcgaag     46440
     ccgcgctcga tcaggggggg catactggcc acggtggtcg ccgttcagaa tgaagaagcg     46500
     ctccatctgg ccgagaacca gggccgttgt gtcgccgcca taaatgccgc ggtcgaagtc     46560
     gttgtacgac acgtagaagc cgttgccatt caggatcagg ttggggccca cgccgcggag     46620
     tgcgggtgcc gcggtcggac tggtcgaacg gctcatgatg ccctccctca acccgggccg     46680
     aaggcgggga attcgagcag ccggccagtc ggctgctcct tttgtgccat cgcttcgaaa     46740
     tcgatgctga atatcggcgc cggcgcgctc ggctcctcgc cgagaagggc accgggttca     46800
     gatccctcgg ggtcggcggg gccgacgcca ccaccccgca cggccggctg atgctgaccg     46860
     tccttggcgg catggttgag ttcgaccggg agtggatcct ggtcctcgac gtacgtatgg     46920
     gccccaagcc gaaactgccc ctttaccagc ggcataaagc cctacgtcgg tgagatatca     46980
     gtctatatcc acatatttaa cgtcactttg aaaaattcta gtcatatcat atatgatatt     47040
     atctaaataa tctctgttta tatatcctga atgataatat atatgattat tcataataat     47100
     aacaatatta ttcatacaaa aataattctc tggggttttt ataatatcat ctacagatat     47160
     aggattatct tttgaaaagt atctaaaata tttgttcttt gtacatagtt ctgaattgtt     47220
     tccaaattta tcaataataa tgatatctgg aattccattt ttgtaaaaat agtttacaat     47280
     ttcaaaaata agatttttgc ttaaaaaatt ttcgtttaca acatagacga tagatgttgt     47340
     taacagccac aattcaattt gttccatcgc aaaaactcct aatttatttc aaaaaatcaa     47400
     cattttgata ttttatcatt tttgcataat taaaactccg ttttccaatt ttttatcata     47460
     aatcaagaaa atttaactat aaatcgccaa aatattatta ttgcatttct tgtcattctc     47520
     ataatttttt aagtgtctca tattatgata gctaaattgt cgttgccatt gttattatat     47580
     tattcggcta ttcttggtca atatcctttg ctatgctatc taattatttc gatccccccc     47640
     caatgccgac agagtgtagc gtgacggacg gatttgcctg cgcgtcccgc cacgcatctt     47700
     tacaggcgcc gtatccggct catttaagag gtgtatttgt tgacggaagc ccacgccgaa     47760
     tgcatcgcgc gccttcactc actgccgtca ccctgctcgc tctcagcgcc ttcacaccgg     47820
     cccgagccgc cgaactctat cacctcaacc agaggaacag caccatccgc ttcagcgtag     47880
     gcacgctcgg cttcttccgc gcccgtggcc atttcgcgca gttcgatgcc accttgctga     47940
     tcgatcccgc acacccgacc agcacgaggg tgagcgtcac catccccacg gcctctgtcg     48000
     tgacaccttg ggcgcaggaa agtgcgatga tccggtctcc ggatttcttc gatgtcgcgc     48060
     gctacggcaa gatccggttt accagcggaa acgtcacggc cacggcaccg ggccactacg     48120
     cggtccatgg gcagctcacg ctgcgggacg tgacgcgacc cgtgatcctc gcggctcacc     48180
     tcgtcaaaac cgcaacggac cccacggccg gtgatacgat cgatgatttc acaattaccg     48240
     gcaccgtccg ccgcaaggcg ttcggcatcg tcgccgaccc ggttttcatc gataacaggg     48300
     tccacatcgt catccacgcc cgcatcctcg tcctggcgtc cgggcatggc tgaagcctgg     48360
     cgtcccgcgc agcgccggct gcactggtgg accgctggcc tcgtcgccac cggcttcgcc     48420
     attgcgtgga tcatggtcgc agtaccactg cgcgatctgc tggtgaagtt cctcctcttc     48480
     cagttgcaca agacgatcgg cttgaccgtc ttcgccctgg ttgtgtggcg cctgggcttg     48540
     cgcaaccgcc acggccgccc agccgaagcg gacgggctgt ccatcgccga gcgtcgcgcc     48600
     gccgcagcgg ggcaggccct gctctatggc ttgctactgg cggtcccggt cctcggctac     48660
     ctgaccgcct gctccgcgcc atcgggcttc ccgaccctgt ttctcggcgt gatcccgatt     48720
     ccctcggtga tcggccctga cccgcatctt ttcgaccttc tggcgcctat ccatcgctgg     48780
     tcggcaatca tcctgatcgc gctcgctgtt ggccacgcgc tgcaagcgat ccgccaccac     48840
     cgccgcggtc gcctcctcct gcgtcagatg tggcgcgcgc cgccccgcta actcgccgac     48900
     gtccttggcc ccgatgcacc tacccccgtg tgaaatcggg gttggcaggc acctgcggcc     48960
     ctcatcacgc cagcttcgtc ggcgcgatca aacccgcgac gatcatcatc gaggtatatg     49020
     cgccgccggc gcgaccgatg cttataggta cggatcgtcc cgattcatca tatgccgtgt     49080
     cttctgcgca agacgataac cgtctaccgg gccggggtct tcgatacagt cgaacgtgtc     49140
     actgggagca agactgctgc cgtcgctgac atacctgccg cggctacgca gatcgtctcg     49200
     ctcaaaccca ggaacagccg gagtaggggg cacagccaac ggttgtgcaa attcgccaaa     49260
     gtcccgccgt ttgaagcaaa aaactctcca tataaatcag ataaatatgg aatatcgcaa     49320
     tattttgtta cgatctgtag atttcgcaaa atgcatccta accaagaatg tgctactatg     49380
     ggttgcataa atgaaagatt ttagatattt agcaatatcg tgggtaagcg tgaaatttgt     49440
     catttcatag ggataatcca aaatgattaa ttcggcagat tcacaaacag agggcaagtc     49500
     gatgtccgag ttcggtcacg atgaaaaaag tatatatatt acggctgtcg aatatttgag     49560
     gcaagctgca gtgcttctgg taagtataaa tcaaacaaaa gatagtttga taatcgataa     49620
     ccttacaaat atcattgaaa atagaccaaa tatatccaga aaatcagctt ctttagccgg     49680
     acgtcggctg cataagaaag tttgatttgg ccacataaac tgtggattta tataattcta     49740
     tatagtttcc atctttttta atcttgtcga tagataattg ctcataacaa tatctatttg     49800
     aaataatttc tgaaaaatat aaataaataa aaatattact atctatatat ttcatgatat     49860
     aaatttattt tttctcattt tttgaaatat attgcttgcc tatccggttg actcccatac     49920
     ctactagatc tagtgttggg catggatgtc ctggcccgtg aagacctgcc gttcccgcag     49980
     tctctgccgg aattccagcg tattttcccg aacgacgcgg cctgtgccgc ctatctcgaa     50040
     agcgcccgct ggaatggagg gttcgcctgc ccaaggtgcg gcgtcgttgg cgagccgttc     50100
     cgtttcgagg cgcgcccggg cgttctgcgc tgccgggcct gtcgcaaaga cgtaagcctg     50160
     atggctggga ccgttatgga acgcagtcac acgccgctgt cgacttggtt ctgggcggct     50220
     tacttgatcg ccagccagac gcccggaatg tcggccgtcc aatttcagcg gcaactcggc     50280
     ctgtcgcgct acgagaccgc cttcggcatc cttcataagc tgcgcgccgg gatggtgcgc     50340
     cccgagcgcg acaagattgg cgacacgccg caagaacacg tcgaagtgga tgaaacgtgg     50400
     gttggaggac gaacccgagg cgatggacgg ggtgtccatc acaaggttct cgtcgcctgt     50460
     gccgtggagg tgcgccaccg gaaaccggga accaagctcg acaatcggaa agacggtcgc     50520
     tacgcgggac gcgttcgtct cgctgttgtc cccgaccgta gcgccaattc gctctgcgga     50580
     ttcgtcgaaa acgccgttgc tcccggatcg ctgatcgtta ccgacgactg gagcggctat     50640
     gccggtctcg gaaggcgcgg gttcgaccac catgcaatcg ccgaatgcgg cgacccggag     50700
     gtggcagaag aattcctgcc gatcgtccac ttggtcttta ccaacctgaa gacctggatc     50760
     aacggcatcc atcacggggt cagcgccaaa catctacaag cctacctcaa tgaattcacg     50820
     tttcggttca accggcgcct ctatcccttc aacgcgttcc gctcgctgct cggaatcgcg     50880
     ggtagggcag ccgcaccaac ctttgacgag ctttattccg gggaatggac acaccctaca     50940
     tttagtgggt gtgggtaaca accggatagg caagatatat tgctctacaa gcctcattgc     51000
     atgtgagtat tttttaaagt ctacaatgcc gttttcatct tttaatataa tccatccact     51060
     tcttttacta ttatggaaat ttggcaccat agcctgccag cgaaagccaa ctttggtcca     51120
     attgagagtg atctcacagc catcagtacg attaaaccgc gaccagccgg atcgcagcca     51180
     gagcttcgtc gcgtcgtttg gaatcggcag gtccagcatt acgggcagct ttcctttctc     51240
     gctcggtatg tagcatattt tccgagcgag ttgcacagcg ccaggccacg cgaagcgtcc     51300
     tctatcttac cgggccgcag cctcagatgc ccgagcctcg atccacacca gaacgctgcc     51360
     ttctcagacc tcatcacctc tttcaaccat ggcccttcat cattcaattc cactcatttg     51420
     tcgcgtggtt cctgccgtcg gactgcaatg agcgtgcgtc taaagcgtgc cgaagatagc     51480
     ctgctcgacc attccccttc acttgataaa gccctaggtc agccttccgt aacagtgcgt     51540
     ctggtccatc accgtcttcc gggaaaagag cgatcccgac agatgcagag atagtaagtt     51600
     cgatggagcc gaacgggatg ggtctgctga ccgcatgtac aacacggtcg gccaattcgt     51660
     gtgcctggtc aggatggtcg acgttggctt ggacgataca aaattcgtcg ccgccaagcc     51720
     gagccacaac gtcgtttcta cgaatggtgt ccgtcagcct tttggcaacg acacacaaga     51780
     tttggtcgcc ggcctgatga ccaaacctat cgttgatcga tttgaagcca tcgaggtcca     51840
     gaagcaagat cgcaaacccc tgcgcattgg cagtggaaac ggtgacagcc tccttaaggc     51900
     gctggttaag atggcttcgg ttggccaggc cggtcagcgt gtcatggagg gcgcggtgcg     51960
     tggcattttt ttcggcttca cgaaaccggg ttacatccat caagacagtg atgacaaatg     52020
     gagtttcgta cccagcctgt tgtaggtgaa tcaatcgctt gtagatcaaa aaaatatgtt     52080
     gctcacccct gccatcggtt aaaatctcct cgtcttcata cggctggccg ctcgaaaata     52140
     tttcatccgt aatcttacgg gaggcgtcga tattcttctt gggaattata aaatcatcag     52200
     tttttctgag aaacgcttcg attgtacaat caaaaaagtt acacataggt ttatttacag     52260
     aaacgaatcg ataatttgaa gctattatga aaattggaat tggtaaataa tttattattt     52320
     tatgaatttg atttttatca acattttcca atacttttgt aatatccatt gtattttacc     52380
     acatttagac gatacttcag aatttattga agtatcactt ttcacgttaa ggctcatatc     52440
     aattcgtaga ccagtttact tttttgtttg ccatttcacg attccaagaa aattctcttc     52500
     ttggaggtta ttacgtgtgg ctattggacg tatctgagct gctagatgac atttgtgtaa     52560
     agaaagatta ccaaatgcac gtgtaaggtc aagagttatc caaaaatcaa ccgtaggttc     52620
     gggctatggg ttcgcgcaaa tgtctgccca acggaccagc gcctgtgcgc tgccggcacc     52680
     cgagagatgg cttccggctg cctgacaaaa cccttgcact catcaatggt tcaaaaaagg     52740
     ccggccgatg ctgagccgta acctggtaat catttagcgg cgtcagcctg taacggctct     52800
     gttcccatcc aggggctcca cgtccatcgg cattacgcca ggcagattca tctgtccgtc     52860
     cctcaaccaa ggccggacac taatcccaaa cggagtaaat tatcctggca ggtcaccatc     52920
     ttgcgtccgt tatggtcgcc cggggttcat gtgagtcgtc ttaccggcgg cgcgatatgg     52980
     tgagggatga gggttgaggt tatccaaaat gtcgatattg tttgtttcga aaggcgaatt     53040
     taagagaaga ttttagtcaa gagaagacgc catgtcgggc attatgccgc ctccattacc     53100
     ttctccctca cagagctttg cctcggctct tcgggcattc cttgacacac tgatcgccgt     53160
     ggcggcttgg cgcggtgaag atttccgtca ggtgtgggtt gttgaatcgg ccaaggcaat     53220
     tcggtcagcc atggagcagg ggccaatatg ggcgacgatg gaagacctta ttcctgacga     53280
     tgatgacctt ctgagcaagg tggcatttga tgtgcttgaa acagaaatgc tttatgtggc     53340
     cttccgttat cgccgcctgt tgcctgaaga gagccgcaag gtcgtcgcga gcgtggaaga     53400
     gcgatttgca ggtgtccagg agggtgatcc gaccgcgccc ggcgctgttg atgacatcga     53460
     gacggtgaaa ggaagcattg agagacaaat caagaaactt ccaaagtggc tgcagcgcgt     53520
     tcttgaagtt ctgatggagc ttctcaagct gacaaagggt atgattcact gatttgcacg     53580
     gcaccgcggc gcagagcgtc gtcgaattta ctaacctaga gcacgttttt ttttcaacgc     53640
     cgggcgactc acggtcggat ttatagccac gatctgatcg gtattgagca gatgcgtccg     53700
     attgtcgctt gcgctatatt gcgcatgata acgtcctcta tcatgcgcga cgttcaaccc     53760
     gcgacgtttc gtgattgaag attttcgaaa atcgaacagc ccctcccggt cctgcgccct     53820
     gtccttagcc gggttggcgc tggcgtattt cgtggggatc gtatgccccg ggccggcgtt     53880
     tctgatggtg agccgggcgg cggcggcggc gtgtttcggc attgcgctgg cgatggcgat     53940
     ggcacggtat gcatcgcttt accgggcgat gcagatcgtc ggcgggctgt atttgatctg     54000
     gctcggggtc ggagcgtcgc gggccaagcc gggttcggcc gagacgggcg cagtttcagc     54060
     gcggccggcg gggctgacgc gcgggatttt gaccggagcg gtgctcaatc tgggcaatct     54120
     gaagatcgtg gtcttcttca ccagtatttt cgtggcgctg ctgccggcct cggcgccgct     54180
     ctgggtgcgg ctggcggcga cggcgatcgt cggcgcgcag gaggcggcct ggtatattct     54240
     ggtggccatg ttgttttcgc ggcctcgggc gcaggtggct tatcggcggg cgggcgtttg     54300
     gatcgagcgg gtggtaggga tggttttgtt cgggatcggg gcggatatcg tcgtcgcgag     54360
     tgtgaaatcg ggcgtgtgag ggcgctcacc ccaggcggag cacggtggca cccgccgcga     54420
     tgatggcgat ggcggtgagg ccgcggcttc ccgggcgttc atgcaggaac caccaggcga     54480
     agagcacgcc gaacagcagg gcggtttcgc gcagggcggc gatggcgccg atcggggcct     54540
     gggtcattgc ccagagggcc agggcgtagg aggcgatgga gcaggcgccg ccgccgaagc     54600
     cgcgcagaag cgggcccggt ttcagggccg cgcgcaggcg ggtggggctg aagcgggcga     54660
     ggatgaggat cgccgggatg gcgggaagca cgaaggtcca tagcgcatag gcgagggggg     54720
     cttcggaaag gcggacgccg acgccatcat tggcggtgta gagggcgatg ataatggcat     54780
     tcgccagggc gagcatcagg gcgcggcctt cccccgcctc gccgcgccgg cgggcgagca     54840
     ggccgacgcc tgccgagatg agcagcaggc cgcaccagcc ggcgccgccg agggtttcgc     54900
     cgaggaagat tgtggcgatc agcgcggtca gcgccggggc ggtgccgcgc attaccggat     54960
     agatgaggct gacggcgccg cgcgcatagg cttcggcgac gaggttgaaa tagacgatgt     55020
     gcagcagtgc cgtcgccagc agatgcggcc aggcggcggc gcggggccgt ggcaggaagg     55080
     gcagcgtggc accggcaatg acggcgccgc ccaggatgag accgattgtc gcgctgcggc     55140
     ggtcggcgcc gccgcgaatg gcgacattcc aggcggcgtg cagcgcggcg cccgccagga     55200
     ccgccgttat cgcccagggc gggatcgtca tggcatgatg atgctccgtt ggttcggagg     55260
     agcatcacca tggaatcggc gcagggtcga gggtttaggc gctggcggca tcgagtgccg     55320
     cgatggcggc cgcgctattg gcgtttctcc aaggcccggt agagggtggc ccggtggacg     55380
     cccagcaagc gggcaacctc ggccacggat ttgccgtccg cctcgatgag ctgacgggca     55440
     tgagcgatct ggtcggtcgc gagagcaggc tgcggcccaa aacgcacacc gcgcgccttg     55500
     gctgcgatcc tgccggtgct ggtgcgttcg acaataaggg accgctcgaa atcggccatg     55560
     ccggcgaaca cggtgagcac catgcggccg gccggcgtcg tggtatcggc ccacggctcg     55620
     gccagtgagc gcaagctggc gccagcctct ttgatacgct cggcaatatc cagcagatcg     55680
     cgcgtggagc gggcaagccg gtccaggcgc gtgaccgtca ccacgtcacc ggcacgcagg     55740
     tgatcgagca ggcgtgccaa ttcttgccgg ccacgctttg ccccgctgac cttctgtaac     55800
     catccgccga atgccgcctg tcgatgatgg agtgatgcgc tcataaatgc gcctgtaagg     55860
     gcgacgctat gagcgggagt ttggatggag atcatcacgg gaattgagcg ccggcgtcgc     55920
     tgacgtgatg aggacaagct acggactgtg gcgcaagcgg aggcgcctgg tgcggtgttt     55980
     gcggaagttg cgcggcggca tgacatatca cgtggtcagc tatggaactg gcgccgtctg     56040
     gtgcgtgctg gcgaattgag tttggcttcg gcacctgcgc aattcctgcc ggttcgtatg     56100
     tcgccggagt tgtcggccgc tgcgatgatt gcggggcctg aggatacgga tcgggcgtct     56160
     gttgcggcgc cgcgcaacca gggtcggctc gaggttcgtc tggctggcgg tacgcgggtg     56220
     gtgatcgagg gcatggtggc gccagcggtg gtcacggcgc cgaggatccg gactggcacc     56280
     gccgtgaaca tctgttccgc gcggcggatg cccgcgccgt cgcggctcgc tgcaacaggc     56340
     tggtcgaccg catgcgggaa gcaggtgttc cgctccgaga aggtgcgccc gaagctcaag     56400
     atgcggttga tccgtcgcct gaaccctgaa atggtgggct attcgcaaaa ggtggcctga     56460
     accaaccagg caatgcacag cacggaggtt ccgtcttggg caccgttcgt gttatgttca     56520
     ggccgcgcag acaatctccc gtggtgccgg ttcgtttgcg acggcgcgct ttttttgaag     56580
     gggtattcga catgtcggcc ctgtcgatgc tgtccggaca tctgagcgtc tcgacggcgg     56640
     cacgggtgag tgctggccag atcgctgtgg ctttggaaac aggtcatttg tcggcgatcg     56700
     gcgacagcca tgcccgcgca ctcgttgccg gcgtcttcag cgagcacgat ccagacctga     56760
     tccttcgcgc cacgtccgag gccggtggaa ccccggctac agccaatgcc ctctacctgg     56820
     agagcctggc ggacggcatg ccctgttgtc ccggatggga gcatctcatg cgtgaaatcc     56880
     tgtgagcggt gccgatatca ggtccttctg cgcaagcggc tcctggaggg aactcgccag     56940
     agtggctgcg gaactggtcg ctggagccga gcgacgggca ggcgtcgaaa tgaagcccct     57000
     gctcggtggc gggacgcgac tgatgctcgc gtatgagcac aggatcagcc acgacatcga     57060
     ccttttcatc catgacgcgc agtggatcgg ctttctgacg cctcggctgc atgatgatgc     57120
     aggcaggttc ccactatacg aagaggcatc gaatttcctg aagatcaaac ttcctgaggg     57180
     tgagatcgac ttcattgtgg ggatgtcttt gctgggcctt gccgatgagt cgtacccagg     57240
     ggtaccgttc gccctggagc cggtcgccga ggtcctggcg aagaagctct tctaccgcgg     57300
     cgcctcactc acggcgcggg atctttatga ttggtgggcg gtgtccagcg ccactcctga     57360
     tgtctttccg gcggcacagg tcgtgtctct ccttggctca aaggtgagcg gcgtcgaaac     57420
     gggtctgaaa aatctatcgc ggtccaaagc cgcgctgggt gtctgggatg cgttgatcac     57480
     cagtgcaaag ccgaaactca cagaggctat cgcgtgggca gaaaaccagc tcatggtggg     57540
     cccaaccttg aatgtcgccc ggacgggccg accatgagcg gaggcgggtc ccgccataga     57600
     taccaaagat cgcgcgggct tctcatcaaa cctgcgtcga agaaatttat gccaaccacc     57660
     ttttgcacat agcaaaatat ttgaataacg tgttctgata ttgtaatctg gcgatgcgcc     57720
     cgcagggtgc gtggcgaatt gaataggggt ggcttcaggt ggccaggctc tggatttttt     57780
     ccgacatcca tgcagagttc cgccggggca aggccccgat cggagggctc acgccaccgg     57840
     agcatgccga tatcgccgtc attgcgggag atgtcgatca cgcgaggcac gcggtggcca     57900
     cgactcgccg cttgatcgga gcccacctgc cgatcgttat ggttgccggc aaccatgagc     57960
     actacggagc gctgcagacc gtgccccggg gaatctcact gatgaagcag gccgcgctcg     58020
     aggacgggaa cacctttgtg ctcgagaacg acgtcgtgga gatccccgtt cgcggagagc     58080
     gagtccggtt tatcggtgcg acgctctggg tggatttcgg gcttttctgc gagcctggac     58140
     gccatgccga atatggccgc cgtggcctgt ccgacttcac cgagatcatc agcgaggacc     58200
     cgtccctgtt cgccatcagg ccggtggaca tgatgcgctg gttctcggcc tcccgcgctt     58260
     tcatcaaacg ggagcttggg aggcggctcg acgggccgac ggtcgttgtc actcatcact     58320
     gcccttcgat ccggtcggtc gcccagcgct acctgaacga cccgatgacg ccgtgcttcg     58380
     cctcaaattg cgacgacttg ctggatcttg gccccgatct ctgggtgcac ggccataccc     58440
     acgacagctt cgattaccag gctggccgga cgcgggtgat ctgcaacccg cacggctatg     58500
     tttatggcgg tgagctcgag aaccggtcat tcaacccggc cctggcgatc gatgtcgggc     58560
     aatcgccatg agtcgcatga cagggcctac caaagcggcg ccccttggcg gcatcctgtt     58620
     ttacggcgat cctcacgggg agtggcgtcc gctggttcgc gcggtcctgg aacaccggcc     58680
     ggccgcggtc gtgatcctcg gcgattgcgg cctggacgtg ccgctgcgcc agaagctcgc     58740
     ctcagtctgg gacctggtcc cgagatggcg ctggatcatc ggcaaccacg acgtcgacag     58800
     catcgccgaa tacgagtttc tggtggagag ccacccggat ggcgacctgg gcgggaaatg     58860
     ggcggagctc gacggggaga tcgtcgcggg tcttggtggc gtctacgcgg caaaggtctg     58920
     gtacccgaaa ttcggtggcg atcatgacga tccgccgaaa ttccggacca ggcaggagat     58980
     gatcaagcag accgcacggg ccgaccggtt caaagggggc gtaccgcggt catcgagggc     59040
     gaccatcttc ccggaagacc atgaggcgct gcggcgtatc agggccgcga ttctggccac     59100
     acacgacgcc ccgacctctc accggcacgg ctttgcagcg atcgacgagc tcgcgcgcga     59160
     gatgggcgcc ggcctcgtcg tccatggtca tcaccaccac agctatgtgg ggcaaacggc     59220
     cgacggcatc cccgtccggg ggctggacat cgccgagccg tggctctgga aggagggtga     59280
     ataaccgcat actggagatg gcctgagcgt cggaatctat ccagataggt gccgttccta     59340
     tttgtattgt atcaaggata ctgtttttgt aatctgacat atgcgctctg aagccaactt     59400
     ccatggcgga gcttgaggaa cgcccgaata gccgttttcg ttgacgatgt ccgccacccg     59460
     ttcggccgca tggtcatgtg ccacatgtgg gcggacacgc tcgatgagct gctcgccatg     59520
     gccgaccgta taggcgttca gaggaagtgg ctgcagcagc cgcccaaggc atcctgggtc     59580
     cacttcgaca taagtctcgg aaagaaggcc caggcaatcg ccgccgatgc gatcctgacc     59640
     gaccggtttg gcccggttga gcacgtggca cgacagcggg gtgatcaggc gaagctcgcg     59700
     acgatcgagg cgatacgcca aagggcctgg cggcaagcag ccaacgtctg atgatctgac     59760
     cgccgtctaa gtcttcgccc ggagacacgt ctaaaccgcc ctaaactccc taaactccct     59820
     aaagtcgcaa aggcaaatca gctcgcagat ggggcgggcc atacgttcct cgtcattcca     59880
     gttctccccc cggcccaaat ctaaaacaga ttccggacca ctcaatggag ggcggtcaca     59940
     ggcgatgagg ttcgatcagc ttgcggccaa tctcaagcgc tgccttctgc agctccgcca     60000
     agaagcgcgg tttcccgttg tcgacgatct gactggtcag gctcgtgatg ctgatcgacc     60060
     ctgcaaaggc gcctgagcga tcgaacaccg ggacaccgat ggcggctagg ccggggacga     60120
     agtcgtcgac agcgagttca tagcctgcag cccggatgcg ttccgccgcc tgcctgagtt     60180
     catccggatc ggtttgactg acgggggtcc gtgccaccaa gggtttgcgg agcgcgcttt     60240
     cgcgctcttc aggggttatg ttggcgagca gaacacgcgg tccggcgcca cagttgagcg     60300
     gcgtgcgtgc accaactccg aaccaagggg catcgatgct gggctgtgca gatcggacac     60360
     gctccgtgca aaccgccatt ccgtcatggt gcacccacaa gaacgtcgtc atgtgacaca     60420
     gctctgcgat gtcgctcagg tatggcgccg cgacctctcg aagctccctc ccggtgtgga     60480
     ctgccgacgc gatctccaaa acgcctacgc tgagggcgta taggccgctt ctctcatcat     60540
     ggtcgaccag acctgcaata atcaacgtct gaagcaggcg ccgcgtcgtg cctttgtcca     60600
     gctcggctgc cttagtgagc tcagtaaggg tctgccttgg cttcgtcaga gaaaaagctc     60660
     tcaatagcgc gatgccgcga tcgagcgcac gcaccagcgg cacgccgggt ttcggcttca     60720
     aatcgcgctc aatgtcctcg gccatagatg atcccgctgc ctaatgaacg cgagccatag     60780
     ccgaaaatcg cggattcaaa aatgtcacgt gatgatacta aatatcatct gttgacacac     60840
     atgaaatgct ttcttaaagt cccgcccaag tcggaagtac cggcaccaaa aatggggatt     60900
     ccatgttcaa tcgacgctcg accgccatag catttctact tgggtggtct tcgacggtcg     60960
     ttcgctctca agagctaaaa aactgccgct cctctcggac gaggtcgtgg ctctgagcgt     61020
     caaaggactg cggaaggttt atcggaagcg cggctttttt ggagtcgagc acgaagtccg     61080
     caccgccgct ggcgtttcct tctcgctgag ccgcggcgag acactgggca tcgtcagtga     61140
     gtcccgatcc ggcaagtcga ccgccgcgcg ctgctgcatg cggtcgatcg agcccaatgg     61200
     tggtcggatc gcgctcggtg atttgattct gtctgtactc agtgcctcgg aagttcgtcg     61260
     gcaacgcaag cacatccaga tggctttccc ggagccattc gcctcgcaca atccacggca     61320
     gattgtcgcc cgcgttattg cgggcgggcc ggtcgcccat agcgtttccc ggcacactac     61380
     gttgcaaaag gcgcgagaga tggtggcgtc ggtcggcctt cccgggcgag cgatcgactg     61440
     ctaccggaac gagctctcag caggccagcg cgtcggcatc gcccgcgcgc ccgcgcttga     61500
     acccgacgtc ctggtggtgg atgagaccgt catagcgctc gacgcctcag tgcgagccca     61560
     aattttgaag ctgattaagg acattcagag ccggcagagc ctcacgatcc tcctcgtcac     61620
     ggatgatctg cgggtcgccg ctgagatttg cgaccgcatc gtcgtgattc accccggcaa     61680
     ggtcgtcgaa gccggggagg cgtttcaatc ttcgccgctt cccaacatga atacacccgt     61740
     gaattgctcg ccgccgtgcc cagcggacgg cgcgtcggca actgaccaac aagaacccta     61800
     gtccggagat caccatcatg tccctcgatc ctgcattgcg cgagaagatc ctagcctccg     61860
     tcgagtccgg tttcgcagag cagatcgcct ttaccgagga gttgatccgc tttgcctcgg     61920
     tgcgcggcgc cgaacatgcg tgccaggatt tcgtcttccg cgcgctgcgg gagcgcggct     61980
     tcgccatgga tcgatttgcg atggatcgtg acgcgatcgc cgcccaccct ggcggcagcc     62040
     cgtggtcgga acagcactcc gatgcgccga tcgtcgttgg catccattat ccccaggagg     62100
     agaaaggtaa gtcgctgatc ctccaggctc atgtcgacgt cgtgccaccc gggcccgcgg     62160
     agatgtggac caacggggcc ttcaacccgg tcgtcgaggg cgactggctc tatggccgcg     62220
     gtggcgccga catgaaggcg ggccatgccg ccaacttctt ctgcctggac gcgttgcggc     62280
     gcattggcct tcagccggct gcgacggtct acgtccagtc ggtggttgag gaggagtcca     62340
     caggcaacgg cgcgctcatg acgcacctgc gcggctacaa ggccgatgcc gtgctcattc     62400
     ccgagccaga ggaagagatg ctggtgcgcg ccaatgtcgg cgtcctttgg ttccgggtcg     62460
     aggtccgcgg ccggccggtg cacgtccgag agatgggcaa cggcgccaac gctatcgacg     62520
     cggcctatcg cgtcatcagt gagctgcgga agctggagca ggaatggaac gacgccaaga     62580
     ccggtcgcga gcacttcgcc gacgtcgaac atcccatcaa cctgaatatc ggcaagatcg     62640
     aaggcggcga ttgggcgtcc tcggtgccgt gctggtgccg gatcgattgc cgcatcggtc     62700
     tctacccagg cgtgaatgcc gccgaagcgt ccaaggagat cagcgaccgc gtggcggcct     62760
     tcgctcgttc cgacgcattc atgggcaaca acccgccgag cgtcacgttc aacggcttcc     62820
     acgccgaggg ctatgtccaa gcccccggga ccgaggcaga agccgttctt gcgcgcgctc     62880
     atgaaggttc gacaggaaag ccgctgcaga gcttcatgac gccgggatat ctcgatacac     62940
     gcgtctacgc gctctacgac aagattccgg ccctctgcta tgggccgatc tccgaaaaca     63000
     tccacggctt cgatgagcgc gtcagtatcg cctcgctgaa gcgcatcacc ggcaccatgg     63060
     cgctttttgt tgccgaatgg tgcggcgtgg agccgatcaa gacatggccc cgatgccatg     63120
     gcggttgagc gggaggtaga gcagatggcg ctttcggatg gcatgagccg ggcggaggta     63180
     gatcgtatcg aggcgaagga cttcgccttg ggcatcggcc cgttgcgccc ccgaaatgcg     63240
     gcgacgttga tcctgctcga cggtcacggc agcacggctc ggatcctgct cgggcgccgt     63300
     catcgcggcc atgcctttat gccggggaag ttcgtcttcc ctggcggccg gaccgatctc     63360
     agtgacggga gggtcgctgt cgccgctccg ctccatccgc aggaggaaag tcgcatcgcc     63420
     ggaagtggct acagggcgac ctcggcgctc gcccaggccg tcgccctctc ggctatacgg     63480
     gaagcctatg aggaggcggg aatgctgctc gggcgggccg aggtgtttca gactgcgatc     63540
     acagcttgga gggacttcgc ggcgcagggg gtgaagcccg ctctcgaccg gcttcggttc     63600
     gtgggccgcg cgatcacgcc cccgggccgg gtgcgccgct tcgacacgcg cttccttgcc     63660
     gcttttcgtc atgatgtggt cgtcgagcta cccggcggcg ggccgagcgg cgaactcgaa     63720
     gagctcgtct ggctgccaat cgatgaggcg aagagggcgg atgtccccgc gatcaccttg     63780
     accatgctcg acgaactgca aagacgtctc gccgacgatc ccgaactcaa gccgggcgtg     63840
     cccgcgccca tctaccgcat gcatcgaagc cgcttcgtcc gtcacttggt ctaaacgacc     63900
     cgacgctgga tccaatccaa gagggatcga gcaatttgac gccaattgac acgatcaacc     63960
     acgcgcacga ccgaatgaac gatcggtacg ttcggaaggg aggtgggttg aagttgtgtc     64020
     atggtatgac acaatagatc aacgattgac accggctcca attcattgga tcgtcagcag     64080
     actggtaaag tgatcgcaat cttccgaatt gtgacaagat gaacagggag ggcgtcagcg     64140
     gtatgtctct cgacaaagag ggcgctagtc gcatcattaa ggccgtagat gcgggcttcc     64200
     aaagacggct tgctctcact gcgggcctaa tccgcttcca gtccactcgc ggcgcagaac     64260
     tcggcgtgca ggactttgtc ttccaagagt tacgagatgg cggagatgcg atggagcgtt     64320
     tcaacatcga taaagacgcc gttgctcgcc atcccgacga cggacgcttc agcgaggaca     64380
     tgctaaagcc cttatcgccg tggcattcat cgtccgcagc aggtggccgg acggtcgctc     64440
     atccttcagg ggcgcgttga tgttgttccg gcaggggcga tcgacgtgag ggcagacccg     64500
     ccattcgagc cggttgtgca cgacggttgg tttttcgggc gaggtagcgc agacatgaag     64560
     gtgggcaaag cggccaacat cttcgcgctg gacgcactac ggcgcgaggg ataccagctg     64620
     gcggcgacca tctacttgca gtccgctgtc gaagaggaat cgaccggcaa tggcgcatta     64680
     atggggcatc ttcgcagtta tagagccgac ggagctctga ttcccgaacc ggaagacgaa     64740
     aagctggtgc gccaatgtcg gcatgctatg gttcgaaatc gagatcaggg gcatgccggc     64800
     gcatgcgcgg gcgatggcgt ccggcaccaa cgcaatcgat acggcgtatc gcctggtcgg     64860
     tcacgtacgg ccgctcgagg ccgagtggaa cgcgcgcacg gacgaacacc ggcatttcga     64920
     ggacgaggcg catccgatca atctaaatct cagcaagatc gagggcaggg actggacttc     64980
     gtcggtgccg agctggtgcc ggggagcgcg gcggaggaca tgctcgcgga atcgcatcac     65040
     gacgcgacag gcgagaggct ggagagcttc atgagcgcgg ggtatctcga tgcccgggcc     65100
     tacgctctct acgaccgcat accgaccctc tgctacgggc cgatatcgcg agacattcac     65160
     ggcatagacg aggcggtcag tctcgcatcc ctgaaacgca tcaccacggc tatggctttg     65220
     ttcattgccc gatggcccgg gctggagacg gctgcccaac tccggcgcgg catcgtgtgc     65280
     tcaacaggaa aacgggaagg ctcatgaacg acaaggaact tgcacggtcg atgccaggct     65340
     tcatcaagct ctggtttctg ctcgacttca ttctttgctg cacgccgccg atctatcttg     65400
     cgttcagcgg gcgcggggcg acgcccgggc tgccgttctc gatcatctat ttcgtgttct     65460
     gcggcgcgtt cgtcacgctc agcatcctcg ccgccgaacg cgtgaaagcc tgaggtccgg     65520
     cgcatgctca tcacattcgg ggggctcgcc ctctttttcg caatcatcgt catctacctg     65580
     cagatctcgt tccggcgcga ccgcgatttc ggcgattatg ccgtcgccgg tcgctcgttc     65640
     ggcgcgttct tccagtcgat gtcgttcctt aacacctggt atccgggggc gatcttcatc     65700
     gcgttcggcg gcctcgcggc cacggccggc gtgatcagct tctacctgct gatgtacagc     65760
     ctgctgacca tcgtcgtgat gtacgtgatc tcgaaccggg tctggctctg gggcaaggag     65820
     ttcaacctct atacccagcc cgacctgttc gcgctgcgct atgacagcaa gaacctgcgg     65880
     ctgatgatcg gcgtcatcgg catcgtgtcg cagtttccgt ggatcatcct cggcatgaag     65940
     gcgctgggga tgatgttcta ctacatggcg ctgaagaaga tcgatttcga cgtggcggtg     66000
     attctcggcg tcatactcat ggtgatccgc cagttctgga cggtgcaaat gggcatgcgc     66060
     ggcgtggtga tctcggacat gctgcagggc gtggtctcgt atatcggcgg cagcctgctg     66120
     ctaatcgggc tgatcggctg gctgatgatc gatcgccatg cctccttcgc cgccctgccg     66180
     gaccatctgt tcgaaattcc cggcttcggc tcgaagcagg ggcccctcta cgtgttcgcg     66240
     ctgatcttca caagcgcgct gggcggctgg tgctggccgg ggattttcgt gcggctgttc     66300
     acggcggaca gtgtcggcgc gatgaagaag gcggcggcga tctcggcgcc gatctcgctg     66360
     atcttcggcg cggcggtgct gatcctcgcg atgcttgcct ccacgattcc cgcggtggcg     66420
     aaggcgccgg acgcggtgtg gttcatcgtt aaccagcagg cgggcgggct ggtgctgctc     66480
     tcgattgccg ggatcatcat cctggcctca acgatgggca atatcgacgg taacatccag     66540
     tccaccgggg cgcagatcgc caatgacatc atcggagatt tcacgaatct cgacgagaag     66600
     cagaaggtgc tagccgccaa gatcggcatg gtggcgatca ccttgctggg ggcctggatc     66660
     gccacgatga agattccgca gctcttcaac gtcgcggtca tcggatacca gggcatcatc     66720
     cagctcgcag tgccgcaatt cctcggtatc ttctggctgc gcggcaaccg ggccggtgcc     66780
     tatgctggca cgatcgtcgg cttcgtgctc gcggtggtgc tgacgctgca ctacccggct     66840
     tatgtaggac cgctctgggg gctcacctcg ggcttcgtcg cccttgccgt caatttcgcg     66900
     gtttatgtcg cctgcgccta catctttccg cacacgccgg aagaggagcg gcgcgtgcga     66960
     ggtctctttg gggatgtggc cggccaggat gtaagcgttg cggctaacgt gagatagact     67020
     gggaaataat agcaaaagca gtggtgtgcg cgcatttggt ggaacgtagg cccgccccac     67080
     tgcaagctgt tttgacctat cgggcactga gcagtctgcg tgaacctatc cggcctcgga     67140
     gcaagggcag tgtcaggtat tccgcgtatg ggtggtggtt gaacgtcagg ccgccaaagc     67200
     tcttacgatg tgatcgccaa agacgacggc gaaatgcgcc tttgccatag cccattctcg     67260
     aggcggcatc acccactctt tgtcagagcg gttcaggatc agatagagca gctttggttt     67320
     cgcccgtctg cccgtccccc cgatccgtcc gccgcgcaga gcctcgagag cttccgacgc     67380
     ttcacggccg cgagcgaggc tggcgacctg gtggcggtaa ggagcgagag cggcggccag     67440
     gtccggttct ggctgacgaa catcgacggg ctttcccgcg cgcgcggcct cctcttcacc     67500
     gaggactggc cggaattcgg cgaccatgcc tggctgctcg cgaccggacg gaacgccttc     67560
     tgcccggacg gccaggaccg gctggtcatc ccgaccgcag cggtcatccg cttcatcgag     67620
     gagttcccgc acggcgtcgc gatcgatgcg tcatcgagca gggccgcgct cctttcgccc     67680
     gacatggcct ccggctaggt tgggccatgg ccagatcgcg ctcccgtcgc cgccgttcag     67740
     gatccgagcc gttcgcggcc cttgccggcc ttgtcgccct ggcgatggcc ggcaaggtgc     67800
     ttgctgccat tcagcatgat ggtgagcagt ttggtgccgt tctccggggg ctcgaactgc     67860
     ccgccatggt cgcgctgctc atcatcgtcg gcctgctcgt gctggcattc cagatccgcc     67920
     ggcgccggcg gcgcgcctac cgcgaggcga tgctgcgcat cggcggcagt gacccgctct     67980
     cgctatcgcc ggtccagtac gagcatttct gtgccttcct gctcgagcac tatggctgga     68040
     agaccgagac gacccgggcg tccggggatt tcggggccga catcatcgcc cgccgcggcg     68100
     gcgaggtcat ggtcgtccag tgcaagcgct acgcccagcc ggtcggcgtg aaggcggtgc     68160
     aggaggccca tagcgccgcg tcgttctacg gcgcgggtcg caccgcggtc atggcctgcc     68220
     gcggattcac gcgcgccgcg cacgcactcg ccggcaagac ggggacgacc ctggtccagg     68280
     tgggcgagaa cgacgccgcc gcgtttcgct gagcgcccgg atcagggcgc cggttcggcc     68340
     ggcgggtcat cggccgggtc tccattctgg tctgagggtg cagaagaggt gggcagccca     68400
     gcttctggat tgcacggcgt acgtcgcgaa ggcggcggta tgatgttgtc gatatccggc     68460
     acgctcatgg cctcctctgt aatctgcgca tcgtcgctgt gcgcttccgg ctccctgatt     68520
     tcgatgccga gatgccgcat caggttcagg gccagatcga ggtggatgtt cagccggccg     68580
     cgctcaagtt cggatattgt tgcctggcgt gttccaacca tggccgccag gtcggcttga     68640
     cggacaccga aagagatgcg gactttccgg atcagctgcc cgaagtggat cagtagatct     68700
     gcagagctct cttggtcgat catcgcgcag cctccatctc acggctgaaa atacgtcgag     68760
     acgtatatga tatgatatac gtctcgacgt atatgcaatc acaagcgccg ggatgcttgt     68820
     gatccgaaat ccccgcaatc agaaccccgg tattggcccg tcatcctccc ggtcgtcgta     68880
     gtggacatgc tggtctgcct tctccatcca cgcggacacg gcggcttcga cggccggccc     68940
     ggccgccttc gccaggcggc ccagccgctc ccggtccagt gtttcgaggt cgatgtcgtg     69000
     gatcggcggg aggagcatgt cggatcgggg cgagctgccg aggtagatcc agtcgatgag     69060
     cgccttctcg ggcgttgcga tcggcatgcg tccggggaat ggccggttga gggcctccag     69120
     acggtcctct tcctcaccag ccgcgagcac cgcggcgggg atccccttga agacgaacac     69180
     gccggcctcg gtcgcgcggt gcccaagggt tggcggcgga tggccggtcc tgagcggcac     69240
     gaccgcggtg acataggcgg aggggttgtt caggatgccg tgcgcgccga ggacgcgctg     69300
     cagagacacg atggcccccg gctcgaggtg ttcggccgcc tcgtccggcc cggccgccgg     69360
     ggatgcctcg cggttcaggt agagccggcg gttgactggc cagatgcacc gggcatccgc     69420
     aaggtcgccc acgagccggc ggtatccgct cgtcgacagc atgatgccac cacccgcgaa     69480
     gagatcttcg agcccgcggc gcgtgatgac gcgcggaacc ccgagccccc ggaggagctc     69540
     gatcgcgcgg atgaccgtgc tcatggtgtc gggcctggct cctggttatc cggccggcga     69600
     tcggggctcc ggtctccgtc ggccagccat ttctcgacgg cgagcgcgac ccggaccttc     69660
     atctcctcga acgcatcccg gtccaacgcc tccgccacgc cggccggcag ggtcggcagc     69720
     acctcctcgc ggaagagctt ccagctcatg gtgtccagct tatcgaacag cgcctgccgg     69780
     gcacgctcgg tgcgcaggtg atcgatcatg tgcggcggtg gctccgcccg catggtgatg     69840
     aggatgtcga ggtcccacag gtcacgcggc gccagccggt tctcgctgag cagcgcgatt     69900
     gtcttggctc cggccatggc atccgcggaa taggtgtcga ccatcacgag ggcgccgccg     69960
     atttcggccg gtggctgcat ctccatcctg gtcaggcaat catcccccgg catcggccgg     70020
     cgcgacactt cgatggtgag cgcgacctga gaacctccga cagtccggcc gccgatcttc     70080
     caccgcgcca cggtgtcggt ttgcttcggc tcgctgatcc ggacgtcttc gagaatgccc     70140
     gtggctacgg cgttgcggat ggccgaccgg atcagcgtct gggtgcgcgc caggttggcc     70200
     cgccgcgcat cgtgctgcag gtcgatgtcc ttggtgtgcc gtgcgctccc gaacagcgcg     70260
     cgcatggcaa atccaccttt cagcgcgatc tcccgctcgg tcgatttcac gaatatgctc     70320
     cgcacaacct cgtattgaag cagttcccgc gcgacgtcgg catcgttcgg ggtacccctg     70380
     attaagctgg aaacagtcat tttatgcccc ttttcagctt aatcaaccga ggctacggcc     70440
     gaggctggtg gagcggcgat ggggcgaacg cggcgggtca gcccgatccg gacagcaccg     70500
     tgcaggcggc gatcgatccg gatcagcttt ttcaggagcc agatttcggc cggcgcgagc     70560
     cagcccgatc gtctcagggt cacggtagcc tccgctcgtt gttccgattc tggtgggcgc     70620
     gatgtgaaac caacaagctg cgggatgccg gaccgctgcc gtcgcccgtc cggtttctat     70680
     gtcagccgct cgaagcgata gccggcggcg tggtattcgc tggggttggc ggtggtcagg     70740
     tagcggtcgt tccagtcggc cccaccagca cgcgcgatat cgactggtcc gttgatcctg     70800
     acggcgagcc ggcccgcccg cgcccggatg gcctgatcgc ttggcgcctg gacgaaagtt     70860
     ctgtcctcgg ggcccatcgc ctcattcgga aaggcgcgca actcgaattg cagcatgatg     70920
     tgctccagag cctaccgcag tggtcgccgg cggcgattga atgcctgata tagcaataca     70980
     accccagaca tatcagttca ataaaattga gaggtgcagc caccgcccga cagagcggat     71040
     cgactcgccg agacagcagc ttcggggcgc cggcatttcg ggcgttcgga cccggggcgc     71100
     ggtctccgcc tgaatcaggg ggcggacgga gcctcgaccg gatcgcccac cgcccgcgtc     71160
     tctgccgtcg ccgagcggtc attcctggct ggctgatgtt gcaaaacctc gagatagatc     71220
     cccgcggcgc gcttgaaggc cctgtgttgc agacgccccg cttcgtcaac cgtcaccgcg     71280
     cgctggatcc tggccgcggc gacgacgaaa cgcccgaccg actccatgaa ctctgtcagg     71340
     ccaggctctc gtgcctgagc ggcgatcgac agcgcccgaa atgccaacct ttcgcgagga     71400
     gtcggatttt cgcagtgtgt ccagagcttt ccggagattg cggcgcacgc cgccccctcg     71460
     caagcgatcc tgtcccgatc acctgtcccg agcgcggcct ccatgtcgag aagggctccc     71520
     cggacaagcc agtcctcctg ccggcagatc ggcagcaaaa gagaacggat gacctgggcg     71580
     gcgaccttgc gagcaacagc ctgatccgat ctgccgccgg gatccctttc ctggatccga     71640
     cggatgaagg attcggcatc gccgggggcg gcgttcattc ctctgaacaa ggcgcttgcg     71700
     gcggccccga tgcgcattgc ctgccggtcg tcccgcccgc cgattatctg gccgagattc     71760
     atcgtggcac tccttcaaat gcttcacgta gcttgttgac caaccgcgta accaacaagc     71820
     cggccacggg actccccggg gcagaggcat tcgcttgaaa gtgctctcga tgtcttgatt     71880
     cgagattaag atcggcgcgc cttcagggcg ccggcatgtc atccaccgca tcatccgagc     71940
     ggacagcatc aaggaatttg gcctgagtag cagctgccgg catctggaac aggcgcggga     72000
     agacgagatc tgcctcctcc agcggaaagc ctatcgtgaa gggggccgat cgaccttcgg     72060
     attcaaggag gccctgctca accagcggcg tgacgatgcg gcgcgcgtgc cgttcggaca     72120
     cgccaagcaa ggtctcgact tcccccttcg gcacatgccc acgcagatag gccagctcga     72180
     gaatggcgaa cgcccgggga tcgaggcgcc cggcctcggc ctcatgctgg acgaacagcc     72240
     tgagccgcgg aagcagggtg tccggagcca gcatgtcacg catgaaccgg acctgatcga     72300
     gagcagtctc gaggaaatac gcgcagaact ccgcgaggcc agacgcggat agcgtgccgc     72360
     ggccatcggt gcccccctgt ggcggatagt cggcccgcgc cagcttggag cggtaatcac     72420
     cgagcgtcct ggctaggccc cgcgacaccg accagagatc cgctcccttc gtgaagcgcc     72480
     tgaaccaggc atgggtgtag aggcgcgcgg tgcggccatt cccgtcgagg aagggatgga     72540
     tccaggccag ccggtgatgt gaggccgctg cggcgatcag ggagaaggcg ggtccgacgc     72600
     ctctatagcc ggcctcgaaa tgtgccatga acccaggcac catctccggc gcgaccgcct     72660
     cgtgacgtcc caccaccaca tacaggttcc ggaactcgcc cggcacgacg cggtgccgaa     72720
     ctccgttcag ctccactgac ctgaacgatt ccggcatgtg caggtagaag tccttgtgga     72780
     tcgacctgat caactccgtg ccgagaccaa ggcgatcata ggctccatca tcgatccgtt     72840
     cctggacctt gatgtgcgca cgcgcctcca cctgcttgtc ccggacggcc ggatcagacg     72900
     agtaattctc cgacagtgcg cgctggatgt ctttcgggcg cgcctcacgc ccctcgatca     72960
     ggttgctgta gtagcagtcc atcgcccgaa cgagccgcgc gatggcgcgt cttgtcggag     73020
     cccgcatcat cccgccaagc tccgccgact ccgccgcgag gctgaaggac aggtcgagca     73080
     ggtggccata acctgcgcgc ccctcttccg gcatcaaggt cagggaacca ggaaattcac     73140
     gcatcttttt gacccataat atgtccggtc tattgtccaa gactggatat cataattccc     73200
     tgcatattac tattatattt tattttttgg aataaattcg gccgctaaga tgtccgaact     73260
     tttgaccgca acagacactc gatttcggac gctcactggc caggcgccgg catgtcgtcc     73320
     acctcgggtc gaatctccgg ctgtccgtgc acccggaccg tccgcccgac cggtacgtcg     73380
     ccaaccccca tgcggatatg tggccggcgc cagaagatcg tcccgccacg atggaccaga     73440
     tggccgcgca cccagtgcgt cgcgcgcgga cgtgccgcac cacctgcggc cacccgccgg     73500
     cgctcggcac gctcctccgg cgagacgttc atcgacacga cctggtgatc gagcagggga     73560
     ctccggcctg acttcagccg ggccttgttg agccgggtgc ggtcgaccgg ggccgtgcgc     73620
     accgcctgcc gggcattcat catcgccgcg gcggggacca gcatgcagta ctccgaccag     73680
     atgtccgcga cggcgttcga gacgaattcg accggattgt agtggcccag atgagtaatg     73740
     agcttggcga ccccggaatt gctccagtcc atcatcatcg tggctcgaat ccggtcgagg     73800
     tagcgagctc gccctggttc aagctcattg ttgaacccga tctccgggat gggaatcccg     73860
     gttgcacgct cgagggaagc ggctccgacc atgacccgag cgtcgagatc ctgccggtcg     73920
     aggtcgaagt ggaccgtggg caggttcgac atcaccatgc cgtcgtagtt gcttgtcagg     73980
     ccgcccttgc cgtcggactc cggcaccggc cagagcacgg aaatctcgcc tctccgaccg     74040
     ccttcgtcgg tctcgacgat gaagccgacc cgcttcggca tgaaattgtc atcctgaacc     74100
     cgctggcgga catgcgcccg ccgccaggta tcccgggcaa aatcgtcatc ccactcgaac     74160
     caggcgcacc gccacggaat ccggatcgca tcgatgcagc cggtgagcgc ctcggggtag     74220
     tcgatcgagc tggtgatcaa cgcctccgtc acgtcgttgg ccaggatgaa gcgcggcgcc     74280
     gagggcagcg tgtccgcgac cgagacgatc cgctggatcg aggaagtcgc cgcttgcagc     74340
     gctcccggga cagcgaggat cctgtttctc atcgcgacga cctgatcaca cagaagcatt     74400
     cgacatctcc cgaccatact cgatagagcg gcgcgctcac cgcacttaca atacaatttt     74460
     ggtgaggaat tatgaagttt catcttcgtt ttttgcacat tcagaatgta ttctggccgg     74520
     gaaacccgga gatgaatcaa tgagcggtca aagtcagtcc ggccagtccg gccaaaccag     74580
     ccaggcccgc ccggaagcgg ccgatcgcga gcactatgtg tggcaccaca tgcggcagcc     74640
     gaacggcttc acctgcggat cgacctgcgt gcgcatgctt tccagcatcc tccttgctgg     74700
     cgagcccgat ccgccgcgcc tccatcccga ggtcatcgcc ggcatgatgg ggaccagccc     74760
     ccggaccggg acgacagaga tcgagatgaa gcgcggcctc gatctctatg gcatcccgca     74820
     cgagcggatg ccgccgaccg cagacggtgc ggggccgggc cggatggaag acctgatcgg     74880
     ctggctgaag gccggcaaca tggccatgct taggtgcctc ttcttcggca tgaagcactg     74940
     gatcctcgcg acccacgcgg acgctcgggg aatccatgtc ctcgatccag ccgcccagag     75000
     tcccggcatc ctctcccccg accgcgtcgc ctcgctcatc cagccgcgtg ggtgggagtt     75060
     ctggaagatc ccggccaacg cgccctgccg ggagttgcat ttcggccggc tgccaagacc     75120
     cggcattgcg accgaggtga tgcaggacgc ggtcgtgggg ctcctcctcg atcatggcga     75180
     cctcgatcgg cggatgatcc cgcccgaggc agccggctgg ctcgtcgggc agcttatgcg     75240
     ctccgaacgg agctatggcc tgtgggacgg caaccggctc ctggctaccc acatcgccag     75300
     cggctgccag ccgtggaagg tcctcgagga tgccggcttc acggtcgacg aggcgaccat     75360
     ggagcgtctt cgcgcccagc tcgcccgcct gcccggcgcg gtctaccatt cgctcgccac     75420
     cgcagtgcat ccggacgtcg aggaaaatgg cggccgatgg ctggtcgatg ccgcgccagg     75480
     gctcttcggc tttgccggcg tccacggcat tgagcgcgcc gatgaggcag ccggggggag     75540
     ggctggcgac acgcttttgg agctccgcca tgacgagatg cgatacttcg tccgggaggc     75600
     gccgaatttc gacggagtgg ccgctcttga agaggttgtg acgggcccga cacgcgggcc     75660
     gtccgatgaa gatgcgcagg ggcccgggcc atctccgggg tgagaaggcg cgcaggccct     75720
     ccggcctgtc ccctcatgca gtcgcagccg aggcgtctac gcctccggtg atggcgatcc     75780
     gcgtggccga tcaagcccgt agcgcctgcg catcaggcca gcatcgatca tgacatcggc     75840
     cagccggtca tgatagccga gatcagcgcc gatccggcac ccgagctcat agccgctgat     75900
     ggccgcagcc aggccgcccg gagagtagag gtgcgctcca tgcccgtcat catcctccag     75960
     catcctggaa tagagggaga gttcggcgcc gagacccagg ccccgccacg gaggagcgac     76020
     gaaaatcatg ccgtaacctg aaacggcgac gacgcccccc tcgtttaagc ggcatgcaat     76080
     gaagggtgcc cctgtctcgg tgtcacgagc atcggtgagg cagatggaaa tcccctccgc     76140
     cccgcaggca tccgacgaga gaaccttcgc atcttccacc tgccgtaaaa ggggccgcag     76200
     catccgctcc gcagaggccg cgtgcgcctc gccaatttcg agccgtgaga gactcccgtg     76260
     cctacccagc agaaatgcag gggcaccagt ctgccacggg ccccgccctg acgctgccac     76320
     cgcggcgatg gcacgggcga ggtgcggccg ggcgaaagcc ggggtcacgg ctgcggctcg     76380
     ggccccggct ccggcgtgac ctcgtcaaga tgtccgatct cctggctggc ctcgtcaatg     76440
     aactgcgcca tcaggctgtc cgtgctgccg cggaagatcg acttcggcgt gaccagcatc     76500
     gcgctgccgc cagtggcctg cggctcaggc ttgctgcagg tccaggccgc cgtgacccgg     76560
     atcatctgct ggggcatgcg cgcggagatg tcctgcagca ccgacagcca cgcgtcctcg     76620
     tcgatatcga ccgtgaccat gtcatcgtcg ccgctgcccc cagccgccgc ggcttccagt     76680
     ggagcggcga gggtgcggcc gacaccggtg gccctgtccg gaaggttctc gaatgccttg     76740
     cgcaactccg agagacgcat ctccaggaaa cccccggccg tctcgctggc aaacagatga     76800
     atcaactcac cgtccggctg tgcatcctga aaggcggcgc ccaggatctc gcgctccaac     76860
     gtggaaagca aagccagcgg cagcggctca tgaacggcga cggtgctgta atagttgggc     76920
     atgatgggtc tccggtggct ttttcatgct atagaaaata acggctattt ttcaatgtct     76980
     gattgatttt tgtcggcccg ccgcccataa tgcccgacac ccggttctcc tgcgctggag     77040
     aggtgccaag caatgccgtt cgccatccct cacgagcccc tcagccgggg ctggctcccc     77100
     ttcgagcatg tcagcgggga ggaggccatc acacatgaga ccgtggccga ggcgcaggcg     77160
     gcatgatgag gagcgacaag ccccgcgtct atctcgccgg ccctgacgtc ttccgggccg     77220
     attccgacac ccatggtgcg cacctcatcc agctctgcgc cgcgcacggc gtgacgggcg     77280
     tctacccggc ggacaatgat atggtcgccg gcatcgacac gatgctgcgc gccggccagc     77340
     caccttcaga ggtcgcgcgg gcgatctttc gagcgaatgc cgatcgcctc cgcacctgcg     77400
     acgcggtgct tgcgaacatc gaccccttcc gcagcccggg cgcggataac ggcacagcgt     77460
     gggagatggg gatggcctat ggcctcggcc tcccggtctt cgcgtacacc tcagacctga     77520
     ggacgacccg cgagaagatc tcgaactggc attgcgcacc attctcggtg caggacggca     77580
     tcacccggga ccgcgatggc atgatggtcg aggatttcgg cgaggtcgac aacctgatgc     77640
     tcacctgctc ggtcgtcggc gagcgcgttc accccgactt cctctccgcg ctccgcgcgg     77700
     cagccgccca tctcgcctga cacagatcac cacatgttct catcttgttc tggatatgcg     77760
     caatatattg tgggcaacgg gcgcgcgcgg ggaccttgct ctgctctttg cgaactgcca     77820
     tcgaatggtg catgctaagc gtccgtggtt ggcactcaac gaactaaagg cgttgtccag     77880
     gcattcgcgt gagggggaac tttcaactcc gtacggcgat tagcacctga tttgttcgat     77940
     ttaacgacgc caattcgata ttggcataga gcactcggta atctatgttc ggaatattga     78000
     gagggccgcc agcctctccc gggagcttat atcttttgac ctttgcgcat ggagtttaac     78060
     ctaagatggg cgctggatcc ccgaaaattt tgagtctggc cgcggccctt gcggcaatta     78120
     cggctgttat tccgggcgct gtcgcgggac ccaagtcgaa tacattgccc agcgacaacg     78180
     caaatgacgt gaatccggga gtacaaaccg gcgaaccgaa taccttcgtc tcggtcggac     78240
     aggatcttct cagcttcact gttgatcgtg ctcctgacgg tcgtattgtc atggcagaac     78300
     attattctca ctcgtcgcat agctcacacg catcgcatta ctcaagcagc tattgaagtg     78360
     cccgacgtaa ttgtcgcgtt tagcacgtcg acacaggagt tgggtcccct ccaagaagcc     78420
     gcctaccgac taattggaat tgcttcctgc aagatagagc aagacgctgg gctttataaa     78480
     tgccatttaa tatccccgcc tgacacgacg tacgacagtg aattcattcg tcgaaggttc     78540
     ttggaccttg tcactgacga aaatcttcgg gctaagatct cgcgggagac agagcctgtt     78600
     cgcaatttga tcttggcgct cgcattcggc gctatagccg attcaaagaa atcaggacaa     78660
     aagtaggtag agaaatattg tggctagttt tctcaagcct gaagcctttg aaccagatcc     78720
     gcgggcaatg cggcttctgc cgtttcggtt tgaacgtatc tcggatgacg ttgttataat     78780
     ttcgaatttt gttggcgagc ttatgtttgc cacagataat gaaatgagtc ggttagtttc     78840
     actcgatcta aagccgggag atggactgtt cgagcgtgct agggaaaaat tacttgtttc     78900
     tgttgggagc gaacgggcgc ccctcgaact ccttgcccta cgcctccgga gtcgcttggc     78960
     ttttcttcgt aaccccacgc ccctacacat ctttgtcgtg acattgcgtt gcgagcactc     79020
     gtgcccgtac tgccaggtct cgcgtcagag ttccgatcga aaccagtttg acatgtcgga     79080
     tgaaaccgcg atgcgagcga tcgacgtggc tatgtcgacg ccaggcgaca gcctcaagat     79140
     agaattccaa ggaggggaac ccttactcaa tttcgatctt attcagcgag tagtagacgt     79200
     ggcgagcaag gaggccgtca gcctcggcaa aagcgtgcaa ttcgtgattg cgtcgaacct     79260
     tgcgatgcta gacgatgaca tcctcgactt ttgcaagcag cggtcggttc taatttcaac     79320
     ttcactcgat ggtcccgcgg atctacacaa tcggaatcgt ccccgccccg gcgggaatag     79380
     ccatgagctt gccgtgcgta acatccagcg agcacagggc gtgctcggac gggaccgagt     79440
     tggcgcgctg atgacaacga ctgaagcaag cttggatcgt gctgaagaga taatcgatga     79500
     gtatttggca ctcggactag agggaatatt tttgcgccca ctttccccgt atggatttgc     79560
     tatgaaaacc cggcagttct ccaaatatga cggcgaggct tggtttcgat tttatgtgcg     79620
     tgggctaaaa tacatcctcg aaatcaataa atcgggccgc cgctttccag agttttatgc     79680
     gtcgctgctc ttgcgacgta tgcttactga ccgcgcagat ggctacgtcg atctacgcag     79740
     cccgatgggg gccggcttag gcaccttggt atataattat gatggagacg tattcgcgtc     79800
     cgacgaggga cgtatgttgg cggaaatggg cgacagaaca ttcaagcttg gcaatcttgc     79860
     ctccgccgac tacgcgaaat tggcactgtc cgagaagttg attgatctgg cgagtcggtc     79920
     cttaacgcag tctgcgccac aatgttcatc ctgcgcgttt gagccgcact gtggggccga     79980
     tccggtttat catcatgcca cgcagggcga tccggttggc attaagcggt tttcggaatt     80040
     ctgcggccgc caaaagcgca tcattggctt tctggcgaat ctcttggaaa agtcgccaga     80100
     tgatgcggcg atattgcggg ggtgggcgtc gtgacaccac tggctctcgc cgggcgggca     80160
     attacaatat gttggagtaa cgtatccgct aaccgcttca tcgtgagggt acaagatcct     80220
     gcatcttgcg cccaaggtcc agccgatgca gcgttaattc gctcggttga tgatgcggaa     80280
     aacgcaaaga ggtccggttt taagtcagcc gtcggcattg ggttatccac cgataaggcg     80340
     actggctttg accaactcat actcctcgac ggccgcttcg attatctgtc tgatggtgac     80400
     atccttcgcg tccacccaaa tacgaatcat atccgcaccc tttatcgcag agcgtcacag     80460
     cataatgcat ttcttgtaac agagcggtgc aatcactggt gcttgatgtg ctcacagccg     80520
     ccacggaatg tctcagacgg ttggatcatc gacgaaattg cagagtgttt cccactcctt     80580
     aacccgcaac ctcggtctct agggttcacc gggggagagc cgatgaccga ttgggagcga     80640
     tttatcaact tattatcctt ggctaaagat caacttccat cggtcgcact ccacgtactg     80700
     acaaatgggc gggcatttgc aaagccccca atcgccgtag cctgggccgc ccttcggcat     80760
     ccgagcctga ccgcaggcat cccgatatac gcggctgccg gacatctcca tgactatatc     80820
     gtgcaaagta tgggcgcctt cgatgagacg gtcatgggta tccttcgcct caaggatcag     80880
     ggacagcgcg tggaggtgcg ggttgttctg catgcgctta gcgtacctcg attggtcgag     80940
     acggcaatct ggctgggacg gaatctcccg ttcgtagatc acgtagcgct aatgggactc     81000
     gaacaaacag gctttgctat agccaatcag gatcaactct ggatcgagcc aactgaatat     81060
     gccgcccaac tcgccgaggc ggtcttgatc ttacaaagcg caggtatccg cgtctctgtc     81120
     tacaatttac cattatgcct ccttcctcga ccagtttggc cggcttccgt tcagtcgatt     81180
     tctgattgga aaaatggatt tcttccggag tgcgaagagt gtgcgaagcg tggggattgc     81240
     cctggctttt tttcgagtgg tcgtaaagcg gtagggcgta aggtgcggcc gatcaaattg     81300
     tgaattggca ccctgcaccg gcgataggac gcgattctaa accagttcat ttcaacaccg     81360
     atcggcggtt caatccttgc tgtaataata gatgcgtcga cacgatcact tagttccgac     81420
     cgctcctcac gatttggata acgctaataa tctgctcttc cgtgaaccgc tgccgaggtc     81480
     ggaatctgag cgtcatgcgc atctaggtgg ggcagcgact cttacctgtt gtcataagtg     81540
     gttcccaagt gggacatcac tataccccgg caacgggcgc gcgcgaccgc ttgttcgctt     81600
     gctttcgcct tggccgtctg tttgattcgc ggcgtggcgc tgcattcggc atgcgcccga     81660
     tcaaaactga cgggcagaat tagatgacca aggcttccgg caatccgacc gacgatatca     81720
     gcggcttgct ggaagatggt attggcgttt tcgacgacgc tggcgagctt catgtgcccc     81780
     tgcgccgcgg gcgtggcggt acaccggtgg caggcacccg cggcgactgg gggctcgaag     81840
     atccacccgc gccaccgatt gtcccggcgc ccggcatgaa tgaccgggtc tcgaactggg     81900
     cggcccgcaa catcatcgcg cccgcgatcc ttgccatcat ccagcccacc gggctcgacc     81960
     gcgagcaggc cgggcgcgtg catgacgccg tgcgccggct gatcccggcc ggcctgccgc     82020
     cgggggccct gaacctgcac ggcgcggtca aactactgtt cggcatggag ttccgctcgc     82080
     tgccgctgaa gacccgctgc gagacgctcg agatgttgct cgcgtggatg gggctcaccg     82140
     aggaggtcgg cctcgagatc ttcggtgagg acatatggcg agcgctgccg ttccactgga     82200
     accagcgcgt cgccgagctg gacacgagcg acgatgcagt cgcaccggcg gaggtggctg     82260
     caggcgcgac cgaccccagg cgggatgtcg ccacgggcgt catcgttgtg cgcgagatcg     82320
     gcaacagcga caatgacagc gcgaagcggg cggacaaggc agtgaccagc ctggtgcaga     82380
     agccgcttcc gctgttccgc tcgaaccgcc tggatacgtt ccgcgagcgg atggtggccg     82440
     acttccctca tgccgccacc gcgatcgacg atctctactg ggacctgacg acgcgcgatc     82500
     acgtcgcatg gacgccccgg atcctggtcg gcaacccggg ggtcggcaag accagcttcg     82560
     tcgaggcggc ctgcctggtg ctggagatcc cctacctgaa atatccgtgt ggcggcgata     82620
     ccgactccgt ctcgttccgc ggcgcctccc ggaaatggtc caccacctcg ccgtcgctgc     82680
     cgctgagcct gatcgcctcg caccagatcg ccaatccggt gatcatcctc gacgagatcg     82740
     agaaggccgg caccagccgc tacaacggca acctgctcga cgtgctgctg ggcatgatgg     82800
     accgcaagca ggcgtccggc tggtacgacc cgcatgtcga ggccccgatc gacctgcgac     82860
     atgtgaactg gctggccacg gccaactcca cgaaggacct gccgcccgcg atccgtgacc     82920
     ggttccggat ggtgagccgc attgccgatc cgtctgccga acacggtccc cacctggtga     82980
     aggcgctgct ccggcaggtc gtggccgagc gcggtccagg agctgcgatg atcgagcctc     83040
     tcggcctcga tgagatcgag gcgatcaccg ggatctgggg cggtggatcc gtccggcagc     83100
     tccagacggt gctggagcac tggctgcgtc agcgggaccg gtcagccagc cggcattgag     83160
     agtttgacca gctcaaaacc tggctttgac agaacgacca cgcgaccatt cggcgtcaag     83220
     tcggctggcg gtcggaacgc aggtttgcgg ccttgaaagc cacggcgatt gacgctattt     83280
     agcgtcagaa cccgcggtcg attaggtgac acatgttcaa tatcttgcag ttctctgatc     83340
     atggctactt cgcgccgcag aagattgcga aggagttgaa aacgtcgagc gaagacgtcg     83400
     cccgctcggc gggtctcgga cgtgatgctg tgcagcgcgc caatcgggtc caatctgaca     83460
     gaacccagcg ccgtctgcgt gaaatggtgg agatcctgaa caagtctaca ccacggttcg     83520
     gatcactcct gatggcctac gcctggtacc gctcacagcc tcttcccggc ttttcggggc     83580
     aaacaccaat gcagttggtc atgcatggcc gagccaatga agtgctcgaa tatcttgatg     83640
     ccgtggacgc cggtattcac gcttgacggc cgcttcctac aaagggcttc tctaccgggc     83700
     aatcaatccg atttatgcag ccgaccccat gtctggtgaa ggagcgcgtc tttacggcgg     83760
     tagattcaat ccgcgtggcg ttcctgcgat ttactgttcc atttcagtta tgacggcttt     83820
     gcgcgaagcc aaccaggccg gtgcattaca gccgaccaca ctcgtttcat acgacgccga     83880
     gatcgagcgt gtcttcgacg ctcgtgatgt atctgccgtc gaagccgagg ggttctcgcc     83940
     ggggactctt gcctctcaaa catggcgcga tgagatgaag gccggcaagc agtcgcaaac     84000
     gcaggtcttt gcgagccgtc tgattgccaa gaactattgc gcgctgctgg ttccaagcta     84060
     cgtggcgggg gctacaccga gtgaccttaa cctcgtgctt tggaagtggg gctcatcaac     84120
     accgtctcgg cttgtgttga ttgacgacca gggacggctc gccgtgcccc ctcttcccgc     84180
     ctgaccgtca gccgttaacc ggctgcagca cgcgtccccg tcgcaccttg gtccggccgt     84240
     aaaccgagag ctgcgggtca cctggccgct gaagcgcacg gctcacggca tcgttgtcga     84300
     cccagccccc gggccccgca tcacgcgaaa gcagggctcg catctccgga ttacgccagc     84360
     tgatgccatc agcgtgcacc gcatcgcgga tcactgcctc cagcgtcggc cgcaggtcgg     84420
     cggtcggcag atggcggtcc tgccagtgct tcggtgcgcg ggccaggccg aagcgcgcga     84480
     ggagcgccag gtgagaggcc ggcgtgtgca tatcgcgctg gttggtggtc cgtccgatca     84540
     gcgtccagga tatctccccc atccaccata gggtgatcat ggaggcgagg aaccggtccg     84600
     ccggcggcag ggcatattcg tccggctgct cggtctggtg atgctgcttg cgatcggaca     84660
     tctcggcctt gaccgcctgc caccgcgtga tttcgtcctc cgcgatcggc cacatccgcg     84720
     gatcgaccac gtcgaaaagg gctcccgcga ccttcttgtt ggcgtgttcg gccgcccagc     84780
     gggccagccg gtattcgaac gccatgtccc agatcgggta gatccgcgcc gcggccggcg     84840
     atacgcgcct ggcatcggtg tatgcccgga cgatccggtc ggcgaggagc acctccggaa     84900
     gtgcccgccg cgggtcggtc agcttcggca gttgctcgac gagcccgtag atccccggcg     84960
     acaggtgcac gaagttcggg ttcatcttca tgatcggctg ggcaccgctg agcgtctcgc     85020
     tgcgcgagcc gtagttctcg ggcagggtga gttccgcgag atccagcgtg cggatggggc     85080
     cgtggcgggt gatctggcca tgcaggaaat gggcaaccgt gttctcgccg aacggccgcc     85140
     gccagatgga ggtctgcgac atgtccggcc ggatcgtgta gggcaggggg gcgtgcccgg     85200
     ccgggcgttc aggcagcttc tcctgtagcg ggaaccagat ccggtcgatc acattgagga     85260
     acatgccctt cgccccggca atggcgcgcg ggacgcagtt gggcatgttg ttctcttccg     85320
     gcgtggccgc cgcataagcc tcgcacaggc gcgtcaggtc gaacggcgcg ccgtcgtcca     85380
     gcttgatcgc gaggtcatag agctgatagg cgcggcgctc gttgagctgg tcgatgtccc     85440
     ggatgatgtg gcggccgacg atcgcggcgc cgggaaccat ggcgacggca gcactgatct     85500
     cgctcgtcgt tgcgccggcc gcctccatgg cgtcggacac caggatggcg ttgcgccggc     85560
     cgcgcagcct ggtcgacagc agcttgctgg tcgcctgggc ccgcccgcgt gccttgtcgt     85620
     cgaggccaag cagccagcca ttgccttgcc tggtgccgta acggttggcc aggtccgacg     85680
     cgctcgggaa cagggcctcg aggcccagta ccacggttcc cggcacgccg tgggcgatca     85740
     tcgccttgcg gttgatctcg ccggatgcct catcgggcag gtagccggtt ccgtcggtca     85800
     ggatctcgat cagttgaggc agatgcgcct cgatgatcgg ctcgaccttc tgccgcgaag     85860
     gctcgcggcc gagatgcttg accgcctcca cctcgatctg gcgcacgcgc tccttggtga     85920
     tcccgacggt attggacacg acatcgagcg tcgccggctt gtcgaagaag ccgtagcgca     85980
     tggccaggat ctgcgcctgc ttctcattgc gcatgatgac gccggggaag ccgggaagct     86040
     cggttgcgcg gttcttccgc ccgtggctgc caccgagaag gtgatgcgcg ggttcagcga     86100
     ggaaggctgg gagcgcgtcg cggaccttgt cgaggtcggc gcgcccgatc atgtgctgca     86160
     gcggaaccgg aatgtcgccg gccaggatgc cggcaaggtt cagccgttcg gtggcgacat     86220
     ccttcttgct gacaacgctg gccacggcct cggtcgcgcg caggagcgcg ccgtcgacca     86280
     gcaacttgag gtctgtcgtg cttttggccc cgaaattgtc ggcttgctgg aggcgggtca     86340
     tgatcccttt ccagtccgag agcaggtcgg ccagcgtgtg gacgccagcc cgccagtcat     86400
     ccttgctgtc ccgtgccgcg acgaaatcct cgaggatccg gcgcagccgg atagcggggt     86460
     ccgcctccag cagcgcttcg gggaagggaa caagggcaag cacgcggaaa accgccgcga     86520
     gagccgcgac gcgcgcgtcg tcttgctggc gcgcattcat ctgggcccgg gccgcaccgg     86580
     catgcgagta acccgcctcg tcgaggtggc tgaagatctg cttgaggatc ggcacggaga     86640
     agcctctgaa ggagacctcc cggctcagca gcgcgtttct gaggtcgagt acgttcgcga     86700
     cgctcatggt catcagcgga ctgtcgggat tctccgaaac cgcctgggcg gtcggtcggg     86760
     ccagctcgat ctcgtccagg gcgtctcgaa gcgtcgtgcc ggaagcgttc atgtgtttca     86820
     gcctgctgac cctctggagt tgggataaaa atagaatata tatagaatgc atttatatca     86880
     acaaatacgc gactgcattt tcggaaaatc tgatttaaat attgaaattc agatgactca     86940
     caatcgatac aatatcgatc tagatttggt agtatattag gtggcttagt tcacgatgtt     87000
     ctatagaaat acttttctga tccccgtaag aaattatgaa attcctgaat gcaatgcttc     87060
     aaacgttcga agcgggacga attaagacac aaacgtactg catgccttga atcataaaac     87120
     cagtttgtgt ggccaacata attttgaaac ggcggtggaa atatagaatt atctgctcaa     87180
     ttcacacttt tcatgattcc gaagccatat acagtggaat catctatgat caagactaat     87240
     aggactctga tccgaccggc tcaggcaaga caacagtatt gggcagcctc catcgccgac     87300
     gcgatgcgtc gaaagcccgg cctgatcgct ttcggcgaag cccgcgacgg tccgacgacc     87360
     gaagaatcgg tcaccgcttt caccaccgcc ccccttgcat ctcgaccatg cacccgatcg     87420
     gcgtgtcgaa aaccgcccgg cgcacgatca tggccatcag tccagaccag tcgcgcgggc     87480
     attggcattg aactcatcga tttgacgcgc tgctttgtcg cccagatctt ggtgttcaaa     87540
     atcggaggtg gtcgtgttgc cgtcccagag caccttgtct tcgatgcggc tcatctaggc     87600
     ccgatggagc aacggatctt cgactggtcc gaccggcgta acgacccgga gatgatggaa     87660
     aacctactcg attgcttgga cgaaccagat cggatctgct ccggcggcgc atcgccggaa     87720
     catcgcgcgc ctaaccctat ggcttcccga acggtaaaag caaaaccgcc ctgcccgggt     87780
     ttgtcgaatt tcataccgat cgggcagaat tgcgattgaa cacccttcca aggtcattta     87840
     tcttaccgat cggtatgacg gattaatgta atgatcaaag acgcccaagc ttttggtgcg     87900
     ctggtccagg cacgcaggaa atcactgggg ctgacacagc gccagttggc gctggcgatc     87960
     aattccggcg agcggttcat cgtggatctc gaggccggga agacaacctg ccagctgggc     88020
     aaggcactcg ccgctgccaa cgccgtgggg atcgagcttg ccgacactgg ggcgcggggc     88080
     gcgtcaacag agcggcgggg tgagcaagag ctcgaccttc ctgaggtcga cttatgagcg     88140
     accacacgcc ggttttctat gagaccctgc tggttggtat gatccatacg gacaccaggg     88200
     gctcttgctt cacctatgac gagagctggc tgtcacggac aggcagcttc cagatctcac     88260
     tcaccatgcc gcttggccgc ccagcggtgg agcaccatgt catcatgcca tggctggcaa     88320
     acctgctgcc agaaggcgat gccatcagta cgatcgcgag gcggtccgga atagccaccg     88380
     gcgatattct cagcctcctc atggtcgtcg gcagggacac cgcgggcgcg ttgagcattg     88440
     gtcagcctcg cagccgcgag gggcgccatt atatgacgat cgccggtcag gacgcgctgg     88500
     agcggctcat cgaagattta ccgcgccggc cgttgctgtc gggagatgac ggcgtctcga     88560
     tgagcctgcc cggcgcgcag gagaaattgc ccgtcgttct caatgacaac gatattgcgc     88620
     ttccgctaaa cggggcgccg tcaacccaca tcatcaagcc caacaaccga agactgccag     88680
     gcagcgttca gaacgaggca ctctgcatgg ttctggcacg acgggttggg ctcgatgtgg     88740
     ccgacgtcac caccggccag gccggcaagc gctcctatct tctggttgag cgctatgacc     88800
     ggatccagcg tggcggcgtg tggcgccggc tacaccagga agatttctgc caggcactgt     88860
     cgctacctcc ggcgtcgaag taccagcaca acagaacggg tatccttggg ccaggactgg     88920
     ccgacctctt ccggaccgtc aggactttca tgacggcgcg cgatacgatc aggcttctcg     88980
     atgcggttat cttcaacgtg ctgatcacga acgtcgattc ccatgcgaag aactattcga     89040
     tcatgttgac tgggcgtgcc cggctctcgc cactttacga tctgatggcc ggcgatgcgt     89100
     ggtccgaggt tacccagaat ctccctcagg acatcggcgg caagaaccgc ggccaataca     89160
     tcaatcattt gcactggcgt cggatggcgg aggaatcagg tctcagcgcc ggcgccgttg     89220
     tccggcgggt gatccagatg gcaacggccc ttccatccat gctcgatcag gcggttgatt     89280
     aggttcgggc aatgccggcc ggagatcatt tcatcctcgg ggtggcagcc aaagcgatac     89340
     gacgtcgctg tgcgacggtg atcgccaata tggatgccga ggacgaagcc cgcccggagc     89400
     cggatgcgct cggccgcacc atggacggct cgccgatttc gcaatgaggc tctacttcct     89460
     cgtcctcgac gaactcggct atctcccctt cgcccagacc ggcggccagc tcctcttcca     89520
     tcttatcagc cgcctctacg agcgcacctc gatcatcgtc accaccaacc tcgccttcgg     89580
     cgagtggccc agcgtcttcg gcgatgccaa gatgaccacc gcactcctcg atcgcctcac     89640
     gcaccactgc gaaatcatcg aaaccggcaa cgacagctgg cgcttcaaaa accgcgcctg     89700
     atcaaactcc ctccccagac cccacccccg ggacttgccc agatgggcaa acaggcaacc     89760
     tcccgcgcgc gtcgctccgt cgctcacaaa ggcactccgc aacacgcgcg ggtccctcct     89820
     gttcgctatc tggacaagcc ccaaaaccaa gcaacaggtg ggtccctatt ccacgccgat     89880
     cccgggcccc aattcagtgc cgtttgacaa tctgcatcgt actggatggc ctgcgcggcg     89940
     aggacagtgt tgccgagcag tgccgcaagg aaggcattgc ccagagcttg tcttactccg     90000
     gtcgaaggag agttcatgga agccggcaag cggcgcctgg ccggtgacac cgcccgtgct     90060
     gcgaccaccg gcgaggtgca ggacctgcgc cgcgaagccc gcgccctcaa gatcaccgga     90120
     aaaccgagat ccttgagcga atgttagagc aacggcacca actgtctgat ctcgagcccg     90180
     acccggacga gttcgggcgc atgccggtgc agggcccgcg gcaagcacct ccggctcgct     90240
     ggccctcttg ccccgccaga ccagcttccc attctccaca acgtgaatgg cggtgtcttt     90300
     gtccgaaacg tccagtcctg cgtagtgcgc catgattgcc tccctgagct ccaacaagcg     90360
     gataacccgc tcgcatcgcg acccaatttg acagatcgaa ccgccggatc gcgatcgccg     90420
     catgtcgagc ggctcttcgc gtggatgact cttaacacgc tactggcaaa agacttcgcg     90480
     gtaagcattg aagccttcct ctacgccgct tccagcgtgc tccgctgaga ctactcgctc     90540
     gttgaatatc cgattcgaaa tggactctaa aagaagcaac cagaatcatg ttgttcactt     90600
     caaggtttac ctcggcccac cttgactaca agttccggtc acctcaggtc atattaactt     90660
     aatcaaaggg agattcagaa cgatgcgctt gaaaaatccg atgttgacgg acggcgacat     90720
     cgaggccatc tcgccatacg gtccggcgcg tgcgacaatc cacggtacgc cactgaaccc     90780
     ggacgaactc gaaagacttg atgcctactg ggatatcagt ctctatctct gcctcggcat     90840
     gctgtatctg cgggacaatc cgctgttacg gacaacgctc cagcccgaac acgtgaaggc     90900
     gcgactgctc ggccattggg gctcggacgc cgggcagtgt ttcacttaca tccatttcaa     90960
     tcggctgatc tgcaaatatg acctggacgc aatgtatatt tcgggaccag ggcacggagc     91020
     gccggcggtg ctgtcgcaag cctatctcga aggaacctat tcggagattt atcctgagat     91080
     cagcgaagat ctcgccggcc tgaggcgttt cttcaaccag ttttcgtttc ccggtggaat     91140
     tggcagccac gcgacccccg agacacctgg aagcattcat gaaggcggtg aactgggtta     91200
     cagcctatcg cacgcctttg gcactgtgtt cgacaatccg gatctgatca cgctggtaat     91260
     ggtcggtgat ggtgaagcgg aaaccggccc cctggcgaca agttggcacg gcaacaagtt     91320
     cctcaacccg ataacagacg gagcggtact gccggtgcta catctcaatg gatacaagat     91380
     caacaatccg acgatcctcg ctcggatcag ccacgaggaa ctggaggcgc tatttgtcgg     91440
     ctacggctac accccctatt tcgtcgaggg tagcgatcga gccagcatgc atcaggcgat     91500
     ggcggcaaca atggagcatt gtgtgcacga gattcgcgcg gcgcagggcg aggcgcggcg     91560
     gactggcaaa gcattccggc cacggtggcc ggtcatcgtg ctacgtagcc caaagggctg     91620
     gaccgggccg cggctagtgg acaaccatta cctcgaagga tcctggcgcg cccatcagat     91680
     cccgatagcc gatgtcccct gtaatccgga ccatctgaag ctcctggaag actggatgcg     91740
     cagttatcga ccggaaatcc acttcgacgg ggatggtcgg atcattccag agttgagggc     91800
     actggcccca aagggtttgc ggcgaatgag cgccaatcca gcagccaatg gcgggaccat     91860
     tcggcgtccg ctcaatctgc ctgactttcg ctcctttcaa gttgatgttg atcatccagg     91920
     agtgaggaga gcaggcaacg tgccgacact cggtccgttt ctgcgtgaaa tcatccgtga     91980
     aaatcatgat aattttcgca tatttggccc cgacgagacg cagtcgaaca agcttgattc     92040
     gatctatacg gccggcaaga aatcttggct tggcgcccat tttccagaag acgaggacgg     92100
     aggcaatctt gcagtggctg ggcgggtcat ggaaatgctc agcgagcaca ccgtcgaagg     92160
     ttggcttgaa ggctatctgc tgagtgggcg ccacggcctg atcaacagtt acgaaccctt     92220
     cgtgcatgtg atcgactcga tgttcaacca gcatgccaaa tggctcgaga aatgtaacga     92280
     gctagcgtgg cgagtgccga tatcatcgct caacattcta atcacagcac tggtgtggcg     92340
     gcaagatcat aacgggttta cccatcagga tcctgggttt cttgatgtcg tggccaacaa     92400
     aaatccagat gttgttcgca tctatctgcc accggatgca aactgcctgt tatctgtggc     92460
     tgatcactgt ctgcgtagtc agaattatgt caatgtcatc gtctccgaca agcagataca     92520
     cctccagtat ctcaacatgg acgccgcaat cgcccattgc gccaagggtg cgggcatctg     92580
     ggattgggca agcaacgacc acgggcaaga gccagatgtc gtgatggcaa gttgcggtga     92640
     cgtgccgact gtggaggcac tggcagcgac cgccctcctg cgtacacatc tacctgacat     92700
     caaaatcagg tttgtaaatt gcgtcgattt gttcagattg gtcccgaact gggagcatcc     92760
     acacggtctg accgacagtg aattcgagga gctgttcacc gcgacaaagc cggtaatctt     92820
     caactttcat tcttatccgt ggctcatcca ccggctgact tatcgccggc ccgcccaaca     92880
     caacatccac gtttgcggtt acggtgaaaa aggcaacatc gatacacccc tcgagctcgc     92940
     catccgcaat cggactgacc gcttcagtct ggcgatcgac gctatcagcc ggatcccacg     93000
     cttccgtgac tcctcctccg atgtacttga ggtcttgctg gaacggcgac aagcctgtgt     93060
     tcagcacgct cacgaattcg gaaccgatcc aaaacacatc tccgactgga tttggccgaa     93120
     agcagactcc gaaggacgat cttaatgggg tgccgtgttc gggattccgg ctgcccgaaa     93180
     gtggcgcacg gttgatatcg cggcaattcc gaggcgaacg cctatgggcg tctggttctt     93240
     acgggaacgg tttaaaggct cttgatagct ggcctcatcg gatcttccgc aagtcttcag     93300
     ctgcaatata gcgtcgctat agaaacttag gtatagcaat gctatttcat gcggcatgaa     93360
     tgccggcgcc actctgccaa atgcaacctt gaaggtcctg gaggaggaag gcgagccaga     93420
     gttctcgacg cgcgatgtct gcgcgatcgc gaaggtgaca gcaccgacac tctaccatca     93480
     cattggcagc gccgacattc ctaccgctga agaggctttc acgctcctga ctgcgtgtgt     93540
     tgcagcaatt gccggtgaag ggagcctcac gcaaaaagtc gatgcggctc ccgatatcat     93600
     gtggacgtcg acgaaagcgg catcgcttct ttgtggcacc gcgtcgctcc gcaagctgtc     93660
     gacgcccacc gctgccgtcc tcgagcaaaa gcgccagggc gcctttcggt ccatcctgaa     93720
     atccaaatcg aatgtacaat cacaatgaga gtacttgtca ccgggggcac gggcctgcgt     93780
     ggcagccacc tgttcccgaa actcgtcgcg gaaccacatc gaaaaatggc cgtcgcacgc     93840
     tcggcatcgg ttcaatggcg ttggctggcc agaattgtcg cgatctagca gatactggca     93900
     tcgctcgtcg gtgtgcccga gttagaactc ggtcgggcag gggtgtagtt gatatgatca     93960
     ctgccctcag tattcctggc gagattcccg tgctatcttc ttcgcatctg ccttctgcgc     94020
     ccggcttgcg tcgagcgcct ggcaagaagg cacacctcat cagccctccc tctgagagcg     94080
     caattgcgga ctggtttatc ggtgccgatc tggtcgacgc ctatgccatc acgctttccg     94140
     attgggctcc cagtgatatc gacaccttag cgcgcgaggc gctggaacac ccaccagcct     94200
     ggtttcaggc gttgctccgc ctccgcgacg ctatcgtttc gttgggtgga gtaaagtcct     94260
     ctcggcggat acggcaggat gccgagtccg aaggtctcgc gaccgtggcg ttctttccgg     94320
     tcctgtcgcg ttcggagcgg gagcttgtgc tgggggaaga cgaccggcac ctcgatttca     94380
     gagcctcggt cctgatacgg gtcacgacgg acgaggggaa gcgcgatctt atcatgacca     94440
     cggccgtgcg ctgccataat cagccgggcc gcgtgtatct gatgacgatc gccccgttcc     94500
     accgccttgt cgtccgcagc aatctcgaac gttttcttgc acgctgaccc ttcaggggcg     94560
     gttgcatttt ctcggcgatt atttccgaat gtgcgtcgga accgacgcac ccgcgtcacg     94620
     caggcggcag aaatgccctg tctggcccga cttcaacagt ggaacccgga acgatacggt     94680
     aatggcacga tagaggattg gaagataacg gttttttcgg agccgtttga agagttttca     94740
     aaaacgtagt gccacgtatc gcgcgattgt gtgttgatct tgcttgcatc ggctccgtag     94800
     cgtggtgtcc ggagtcgggg tcatgttctt ccgcatcaaa ccatcaggtg gccgtcgcta     94860
     cctgcagatc gtcgagaaca agcgggtcga tggcaaggtc cgccaggttg tgcggctgac     94920
     catcggccgg atggacgaac tcgaagcaag cggccagctc gcgaggctcc tcacctccgg     94980
     cgcccgccat tgcgagcaga tgatgctgct ctccgccatc gagaatgagg cgaccacgct     95040
     gagcatgcgc cggttcggcg cgccattgct gttcggccga ctgtggcagg agagcgggat     95100
     cgctgcggtg ttcgaggagc tgctggccgg gcggcagttc gagttcccgg tcgagcgcgc     95160
     ggtgttcgcc accgtgctcc accggatcat ggtctcgggc tcggatcgcg cctgcgacaa     95220
     atggctcgag gattacgaca ttcccggcac cgaggagctc ggcctgcatc acctctaccg     95280
     cgccatggcc tggctcggcg aagagctgcc ggacgaggaa cagggggatg ccacgccctt     95340
     tgcaccgcgg acggtgaagg atctggtgga agagcggctc ttcgcccgac agcatgatct     95400
     gttcaccgac ctctcggtcg tgttcatgga caccacctcg ctgtatttcg aaggtgccga     95460
     cggcgagacg ctgggcgcgc ggggccactc caaggattac cgcccacagc tcgcgcagat     95520
     gatcctgggc gtggtgatcg atcaggacgg ccggccgatc tgcaccgaga tgtggccggg     95580
     caacaccgcc gatgtctcgg tactggtgcc ggtgatcgac cgcctgcggt cgcgcttcgg     95640
     catcacccgg gtctgcgttg tcgccgatcg cggcatgatc agcgccgcga cgatcgccgc     95700
     gctggaggag cgcggactgg aatacgtcct cggcgcaagg gaacgcaccg accgcatcgt     95760
     ccgcgaggtg gtgctggccg atgagcgccc ctacatcccg ctctgcctcg agcgcgccgg     95820
     tggcgacgag acccagctct tcatcaagga ggtcaaagtc gcgggcaagc attacatcgt     95880
     ctgccgcaac gaggcggtgg ccatcgaaga ggccgagacc aggcgccagg tggtcgccgc     95940
     cctcgatcgt cagctgacgc gaggcgacaa ggcgctgatc ggcaactccg cctatcgccg     96000
     cttcctgcgc ccagtcagcg acgcaaagcc cggccgcaag agcaagctgt tcgagatcga     96060
     cgccggcaag ctcgccgagg aagcccgctt cgacggcgtc ttcgtgctgc gctccaatgc     96120
     caggatctcg ccgctgcagg cggtgctccg ctaccgggac ctgcagaatg tcgaacagct     96180
     gttccgtgtg gcgaaggcga cgatgcgcac ccggccaatc taccattcct ccgccgccgc     96240
     catccgcggc catgtgttct gttcttttct cgcgctgatc ctgcaccagg cgctcgacga     96300
     aaaactccgc cgggccggca agcgcgtcga atgggccgat ctccttcgtg atctcgacag     96360
     actgcagcac ggcgaaatca gtcagaacgg caagcgctgg cagctgcgca ccgaagccgg     96420
     cgttgcggcg gccacagcct tcaaagccgc ccgcatcgcc ctgccgcccc gtctgcagac     96480
     cccccagcaa gccgtaacct gatccggctg cgcattccgc cctgtagtgc cacagctccg     96540
     gcgcacgcca gatttcacac gccttttcaa ttgcttagga aaacccgctg tttaactggg     96600
     gtctgggaac gttttctcca cgacgtccgg gaaagcgcgc accttcgccc cgacaagccg     96660
     gcgggagctt tacagtgccc ggcgttctgc tggcggcgct gacagcggtc ctccgagagc     96720
     gatgcgcccc gccgcgacat cgtcggagac cagcagcctg gccagcactg cggccccggc     96780
     actggccaat accgctccca aaatttcggc ttcgagagaa agaaagcatc cccaaggcag     96840
     gagaacgccc gcgattacgc catgtgtgga aaattgccct ctcgtgtctc tgcggaaatc     96900
     aacagtcgtg ccggccctag ttctccagct gaggtggcgg agtggacggc gattgccctc     96960
     aagagcagac tgtctgcctg cccaacgcga cccccgcggc cacttcaagc gcccaaccta     97020
     gcctgcaacc gggtgcgtca gccagccaca catgagattg gcgccatgcc gggcctggca     97080
     tctggctgat cagtccggaa agtcgggatc tcttgaaacg atatgcatag cgcgacgggc     97140
     cacctgatcc tgataaccac gctcacgttt cgcccgagcg agatcggcga ggcgatccag     97200
     agcagtcccg agatcgggcg caggatcgaa gcggcttctc gacgagatgc cgatacgccc     97260
     ccaacagcgc aggattccga ttgtaccaaa caggtcggtc aaaacctcga ttctgtagta     97320
     gcggcgctca ttcatcgcgg gccggatgcg cacgaggtca acgacgtcgg gaaacaaagg     97380
     aagctgaacg gcggtagggc tgggtacaga tggcatgcgc gggcggcgtt tgaccaccgg     97440
     tggcacggcc ggtgcagatg gtgtccgctg cgtccggatc tcctggcgtg acaaaatcga     97500
     catgaaaaga gtctagcacg accacttttc aagcgaatcc cgtaaacgac cggcagacgg     97560
     attttattct atccgctctc cagatttaat ggcgagatcc gggtcacccg aggccggcca     97620
     aggcatcggc cggacggctc gagaacggcc tcactgtcgg cccgatgatc gcggcctgtc     97680
     ggcacgaagc cgtaccagtg ttgaaaactt acgccaccga gatagcaccg ccagccacgc     97740
     agacgcactt tgcagggctt tacgtcagca ggtgtgggaa actgcctcgc gtataggcgg     97800
     aggatcaggg acgtggcccg tattggcaag ctcgccggct taaaatcatc ttcgagctgc     97860
     gggcttcaga tttcacaaat tcaatgcgaa tatggaagtc gcagaatata tcttatggaa     97920
     cttcgtagcg ctaatttggt gagcgggctg ccccatgaag agacttacga tgcggaacat     97980
     cagagaagcg cagcggctgc atgccggcgg attgtcgaca cggaagatcg ccgcgagcct     98040
     cggcgtcggg cagagcacgg cgagcgatta tctcaagccg gtcgagcatg ccgggctgag     98100
     ctggccgctc gcggctgaga tgacggacgc ggcgctggag gcgttgctgt ttcatccgat     98160
     cggcggcccc agccgtctcg tcgaggcgca gccggactgg ccggcgatcc atcctcgaga     98220
     ttgcggcgca ccggcgctcc atacggcttt gttgtgcggc tttggcacgt gcccgccgct     98280
     cgtccagctc ctggtcaaga ccagagtacc gaagcccggc ggcctgacgg gtggcgcgag     98340
     tgatatcgcc tgagtgccac gtcctgaaat tggaggccgc ggtgcccagg cggcgggatg     98400
     aagcaccatc gctgaagcca tggacgagca ggacgccctc gggctcgccc ctcaggttgt     98460
     cgcgactgga gtggatggtg gcggcaaagt ggccgatgcc gggaatgtcc agcttgccgg     98520
     ccgctatcag gtcccggcaa gcgatcggcg gctgcgatgg ctgatggcgc ggccggcatc     98580
     cgtatctccg tctccgcaat cggggtgggc gccagaacgg tgtcgcgcgg tgtggcagca     98640
     tggccggacg gaggccgcgt ttgcagcgcg gccgccagcc ttgcaaggcg ctattcctcc     98700
     tcgtgcacaa agaccacccg gcctgccgcc ggctcgaggc gaagccgcac tcgatcgggg     98760
     tacagggctc atgcgttgtc gaggcgcagc cccccttccc cgccacacgt tcctcggtaa     98820
     ccaggtgcgc catcgcgcaa ccgcgcgtgg cgatcacggc aacgctcttc tcgatcagga     98880
     cgaaggtgcc ggtgatgttg gtgtcgatga aatcgcgcgg cccgtcgatc gtccggtcga     98940
     catgggattc ggcggcgaga tgcatcacga tgtcgggttg gtgggcctcg aagccggtcc     99000
     gcatcaccgc ggcatcggcg atgttggcgc ggatcagatg atgacgcgga tgccccagtt     99060
     cgtcctgcga agccagccca tgtggtcaga aataccccgc cgtcgcccag agctggtgtc     99120
     gggtccggca ggatgtcacc cagttctttt cctcaccggt aaagtccggc ggattatctg     99180
     cgccacacca tagccccccc gaattccaag ctgcgccagc ccatctgtca gcggagaaaa     99240
     ttgtcgcgca gtagctgaac aacttcccgc gaacgtccgt cgagcaccgc tcttacgccg     99300
     aacagggcag tcgaggcgac ctggccgatc tctactttcg gtggcatgac cagttcgacc     99360
     cggttcacat ggacatcaag caaggcaggg ccctcggcgg ccagccagcg ccgcatcgct     99420
     ggctcgagct cggggccggt gtccacgcgc cagccgctga tgccgcaaac ctccgcgagt     99480
     ttcgcaaaat ccgggttctt caactccgtg aaggaatcga ttagaccttc taccctctgc     99540
     tccatctcga cgaaacccag cgagccattg ttgaagacca gcagtttgat tggcaacttt     99600
     tcctgcacca gcgtcagcag gtcgcccatc agcatggtca tgccgccgtc gccgcacatg     99660
     gcgatgacct ggcggcctgg aaaggcggcc gccatgccca tcgcctgcgg gtaggcgttc     99720
     gccatggtgc catgcaggag gctggtcagg aagctacggc ggccgtttgc ggtgacatgg     99780
     cggagcagcc ataccatcgg ggaaccgccg tcagcggtga agatcgcgtc gtccgcggcc     99840
     agcgtgtcga gcgtctgagc gacggtctgc ggatggatca gcgcgtcgtc gtgcgcgcag     99900
     gccaattttg cgtaaccctc gcgatccgcg gcccagcgct taagcgacct gtcgagatga     99960
     gcgctgtcgc tcctcgtctt tagccggggc agcagggcct cgatcgtcgc gccgacatcg    100020
     ccgaccagcc ctgtccggat cggcgcgcgc cgtccgaggt gcgtcgggtc gctgtcgatc    100080
     tggatcacgt aacgggcgtc gggatagaac tgcgtccacg cgaaatcggt gccgaggcag    100140
     agcatgatat cggccgcatc gatcgcttcg acgccggcgc gattgccgag aatgccggtc    100200
     atgccgatgt tgaacggatt gttcggctcg ataaattcct tggcgcggct ggtatggacg    100260
     atcggcgcct tcagtaggcc ggcaagctgc acgactcggg ccgccgcgcc gcgcgcgccg    100320
     atgccggcat agatcgtgac gcgggccgcg ctgtcgagat cgcgggcgag ggcgtcgagc    100380
     tcgtcgtctg acgggcgcag cacggaggat ggccggtgga ctcgccattc aagcctgtca    100440
     tccgtcgttt cagtgaacat gtcgccgttc acgatcacca cggcaacccc gccccgcgtg    100500
     agcgccgcct gggccgcgag cgtcgtgatc cgccgcgcct ggtccgggtg actcacatat    100560
     tcgcagaaga cgctggcctg ttcgtagatc ttccgctggt caacttcctg gggaaagcgc    100620
     agccccgcct cggcacgggc cacgtcggag gcgatcagca cgaccggtgc gccgttgcgg    100680
     tgggattcga agatgccgtt gacgaaatgc aggctgccgg gcccgcacgt gccagcgcag    100740
     acggcgagct cgccggtcaa gtagccctcg ccgccggcgg cgagggcgcc ggcttcctcg    100800
     tggcggacat ggacccagcg gaggtccgat ttccggacgg catcggtgaa atgattgatc    100860
     gtgtcgccga cgatgcccca gcagcggcgg gcgccggctt ggcaaagcgt atcgacgatg    100920
     atttccgcta cggtgctggc catgaaatct cccgggttag tgtgccgtgc cgcgcgccga    100980
     ggcacggatc ctgatcaggt cgatggcggg gcggaaactg tctgcccgcg ccgcgcgcca    101040
     ccagtccgcg tagatcgtct cgtccggggc atcgcgcagg atgcctttcg gcaggaaggt    101100
     gtggatctcg tcgatcggtg cggccttttc ggggccgatg cggtgcatga tgtgatgcgg    101160
     ctgcagatcg gtcgggtgct tgaacccgac ggacgcaacg atttccgaca gagccttcag    101220
     tgtgtgggcg tggaagcggg ccgcgcgttc gccctgcacc tctgggatca gcccgcgctg    101280
     gcgtcccggg ctctggctgg tcacgccggt cgggcaggtc ccgagatggc agcgctgggc    101340
     ctggatgcag ccgatagaga acatgaaggc gcgggcagcg ttgcaccagt cggcaccgag    101400
     ggagatgttc cgggcgaggc ccatgccgga atagaccttg ccgctggcag ccagccggac    101460
     ctcgtccttc agcccggcgc ccaccagcgc gttgcgcatc agcaccagtc cctcgagcag    101520
     cggcatcccc acccagtccg acagttccag cggggcggcg ccggtgccgc cctcggcgcc    101580
     gtcgaccacg atgaaatcgg gcctgatccc ggtttcgagc atcgccttca ccatcgcaaa    101640
     gggctcgtgc ggctggccga tgcagagctt caggccgacc ggcttgccgc ccgagagctc    101700
     gcgcatgagg gcgacgaatt ccatcatttc gatcggtgtc gagaacgccg agtgcccgcg    101760
     cggcgagagg cagtccttat gttcgggaac ctggcgcacg cgagcgattt ctgaggtcac    101820
     cttggcggcg ggcagcaggc cgccatggcc gggtttcgca ccttggctca acttgatctc    101880
     ggtcatcttc accgcgtcat gcgcggcggt atcgcggaat ttttcaggat cgaagcagcc    101940
     attcgcatcg cgcgcgccga aatagcccga gccaagttcc cagaccagat cgccgccatg    102000
     ctcgaggtga taatccgaga ggccgccttc gcctgtatca tgatagaagc cgccacgctt    102060
     tgcaccgaga ttgagagcgc gcaccgcgtt cgccgacagc gcgccgaagc tcatcgcgct    102120
     gatattgagg acggatgcgg aataggggcg gttgcactgc tcgttaccaa ccaggaccct    102180
     cggactttcg tctggctcgg actctggagc gatcgaatga ctgatccagt gatgttcctt    102240
     ggcgccgaca tcgcgctctg tcccgaacgg gtgggtatcg gtttctcccc gagcccgtag    102300
     atggacgagg ttgcgcgcct cgaacgaata cggcgtgccg tgcagatcgt cctcgacaat    102360
     gtacgcacgt aggtaagggc gaagctggta gaacagccag cggatgcgac cggcaactgg    102420
     gaagttccgc gttatcgtcc agcggcgctg cgtgaagtcg tggatgccga gcgcgactat    102480
     ggcgaggcac agcaggccca accagatcca cgatttcacc aacaggatca ccgacagtac    102540
     gagcgccgcc agcggaatga tcgccctctt caacagatca agcatgaatt ctttccgagt    102600
     ctaggattaa ggattggaag acggtcgtcc ccgttcaagt tgcgcggtgc ggattgaccg    102660
     gtctcatcgc ggcgtcgggg catgatatct ggcaggctgc cgaaaacgtg atggcacgga    102720
     cgaaagacag gacggtcgga atagctcgca gcgccatgat atgcgccagc aaattcatat    102780
     agacgccgaa gaagggcggg atagtgattg cggagctaaa cgagactcca tagccggacg    102840
     atctgacatc gatatggaac cgctcgttca ggtagctgtg tggcaccgaa cccagacatt    102900
     agtgaaatcg gttgtttggc ggcctgctca tccttgaaat tcagcaacaa atttcagggt    102960
     ccggacatca gaaaatcaat caaaacagtt caataacaat tatttatgat agagcctcaa    103020
     ttataaatat gacgtggctt tcgttttgtt gcataggcgc aaaaaccggt gccgcacgca    103080
     gggtaaaact ccacagaaaa ttgattttcg tcattgcatt gcataattca taacgccatg    103140
     tcttcggcct gtgacaacaa ctaggcggag aacatatgaa caggttttca gaattactcg    103200
     gttcccggaa acctatctgg ctccttgctc cctttgccgt cacatgcagt gccacccccg    103260
     cgagggcgca gacgccttcg ccactcgccg aatggcaata ctcctcgggc atccaactcc    103320
     agcgcctgtt cgagccgaaa atcccgacct ggcaggtcga gctcgggctg ggcacacagt    103380
     tcgcccccgc cgcgcccggc cttaatcgct accggatcca gggcggcccc ggcatcgata    103440
     tccgctacaa gaatcgcttc ttcctctcca ccggggaggg gctgggcgtg aacctattca    103500
     gcttccgcca tatcagcttc ggcaccgcga tttcctacga tctcggccgc tccccccatg    103560
     tcgacggcga ggcgctgaac ggtctcggga ccatccatcc ggcgccagag ctcaaggttt    103620
     tcgcgactac ggtactcacg gagggctttc cgctgaccat ccgcgtcgac atccgtaagc    103680
     aattcggcgc atcctttggc tatatcggtg atgtcggcgc ctacatgccg atgcccggca    103740
     gctcgaaaac attttcatgg ttcctcggcc ccaccgtcac cctggccgac gcgcgctaca    103800
     tgaacaccta tttcggcgtc agccacgccc aagcagcaag ctcgaaatac cattattacc    103860
     acgcccatgg cggcttccgc tcggcgggca ttgggatatc ggcaaattat ttcgtcaccc    103920
     cgcatgtcat catcaacctc aacgcagcct atgagcggct gctcggcagc gcggcgaaga    103980
     gcccgatcac gcagaccgta aacgaaggcg tcgtctccct ttcggcgctg tacaagttct    104040
     gatcgacgct ccctaggttc cgtacctatt gccatgacca cggtggtttt gattcaagtc    104100
     tcctcggagg gcttggaaga tgtcggaagt attctggccc cacttggaca gtgggtttta    104160
     taaaggctgg cgatatcaat agtttatttg cccgtgagcg ggtgctgcca ctacattttt    104220
     ggggtgttgg gtcggcggcg cgcggccgcg gcttcagtct gcggggtgtt cgctgatgtt    104280
     gtggggcagc gcgatgctgg cggccttgaa gacattgccg acctggccgg tgacgtgggt    104340
     cctcgtggtg atgaccttgc cgcccttttc gatggttgcc tgctggagcc tgtcgagatc    104400
     gttcagcaac ttctgccatt cgggctggaa gcccctggcg ccgcacaggc ggttcagttc    104460
     cttggcgagt gtcagggcca ggaaggaaca gaaaacgtgg ccgcggatcg cggcgtcagc    104520
     ctggtgaaag atcggccttg tatcgaagct ggccttggcg gcgcggaaca gggcctcgac    104580
     ctcgagcagg tcgcgatacc ggatcacggc ctgcaggggc gtgacccttg cgttggtcct    104640
     gagcacgctg aggccatcga agcgggcctc ggcagtgtca ggaattccgt gtatgggcgg    104700
     cggttgaaca tcaggccgcc agggccctta caaagcggtc gccgaagatg acggcgaact    104760
     gagcctttgc catagcccat tctcgaggtg gcatcaccca ctctttttcg gatcggttca    104820
     ggatcagata gagcagcctg gccgcggcct catcgctggg gaaatggccg cgcgcgcgga    104880
     tggcacggcg cagcttggaa ttcaaagctt ctatggcgtt cgttgtataa atgatccgac    104940
     gaacgtcgcc cggaaagccg aagaaaggga tgacttcctg ccatacccgg cgccagctct    105000
     ggccgatggc ggggtatttc tggccccatg gaccggcctc gaaggcggcg aaagcggcct    105060
     cggcggccct ggcatcaacg gcccggtaga tgtccttgag ggcggtggcg accgccttgc    105120
     ggtccttgta ggacacgaaa tccatcgaat tccggagcag atggacgatg caggtctgca    105180
     cgatcgtctc gggaaagacg gccgtgatcg cctccgggaa ccccttgagg ccatcgacca    105240
     ccgccagcag gatgtcctcg acgccgcggt tcttcagctc gttcatcacg cgcagccaga    105300
     atttggcgcc ttcgttctgc tcgatccaca tcccgagttc gaccttcgtc ccgtcggcca    105360
     taacccccag cgcgatatgg atcgccttgt tgcggaccac gccctcgtcg cggatcttct    105420
     ccctgatggc atcgaagaat accagcggat agaccggatc cagcggccgc tgctgccagg    105480
     ccgtcacctc gtccagcacg gcatccgtga tcgtgctgat cagttccgcc gaggcatcca    105540
     tgccgtaaat ctcgcgcaga tgttccgcga tctcccggat gcgcatcccc cgcgcataca    105600
     tcgagatgat cttgtcatcg aagcccggaa accggcgctg gtatttggcg atcagttgcg    105660
     gatcgaagct acccgcacgg tctcgcggga tcgcgatctc gatctttccc gtgccggtca    105720
     acaccgactt gcggccgtag ccgttgcggc tgttctccgc ctccgcttcg tcactcagat    105780
     ggtaatccat ctccgcgctc aagacccgct ccgccagggc tttcttcagc gcgttcacca    105840
     ggtctccaga attcagcgct gccgccgcgt caccaccagc cagaagctgg tccagcaaat    105900
     cgtccgggat cgccggtgcc gtccgtcgtg ccatatgggt cttcctttct acccgctatg    105960
     ccactcacac acgaaattca ggacactgcc tctcatccgt catccgcgcc cgaccaccgt    106020
     cgcttgcccg cgacccggcg atctcatccg tcatccgcgc ccgaccagcc gcttgcccgc    106080
     cacccggcga tctcatccgc cacccccgct ccaacaccgc cgttttccca ccatcccgct    106140
     cgcccgccac cccgctccaa caccgccgct ttcccaccac cccgctcgcc cgccaccccc    106200
     gctccaacac cgccgttttc ccaccacccc gctcgcccgc caccccgctc caacaccgcc    106260
     gctttcccac caccccgctc gcccgccacc cccgctccaa caccaccgct taccccacta    106320
     ccaacaccaa ccccatttcc acccaaccca ccacctcttc cgccacccat tcctcaccac    106380
     tccttacccc cgttactgcg tctagtttcg acagatagtg ttgttctgta tgtcgttagt    106440
     ccggcaggac aatttgaacc cacattgaat cctgttttat gccgatattt caccaatatt    106500
     ggtgatttat cgcatgacgc tattgcgaaa gtgctgctgg ctcagaacgg ctggcagcct    106560
     ctattcccat gttaaatatt gggtaatttt tggtggatta ttggtgattt acagcattca    106620
     atgttgtcgg ttttatcgcg ctgtaacgcc cctatcatgt tgataattca ccataatcca    106680
     agatatcttc ttatcatgtc atttatgggc agtttgcccg gcactaaccg ggactattcg    106740
     cgagcgcatt tcctctgatt tttctcaggc gtgctgtgca acctgacatc gtgcgggcgt    106800
     gatggcttac cggccgaacc tggctgtttt tggtgggctc tacgatgtgt tggcgttgga    106860
     tgtggcagag atcgggaccg gacggggcaa acgcccctgg gatcagctga ccagcctggg    106920
     cagtctggcc ggggcatagc cgaggattgc ctggtccggc attgagcgcg gcagatgcat    106980
     gcggatcgag cgtttcaggg tttcgaggcg gacggcgagt ttgatcaggc gcaggtgcag    107040
     ggtattgaac tggataccac gccagcgcga ccgacgcggc atcagggagc gaaaactcca    107100
     catcagccag taggcgccga tatgcagaaa caggcgcatc tggttggcgc tggcccgcga    107160
     gcacgaggtc cggtcggccg caagattggt cttccacgcc ttgatatggt tctcggcctg    107220
     gccgcgcgcg cagtagatct cttgatacag ggtgcgcggg gaaccagcct tcaggctggt    107280
     gacgatgaag cgggtatcgc cccccagcgg ccaggcctcg acgcgggcga tgatccgctc    107340
     gacgcggtcc cagcttgctg cgccatcatt gaactctttg aaccgccgga ttttctctcc    107400
     cggagcctgt tgcgcgcgcg ccgtggtgct ggtcatgacc cggcgctcga cgatgttcag    107460
     cacgcggaac cgacagctgc aggcgaactg gtcgtgcacg aagtcaagcg accagcgggc    107520
     attgagccgc gtctcgaaca ggatcggcgc gcgtgtgctg gtctgagccc caagttcccg    107580
     ccattcacga gtagagtctc atccccaagt gatgcccacg attgggcgta ggtgcaacag    107640
     ccgggttggg ggttaacccc caacccggcg cgccgatgat ttttcccgcc acctggacac    107700
     ccgcattaac cctgtgagtg ttgttgaatt cgtgattcac tgaggcggtc gtgaattgga    107760
     ggcgtgtgga tggaggcgtg gtcgctgttc gggctttcgg agcatcttga gcgtctgagc    107820
     aagaccgggg acccgctgga ggttctggaa gcgacggtcg atttcgagca tttccgtggc    107880
     tggctggttg aagggctggg ctatggcgac ggagccaggg gtggccgccc gcccttcgac    107940
     cctgtttcga tgttcaaggc gctgatcctt caggcccagc acaatctgag cgatgccagg    108000
     atggagttca tgatccggga ccgcctgtcc tggatgcgct tcctgcgctt tgatcttggc    108060
     gggccgacgc cggatgagaa cacgatccgg ctgttccgta acaaactgac cgagaccggc    108120
     acgctgaagc gggtgatgaa ggcgttcgac tggcagttgc agaagaaggg ctacatcccg    108180
     atgtcgggcc agatcgtcga tgcgtcgctg gtgccggcgc cgaagcagcg gaacacggac    108240
     gcagagaagg aagcgatcaa ggccggcaag acagcgcgtg agatctggcc ggacgagccc    108300
     cacaaggcag cgcaaaaaga cacggacgcg gtggacgctc aagatcggcg gcaagatccg    108360
     gtatcggccg gacggcacgc cactgcccca gattgcgctg ccggtgttcg gctacaaatc    108420
     ccacatcgcg atcgaccgac gcttcggctt catccgggag agtgcggtga cgtcggcatc    108480
     ccatgcggat ggccgggtgc tgccgcggtt ggtgacgacg gacaacacct cctcggaggt    108540
     ctgggccgac agtgcctatc gctcgcagaa gaatgagaaa tggctggctt caaggatgct    108600
     ggtcagccgc atccacaggc gcaagccggc gggcaagccg atgccgcaca atatcgcgcg    108660
     ggccaatgcc gcgaaatcgt cgatccgtgc ccatgtcgaa cacgtcttcg cccaccagaa    108720
     gaacaggttc ggcctgttca tccgcaccat cggcatcgcg cgggccgagg cgaaactcat    108780
     cctggccaat atcgcctaca acttcgaccg gctcatcttc catgaacgcg gccgagccat    108840
     gggatgaatc cgtccagacc tcgggattgc ggccccgatc gcggcctccg cgacccacgc    108900
     cgacggtcaa ataaggccct tcaaacggcc cagagcgccg catcaagatt cagatccaac    108960
     aaaccgctca atccgcaagg gtaaatacgg gtgtccacct ctgccggggt tttgttgccc    109020
     aggctcgaat gggggcggtg atgattatac aactcgatcg cagcacgccc acaggacgga    109080
     agagcgtgaa cttctctatc gttggcaccc ttggacgggt cgacaggtgc atgttcacga    109140
     ggtcatcgag aaggccggct gggcggcgtt tcgctgtagc ctgacgggca ttggttccga    109200
     acggcggctg gaggttccgg cgtggatgtt cgaccgggcc atcagtcagt cctggcggct    109260
     ccggcctgtc ccaatcgcgt cggctgcggc gttggcagcc ttggcggcat tgctgagcga    109320
     cgcggcggag gtttgtgggg ggtcatcggg atcgagacat tcgggcgcag catcggagtc    109380
     cccaaaggcg attcccggag acacccatgc cgcgccgacc gacaccccag caacccgacc    109440
     tcttcgaccc gccatcggat cccgagcggt tcccgacgcc gcaatggcag agcttgcccg    109500
     acgaggtgcg gctgacgctg accgagttga tggcccgctt gatcctcgac cacgccatcg    109560
     acgcggcccg ccaacggaag gacgcgggac atgatgcatg agaagatcgg accgcatcat    109620
     ctggagcgca aagcgctcct ctatgtgcgg caatcctcgg cgcatcaggt gctgcacaac    109680
     cgcgagagca gcgccctgca atatgcgatg cgcgaccggc tcacggtgct cggctggtcc    109740
     tccatcgaga ccatcgacga tgatcttggc cgctcggcgg cgggcggcgt tacacgggcc    109800
     ggcttcgacc ggatggtggc cgaggtttgc ctggggaaag tcggtgcagt tgcggcgcgc    109860
     gaggtctccc gcttcgcccg caacagccgc gactggcagc agttgatcga gatgtgccgg    109920
     gtcgtcgaca ccgtcctgat cgaccaggag acggtctatg cgccacgcca gagcaacgac    109980
     cgtttgcttc tcggcctgaa gggcagcctc aacgagtacg agctcgatct tctgcggcag    110040
     cgctcgctgt cggcccgata cgagaaggcc cgccgcggcg agttgctcgt cgctgccccg    110100
     gtcggcttca tgaaggccgg cgacaggctg gagaaggacc ccgatcgccg cgtgcaggag    110160
     gccattactc tcgtcttcga caaggtggct gagctcggca gcgcccgaca ggctctgctc    110220
     tggttcctgg agcacagtct ggatctgccg gcccgacgcg ccaatggcga tgtggtctgg    110280
     cgcaggccga cctacgccac catccaccgc atgatcgaga acccggtcta cggcggcgcc    110340
     tacgcctatg gtaagactcg cgtgacgccg cggcacgacg cgatcgttcc gcgatccagc    110400
     agtcgtcgca agcggcgcgg cgactggctg gcgctgaagc caggggcgca tgaaggctat    110460
     gttagttggg aacgggcaga ggcgatccgc acgatggtca gcgacaacat ccctgcgagc    110520
     cggcatcacg gagcgcccaa gcatggcgat gctttgctgg ccggcctgct gcgttgccgg    110580
     cgctgtggcc gcaagctgac ggtccgttat actgggacca atcacaatat cccccgctat    110640
     tcctgctggc ggggcctgct cgacaatggc gagccgcgct gcatcgcttt cggcggcctg    110700
     cgggtcgacg acgccatcga ggaggcattg ctgcgggtcg tggaacccgg cgccatcgcc    110760
     gccgccgccg ccgcagaggc gcaagctgcc ggccggcgag accaggtgcg cgaggctctg    110820
     gtgcgcgatc tcgaagcggc ccgctaccag gccgatcggg cattccggca atatgacgcc    110880
     gctgatcctg cgaaccggct tgttgccgcg gagctggaga cgcgatggaa ccgcgccctc    110940
     gcgcaggccg ccgaggtcga ggcaaggatt gccgagcacg atgccgccgc cccaaattcg    111000
     tcttccctgg cggtgctcga cgccgccagg cttggtacga accttcgggc ggtctgggcg    111060
     gcgccgacaa cggattcccg gctcaagaag cgtatcgtcc gcaccgtcat ccatgaagtg    111120
     gttgccgata tcgatgacac agcctccgag atcgttctgc tggtccactg gattggcggt    111180
     gcccacacag agcttcgcct gccgacgcgg cgccgcggac agcgcaacag cacggcctcc    111240
     gagatcatcg ccgcggtgcg ccatctcgcg ctcatcgcct ccgacgacct gattgctggc    111300
     atcctcaatc ggaaccgcct gctgaccggc catggcaacc gctggacccg cgagcgggtc    111360
     acagccctcc gttcgcatca caagatccag gtcttccgcc ccgcgcccga cggcatcgaa    111420
     cctcagctca accttaccga tgccgcacgc ctccttggcg tggcgcccaa gaccctcagg    111480
     ctcgccgccg aggccggagt gatcgagggc gaccaccctt tgcccgacgg cccgtggatc    111540
     ttccgccggt ccgaactcgc caagccagcc gccgcgcaga tcactcatcg cgcacggcag    111600
     aaccccaaac accccgcggg atcacacccc gatcagaaaa acctatccct ctcaacaaca    111660
     tagacaaatg ggtcttatga aacaggattg tagtcgtgac gccaggcggc cagcacggac    111720
     ctcgcttgag gcaggctcgt gaacaaggtc tcgttcagac actcgtcccg gagccgggcg    111780
     ttgaagctct cgacgaaccc gttttgctgg ggcttgccgg gcgcgatgta atgccattcc    111840
     acgttccgct ctttcgacca gcgcaggatc gacatgctgg tgagctcagt gccgtcgtcg    111900
     ctgaccacca tgagcgggcg cgccccgcgc tcagtgatcg ccatatccaa ctcgcgtgcc    111960
     agccgggcgc ccgaaattga cgtgtcggcg atcaagcgaa cgcattcgcg gctgaaatcg    112020
     tccacgacgg cgaagatgcg aaacctgcgc ccacatgtca gggcgtcgga gacgaaatcc    112080
     agcgaccagc gctgattgca gccctgcgga atggtcatcg gagatcgtgt gcccaaggcc    112140
     cgctttcgcc cgccgcgacg gcgaacctga aggcgttctt cgcggtaaag gcgccgaaac    112200
     ttcttgtggt tcatggaaat tccttcgcgg ctgagcagcc agtgcaggcg ccgatagcca    112260
     aatcgacggc gctcgcccgc aagcacgcga atgcgttcgc gagcctccgc atcatccggg    112320
     cggcggcttt gataccgcac cgtggtccga tccacgccca gcgcatcgca ggcccggcgt    112380
     tggctcacct cgaacaggct ctgaagatga gctaccgcct cccgcttatg gctgggcgct    112440
     agaattttat ggaatggccc gcccctttcc cccttgtaga gtaatctgcc gggggccaac    112500
     ggaagaaagg gaggcaggca atgaagacag agatcgcggt tttagggatt gatctgggca    112560
     agaacagctg cagccttgcg ggactggatg ggactggtgc ggtgatcaaa cggcggcgga    112620
     tgcgaccgga gaccgtggtg acgttcacga aggagttgcc gccttgcgtg atagcgatgg    112680
     aggcgtgctg cggcgctcat catcttgccc gtcttctcgc ggcgcaggga cacgacgtcc    112740
     ggctgatgtc gccggaatac gtgcgccctt atgtgaaggc gcagaagaac gatgatcgcg    112800
     atgccgaggc gattgcggag gcggcaacac ggccgacgat gcgttttgtg tccatgaaaa    112860
     cggaggagca gcttgacatg cagaccctgc atcgggcgcg tgaccggctg gtcggtgaac    112920
     ggacggcgct gatcaaccag ctgcgagcga tcctgttgga gcgcggggtt acggtgccgc    112980
     aggggcggag caagctcgag cggtccctga tcgagatgtt cgatggcgat gaagccgagc    113040
     caccggcgac attgacgccg cggctgcggg cgctgattgc cgacatgcgg gccgaatggc    113100
     gtgagctgga tcggcggatc accgcttttg aggacgaatt tgtcgctcgc acgcgcgagg    113160
     acgaagcggc acgccggctg atcagcattc ccgggatcgg cgtgatgaac gcgaccgcgc    113220
     tgattgccgc gatcggcaac ggtgagacgt tcagccgggg ccgcgatctt gctgcctggc    113280
     ttggtctggt gccgcggcag atcacgacag gaggccgacc gcggctggtc gggatcagca    113340
     agcgcggcaa caagtatctg cgcaagctgc tgatccatgg tgctcgcgcc gctcttccca    113400
     gtctgttgac cagctcaacg ccgctcggcg gctagctgcg cgggctcacc gctcgggtcc    113460
     acaagaatgc agtggttgtc gcactggcca acaagctggc gcggatcgct tgggcggtac    113520
     tgagaaacgg cggcacgttt gatgccaagt ccgcatcagg gatggcatga ttagccggct    113580
     aatgatctcg ctaacttgat cgccggtcat gatgtttgcg ggtggtggaa tgaagatggc    113640
     ctgacagtcg accggcgctt cgggaacctg cttcaaaaaa tggcgcgctt gatgccgtga    113700
     attttatgag gaccggatcg cgcggatctc catcttggcc gggagcttgc tccgaggccg    113760
     gatacgttga cgcagactgg tcagttcatc gaaaatacca cttgcagacg gggcgggcca    113820
     tacgtttttg acgcaatttc cttgagcatg gcgttgtcca gcacggcgtc cgccaacagc    113880
     cgcttgagcc gagcgttctc gtcttccagc tgtttgagcc gccgggcgtc cgagacttcc    113940
     aacccgccga atttggcctt ccacttgtaa aacgtcgccg aactgatccc gtgtcgacgg    114000
     cagacctccg ccgtcgacat ccccgactcc tgctctttga ggatgccgat gatctgttcc    114060
     tcgctaaacc gactgctctt catctcgtcc gtctccctga tggggcggac tctactcatt    114120
     cctggaggaa atccacgggc tcagaccatt cgcaaccctt gtgatggact ttctgtagca    114180
     aattagaatg gcgaagctga tgcctacccc ttcaggctgc ggagcgggtt cttcaggtcg    114240
     ttaaaaagct taatagctcc ctaatgttga cagcagaaac cgacccaacc aagtcatctg    114300
     gagacagaac tacccatcgc ttaagcggcc attcgcaggt tcaagctggt gtgggctcag    114360
     cgcccgccaa ttactcaatt agctccagaa cgtatgctga aacggtgtgt acggagtgga    114420
     tagctagcct ggcatgtcac ggcttaatcg tgatacttcg cctttgttct tccgacttgc    114480
     cgtgcgcgcc gcttttggca ttgcgtaagt gagcgatgcc gtcgacgatg ttgttcaagc    114540
     cagacgcgat cttcttcagg tccttattgt cccaatcgac aggtcgcagc cctatctgct    114600
     cagttgctat cttccagagc tccgccagtg tccgtctcgc tgcgcagccc gacgttctcg    114660
     accggcggcg cgagagctga gcacgcatct actggagtcg ccaaccaaaa gcagaaaata    114720
     tacgcttatg ggtcgggaac gacgaagatg gacggtactc ctacgccata gcgacataga    114780
     gtacgctgcg gctctcttta atgatggaca gctccaccgc cgcagccaat cagatcagga    114840
     ttcgcatctc ggaaagtatt ggcaccacgg cagggcaaat ctatcagaaa cactcaatgt    114900
     gtctggcgtg atcgggcata caccctgaaa ggaagcgggc gtctatcagg atttgagcag    114960
     tttgagttcc acgaggctgg tcgctgtggc gataatcgcg tcctcagggg atcgcggagt    115020
     ccagccaagc aggcgctgcg ccttggcggc agtcgcgttc ttgcgtttgc caagctcggg    115080
     caacaagggc cgcacttcgg gatcgaataa tgcagctgcg cgcaacagcc agttcggcaa    115140
     ttggcgcgtg gatacggcgc aggcagcgtt gccaagacgg tccttcaagg tctgagccac    115200
     ttgagtaacg ctcatgaaat gtcctgcggt cgcaaggaat cgctccccgg ctgcggcggg    115260
     atcggtcatt gcccggagat ggagatccgc ggcgtcgcgg gcatccaaga cgccgaacca    115320
     caggtcgggg catcccggtg tgctgccttc catcatccgc tttatcaaat ggatcgacgt    115380
     cgacaggtca ggccctagta gtgggccaag gatgccggtc ggattgacaa ccgcgagttc    115440
     cagcgcaccg ccttcgcggt tcatgaacgc ccacgcggcg cgctcggcca gcgttttgga    115500
     tctctgatag ggctggatcg tcggatcgtc gggatcagtc cagtcatttt ctgtgaatat    115560
     ccccgtatgc ccgttgccat atccgatcgc cgcgaacgac gacgtgagca ccacccgctt    115620
     cacattggca tcgcgtgcta cccttaagac ccggagcgtc ccgtcccttg caggtctgat    115680
     taattcattc tcgtctttgg gaatactacg aggataggga gatgcgacat ggagtatata    115740
     atcgcagtta gcgatggctt cgttccagcc cgcgtcggca gtgaggtccg cagcgaaaag    115800
     agcaacctga tcggtggtaa tttccgctcc gccttgtcgc agcatggcct ctacggcgtc    115860
     cttccgccgt agatcccgca ccgtggctcg gacctcgtgc cccgccgcga gcagttggat    115920
     gatgcaatgc gcgcccagaa accctgtgcc gcccgtcacc agaacccgtg ccatatcgtc    115980
     tccttgcctg acctgagaca gagccctaca ccttcaacca acgtttaagg tcaaggactt    116040
     tcgatgcgca tcggtgatat cgcgcggcga tcaggtctct cggcgtcgcg tatccgcttt    116100
     tacgaacgtc agggcctgat ccccgtcgcg gcgagaagcg agaatggcta tcgggattat    116160
     cccatgagtg tactggagac gctcgacatg atccgtcagg cgcagagcct aggcttcacc    116220
     ctcgacgaga taagggcgga acttgtccag ggaggcggcg aaccgccggt cgggaagcag    116280
     atactcttgg cgctccacga aaaacttaag gtgctcgaac agcatatcaa ccagatgacg    116340
     catcgtaagc agcgcatcgt ctcacttatc gaaaaatacg aagcctctca cagctagaaa    116400
     cagtcaacta aggtagcgag accactgctg cacctgtgac ctattgtggt cgatcgtaag    116460
     cgcagtctga atgacggcct tgcgttggcg agtgagcgct acgcggcggc tggtagagcg    116520
     gcctgagttt tccaggccca aggcagcagg gtgtcgattt cgttggcctt agtatggccg    116580
     gcgacgatgc gttcgaggat ttcggtgagc caggcgagcg gctcgacgcc gctgagcttg    116640
     gcggatccga tcagcgtcgc catcagcgcc cagtgctctg cgccggtgtc gttgccggcg    116700
     aacagggcat tcttccgtcc catgctgatt ccgggctcaa ttcgcccggg attccgatat    116760
     taactcgccc gggattccgg gaattattcg cccacctatt ccgagattaa ttcgcccacc    116820
     tgttccgact tttattcgcc caggcgggcg gggttggccg ggtcggattg aggtctctgc    116880
     tggctggttc aggttccctc cctttgtctg atcgagggag tggatgaatg ccagtggagc    116940
     ggattgcgat gcgcgatgtg cgcgagattg tcagattgag gatggcgggg ctttcgaccc    117000
     gccaggtagg gatccgggtc ggggttgcgg catcgacggt gcgcttgacg ctgcggcgac    117060
     tggaggcggc cgggctcgat gggccagggg ctctggcgct gtccgaagcg gccttggaaa    117120
     ggcgcttgtt cgaaggctcg gcgggcaagc ggccggggca tcgacgtgtg gatgagccgg    117180
     actgggggcg tatccgccgc gagttgcagc gcaagcacgt gacgctgtcg atcctgtggg    117240
     acgagtatat cgccgagcac ccggacggat atcgctacag ccggttctgc gagctctacc    117300
     ggagctggga agcccggcta ccggtgacga tgcgccagac ccacgcatcg ggcgagaagc    117360
     tgttcgtcga ttatgccggc gacacggtgc cggtggtgat cgaccgactc accggcgaga    117420
     cgcgtgcggc ccagatcttc gtcgccgttc tcggcgcatc gagcttcacc tatgctgagg    117480
     cgacctggac ccagaccctg ccggactgga tcgaggcgca taatcgcact ctggcagcaa    117540
     ttggcggcgt gccggcgctg ctggtgcccg acaacgccag ggtcgcgatc atccgcgcct    117600
     gcctctacga tccacaggtc aaccggacct acaccgatat ggcgcgccat tacggcacgg    117660
     ccattctccc ggcgcggccg cggcggccgc gtgacaaggc gaaggtcgag gtggcggttt    117720
     tgctggcgga gcggtggctg ctgggcaagc tgcgcaaccg ggcattttac agcctcgccg    117780
     aactgaatgc cgcgatcgct gaattctgcc gctggctgaa cgaggagcgg gtcgtccgtc    117840
     gcctgggggc gacaagacgg catctgctgg aaacactcga tcgtcccgcg ctgaaggaac    117900
     tgccggccga accctatgtg ctggcgcaat ggcggcgccg gcgggtcggc atcgattatc    117960
     acgtcgagat cgagaagcat ttttactccg tcccctaccg gcacgcccgc gccgaggtcg    118020
     aggcccggtt caccgtgcgc acggtcgaga tctttctccg tggcgagcgg atcgccgtgc    118080
     atgcgcgcgg gtcgggcaac ggcaagcaca cgacgatcgc cgagcacatg ccctcgagcc    118140
     accggcgtta cggcgactgg accatcgcgc ggatccatca ggaagccgca cggctcggcc    118200
     cgtcggtcgc gacactctgc accctgatcc tcgaacgccg gcctcatccg gagcaggggt    118260
     tccgcgcctg catcggcatc cttcgcctgg cccgcagtgt tggcgccgac cggctcgacg    118320
     ccgcagccga gcgcgcgctc accatcggca ccctgaccta cggctcggtc aaatccatcc    118380
     tcgatcaccg gctggagcga gccgccggca ccgccagtcc cgatcccacc ccgatccgcc    118440
     accccaacat caggggcggc ggatatttcc actgatgaca aggagaagcc tcatgctgaa    118500
     ccatccgacc ctcgatcaga tccaccagct cggtcttgca ggcatggccc gcgcgttcac    118560
     cgagctgcac gccaatcccg aaacccccag cctcagtcac gccgaatggc tcggccttct    118620
     gctcgaccgc gagatcaccg tccgacgtga caagcggttg agcacaaggc tgcgccatgc    118680
     caagctgcgc catgacggtg caatcgagga tgtcgattac cggagtgccc gcggcctcga    118740
     tcgggctctg ttccagaagc tgatccaggg tgagtggatc gacgcgcacg acaatctcgt    118800
     cctgagcggg ccgacagggg tcggaaaatc ctggctggcc tgcgccctcg gtcacaaggc    118860
     atgtcgtgat gacaggagcg tgctctatca gcgcgcgccg aaactcttca ccgaactcgc    118920
     actcgcccgc gccgaagggc ggcacggccg gatgatccgc actctcggca ccgtcaatct    118980
     gctgatcctc gacgacttcg gccttgcacc gcttgacgcc agcgcccgtc acgacctgct    119040
     cgagatcgtc gaggatcgct acggccgtcg cgccaccatc atcaccagcc agatccctcc    119100
     ggcgcattgg catgagctga tcggcgatcc gacctacgcc gacgccattc tcgaccgtct    119160
     gctccacaat gcccaccgca tcgaactcac cggtgaaagc ctgcgcaaga cccgcaagca    119220
     aaccccaaaa accgcttgac ccaacaagaa caggagagca acgaaatcaa cagccacaga    119280
     gaccgctacc cgggcgaata aatctcggaa tccccgggcg aataaacgtc ggaatcgtgg    119340
     gcgaattaaa atcggaatcc atgggcgaat tctccggaat ccgcagctgt ttcccaaccg    119400
     gggccgcctc ggcctggttg ccggcacccg cgaactggtg gccgtgtggc cgtatctgat    119460
     cgtctacgag accgacatga acgctgattt ggttcgaatc ctccgcatct ggcatggcgc    119520
     cagagactgc ggtgacggat taccgtgaga tcgatacggc cccttcaggg ccgtcttggg    119580
     ggtcagggtg ctcactgaac gggtgccgca ggttgagccc tatgttcgtg aggtcaccga    119640
     gaaggccggc tgggcggcgt ttcgctgtag cctgacgggc attggttccg aaccgcggct    119700
     ggaggttccg gcgttgatat tcgaccgggc catcagtcag tcctggcagc tccggcctgt    119760
     gccagtcgcg tcggctgtgg cgttggcagc cttggcggca ttgctgagcg acgcggcgga    119820
     ggtttgtggg gggccatcgg gatcgagaca ttcgggcgca gcatcggagt ccccaaaggc    119880
     gattcccgga gacacccatg ccgcgccgac cgacacccca gcaacccgac atcttcgacc    119940
     cgccatcgga tcccgagcgg ttcccgacgc cgcaatggca gagcttgccc gacggcacac    120000
     cggatctagg cgtgcagcga tgcgccttta actgccttat ccacatcctt cttcaagcca    120060
     cgcaaagcga gaccaacgag atcgggcacg tcagcaggct cagccttaaa aactgcacgg    120120
     tttgccgcat catggccagt tgagaacatc gcccgaacgt agaccgccct gatgacgttt    120180
     cgctcgatgg cttgcccata tgcgcgctga agcacctcgg tattggcggc gaagatcatt    120240
     atcggctggc cgagcagccg ggcgtgctga cgcccacgcg cgtcctcata tggctccccc    120300
     atcgcttcgg gcgccgcggc tgcgatgcct gtggccagga aagccgtaac gtttagcttt    120360
     tgccagaccg ccagatcgtt taggatcaga atggcgactt ttgtatcgaa gttcatgtag    120420
     atatccgttg ccagttggga aacgaacatc tcacccgact ttggctttgc agtctggaac    120480
     attcgtgcag agggcgcgat acgccgcggg cgtaaggccg tacgcacgac ggaatcggcg    120540
     gcccaggtga ctctgatcgg cgaaaccgca ctccaccgcc acggtggcgg ggcgcatccc    120600
     ggtcgccagg agctgacggg cgcgcagcag gcgaatttgc atgagatagg aatgcggtga    120660
     agtaccgtaa gctgctcgga atgcccgggc aagctggaag cgactagccg cgcctgctgc    120720
     cttggccaga ctattggcgc cgatatccct tgccattgtg tcgtgcagca gctcccgtgc    120780
     tagacgcgct acacgtgcgg caccgccgcc aggggcgtct cgccttggac gaccgagatg    120840
     cggacgcagg cggtccagca cggcgtcgag ggccgcgtct cgtatgaggc gctcgctcga    120900
     atggaacaac acaccgcagg cggcacggat ggaatgggcg aggagcgggt cgtcacagag    120960
     actggcggcg aagcccggat cgccgccgta cgcatccatc aggccggccc gcaaccatga    121020
     acgcggcaga tagatcatag agtaggcgaa cccgctggcg tcccccgctt gtccgtcatg    121080
     ggcttcctgc ggctcgatca gaatgacacg ccccggtgtg ctgcgccggc gggcgccacg    121140
     gcagatgaaa tcctgaacac cgctctcggt gacgccgact aaccagtcat cgtggcggtg    121200
     aaggtcatag gcatgcgcca tgaatcgtgc gtggacggct tcgatcccgc tcgcggtgtc    121260
     atgggtcaga caaatgcggt cagacataga attcatcgca gaaattatgg agcgtatcgt    121320
     tggctttggc ccagtcgtga tggcacatcc gagatgctaa acctgcgccg atgatagata    121380
     agctctcaac ttagctcaaa tggcccgggt tgacggttac actaaagcat ttttaagcgc    121440
     ttggattggg tggtccgttc gaaagttagt ctccgatttc gctagcctcg atcgagcctg    121500
     gcgaaagcat agtagggtca taatattccg caggagtaag atggccaaga gccatacgag    121560
     gtcagctctc attatattcc cttcgccacg cattgatcag ccgccggaga ccgaagtaaa    121620
     gcagtgcttg caactgcaga tccacccata tggccaagag ccatacgagg tcagctctca    121680
     ttatattccc ttcgccacgc attgatcagc cgccggagac cgaagtaaag cagtgcttgc    121740
     aactgcagat ccacccatag agataatagc tctgctcagt aacaccggtc cggcagcacg    121800
     catccgcagc cgtcccgcca tgtgccagca taatctcggc ctcgcgcagc ttgccaatta    121860
     tctcctcttg cttgcgattt tgaactgatg gtgtgatcgc tgccgctttg ctcgcctggg    121920
     tggtagtcac tcacggcacg cattgtattc acaactgaaa gccttctcgg agggtcagat    121980
     cccttcggcc gtcgcgaagg atgatgctac gcaagtcgcc tctcgttcgc cgataatccg    122040
     tagcgcggcc tcggccgcgc gatggacatg gtcccggcag gcggcgccgg cagcggccgc    122100
     atcgcgccgg tcgatcgcat cgacgatgcg accaagctcg gcgacagtgt gcggcagcct    122160
     gccgggcgcc gagagcgagg tcgcccgaag ctgggaattc cggttcaaca actggccgag    122220
     gatgcgcgaa acataagcgt tgcgacaacc tgcggtcagc acgtcgtaga aacggcgctt    122280
     gatgtcgagc agggtttcgc gggaagtcgc gggaccggaa gcagccaatt cctcgtaaat    122340
     gtgccgcagc gccgcgcgtt caccagtggt tgcccgacgc gcgaaaccct cgccggccag    122400
     accttcgagt gccgcacgca gttcgtagat ttcttccgcc tcggtcgccg agatactggc    122460
     cacgaagggc ccgcgattag gatggacgac aaccaagccc tcggcttcga gtaaccgcac    122520
     cgcctcgcgc acgatgctgc ggctggcacc gaaggtctca cagagcagcc ggtcggacag    122580
     atgggcgccg gccggaaata ctcccgcgat gatagctttg cgcaagccgt cctcgacctg    122640
     tctgcgcatc ggctgcggga tgattttcag ggctttacgc tgcgtcatcg aaaagcggct    122700
     tcctcctcgg tcatcttggt cagaccaacc ttttatagag agatagcccg aggcgcggaa    122760
     gcgaggccac ttgattaacc ttataaattg tcatattgtc ggacaatcta gcggcgcaac    122820
     tggccgccca attggaaaag gggtaggaat gtcagaagac aaggctttgt tcgacaaggg    122880
     tttgcccatc cgccgcgcgg tgctgggcac tgactatgtc gacaattccc tagcgagggc    122940
     cgacgagttc atgatggcat tccagcgggc gaccaccgca tgggcctggg gctgggcctg    123000
     gggtgacgat acgctggacc gcaagactcg cagcctgatg aacctcgcga tgcttaccgc    123060
     gctgggcaaa gcgccagaga tcaagcttca tgtgaagggc gcgcttaaca acggcctgac    123120
     cgtcgacgag atcaaggccg cgctgctgca cgcgacggct tattgcggca ttccggccgg    123180
     gcttgatgcg ttcaaggcgg cgcatgaggt gctggtcgcg gaaggcgtgc ttccccagaa    123240
     gaagtccgct tgaccatggc acagcgtgtc gccttcatcg gcctcggcaa catgggttgg    123300
     ccgatggccg cgcgcttggt gggcggcggc tgcgaggtga ccgggtgcga tgctgtcgaa    123360
     ggccgcgccg aggcttttgc ccgcgaggtc ggcggcaccg cggcggcgga tgccgacgcg    123420
     gctgcgcgcg gggccgaatt catcgtgacc atgttgccga acagcgcgct ggtggaaagc    123480
     gtggtcgcgg cgatgaggcc ctccctcggt gccggcgctc tgctaatcga gatgagttcc    123540
     ggaatccccg gtgtcacgcg gcggatcgcg gcggggctgg aggcggcgaa ggtcgcgatg    123600
     atagatgcgc ctgtatcggg tggcgttgct cgggcgaaga ccggcgatct ctcgatcatg    123660
     accggcggca gcgcggacga ttgtgcccgt gccgagacgc ttctgcggct aatggggaca    123720
     accataaccc atgtcggcga tatcggtgct gggcaggcga tgaaggcgct gaacaatcta    123780
     gtttccgccg gcggcttctt gatcggcgtc gaggcgctgc tgatcgggca gcgcttcggg    123840
     ctcgatccgg cgcagatggt ggatgtgctg aacgcttcga ccgggatgaa caacagcacg    123900
     cagaagaagt tccgccagtt cgtgctctcc cgcaaattca acagcgactt cagcctcgac    123960
     ctgatggcga aggatctttc cattgcgctc gaagtcggtc gcgatggcgg catcgcgacg    124020
     cccttcgctg cactatgccg cgagatgtgg gcgagtgccg gggcggcgct gggcaagggg    124080
     caagatcata cggcgatggc acgattctcc gagcttctcg ccggcgggat gctcgctgac    124140
     gcggaaatgg gcgacaaacc gcccgaaggc tgagacttcg gacgtggcaa aggtcgccgc    124200
     cgaaacaacg ataagcaagg gaaacgccat ggcttcatac gcagataccg cccggcctga    124260
     cgcactcgcg gtgccgatcg aagagcgccg ccgcgccgcg atccgcgggg ctttcttttc    124320
     cgaatacatc gacatgttcg atatatacgt gccgatcgtg gtgctgacgc cggtgctgtt    124380
     cttttttcag cccgcgcact tgccgcccgg cgaggaggca ctgctggcgt cgctggtgtt    124440
     catcaccacc ctgcttggcc ggccgatcgg cgcgttcttg ttcgggctgg ttgccgaccg    124500
     gatcggccgg cggatggcgt cgatctattc ggtgtcgggc ttcgggctga ttacgctgct    124560
     gatcgcggcg ctgccaggct accagagcat cggcgtcgcc tcgtactggc tgctggtgct    124620
     gctacgcttt ctcgacggca tctgcctcgg cggtggctat accggggcga tgccgctcgc    124680
     aatggagtat tcgcgcaaga gcgagcgcgg cttcgccggc gggctgatac tcgccgcttt    124740
     tccggctgcc tatgtcacga tcaacctagt cgcgatggcg gtgtttgctc tggtgccgtt    124800
     gcatggtctc gattcgccct atgcccagtg gggttggcgc ataccgtttg tgatcggcgc    124860
     ggcgctcgcc gggatgctgg tgctttacta tgtgttcaag gtctccgaat cggaaatctg    124920
     gattaccgaa acggccgagg gcacgcagaa actgccgctc actgacctga tcgctgggcg    124980
     gagcgggcgc aacctgctgc aggtgctgct gttgatgacc ggcttctggc tcacccaaaa    125040
     cctcattacc atcttcattc cggcaacgtt gctattccac ttcctgcatc tgtcgaaatt    125100
     ccagctcacc tcgacactac tgatttccta cgcactgcta ttcttcagct acatcggttc    125160
     gggcatgctg gggcagaagg ttggacggcg gcgctttttc gtagtcgctg ggccgctgat    125220
     cgcaaccgtt ggcgcggcga tcatgtatgt tctggtcggc gtgccgggcc tttcgctgcc    125280
     gatgatcatc gtgctggtct gcgtgctctc gatcttggta acctcgccct ggggagttat    125340
     cgtcacatat attaacgagc ggtttgctac agacgtgcgg gcaacaggat tcggtgtcgg    125400
     cttcagcctt tccgtcatca tcccgtcctt ctacgccttc tacatgagct ggctcggcta    125460
     tctgatgccg ttccgctaca cgccggtggt tctgctagtt atcggcggct tgatcggcat    125520
     ggtcggcgcg ctgctcgggc cggaaacccg ggatgtggat ttttgaggag ttcccgatga    125580
     accaaccgga aattctcgcc gtccgctacg gcacccgcaa aaccgagaaa agtgaaatat    125640
     attacgacta cgcacgctat ggcgaggccg acggcgaagc ggtgatggat tattacttct    125700
     ggattctccg cgacgggacc gaaaccatcg tgatcgacac tgggttttcc gcagcctcgg    125760
     gcgccgcacg caaacgcgac accactatcg ccccagcggc cgcgctggcg cggctgggga    125820
     ttgatccggc gtcggtgcgc gacgttatcc tgacgcacgc gcattacgac catacgggca    125880
     atctcgatct gtttccgaat gcgctcatca ccatgtcccg caccgaatat gcgttcatca    125940
     gcggcccctt tgccgatcgt gtgccgctcg ccgttgcgat ggacagtgat gacaaccgag    126000
     gcatcgtgcg cctgcacgaa gccgggcgga ttaagctggt cgggccgcgc cacgaattcc    126060
     ggccgggggt cgagttgatc gagctgccgg gccattcgcc agggcagatg tcgctggtga    126120
     tcgcacggcc ggatgggccg gtcattcttt cgtcggacgc ggtgcattat tacgaggaac    126180
     tggagaagga ccgacccttc acggtgatgt ccggcttgct cgacatgtat cgcagcctcg    126240
     acgccattcg cgtgatgcgg gaaacgccag gggctgttct ggtgccgggg cacgaccccg    126300
     aggtgatgcg ccgctttacg ctggtcgacc cggccgatcc cggttttgcg gtacggatcg    126360
     gatgagcgcg gcgaacacat tcttctgcga caaagttgcc atcgtcaccg gcgcgggagc    126420
     cggaatcggt gctgcgacag cccggctgct cgccgccagg ggcgccaatg tcgttgtcgt    126480
     agatatcgac ggggcggcgg cagaacgcgt cgccgctacc ctgccctccc ctgccatggc    126540
     ggtcgcggcg gatgtcgcga ccgaggatgg ggtggcgcac tacatggaag cggcggcggc    126600
     aaggttcggc cgggtcgacc tgcatcacct caatgccggg gtgatcggca agttcaccgc    126660
     ctttcccgac ctcgacgtgg cagatttcga cgatgtggtc ggcgtcaacc tgcgcggccc    126720
     gttcctcggc ctgcgggcgg cgttccggca atatgcgcgg caggatagtg ccggcgccat    126780
     cgtcgtcacc gcctcgatcg ccagcctgcg cggcagccac gacctcgtcg cctaccaggc    126840
     ttcgaaacac ggggcgctcg gtgtcatgcg ctgtgcggcg atgtatgggg gcccgctcgg    126900
     catccgcgtg aacgctgtcg cacccggcct ggtgccgacc gaattgttcg ccgcgcagaa    126960
     gagcgcgcaa ggcggcggca acgatatggc gcagcgcggc accaccgtgc cgctgcgccg    127020
     caccggcaca ccagaggaga tcgccgccgt cgtcgcgttc ttgctgagcg acgaggcgag    127080
     ctacgtgcat ggcgaggtga tttcggtcga tggtggctcg gccattgtca gcaccgtgcg    127140
     gccagccggt ggtgccggcg cctggaatac agaggcagtg gaccggcgga cggaactcac    127200
     caggtggcga caggacggaa cggaggatac caatcatgga tgacggcaag ccgatcggct    127260
     tcatcggcct tggcaacatg ggtggacgga tgacgcgccg tctgatcggg cgtggttacc    127320
     gggtgctcgg tcacgatagg gcagcgaatc tcgccgccga actcggtgcc gaaccggccg    127380
     gctcgatcgg cgcggtgatg gaacaggcgg cggtgatttt gctctcgttg cccgacagcc    127440
     gcgtggtgga ggcagtggtc gaaggtgaca acggcattct cgcccattgc cgcgcggggc    127500
     agatggttgt cgacctcagc acctccgccc cggcctcgac catccggctg cacgcgctgc    127560
     tcgctgagcg cggcgtgcag tttgtggatg ccgggatatc gggcggtgcg gcggctgcgg    127620
     acaagggcac gttgacgctg atggtgggcg gggacgccac ggtgatcgaa gggcttcggc    127680
     cgatcttcgc gagcttcgcc gccaaggtgg tcgcgatggg atcgagcggc gccggacaca    127740
     ccgccaagct catcaacaac atgctcaacg cagttagtct tgctgccacg gccgaggcta    127800
     tggtcgccgg caaaaaggcc gggctcgacc tgcgcgtgct gctcgacgtc atcaacgcca    127860
     gtagcggcgt caattttgcc tccctcaacc gctttcctcg catcgtcgag ggcgactacc    127920
     tggaaggcgg actgacagga aagctgatga ccaaggacat cgtactctat gtcgagcggg    127980
     cgcgggaact cggcgtcgcc tcactcaatt cggctgggcc gctggcgagc ttcggcctcg    128040
     ccaccgcgct cggttatggc gaccagatca gcaaccgcgt ggtcgacgcg atcggcgatg    128100
     tttccggcgg cgtcaggttg cacgaccagg aaaggacaat cgcatgaaga tcatcgaggg    128160
     ccgcgcggcg ggagcccctt cgcaggcacg gagcgacagt ttcaccggca cggtctgggc    128220
     agacccggtg ctgtcgatgc cgggcgagct ttccattaat accgtattct tcagccccgg    128280
     cgcccgcacg ttctggcata tgcacgagcg ggggcagatc ctcaacgtcc tcgctgggcg    128340
     cgggctagtc tgcaccgaag gcggccgtcc gcagccgatc cgcgctggcg ataccgtgtg    128400
     gattccggcc ggcgagcgcc attggcatgg ggccgccccc gacagctaca tgatccatac    128460
     cgcgacctcg ctcggccgca ctgactggca ggggccggtc gccgaacgcg actacgcgcc    128520
     atgacgcttt ccgaacgtca atcgaccctg aaggcccgct tcaccgccga acgcggtacc    128580
     tgggggccag gctgggacag catgctgcgg ctcgatcctg actttctcga atcctatctg    128640
     aatttctcga tggtgccgtg gaaggccggc ccactggaac cgaaagtcaa ggaattcgtt    128700
     gccatcgccg cagatgcggc ggcgacccat ctctacgcac cgggcatcgt gcggcacatc    128760
     aaggcggcgc tcgcccacgg cgccagccgc tcggaggtga tggaggttct ggaactcacc    128820
     agcacgctcg gcattcatgc cgcgaatatc ggcgtgccca tcctgctcga agtgctgcag    128880
     gaggccgggt tgcgcctagg gccgaagccg ttcgatgcga ggcaggagcg gctgaaagcg    128940
     gaattcaccg aggcgcgcgg ctactggcac gaattctggg ccggcattct cgaactcgat    129000
     cccgatttct tcgaggctta tatcgacttc tcatccgtgc cttggcggag cggagtgctg    129060
     gagccgaagg tgaaggaact gatctactgc gccttcgatg cctcggccac gcatctctac    129120
     gtaccggggc tgaaactgca catgaagaac gcgatcggtt atggcgcgac ggcggccgag    129180
     atcatggagg tgctggagat tgtcagcgtc ataggcattc atgccgcgac gactgcggcg    129240
     ccgatgctcg aagcggctct cgccgcttta tgaagttcga ggcggatcga ccggggagga    129300
     tcggtgcgcc gccggcgtcg atgaccgcgc cggcgtgcag gcagagatcc gcgcgatagg    129360
     cgctggcgat tatctgcacg ccagacgggg cgtcgccaac aaagcaggtg gcgacagaca    129420
     acgaccccgg atgatccaat ccttccggct tgctggggtg ggatgccgca gctagcatcc    129480
     tccgcgtcga tatatttaca ggaataaaga ccatgatcca cgaactccgc atctatcact    129540
     gtatgccggg tcgactgccg gaccttctga agcggttcga gaccgtgacg ctcggattgt    129600
     gggataagca cggtatacga caggcaggct tctggacgac gcttgtcgga gagtccaaca    129660
     tggatctcac ctatctgctg gcatgggaaa cccttgcgga gcgcgagagc aaatggaccg    129720
     ctttccaagc tgacccagaa tggctggcga agcgcgccga aaccgagaag aacggtcaga    129780
     tcgtggccag catcaccaat cagatcctcg tgcctacggc attctcggca gtacgctgac    129840
     gtcctacggc tgcgggggct tcaaaatcat gtcggtgccg ggggctgaag ggcagtgccg    129900
     tcggcccccc ttcggttgtt tgcctatgac agaagcgccg aaaaccggca cgtgatcagc    129960
     ggcaaaagcg tgatcggcca atacccacgt gagcctgaac ccgtttacgg cgacaccgcc    130020
     ttcagcagga tttgctgcgc cgcgtcgagc ttgtcggcga gcgcattcgg cacgccggat    130080
     cggcgaagca ttgcaccgat cggatgaaag gcaattaccg tttgaccatc gtcccgcacc    130140
     cggacaagca cacgcaaagg caaatccagt gcaaccaaag gggccgcgag catactcggc    130200
     gtgccgcctt tcgggtgccc gtaggcgagt accgttgtcg gtggcatgtt caatccggca    130260
     tcacgcgcac ctgcctgatg gtcgatctgg ctgaatatga caaggcccgc ttgtgcgatc    130320
     gcggccctca gacgttcgac cgtggctttg atctgccccc ttctgagtgg tccggtatct    130380
     gttttagagt ttggtctgaa ggaggactgg aatggcgagg aatcacaagc cggaagagat    130440
     catcggcaag ttgcgcgagg ctgagattgt tctggcgcag ggcgggacgg ttgcggatgc    130500
     gtgccgtcgg atcggcgtca ccgagcagag ctattatcgg tggcgcaagg agtatggcgg    130560
     cctgaagttg gaccaggcgc gtcgcatgaa ggaactggag cgggagaacg cccggctgaa    130620
     gcgtctggtg gccgatctgt cgctggacaa ggcgatcctg acggaggcga cacggggaaa    130680
     cttctgagcc ccgcgcggcg ccggcgctgt atcgatcaca tcagaggaac gatgtctgtc    130740
     tccgagcggc gggtgtgccg cgtgctcgga cagcatcgat cgacgcagcg caaggtgcca    130800
     cgcggggcgg atgacgaggc ggccctgacc ggggacatca tcgccctggc ccggcaatat    130860
     ggtcgttacg gctatcggcg ggtgacggcc ttgctgcgag atgcgggatg gcatgtgaac    130920
     cgcaagcggg tcgagcggat ctggcggcgc gagggtctca aggtgccgca aaggcagccg    130980
     aagcgctcac gcctctggct caatgacggg tcatgtatcc ggctgcggcc tgagtatccc    131040
     ggccatgtgt ggtcctacga ttttgtggaa ggacggaccc acgacggccg caagttccgc    131100
     atcctgtcgg tcatcgacga ggccagccgg gagtgcctgg ccctgccggt cgcgcgacgg    131160
     ctcaggagcg aggatgtgct gggcgctttg gccgagctgt tcgtcaccag agggccgccg    131220
     gcgcatatac ggtcggataa tggtcctgag ttcatcgccc gggcggtgcg gcaatggctc    131280
     gggaaggtcg gtgtgaagac gctctacatc acgccaggtt cgccatggga aaacggctac    131340
     tgcgagtcct tcaacggttc gctgcgcgat gaactgctca acggggagat cttctacacc    131400
     ctggcggaag caaagatcct gatcgagacc tggcggcggc actacaacac cgtcaggcca    131460
     cacaactcgc tcggatatcg cccgccggcc ccggaaaccg cgacgccgcc acggccgccc    131520
     tccggttccg cttcgctcca ccgacagccg gccatggcgg cggagacaac aatgcactaa    131580
     cctccaacac ggaccactca ctgggggccg gtcagcttcg aacgtgtgtg ccgattggca    131640
     ctcgtgaatg tctacgtcgc tcatgttgtt gcttcgccct ctatatctat ccacaccgtt    131700
     ccgtgatttg cgtcccgtgc gatgagagtg tggccgtcgc caaggctgta aaacgcgaac    131760
     agctgcggat ccagcgaagg agaactgggc accagacaag ggctgggcaa ccatctcctt    131820
     cgctacagac ggctatgggg ggggacttcc caccaatgat caagctgatt ttgggcgatc    131880
     ggtgggcatc ttctcgggat cgaacatgga tcggttggtg agcatgacgc atgcaatgcc    131940
     cagcaggcga tcggcaacgg ttctgagggc gcggccgtga gagtggccac gtcctcggag    132000
     ggcggcgtag cggctgcgac tgcgggcgtc tgctgggtgg cgacgcgggc ccagtgatag    132060
     acgacggttc gcaggcgacc agaacatgcc tgacgcatct ccacacgaca ggatctgccg    132120
     ctccgctttg tgaccggggc cacaccggtc agggtgcgca aagcctggta atctcgcgcc    132180
     tggagggctt gatgagcctc cgcgagcagc gtggcgagga caatccgtcc cacccccggc    132240
     aaggagcgca ggattgccgc gtcgcgctgt tcggtatctt gccccggctc ggtctccggt    132300
     ccggcaagtt gttcgaccag gccatcgatc cgctgcagga cagtcttgat ctgccgatta    132360
     acgaggttga ggcgctcagc cacggccgtg atgtggacgc gggccgcgtc ggctgtcccc    132420
     ggggcgacag tcagcgccgg ccgacgcaaa atggccaggg catcgtgtgc ggtgacgcgg    132480
     cggatacgat gggcggctag gacctttgca atcttcgttt cggtcaggcg catcgcatgg    132540
     caagaacgat cttcgctgtc ctcagggacg gatcacgcta tcggccacag gcgactgcct    132600
     gaccggctct cggaatggcc agggcaaagt gaggtgatgg cgaacaagcg gagatgaaga    132660
     accaggacac cccgatcaat ccgaagcgcg tcgagcgcgc tcgattgagt gggacctgtt    132720
     ctccaagcgg atattcatca gggcgcgcag cgatctcgtt gcacattcag acgccgcata    132780
     catgaccgca accgacccgt tcaccaaatc cgatccgaca ccttgacctg caggagccat    132840
     ccatacacgg gttgaaatcc ggcgagtatg gcgggaggaa caagagcgtc gcgccggcct    132900
     gttcgatcga gttgcgcacg ccggcggcct tgtgcgccgg caaattgtcc atgatcacga    132960
     gatcgcccgg cgtcagggtt gggaccagca tctgctcgac ataggcgcgg aacacggcgc    133020
     cgttcatggg gccgtcgtag acgaagggcg cggtcatgcc ggaaaggcgt agcgcgccgg    133080
     tgaaggtcgt cgccttccag tggccgtgcg gcacgccggc ccggcatccg gaagccaaat    133140
     agcaaatagg aacctgactc tgtgggagtt tcatgcccgt tcatgcggcg cggactcgaa    133200
     acggctctgt taccaccacc cgtccgacaa tatgtgatgt tgccattcgg caccggcgag    133260
     cccgctagcc gggtggaaga cggagacggt gcgggtttgg tcgcgattgc ggccgcgggt    133320
     ccggaaggca tcgtatggcg gacgttcccg atcaggcggc gtcctcgtcc ttcatgtgat    133380
     gcttgccagg cggtaccgtg tgttccagta ccgccatcgc cgcgcccacg ccgcccttcc    133440
     ggtacggcac acctgcgaga gcgaatccca tctccacccc ggccaacgtc cccatcaaca    133500
     tcagatcgtt gaaatgacct aggtgcccaa tccggaacac gcagcctttc agcttggcga    133560
     ggccggtgcc tagggacatg tcgaacttgt tgagaacgac ctcacgatag cggtccgcgt    133620
     catggccttc gggcatgaca accgctgtca gtgcgctgga atacgcatac ggatcgacgc    133680
     aaaggatctc cagttcccag gcccttatcg ctgcccgcgt cgccgccgca tgcctatcat    133740
     gacgcgcgaa gacagagtcc attccctcct cctgcagcat ggccagcgac tcgcgcaggc    133800
     cgtatagcag gttggtggct ggggtgtagg gccagtagcc gtcagcgttg gcagcgatga    133860
     tctcgtgcca gtcccagtag gaacgccggc tcgagttgcc ccgcgctgcg gcgagcgcct    133920
     tgtctgagac ggcgttgaaa ccgagacccg gcggtagcat cagccccttc tgcgagcctc    133980
     ccactgtaac atcgacaccc cattcgtcgt gccggtagtc gatcgaacca agggaggaga    134040
     tggtgtcgac taggaacaac gccggatggc gagccgcgtc aatcgcccgg cggatgtccg    134100
     gaatgcggct ggtgacgccg gtagaggtct cgttgtgcac caccattact gccttgatca    134160
     catgcccacg gtcttccgcc agtctggcgc cgatctctcc agggtcggcg ccgtgccgcc    134220
     agtcacccgg tatagtttcg acctcgagct tcagttttgc agccatcctg ccccagagcg    134280
     tcgcgaagtg tcccgtctcg gccaccagca ctcggtcgcc cggagagagc gtgttcagga    134340
     tcgccgcctc ccaggcgccg gtccccgacg agggatagat gatcacagga ttgccggtcc    134400
     ggaacacagc cttgcacccc tcgatgacct cgaggccaag acggccgaat tcggggcctc    134460
     ggtgatcgat ggtcggcatg tcgatcgccc gaagcacccg gtccggaaca ttggtcgggc    134520
     cagggatctg aaggaagtgc cggccggtat gcatggaatt aacccaagtc attctcttca    134580
     ttcagctccg agttgtgacg ttacgggcct gctcaccgcc gaatctgact gttcctggtc    134640
     tatgggcttg ctgcccagat agctggccag catcgagccg atgaccatgt tgagcatcgc    134700
     gttcatcagc gccggcagtg ccgcaaaggc gccaaaattg aggctggcca gaaccgcgcc    134760
     gagaccggag ttgtaaatgc cgacatcgaa catgatggcg cgagaattgg attcatcaag    134820
     gcgtagcagc cgagcgagaa ggtagccgac cgcaaggttg atgatggtga gaatggatgt    134880
     gacgatcgcg atgatcggca cccagtccag attccgggcg atcgcgggct gtgccttggc    134940
     aaccagccca agcgctagcg cgtagagcaa caaggccgaa atcatcggca ggaccggctg    135000
     cacaagcctg atacgctgcg cgccgagcgt gtagcgagcg ccaatgccga tgatcagcgg    135060
     caataggacc atcaccagca tctggtggaa caaagcgaaa aagctgaccg caacatattt    135120
     gtgggcgaag gcggtcgtga aggctggcgt caagagcggt gacagcagcg tgtggatgaa    135180
     ggtcaaactg atcgctaatg cgacggcacc attggagagg aaggtgaaga ggttggaggt    135240
     gacacctgcc ggtgttgcgc cgtcgagaat cgtgcctgcg gcgagttgcg gctgatttgc    135300
     gtagatcaga tgcgccgcga tgatggcggc tagcggaacg gtaatccact tgatcacgaa    135360
     gccagaaatc agaggtttcg gacgcgtaaa gacctgtttg gtcgcctcga tcgtcagcgt    135420
     caagctcatc atcaggatga ccgccgccag ataatagatg acgtagggcg cgaaggcgac    135480
     gaagacgtgc ggtgccaggt agccaagaac cccgcagacg accagccaga cgggcatcat    135540
     cttgttcagc agaaggcttg ctaacttcat gtttccattc ccttgaattt attattgttg    135600
     aagcgtgaat atcaggccgc cagatcctct gtatgattca cttctggcca tgattattca    135660
     ggaagatgca cttccatgga ggatcagaga attttaccgt cccttccagt cgggttgtcg    135720
     cttggtcagg aaggcgtcca tgccttctcg aaaatcctcg ctcatgtaac aggtgaggat    135780
     gaggtcattc gcctcgatgc gcgacagccg actaatccga ttaagcgcat ccttcgttac    135840
     ccgcagcgtg agcggcgcgt gccgcgtcat cgtttcagcc aaggccgacg cccttgcgag    135900
     caaggtctca tgatccggca gaacctccga gacgaggccg atgcgctccg cctcaccggc    135960
     accgatcagc cgcgccgtga agatcaggtc tttcacacgt gccgcgccga tgagggcagc    136020
     cagccgtgcg taattttcgg ctgacaggca gttaccgaga gtacgggcga tcggaaagcc    136080
     gaacttcgcg ctctcgctag caatccggag atcgcagacg gcagctatcg cagcgcctcc    136140
     gccggtgcat gcaccgctaa tcgcggcgat cgtaggagtg ggacaggtct cgagtgcctg    136200
     gagaacggca tcaatgcgcc gttcgtaagc aagtgcgtcc tcgggggttc ggaaggctcg    136260
     gaactggttg atgtcggtgc cggcggcaaa agccttttcg ccgccaccgg tcagtaccag    136320
     cgcccgtaaa tcaccggtgt cgccgcagat tgccgccaat cgctcataca ttgcgaacgt    136380
     aagagcgttg cgcgaggccg gtcggttaaa agtaatgtag ccgatctgac cgcgtacctc    136440
     gtagacaaga tcctcggatt cctgagtgaa ggcactcatt cggcggcctc cttgcgctcg    136500
     ggcattgccg cctgcgcggc gcccgaatcg atcattccgt cgatttcgac ttcggagaat    136560
     cctgcctcgc gcaggacctc gcgcgtatgc tgaccgtaag ccggtgccgg acggcgcaca    136620
     ttggccggcg tcgtcgagaa cttaaccggc agcccgaggg cgcgcgtgcg gccggccacc    136680
     gcgtgctccg tttcgacgat catgctgcgt gccttcacct gcgggtcctc ggccatctgc    136740
     tggacggtca gtaccgggcc ggctggaacc cccgccttgt cgagcgccac cagccattcg    136800
     gcggatgtct tctgccggaa gattgcctcc agtctcgcct ctaactccga cagattctcc    136860
     attcgtccgg cattcgtcgt gaagcgcgga tcggctgcga gatcgtcggc ctgcaacacc    136920
     gccaacagcc tcctccagtt gccttcattg gctgcaccga cggtgatcgg atcgtcgctg    136980
     gtacgaaaag cctggtaggg cgccataagc ggatgaccgg aaccaagtgg accgggcgag    137040
     gaaccggtgg cgaagctgat cgctgcatgc cagtagagat aggtgatccc tgcctcgagc    137100
     agcgaggtgt ccaccatctg cccctcgccg gtctggttcc ggtaattgag tgccgcaaga    137160
     attcccatcg ccgcgagcat cccggcgccg atgtcggcaa tcggcggccc aaccttcact    137220
     ggcgctcgcc ccggcccttc gccggtaacg ctcatcacgc cactcattcc ctgggcgatc    137280
     aggtcgaacc caccacgttc agcatatggc ccggtgcggc caaagccaga gatgctgcaa    137340
     tagatcaacc cgcgattgcg cgcatgcatc gcttcataac cgaatcccat gcgatcgagc    137400
     gcgcctttgc gatagttctc gatcagaata tcgctcgaat cgatcaggcg gagcagagcg    137460
     tctcgcccca gcggcgattt aagattgagc gctatacccc tcttgttgcg attcatcatc    137520
     atgaacgccg cagactcgcc ggcgactgag ggcggaactg cccgcctggt atcgtcgcca    137580
     cccgggactt tttcgacctt gattacctcg gcgcccatgt ccgccaacat catgccgcag    137640
     accggaccag ccattacatg cgacagatca agcaccctga ggcccgcaag tggtccggtg    137700
     gcattcgcgg ctttgccgtt cgtcatcggt ggccatcctc cgttttgcat gcaataaaat    137760
     gcattccacg ggtacttgca agctattaat gtcgataaga ggccattttg cattcatttg    137820
     ctctgcatcg cctgctcaca caagatcggc taaatgagga cgatggttca tgaagatgtc    137880
     gtcaccttta tccgtgaacg cctgatcgag ggtgagatcg cgcccggcgc tcgtattccc    137940
     gaacgagacc tttgtgcggc actgaacgtg tcccgcacgc cgctgcgcga ggcgctgaaa    138000
     gttctggcgg cggagggcta tgttgtcttg ctacctaatc gcggtgcacg cgctgcgaag    138060
     ttgacggtcc aggacgtgcg ggatctgttc caactgtccg cggcactgga atcggccggc    138120
     ggagaactcg cctgccagcg catcaccgat cgagagatcg cgacgatcgc ggaacagcac    138180
     gcaaccatgg cgagttattt cgcgagagga gatatgcaag cttattatgc gtgcaatcga    138240
     gccatccatg aggcgatcat ggcagcctcg ggaaatgcgg cgatgattaa tgtctatgaa    138300
     agtgtcagcg cccggatccg ccgcgcgcgc tacattgccc cgatgacgga ggcgcactgg    138360
     cgcgaagcgt tcctcgagca tgaggccatg ctgaatgccc tcacccgacg tgatggccca    138420
     atgctggcga tgattctgaa aacccatctc cgccacaaag cacaggaagt cgaacgcgct    138480
     ggcttcgccg ctgattgaga cagggcgttc ggcggtggag gacaccggat cgaagggagg    138540
     gtgcccacaa tcgcagcctg acagagcaga caaccctact caggagacct gctccgacac    138600
     cacaacacgg gacacgatcc gggagtcgca agttcaaggg atcagtacgg tacaccgtcc    138660
     ttgtgagtaa actgcccttt tccatcgtct cccatggcag cctctatgtc atccgacgga    138720
     tagcttacag catcgtcaga tgaccggtcg cctacctcca ggatcgcgca aacctgtgac    138780
     gtctggtttt ccagatggtg cgcagagctc gaggcgggaa agcccgcaac catccctggc    138840
     aggagcttca tctcaccagt atctgtaaac atggtcggct cgccctcaag aacatagata    138900
     aactcgtcct gccgagaatg ccgatggtga agagtggata tcgcacctgg ttcagtgaca    138960
     aagcgacgcg tcaagtggct cactcaagtc tcttgcgtcc ggtcaacatc gactgaacga    139020
     gattttcccg gtgaacgaca cttgcagcgc caacgccgag cacatgcagg ccgatcaggg    139080
     tgagagtcag attggcaaga aaattgtgca gattctcaaa gagttcttca ttcccatttt    139140
     cgcccactac tgtgcctctc tgtccgggac gggcatactc cgtgtcgcca ttggcataag    139200
     cccgctgtat caggacgatt ggcgactggg ctagcggccc tttgccttct gcaccgtata    139260
     cgacgagtcc ggtaccgatg gttcccaaaa ggctcagcat caatgcgatc accatcacac    139320
     cgccggccgg actgtgcccg atatagcgct tcgcattgcc acgtatcaaa catacgagat    139380
     accgtaccac ggtgatcggg ttgtagatga agtcggcaaa tcgggcgtat cgtggaccgg    139440
     cgaaacccca gatgatccgg atcgcgagga tggcgccgat aacataacct ccccagacat    139500
     ggagggcgct aacattatca ccttcgtcct cagccgtaac gtaggaaatg gcgaaggcta    139560
     ggacaatcgc ccaatgcccg aaccgaatga agggatccca cactcgtatc gtcggcttca    139620
     ccttgtctga tgacatcgat ttgttctcgg tttcgaccag atatggaaat cggacagata    139680
     gtcgcgctgg attgaggacg agcgcattga tctgcctcaa cctgttatct gtagtgaaac    139740
     gacaccagtc ctaatgtcac gcggcggttt tgaccgacct gcgcttagcc tcgctctcct    139800
     gcacctgttt gagctggaca ccagcaaata cccgtgcggc ttcgggaact catgcgggtt    139860
     tgacggcgca ttgtggggcg tgatttcacc tcgaagtggg tctcggaggc cgcgatggcg    139920
     ccgcaattcc gttgcctcga cggatttatc ccatggctca ggcacgttga tggaagacaa    139980
     gccggtcgaa attataggcg atattggcca ggatgagttt cgccattgcc cgcgcgatgc    140040
     cgatggtgcg gatgaacagg ccgaacctgt tcttctggtg ggcgaagacg tgttcgacat    140100
     gggcacggat cgccgatttc gcggcattgg cccgcacgat attgtgcggc atcggcttgc    140160
     ccgccggctt gcgcctgtgg atgcggctga ccagcatcct taaagccagc cctgtctcat    140220
     tcttctgcga gcgataggcg ctgtccgccc agacccccga ggaggtgttg cccgtcgtca    140280
     ccaaccgcgg cagcatccgc ccatccgcct gcacggccga ggtcaaagca ctctcccgga    140340
     tgaagccgaa gcgtcggtcg acggcgatgt gggatttgta gccgaacacc ggcagtgcga    140400
     tctgaggcag tgacgtgccg tccgaccgat atcggatctt gccgcccatc ttcagtgtcc    140460
     accgtgcatc catgtctttc tgggccgcct tgttcggctc attcggccag atctcacgcc    140520
     ctgtcttacc ggccttgatc gcttccttct ccacctccgt gttccgctgc ttcggcgccg    140580
     acaccaggga cgcatcgacg atctggcccg acatcgggat gtagccgttc ttctgcaact    140640
     gccagtcgaa cgccttcatc acctgcttca acgtaccggt ctcggtcagt ttgttccgaa    140700
     caaccagatc gtgttctcgt ccggcgtcgg cccgccgaga tcaaagcgca ggaagcgaat    140760
     caagggcagg cggtcccgga tcataaaccg gagccaactc tcccgggagc gcggtcgatg    140820
     ttcgggcgcc gtggtattga ttatgccaat agccaccgcg gtcgcgcagg cggcaaaggc    140880
     gtagaacggg cgccagcccc aggagccgga gatgaatgcg ggcaaaagac gcgacaacaa    140940
     gatccccaac atcaatccgc tcacgacatt tccaacgacc catccccgcc gcgcgtcggg    141000
     cgtcacggtc gcgatcagcg gtatcaaaac ctggatcgca cacgaggcgg tacctgcggc    141060
     gaaggccgct gcaagaagca ccacaaagct ctgtgcggtg gcacaaatca gaagcgcaac    141120
     cgcctctgca gcaaggagcc taatcataaa ccgccgggtc tcgataatat cggcaagggg    141180
     aaccaagcac accagtccga cagcatagcc atgcagactc gcggccgccg tgaggccggt    141240
     ctctgctcct cccagcgaga aatcccgggc aaccgtggcc acaatcattt ggccggcaaa    141300
     gagaggctga acgatcagac gaacagtcgc tccaaatgct gcctgcaacg acaaagacgg    141360
     atttcgtggc tgctcaagga ccgcgcaagc gtcaccagtc atcggaccgc agcctgatag    141420
     cgcgcaaaca attcggcatc ttccatcgag ccgtggtgat ggagctgccg ccaccggcca    141480
     tcaacgcgca cataccaccg gctcgtgcga atcttcagat cgagcgtggt atctccagcg    141540
     acgaggcggc ctcgctcgcg gccgacggcg aggaaggcat cgcttagctc gtgcagggaa    141600
     tagtcgaaga actccactgt cacggccgcc cgcccggtga agatgcgttc gtagaccggg    141660
     ccgatctcct gccacccgcg ccgaatgcct cccagcggat tatccatcga cgcttcttct    141720
     gtctgcagcc agttgcggac catcatgtcg acatcgcgcg cgttgaaggc ccggtagaac    141780
     tcggccaggg caccaagcgg cgtcgaagga tcgatcggat tttcctgccc ggtcacaggc    141840
     acgctgatta cgtcgagcat gtcaattctc ccatctctgt cgatgagagt gaaggctagt    141900
     ggatcccatt gagtgggata atatgataaa aacatgaatg actatcccaa ttattggaat    141960
     aatcgagtgc cctccttgtc cgactacgaa accttcgtcg ccatcgtgga ggccggcagc    142020
     ctgacagcag catcgcgtcg gatgaaccgg tcgcttcagt ctgtgagccg ggcacttgcg    142080
     aacatcgaaa gggatacggg cgcaaatctc gtgcggcgca caaccaggag catgcaaccg    142140
     acagatgcag gtctggtttt ctatgggcgt atcaaggaag cgttgtccga tatcgcggcc    142200
     gcccacactg aggctgcgga actcacgcgc gagatcgccg gtacccttcg catcggatcg    142260
     tccaccctct ttgggccaac ctatgttgtc cctaccattg ccgccttcat gcgtcgccat    142320
     ccggcagtcg caattcaact ggtgcttgag gatagcttcc aagacctact caaggccgaa    142380
     ctcgatctcg ccatccggat tggagagctt tccgacagcc gcgcgatggc gacgcgtgtt    142440
     ggcgcgttac gtcgtgttgc ctttgcggcc cccgaatacc tgctgaaaca cggccgcccc    142500
     aaggtccctg gagatctcag agcacattgc tgcgtcatca ggacgctcac aaagtctcct    142560
     cagcgctgga ccttcgagag cgctggcaag ccagagacca tcccggtagc cgcgtgcttc    142620
     agctccgaca acgctggcgc ctgcaatgag gcggtcgcag aagccgtcgg tatcggcatt    142680
     gcgccgctct ggcaaatcgc tggcatgctg gaaaccggac gcgtggagct aatcctgacc    142740
     gaatacgagc caccaccgac gcctgtccac gttgtctggc cgcaagcgtc tttgctaccg    142800
     acccgaacgc gggcgttcat cgacttcctc gcggcacgac tgagatcagg tttgagggct    142860
     cttcgatgag cgccctcaag gcgaccgtat cgaatcttgc ggtgcgtcgg cgtgccgttg    142920
     atcagactga taagcttcat gtcataggca ttgacgattt cgcttaccgg cggggccaga    142980
     gctatgggac gatcatttgc gatctggagc gccggaagcc tgttacccta ttgccggacc    143040
     gagcgctgga gacgtctcga gcctggcttg ccaaacgccc ttcgatatcg attgttgccc    143100
     gtgaccgggg cagcggatat ggggaggtga ttgcaaaagg gctgccgcct aaaagtccaa    143160
     acgcagcgta atcggcttct tcatggcaaa caccttgcgt tcgccaaacc tcgaatcatg    143220
     cgtggacggc ccattgagtt caagtaggca ttgcaagctt tgatgacggt tcgaaagcga    143280
     tcatgcgttc ggcctgttaa gttatatagt aggataaaat cactacttta acacgatagc    143340
     atccgcgcgc aggtagggtc catatcgcaa gggggagaag atccatgcat gtcttcgtaa    143400
     cgggcgccac tgggttcatc ggggcggccg tcgccgccga tctgctggcc gcgggccaca    143460
     gcgtgaccgg ccttgcccgc tcggccgaga aggcaaaggc cctggccgaa accggcgccg    143520
     aggtgctgat gggcaacgtg aacgacctcg acctcctggc ccggacctgc ggcaagatcg    143580
     atgccgtcgc acacctggcc ttcaaccacg atttcacccg cttcaaggaa aactgcgagg    143640
     acgaccgcaa ggtgatccac gccatgggtc agacgctggt aggcacgggc aagcctatgg    143700
     tcgtcaccag cggcattccc gccgcgccgg ggcgagcctc ggtcgagacg gacagccatc    143760
     cgggcagcga tgtgatgccc cgcgcggcca gcgaggaagc ggcgcacgag gcattggctg    143820
     ccggcgccaa catgggcatc atccgtttgc cgcaggttca tgacacggcg catttcgggc    143880
     tgatcacctt tttcgcgcag gtcgcgcggc agaaggggtt cgtcggctac gctggggacg    143940
     gatcgaatct ctggcccgcc actcatgtca gcgacgcggc gcgggtctac cgccttgctc    144000
     tggaacgggc cgcgccgggg gccgtctatc acgccgcggc cgaggcgggc gtgcccgcga    144060
     tcgaggtatc cgaggcgctg gcgaagggca tgggcctgcc ggtgcgcgcc ctcgatgacg    144120
     ccgaggtcga gggctacttc ggcccgctga cgcatttctc ccgtttcaat atcctcgcgt    144180
     ccagcgactg gacgcgcgag gtgctgggat ggcagcccac cggccccggc ctgctggagg    144240
     atctgaggcg gatcgaggac ttcgcgtagc tggccgaccg cgccgcatct tcgtcacgcg    144300
     ttcagcaggg tcgtgcctgg tctttatcag gcaggcgctg gagacccgtt ggttccttac    144360
     gcgatccggc gactcgctga aaacgccacc tactgtgcct cggcctggtc gggtttggca    144420
     aaggccgtgg cgatgaaggc ggagaccacc ctacggttgc tcttgcctgt gtgggcgagc    144480
     gcattgcgct ggaaatgcca aggacgcagg cgggccgttt cctggcgaaa actcccatct    144540
     cactccggcg cccttcttca gctgggcctg cagcccgtcg acgatggcct gccggtcatc    144600
     cctgtccttt tccgcctcgg cctcattgac cgggacgatg tagcgctggg ccgccttgcc    144660
     cttgccaatc cagacctctt ttacccagag ctgggtatcg ccatgctggc gatcgagcgc    144720
     cagcgggacg atcgaggcca tgtcgttcag gacaacgtcg cggatcactc ggctcgtgcg    144780
     ctcgcgcacg ctggggatgt attccatccc cagcgcttcc agtgccgcga tggtatcgga    144840
     gctgatcatg ccgcggtcgg cgaccacgca ggcgcgggtg atgccgatcc gcaaccgtcc    144900
     attccggaat cggcccccga ttagcctccg tcatcgtgtc tcgttgtggc ttactagggg    144960
     ggatttcgcc agcaggtgca ggggacgcgg ctcctgcgag ccttggtccc accgaactat    145020
     cgtgcggcct tgctgcgaga cacggggtca tttcgcacgt tttgagcaaa cgatcgcgcc    145080
     gatggtgtaa ccgggccaag gcaagagccg tccacacacg ccccattcat gctgattaag    145140
     caaaatccct atttattatc ggaatttcct ccgtacgtat ttgtttggcg tcgaactgaa    145200
     caagtgggtt ggccttaaaa tgttcctgta tgactttgac gaaaacagcg acgttggcag    145260
     acgcaatgcg ccgccccttg taggtcacac tgaccgtcag gggcggcggc gtgaactcgt    145320
     gcggaatgag cgtgagatgc ccggcgcgca cggcgtccca gacctggtag cgttgatgcc    145380
     gtaccggcgg tcgacgggca tctggctggt gatcagagtg gattggcgtt gatggcggtc    145440
     gtctacgctc tcgcagaggt ggcggcgctg gccgtcatcg ggtttctccg acccctagtc    145500
     gttgatgatc ggcctccggc ctgcctgcct gacggatccg atcgaggctg atcctggtct    145560
     cgcggatcgc ggcatcggct gccgccatgg cctcttccag atcgctgaag tcgaacgcga    145620
     gccggggcag gacgccaccg gatggcgccg gcggaagctc ggcgggcggc gcgggctgcg    145680
     gcatttcgcg ctcgatccgg ggacgccccc tcccccgccc cggctgcggc cggcgtggcg    145740
     gcgccacgta gtcgcgcatc cggcccatgc ccgacaggcc gaagagccgg cgcttgctgc    145800
     ggtgggtcaa ctcgacgacc agcccggcct cgagcagttc gccgagcagg gcgtgggcgt    145860
     tcgccacgtt catgccgagc cgatcggcga gcgatttcgc ggagataatc ggggttgccg    145920
     ccaggatatc gatcgccttg gcggcccggc tgttcttgcg ccgcttgccg atcgaagcgc    145980
     gcgcgacctg ccatgcccga tcgagatcgc ggaggaggtc ctgggcggcc gcggcctcgt    146040
     tcgccagtgc gtggagcaga agcgggatcc agctctcccg gtcgaaggga aggtcgccgg    146100
     cgagcgcctg cggcccggtg atcggcaccg gaaggtgcag cagtccgctc tgctgccaga    146160
     agcggatgag tgcgccccgc aatggagctc gtctcccgcc cccggccagc caggcatggg    146220
     ccgcgtgcgc cgcgccgagc agcggggagg cgcgctcgac atcgcgctcg attgccttca    146280
     tcgccacctg gatctcgcct tcctgatcaa aatcgggctc gacgatccac tggtgcatcg    146340
     agagcgcgtg tcgggccgca tcgaagatgt cgccccgctc ggcgaggctc agccacgggt    146400
     ccatgcggag ccggacgccc tcgagcaggg ccgcgagatg ccacggctcg atcaactgcc    146460
     cgtccaccat cgcctggcgg cgcaccgcat cgaggcgaaa ccggtagagg aaggcgccgc    146520
     ggagcgggtg catcgagagg gcctggtcga gccgggcaaa ggcgccggcc gcccgctcaa    146580
     gtgcgatcat cagccgctgc tgggcggaca tctcagggtg atccatgaga cgcaccacca    146640
     cctgcaagga cgtcacttac acatctcgtc cgtagcctcc gggggaccgc tcccatcccc    146700
     ccgaggccca aatgcccagt ttctccccca gccgcgacgc gatcgaggtc cagctcgcga    146760
     ccagccgtga cctcgccgat ctggcctacg agatccgcta cgaggcgtat cgcgcgagcg    146820
     gctatatcgg cgagcgcgcc gatgggttgt tcagcgataa ggaggacacg cgcgcgaacg    146880
     cccagaccgc cgtggtattt cgcgacggta ttccgtccgg cacggtgcgc accctcctcc    146940
     tcgacccggg ctccgacaac cccgacttcc actacatccc ggcgctcgac atgttcgggc    147000
     cggagatccg cgagcttctc gccgtccgcg ggaccgcggc gcgcccggcc accgcaatcg    147060
     aggccaccaa gctggccctg gcgagccatg cggagcggga tatcgcggtg ctgcaggccc    147120
     tcttccggac ggttcgctat ctcgtccacg cgcatgacac gaatgtcgtg ttcaacgcgg    147180
     tcaagcatca tcacatgccg ttctaccgcc gcctcggcta ccgcaagatc gaggatccac    147240
     gcccctatcc tggactcgct gtccagaccg ggctgatggc gtgctttcgt gaggaattcg    147300
     cggatacggt cgaccgcgtg ccgttcatga gcggcctctc cgtcaccgac ccgacctgcc    147360
     aggcgctgct cgccggccac cgggtgcaga tcttctcgac cggtcggccc gaggcgcggc    147420
     cggcgctcga aaccccgaac cgcctcgggc gcgccgcgcc ggcgccggac cctgatgcgg    147480
     atcaagagcc gggcccgggc tgagcggaaa gctgcgaaaa tccccgaacg gaaaatcaat    147540
     attttagtcc gtattttttc tccatattca gtatagcaca aaataaccgt cttttttagg    147600
     ggcctatcaa gcttttttaa tcgatttcct gataactccg gttgtcgata ctacggaaat    147660
     ttcatagggt tccgagcgca aaaccgaccg attcgcgctc aggagaggcc actcgtgccc    147720
     gatgacaccg aattcgcacc gcaagaccgc cccgacgcgc catcggccgg cagcctggtg    147780
     ccctccccgc ccccgctcgc cggcgacggg cacgcggtcc ggcgctggtt cagcgagatc    147840
     gaggacgaac cggtcccggt ggccgatggc acgctcgccg gcgcccgcag cgccgccagc    147900
     gcctatgccc gtcgggccaa ggcggacaac accaggcggg cctaccgcgc ggcggtgcgc    147960
     gtctggtgcc tctggtgcga ccgccacggg ctgacgcccc tccccgcctc cggcgcggat    148020
     gtcgccgcct tcctcgccga tgagcgcggc cgcggcgtct cgaccgaaac gctcaagctc    148080
     cggcgcgccg ccatccgcta cctgcatcgc ctcgccggct gcccggtgcc caccgatgat    148140
     gcctgcgtcg ccgagaccat ggcgggcatc cagcgtgacg ccgcctcccg tggcgagatc    148200
     cgccgcaaga aggtggcggc gacggcgacg gtgatccgcc ggctgctggc accgatcggc    148260
     gataccgagc tgactgacct gcgcgaccgc gcgctgatcc tggtcggctt cgccggcgcg    148320
     ctgcggcgct cggaactcgc cggcatcagg atcgagcacc tgacaccgtc agagcgggga    148380
     ctccgcctga ccctgccgca gacaaaaggg agccaggccg aggcggtcac cgtcgccctg    148440
     ccctacggcg ataccgaact ctgtccggtg catgcccttg agcgctggcg ggtcgccgcg    148500
     gggctgcagc ggggcccgtt gttccgtcgg atctggtctc cgccatccgg ccgcaagggg    148560
     cgcgagcgga ccgcgccgcc tgggccggtc atcggcgagc gggccctcac cccgcaaagc    148620
     gtggccctga tcatccagcg ccgggccatg gcggccgggt tcggccggcg cgacctgggc    148680
     gggcacagcc tcaagcgcgg ggcgctgacc accgggatgg agcgcggcgt ccatccggcg    148740
     cgcctgaagc ggctcggccg ccacaagagc tatgacgtgc tcggggagta cctggagttc    148800
     ggcgacctgt ttgacgggca cccgctggat ggggtgctct aaatccgtct cctagctcaa    148860
     tgccgcggcg caagtatgcg cgggtcgtac agccatttcc ggcgcttgtg aaactctatt    148920
     ttgcgggcac ctggatgggt cgggttgatg aggacgttca gctcctcggg aacgataacg    148980
     gatgggacga ataatgccgc cgatcttttg tcccggaccc aagtggttcc caagtcgata    149040
     ctcaccttcc cgggaggctc cgcatcccac cccacaggca gcgatgcctc atcatatgtc    149100
     tctgccgatc tgaccagatc atccgggatg atgatctcga ccagatatcg gttcagcggc    149160
     aaaccgctcc cgttcagatg caccacagtt tcgaggcaag ccagcgcgcg cgaggatgct    149220
     gcgtaaacca ttggggtgcc aacgtcattc cagcgtccgc ccgtgatctc cgcccccttt    149280
     ccgctcctgt cgtccgccgt ataatcccga gtgtctgtcc cgatcctcca gaaactcgcg    149340
     gtcacgcata ggccccgctc tgaatgcggg acaatgcctg tgagacgagg gcttgccccg    149400
     ccatcgtgtc aagcaatttg ataggcatct gaccgccgag cgctggcaat ggctcgcgca    149460
     accagcgcga gagccattct gcggcgttaa atccctctgg atcaccggat tccttcacca    149520
     tcgcctcgac ctgccccacc agtcgcgcaa taccggcaat gcgctcgctc tcatcggccg    149580
     gcagattctt cgcctgggcg acctttcgat tcagggtggc tacactcagg ttgagcgcac    149640
     ggagcaaagt gtcctgctcg atcctgagat cacctgcgat ccgctttacg gtgagcgcgg    149700
     gaatccccct cctgatcatc tcgatttggc gcataggcgc ctgataaaag tattccaggt    149760
     aggacacatc ggtcccacct tttgccgccg gggatccggg tgatgtcatg ggaaccttaa    149820
     gcgcgcgaga tgtcttgggg gccttgtgcg aaggcttgtt tgccttcgga cctgaaggtg    149880
     ttctggtcgc ggctttgctc acagtcgtgg taaccatgac gatactcctt tgcgcaataa    149940
     tttagcgcat ttgcgcattt gttcaacatc cccgccacga agtcagagat ccaacacgtt    150000
     ccttacagac ccggcggcta ttctgaccgg accgatcccc gacgatcgtc cgacaggaga    150060
     gtccgccttg gcccagaaca agccgccgcg attcatcgct gaactcgagg ttgcgcaggg    150120
     gcacgcctcc ttctcgatcc acgtgtctgt ccgcgccgca tctgccgcgc cggaggacac    150180
     tgcgtcgacc caccttctcc ccgccggtga cccgcagagg gcgatcctga ccgaagcgat    150240
     ttccgccctc cgccagacgc ccgaaggcgc gcgggtcgag ctgcggacga acagcgacta    150300
     tctgaccgac ggcattcttc gctggcgtag cggctgggag cgccggaact ttcagaccgc    150360
     gaagggcagg cccgtcgctc tcgccgacgt ctggaagacc ctgttcgccg aagtcgacgc    150420
     ccggcaggtc cgtgcggtgc tgggcacctc aacgacaaag agccgggaag cgacgcacca    150480
     tgctcatgac gccatctccg tcgcggacca tgcgcaacag atgagctgat ccgccgggtg    150540
     aagggaccat caacgcctcc ggcgtccgat cccgacaccg atgatctcgg tacgccccct    150600
     cacccaccct cttggccggc cgcccgttcc tttcacgtcc agtcgctatg ctggcgatgg    150660
     aacaaccggt ggcgccgtca tgaactcaat atccccctcc ccgctcgtcc gtaaccagca    150720
     gctcgtcgtc aacctgttcg gcggtccctg cgccggcaag tcgagcctgg cggcgatcct    150780
     gttcgggcgt ctgaagcgcg agcactacga ggcggagctc gccgtcgagt tcgccaagga    150840
     cctcgccttc gaaaaccggc gcgacgcgct gaaatgccag atctacgtcc tcggcaacca    150900
     gtactggcgc atccagcgcg ccttctccgg cggcgcccag atcgtggtga ccgacagccc    150960
     ctgcctgctg tcttgcgcct accagaccag ccccggcatc gaggccgcgg cactggaggc    151020
     gcatttcgcg tacccctcac tgaacctctt cgtcgaccgc tcggagcgat acagcgccta    151080
     tggccgcgtc cacgagcgcg accaggccga acagatcgac gaacgcatca tcgggatcct    151140
     gaaccggttc agcatcccct tcacccgcgt ctcgatcgag catggcgaac agcaggcggt    151200
     cgcgatggtg ctggagcagg cacgacgggc agcagagaca atcggggcgg agccgctaag    151260
     cagcttcgac catgataatg cccccctccc ctgctaggcc cagccacccc atggatgcgt    151320
     gcatcgcgct gcgtgcatca cccatcacgc agcacgccta accaggtcct gccatctcgc    151380
     ctgccacggc gaacagccat gaagatcgca ctacgcatca cgcatcgttc ctcacggcgc    151440
     acggtgcacg catcacgatg cacgactcgt gatgcgtcag gcacgcatca cgcccgccca    151500
     tcaggatccg gccagatccg cctcccctcg gaatatgttt caattcaatg ggatagaccc    151560
     aaaaagacag actcacgcat cacgctgcat aaatcacgct tcatgcacca cgcatctcgc    151620
     atcaccggat taccacccac gagccggatc aagcggcaat ttgatgcacg caccacgcat    151680
     cgtgatgcat catgccatca gatcacatga acaagcaggt ccaacacact gatccaagcc    151740
     tataacgcat ggcctgcgca tcgtgcatca cgcatcccgc atcaccaatt aattcaaaaa    151800
     cagatttgaa tttcttgaca gccatccgat gcgtggtgca cgcatcgtgt atcacgagtc    151860
     acgcgtcacg gctcgcgtct ttgcgggtcg ggcgcgagca gagggaaggg gacattgatg    151920
     cgtgcatcac caatcacgat gcagtgcgag cggccatgaa gcggattgcc ctggtgcagc    151980
     agaagggcgg ggccgcgaaa acgaccctgt gcgtccacct cgcagtagca gcagatcagg    152040
     cggggacgcg gaccgccatc atcgacaccg atccgcaggc aagcgcatca gcggtctggg    152100
     ggcaggcgag gggggatagg accccgccgg tcgccccggt cctggctgct gagctgaagg    152160
     aggcgatgga cgcggccgag gctgatggct tccagctgat attcgtcgac accccgccac    152220
     acacggcgcc cgcgctcgag gtggtcgcgc ggaacatcga cctcgccctc gtgccggtgc    152280
     agccatcaat cctcgatgtt gctgccaccc aggccacact tgacctgctg cgcgcgaacc    152340
     gggtgccatc ggtcgcggtg ctgacgagaa cctctcccag accggacgag gaaatcgtcg    152400
     agacggtcag agccctgaga gatctcgaac tgcctctact gaacacccgc atcgtcgagc    152460
     ggaaggtcta ccgccgggcc ctgacccagg ggcaggccgt cggcgagttc gaacccacca    152520
     gcaaggccgc gcgggagatc cgacaactct ggaaggagat cgcggtcctg gatgcgatcc    152580
     agctcaagcc cgccacagca cagaagagga ggtcgtaatg tcggcacccc caaagcgcag    152640
     cttttcgagc ttcgtgaagc gtacgccaga tcatctcacc gaggctggcg gacgtcatga    152700
     ccaggcgccc gcgggacgcc ccgatccggc acaggcgccc gcctcacact cgaggccggc    152760
     cgaagcgggt tggcccgagg agcgccaacc gaccccggcg cagagcgaac ggcccgaggt    152820
     agacgaaaca ggggaggggg gtgatggccg gcagagggta cgcacatcca ctggacgtgt    152880
     tcgaacctat tccgcttcac ggagcctgcc gggggtcacg ttgcggcttt cggaggaaag    152940
     gtgggagcgg ctcaagctgc tttccgtcca ggaaaggcgg cccatccagg agatcctcgg    153000
     cgaggccatg gacgcctaca tgcgagggcg agggctcaga tggtagcgga tgatgcgtgc    153060
     ttcgtgatgc acgcatcatc cgctaccgag tcgcgtggtc gggagatcgc tccgactcga    153120
     attgtccaca atatccacat gggatttcct gacttcgcgc tgcacaactg atgcaatcca    153180
     cagatgagca cggttttcca cggggatttt tcaaccgaag catgggattt tccgaccaaa    153240
     aaacgagtcg ccccgtggga attcctgacc atactactaa tagaatcaaa ctaaatacta    153300
     atagctcggt cgagaaatcc cactcgaaaa cggtcaagaa atcccacaat actttggtca    153360
     gaaaatccca caatttgcag gtcagaaaat cccacagttg acatcgactc gatgagaagg    153420
     cgaaaagtcg ctttggaggg tggctatgat caatcgcctg gaccagaacg tcgcacagct    153480
     ggtgctcgat tatggcagtg agagggcccg ggaaatcgtc ggtccccgct accgcgcgct    153540
     tgtggatatc gccaacgagg tgctgacaga cgagcgtcag cagatcggca tctcgtattc    153600
     cgggttctgc ctgaccagtc tgccccacaa gcggctttcc gacagcgccg tgtggcagcg    153660
     gaaggggcac aaggttaccc tgctcgtcga acccggggta atgcgctcca agggccgcac    153720
     ggtcctgtat ggcgtcccgt tcggggctcg agccaggatg atcctcctct acctccagac    153780
     tcaggcgatc cggacgaaca gccgcgagat cgagctcggc cggtccatga gaacctggat    153840
     ggagcgcatg gggatcgcca tcgggggaga gacgacacga gccctgaggg aacaggcggc    153900
     gcggatatcg gcctgcagcc tcaagttctt ctgggaaggc gacggcgccg agggatggac    153960
     caggggcggg atcgtctcat ccggccttcg cttcaagagc gtggttgatg acgacgacca    154020
     ggggaagctg tgggacgacc gcgtcgtgct ggacgagacg ttctggcgtg cgctgaagga    154080
     ccatcctgtt cccctgcagg aggctgcaat ccgggctctt gcccaccgct ccctggcgct    154140
     tgacgtctac atctggcttg cctggcgctg ccacgagatc aaggggccga cggacatatc    154200
     ctggatctca ctggacgcgc aattcaacac gacaggtcgg ccgctgaagt acttcaagcc    154260
     cctgttcacg gacgctctgc gagcggccat ggcggcctat cccgactgcc ggctggatgt    154320
     ggaggatcgg ggcattaccc tccggccctc caggccgcca gtgctcaagc tgatgacata    154380
     ggggcgcagc tccgtgggat ttcctgacca atcggggatt tcctgaccaa aatgggattt    154440
     cccgaccgga cggtctgatc agatgggcgg gcgaggggaa caaaaccatc agccagggcc    154500
     gaaaattcga atttatctcg gcttgaagtg cggctccgat acgcagggca cttatttcgc    154560
     cgtgggtgtg ggatttcctg accaatcggg gattttctga ccaaaatggg atttcccgac    154620
     cgaggcgagc ctgaactgga gatcgcggcg gcaaaacccg gctatctcaa caagatctct    154680
     ctccaaaatt cgaatttagt cggtggagtc atctccaacg gcctgaggtc agacaaaaat    154740
     atcaaatact ttcatggtgt tgcagagttt gtctggctgg tgtgggaaat gtgggatttc    154800
     ctgaccgcgc attccgagtc gcgctccgtc gcctcctgaa tttatgggat tttccgaccg    154860
     aaataacccg ccctggcatg gcgtgggaat ttccgactgg ccggaactga agcaccagcg    154920
     gggcgtggga tttcttgacc atcggagtca taaatccagc cagccgaaaa taattcgtaa    154980
     tttcaatagc ttcccatacg ctgccgagcg ggccaagcgt gggatttcct gaccagcaga    155040
     gaatcttgcc tgcgacatca gcgtgcgatc cgaaggtcga gaaatcccac ataccggcaa    155100
     tggcccggga gggtggcggg ccagagaccc cagttgcagg tgtgggattt cctaactgcc    155160
     cggaaaaccc caaaaaaatc aggaggattc caaagcaccg gagtgccggc caaaggcggt    155220
     cgacagcctg gatgactggg gccgatccac ggtcgagaaa tcccacagcg atcagcagcc    155280
     tgaaactcgg cgatgaatgc cggtcgagaa atcccacacc cctcattcag tgcgcgcagc    155340
     cggccgaggt agccactctc tttgggtgtg ggatttctcg accggctgaa aaatccgcgg    155400
     cacatacatc acggcgtcag attcgccgcg aatataagga tgaggtgacc gcctccagag    155460
     ggtatcagcc gcagccgggg gccaggccat ctggggcagg ctggtcggga aatcccacac    155520
     gctgctgttc cacccaagcc ttcacgaccg ggccttcgcc gtcgaaccag cgccggaggg    155580
     cgtcgaccga gaaccaaccg aagttgtggt ggcgctgctc catcgggttg agccagacgg    155640
     tcaggtcgtc ctcggtcgga cgggccgctg ggtcggcctt ccggcgctcg atgaattccc    155700
     gggtccaggt cggccggatc ccgaaatagg caggcttggc gttcgggccg aacagcggat    155760
     cggtgccgcg gcgctcggca aagcgggcag ggaggccggt ggccttgaac gtcgcatcga    155820
     ggaggtcctg atcctcgtcc tgctcgcgca gacggtcaag gtcggccggc tggatccgtg    155880
     aggcaatcac gatggccagg ccaccgcggc cgaaaggcgt gagggcgcgc gttgcgctga    155940
     gcgcgatgtc gcagcccagt aacgcgttgt agaccgcctc gagatcccgg cgggcatctt    156000
     caccgagtgc ccggaccatg aacgaccgct cgctccaggc cccgatgatc cccgcgttgt    156060
     acgccttcca ggcttcccgg tcggcggcct tcgaatggac aggcaggacc cgcaccctgt    156120
     cgtccttgtc ccgccaggtc ggcagaaagg cgaccaaacg gttggcggcc acgaggtcga    156180
     atccctcgtg ccgcgttgcg aggccaccgg tgatgccggg cttgccgacc agctgggcga    156240
     cattggacgg gtgcgagcaa cagaggatcg actggtcgag gtccgggcgg tcgcaaaaca    156300
     ccagtgccga ccggctcgac agtccggata tccggtaccg ctctatgccg ggcggagcct    156360
     tgctggagat cccgaactcc cggcggagct cctcgatccc ggactcgtgc tctgcgcaat    156420
     agtcgccgcc gagcaccaga ccgcccacct cgctggcctc cccgatccgg aagaagcccg    156480
     tgctttcctt gcctgtccgt gccgcgcgca tcgcaaactc cctgcctgaa tcgaattctg    156540
     ctcagcccag gccgaggccg agatcgagat cgaagatgga ctcgtgatcc tcgagaaccg    156600
     gcgccggcgc ttccgtttgc tcctctcgga tgggcgcagg cggcaccgcg agggcgtcgc    156660
     cggcggcgac gccgtgctga cgggtgaact cgtccatcac ctgttcgacg gtgtggaagt    156720
     acccggcctc gctccagtcg gcgcggttgc cgacgatgta gaggacttcc ttggcccgcg    156780
     tgacggcgac gttcgcgatg ttcgggcgcc cgcccgccca gccgcgtgcc cgcttgaatg    156840
     cctcgccctg gtggcccagc acgaagatga caccttccgc ctcgcggccc tggaccttgt    156900
     gcacggtgcc gatccgtcgg gtcagctcgc gggcctcggc gaaggagatg ccgatcccgg    156960
     catggttctg aatgaccatg tcgcgcagcc ggctctcgat gatccgaaag gggctgatga    157020
     tgtagaggtc gagcttgcca ccgcgggcga cgatatcgcg gaggaggttg aagacgacca    157080
     tcccttcctg ctcggaccat ttctcgtcca cggggtcgtg gacatcgatc cagcgcgacg    157140
     gcccgcaggc atcccggatc gcggagggcg aaggccgctt ggcgttcacc atcaggccgc    157200
     cgtagccgat ctggttcgag atcgagaaca tcggctcggc gcaccgtcga tgggccagca    157260
     gcggcatgcc gacccggcgc gcgccgccct cgcaggggta ttcggcgaac acttcggatg    157320
     ccccgtccgc gaaggtctgc acggaccccc agggcgccat atcgacctca tggtcgatgc    157380
     ccatcgcctt tgcgatctcg acgaccatgg gttcgttcag cgtgacgacg ggctcgacct    157440
     ggatcgggtc gcccacaacg agcgcgttcc ggctgcgctt gatcgcgccg accgccgatt    157500
     gcggcgtcgc ctgtccggcc tcgtcgatga acaaccagcc gatcatcggc tcttcaacgt    157560
     cgcgcagcat cctgcggacg ctggcgaagg tggtcgacaa gaccggaacc gcgatgaaga    157620
     gcgtactgag gacagactgg acgactttcg gcttccgccc gttaaaccga ccggcgagga    157680
     gttccatcgc cgccgagagg ttggagccga cttccgtggc cgcaccctcc ataaaggcgc    157740
     ggtgaagatc gattgccgcc tcgaacagat cctcgcgctg tctgtggtcc gcaccggaaa    157800
     gccacggcga agaggtatgg aagtgaaaag ggtcactctg gtcgagttca ccggtcgccg    157860
     ccttgtttac gtcagacagg cttttcctga ccgtgtcgag cagctgcagg aagcgatctc    157920
     gctcccggtt ccagcgctcc agcgccgcat gccggccacg cgcgggccgg tgtgcctcaa    157980
     aggaggcggg gatccgtttc gctccagtct tcttgtccac gatgaccggc gagcggccgg    158040
     ctgccagagc gagctggttc ctgagacccc agtcttcatc aaaccagaat tggtcacgaa    158100
     atttcgcccg gtttgccgaa ttgccgagcg cggccgagac cagcccccag ctctcgcgct    158160
     catgcagcct ggatgctgtt cccgggtagt atctggttgt cgcatcatca gcgatcgcgc    158220
     cattgtccgg ccattcggtc gagacgttct cgactgcgcc gttgttcgag gaggcaacca    158280
     gcatctcgaa gccgatcagc ttgggatcga gctcgaacaa ggatgggtcg gcgcgcccgg    158340
     aggaacgcgc tcctccagat ccgaatacgc gaaaggcgtg ggaggggtgg atgaaatcgc    158400
     tcatcgcgat agcgcgacgg acaatcagcg ccgcggccgc gtccttcagc aacgtggtct    158460
     ttccggtgcc cggtgggccg ttgacaccga tcaccttgtt ccggcggacc tgcgcggggt    158520
     gcagcgcata attgatgatc gactgctgca tggcgaccag ctgattgcgg cccgcgtgcg    158580
     gccacttccc ctccgggaaa agcccggggc gcagcagcgt gttgatggcc tttgggtcct    158640
     cgagaatgtt gatcctacgg acctgttcct tcacgccgag ataccgatcg aggagaggct    158700
     gctcgatacc cttcgccaga tcgcggcggg cgtcgagcag gtcgctgaga aaaaagctgt    158760
     tcatgatcag ggcgtcgggc attcgctgtt tcggcaccgg cgtgccgtcg gggcttaccc    158820
     tctggtagta accgatcacc ttcgcgggct tgctgaccac gtcggactct cgtgatggcc    158880
     gtgagaccag cttctcatcg aaccccaggc tgtcgagcat ccagtagtag atctcgagga    158940
     tggcagcctt gtcgatcggc ttgtccttaa accggtcgtc gaacaaatcg cggaaactct    159000
     tgctgatgtc agcggcggca tgcttccagc ctggcattgc gcccagatcc cggttcagcg    159060
     cgcgcacgag tccccatccg tacgccgata cagagaaggg cgaaactccg tccttgagat    159120
     cgagcgtgcc gttcggcgcc acgcggagcg tggcgagaat cgaaacgccc gacccggcgc    159180
     caccatctcc aaagctctgg ccatagacct cctcgagcct gacggctgcc ttggcttccg    159240
     ggatcgaccc gaagatgaca tcataggcga ggtagccagc acgcaagttc gggaactctg    159300
     tctccggata gccttcttcc cacggcagcg catctccgta gacgagatcg agcgccgcca    159360
     tgtcgcgctc gcggcccgag acgatatcct tcaggtcctt cacggtctcc ggcgtcagga    159420
     cctccgcggc gatccacgca tcgagcaccg ccaggccctt cttctgcgac gggctgagct    159480
     cgacaggttg ctctgccgga ttggcaggtt gagccggcag gacggtcaaa acggactcat    159540
     cgtcctgggc gggttgcccg gcgggcgcgg caggcgcggc atgctgagac ccggccacgc    159600
     ggatgggctg gccagtgccg atctcggcct tgcggctttc cgcgacgatc tccgcaacct    159660
     cggggacatc atcgtctgtc gcgccgatga attgcgtcgg cgggcgtctg cgctgggtcg    159720
     tgctcatacc cagcagtatc ggtgccagat atgaaaggga ctaaggacgg atgcagcagg    159780
     acttcagtcg ataaatccaa atttatttcg aattatccaa cgactcctcc aacaagccgc    159840
     gagcaggatt cattggaatc gggccaccgt ttctcctatg tctgatgagc ggctgagatg    159900
     atggccgcgt tcaactgggc gcgccatgag cagtaattct gaccagaaaa tcgatttctc    159960
     cgcgacattc ggactctcga agagtgtgcc cgcgatgatc gaggcgcgag atcatctcgg    160020
     ccggcatttt ccgacgcggc cttgggagga catcctgctt ggtgcggtcc agccgccggc    160080
     accgatcgag gtcgtgcact acagcactgg agcggtcgcg atcttctgga cgcgtggcgc    160140
     gtcgatcgtc tgcctgctct accaggggga cggatgcgtc ttccatggcc agggttcgga    160200
     cggccgggac tgcgcccggc ttgggacgat gagctatgtc gaggaggtgt tgcctcgctc    160260
     tgtgatgctc gagatcctgg cggtgtgccg gcagaagggg tgatcgacga ggctgggtct    160320
     cgcaggacgt ccaacacata attcacaaaa ccgttggaaa ttttgcccaa cggcaaccac    160380
     aaacactctg cacaccggtc tccagtcgcg catcgcgcgg cgccatagca aggagactta    160440
     cgatccatga actctcgcac catcatcacg tcgtcggcgc tcatcatgat gctggccgct    160500
     ggtagtgctc tcgcccagac atctgccgga ggccaggccg gtgtcggcgc ctctgtgggt    160560
     gtcggagcaa acgccggtgc tggcgggctg gtcggcagca cgctgggtgc cgcaaggtcg    160620
     acggccggga atgtcggcag tgcggtcggc tcaaccgccg cgggcgtgac gagcaaggtg    160680
     ggcgcacagg cgaatggcat ggcaagatct gccgaagcaa cgtccgccga tttctcggcg    160740
     gccactatat ccaaggcgag attggcaacc aggcagatct ctgttctcga ggcacgtgag    160800
     caccgtgaga tccggacagc gaagacggcc agccgtcgtc gggccatcga aaccagggcc    160860
     cgggccgaac gcgcgcggct gatcaagagc cacggactgt cggtgtccga atacgatcgg    160920
     atcgtgagcg aggcccggag caacccaagc ctcgccagtc gcatcgggct gagcgtatct    160980
     gcaggtgccg gcgcgcagat gaagtgaggc gcattcgata gccggacggc agaacgcccg    161040
     ggtgccgtag ctcccgggcg tttttttgtg cggcctgtcg ggagtccgta tcgccacaag    161100
     atacgatcaa accgccagca gcttcctcgg cttcaacctc ctcgcctcaa tccgcccctg    161160
     gttcagggtt gtccacgcct cctaagcgcc agacaccgcg ctgtggcgat ggcctcaacc    161220
     ttatcgcgaa ctgctttagc gtcggcgaat tcgacggcga atgcggggag ctgaagggtc    161280
     accaggcgct ctgtgatccg tgttgtgagg gcttcgagcg cggcttccgc atcctcgacg    161340
     gtcagaccga ttgtgcgcgc gaggcgtaga aaatcctggc gcgtcagccg atcatccttc    161400
     ccattcagtt tcagggccat tcgatcgccg gcaaggcttg ggaaaacccg tgtggtcacg    161460
     gcatcgtaga gtggcgcaaa acggacggtc gtgaacgtct tcgcgcccac atcagccgtc    161520
     tttaggacgg cgagattctt caggtgcata tcgccgtcgg cgatcaacca ggcaaacacc    161580
     gcgcgtcgga acaggatgtt gaggtctgcg gccgggtcgg tggaaagcgg acgcaaggcg    161640
     cgcgccattc tctcgatcgt tccgtcgtat ttcgccgatg tcgggagatc gaggacggag    161700
     caaaaatcct ccatcgcgag ccgacgcaga tcgtgtggtc cacgtctgat gtcgaaccgt    161760
     tcgacgacca aggacggcgg catgccgtcc ggcatcgcaa tcaacgcggc gtctggcgtc    161820
     tcgaaccctg cggcgcgccc aagttcgagg cacagccact cgacgatcgg tagcatgtcg    161880
     aagcccgccg cgcctgttgg cttcaggatg tgggtgaagg gctgatcgat cgccgggaca    161940
     agggacccgt ccttggtcag gctcatcggc gccttgatct ggacgcccga caagcgcggc    162000
     gtttcagagc gcgcaaagat gcgcgccaga ttctgctcga aggtgtcttc gatttcgccg    162060
     cgtccggggc cggcatagac ccccgtgaag cgaccgtcag cggcaaagct ggagagtggg    162120
     gtcgacagca catcagccgg cagcgtcgcc aactgatccc ggtcttcgac gatggcgatg    162180
     ttcgacatgt agcgtcgacc tcggcgcagg gcatcgcgct cgtcgcgttc atgcaggacc    162240
     tgggcgagcc agccctcggg cagcagcgat tcgatgaagg ccggcaattt gccgggcgtc    162300
     gtcccgcgga tgagcgccgg accagtgcgc cgctcaggtt tccagcgcca ctcgaagccg    162360
     tcatgggtca aacgaccgac aagatccccg tgccaggcaa ccaaaagatt gagcgcggcc    162420
     ttgttcacgg gcgccgcgcc tccgggtttg gcgaggagga agcgttctgc gccctcaccc    162480
     tcccgatacc attcgttctc gcgggcaagc gcccaaacgg cgtcagccgc cgcctggggc    162540
     gtgccgtgtt ccgccaccaa ccgggcggcc atctgggcgc gcatctcggc ggtgatggcg    162600
     ctggcgtgct cgctcctcaa ccgaaaggct tcgaggaagc gctgtcgtgg cgacgaagcg    162660
     gcgatgcgca gctctccgag atcatcgcca atgacggcga tcgccgtcga ggggtgggcc    162720
     ggagcctcat tttgaatgat ttccagggcc cgcaacctgg ttcgctggtt gcgtcgacca    162780
     ctgatgaaga ggcgcccatc cggcgtgggc gcgagcagga cagcgctggc ggatgatagg    162840
     taggcgtttg gatagaggta atgcgcgatc cgcacggcgt gggctaggat agccgtctcg    162900
     gcatcgccgt cgtgatccac gtagacacca cgaacgaggg ggatcaagtc accgctttgg    162960
     gcgcgatgat gcgcccgttt ggcgtctatc gtctctccga ccaagtggat tgccattgga    163020
     ttatcccgca tctcagatgc gtgacaattc cacactcgac gcccgggggc aagaattttc    163080
     ccgcatctga aatgcacgac aatcccaagt ctgccgtcgt ggacctcgtc gccgaccgac    163140
     gtctgagctg agcggggcct tagtacctga ccgctcccct gggccgatcc cgcccctagt    163200
     tcggcgtcgc cttgatcggg gatgtccgcg gatgcggcac gctcaggctg ggctcggcga    163260
     tgatcttcac cacccggtcg ccttcgcgca tgttctgacc ggtgccggtg acgccgagcg    163320
     tcttggcctg gacgaccgga gccgagacct ttccttcgtc gttgagcttg cggtagcgga    163380
     tcatgccggt gaagtcgcgg ttcagccggt cgaggtcgag gcggaatatc gtctcgccct    163440
     cctgcacgcc cgcccgccag ccagccttca cgtagtgctt ccagaccgcc tcctcttccg    163500
     agttgtgggg cagtccggcc tcgaaggggc ggtgcggcgc ctgccaggtg cggtagagat    163560
     agccgtacca gagcggggcc gacggaacaa agcgtgcctg gcggacgatg tcgtaatagg    163620
     tgtcggccac ccggatcgtc cggccgaaat cggaggactg gtacaggttc cggctctcgg    163680
     aaatcaccgg cggcaggatc tgcacgccgc ccggctgata ggtgaccagc cgcgagaagt    163740
     cgtaaatctg gctgagacgc gcggcgttcg cgcgaagctc gccgtcgatg atccgggtcg    163800
     cccaggccac gccgccctcg gcgccgtaac gcagcgcggt gtcgcggatg accggaagct    163860
     cgaccatctc tttcgcggct tccttgcttg tccccgagcc atcgcggtgc atgcggctca    163920
     tcgccttgag gctcggaatt gcctgccggg cggcgtcgcc ggtctggacc gggaacatcg    163980
     aatcaccgtc attgatatgg atgccaacca tgtccggcgg gacgggcttc gccgacgcgg    164040
     ccttgccggg cgcaccctgc aggttcgcgc agccggtcag cccaaggagg atgaccgcgg    164100
     cggggagggc ggccgatcgg aaacggatgc gcgccatggt caggtcccgg ccgcctggtt    164160
     gacgtcgaac tggatggtgc gggccgccgg cgaaaccact agcttgccgt aggtgcggat    164220
     ccgcgcgccg atgtcctgca gcacgatcgc cgccggcacc ttgttcttga ccaggacgat    164280
     cgtcggcggg gtcgcgggcg tgtgggtcgg cgggaggacc gtgtagttga tctgggccgc    164340
     gagcttccgg atggcgccct cgaccggccc gttccagcgg atcgtcaccg ggcggcgaag    164400
     ctgggcgggg aggcgggcca gatcgatctt cggcagggcc gcctggaccg gcgccgcggg    164460
     ggcggcgatg gcgacaccct tgggggtggc cacctgctgc gggtcgaccg gaccattgtc    164520
     gagctgggag agtgcctgac tcgcctcggt gaacgcccgg gcgagattgc tttcagcctc    164580
     ggcctggacg gcctgggcct cggtggtcat gacgtctgcg tgggcgagtg ccggcatgcc    164640
     ggcaaccagc gcgagcacgg cgagaacggc cttggagcga atgcgtacca cgctctgatc    164700
     cttctgtcgg tgaactgccg ctagaataca atattatgcc ggttattttc cacataaaaa    164760
     ataccagccg ctatcgcacc cggttgggca tcatgagcgt gatctcgacc acgaaccggt    164820
     gcggcggaca tgcaccataa tggcggcgac gtcgtcacca ttgcgcggaa gcttgaaagg    164880
     cggagaaatg tcgagatctg ataaatgtgc aattttgcac accttggcag gtctcgacat    164940
     ttctccgcag cgaataagtc gaaattaccc tgctctaacc cgagcctctt gtcctacatt    165000
     ttgggataaa atattctgaa ttttgcacca aaatacccat gattttgaac agaaatgtca    165060
     tacattttgc acggaattat cctaaatctt gtcggcaaat ggtctatatc ttgcacttaa    165120
     atatgctgac ttttgcaatc taatgtcatg cattttggaa cgaagtgcga ttaggtaacg    165180
     gggggtagaa caaaatcggg tggaaattcc tcctcaaaca gccacccctc gccataagct    165240
     gaaaaccagc gccggggcgt caccggaaac cagcaaaatt cggaatatca gacggaagcg    165300
     ggaaaacagc ggaaaatagc gtagcagggg agtggaaatt cgaattaatc ggaaaatcag    165360
     ggcggggaag gggaggggtg aaacggaaat cgggtttcct gtcgaggcgg gcgaacggca    165420
     tacacaccta aaatgcacct taaaagacag ctgctaaaca ccaccccaac ggccgcgcat    165480
     ttcccaaaat aaaagccggc cccggacgga aatccagggc cggctcggca gcacgaatgc    165540
     ggcctactga ggggtgggca tatcctccgg caccactgcc aagctcccgt ccggtcgcat    165600
     gaagggtgcc ggattgtccg accggatacg gctcatgatc cgttccacat cgaccctcga    165660
     cggtcggatc atgattccgc cggtcccctt gccggtccac ccatcccgct tccggccata    165720
     atgctcggtc gccgtctcag gcactgaatg cccggccagc gccgcaacct cgacggggct    165780
     gtagatcgtc ttccagttgg cgatcgcctg gtggcggaag gagtaggggg agtatttcgc    165840
     cgacatccct gtggctgccc cgatatggtt gatcgactgg cgcagccgcc tgatggtcgg    165900
     ttccgtcccc tccttggccg cctgacgctg gaagagtgcc atcgtgtacc ggatgggctc    165960
     gatatcgatc cgggatagcg gagacaggtc gagaacccgc accagcccgt tggcccgccc    166020
     gttcgacgcc ttcgcgttgc agacgaagag ccagacattg cggccgaacg gcgcgtctgg    166080
     gttcttcgaa gtcctcatat cgcaggttgc ccactccgag ggccgcatgc cggttcggat    166140
     cgcggcgcgc gcgaagtgga acatggtgcg agcagattct ccacgccccc gatcgaggca    166200
     gaactgcagg agcttgttgt agtcctcgag ccggaagaac ttcgtcccct tgacgccctc    166260
     ggacgctgcc acctctccgt catcggcgct cacgccgtca aggattgcag ctgctgcccg    166320
     cgccgaaggg tgcatagagt catacagata gaatgcgctc gcagccttgt atgaacgcca    166380
     tgtcgaggaa ctgagggtcg gtctcaggcc gatgagccac cgcacaaagt cgagcgggtc    166440
     gatatgctcg tcatcgggtg catcaagcgc gtcgtcaggc attgggagag ccccgggtcg    166500
     gcagctgtat ctgttcagaa ggctgtgagc gcgctcacgg tacatctgca ccgtggaagc    166560
     actgaccgtc tgtgggccac gccgcttgtg aaagctctcg acaccgctca gccgcccgat    166620
     atggtcgctc attgaccaaa cggcccggcg ggacgcggtc tcgaagtcag gacattccga    166680
     cacctcgacg tcaggaacaa cctgggcttc cggcggaacc agggacgaca catggggcgc    166740
     cttcagttcc agggtctccg gaaggacaga tgtcgaaaca ctcggttcac gtgccaggtc    166800
     cggcaaggca acatccgccg cgcgagccgg atccatccac ttcgcggcag cacgatcagc    166860
     ttccgcggta tcgcgtcggc cattctgcac gggctgggca tggccaacct tgatgttcct    166920
     ggagagggtg acatcgagcg ggctcgccat ggcagcggcc gcttgctcct cggttctgtc    166980
     ttcaggcact ggatcatcct tccggtttgg tgcgccagcc tcatcgggat gcgcgcagat    167040
     gctccagtat atcgagcggc ggtgatccaa ccaaagaatt actttcacaa ttcggatttt    167100
     gtaagctcgc tgagatcgtg aaaataattg ataattattt ttgaatttat atgctataag    167160
     cattccacgg gcggattttc gcctagccag atcaaggatc aggaccgtga ccgccacagc    167220
     cgccatcccc gtcgaccggc cgtcatacca cgaaggcaag cggctttacc gccgcctggt    167280
     cgccggcgac ctgtcgcacc tggcgcccgt cctcgcatcc ctgcaacccc tcgtcggcgc    167340
     cgccgcggcg ggcctggccg cccggctcat cgaggccggg gtcgatgcgg atgagctcct    167400
     ggtccgggcg gcacttgccc atcacgtccg ccggcccggc tacctggagc ggatggccgc    167460
     gccggacagt atgcgccacg acctggatgg caatccggtc gagccggtgt cagcgcgcca    167520
     ccgcgaccat gcggctgcga cccggaaggc aatgggcccc agtctggcga aggccaggca    167580
     gcaggcgcgg cgccgcacgg agcgggaggc ccgctcgaga tggcgtgcaa ccccggctcc    167640
     ggtcgtcgag gtgaagcagg ccggccggcg tcggctggcg gctccggccg gggcggggca    167700
     gggggctgtg gcgagccttc gtgatcggct gggcattgcc gcgcgcctgt cgttgggctg    167760
     aactcctaga atagaacctc ttcaccggcc gcccgcccga tccggttcgc cgctcgtccg    167820
     aacatctcca cctcccgcgg cgtcatcccg agtgcgttcc cgtattccgg tgcgccgttc    167880
     gtgatcgcga gccagagcag cttcagctcc tgccggctga atgcgatcca gaacgagcca    167940
     ggcgcggcgg attgcaacgt gtcgacggcc ttgcgggcag tcctctcgga cggctgggac    168000
     accacgaact tgccggcaag ctgctgcgat aatgcggcga gcgacgcgga agcttcggcg    168060
     ggggtcagtg cggctgattc ggcggccatc gggatctcct gttggcttgt tgcttccatt    168120
     ctaccgcgcg gaccgatgag ccttaacctg cccaggagtt cgggatgccg gcgaggtcac    168180
     ctggcgcacg ctgccgtttc gggcctctcc atcagaaaac cctccattcc agtgggcatt    168240
     tattctggat ttttgctcca aagtatccat catattgggt gtcaaatatg atcgcgccca    168300
     cccggccggc cgatctgatc tggaggtcca cgactatgcc aaagctcagc cccctgtcgc    168360
     gcgaggaaat gatgagactg cggacccagt tggccgacga cgtcgaggcc ggcggcctgc    168420
     ccctatcgct ggccgtccga cggatgcgca aggcgatcgg cttcacgcag gtgcaattcg    168480
     ccaaagccat gcggctcacg acccgccaga tctgggagat cgaaaacggc aaggcgaatc    168540
     cgtcgctcga gacgatgaac aagctcgccc acccgttcgg gttccgggtc ggcttcatct    168600
     cccggcatcg agccgccgcg atggaagagg cggatcgagc gccctgaggg ctctcaagac    168660
     tggggtcagc caggttcgtg gggaattccg cccacagatc agtcgccccc ggatcagccc    168720
     gggctgatac ttagcgcctt ggccacgagc ggctgagccc acgcgacggt cgccgacaac    168780
     tcgccgccct tcggaatcag catctcccgg ttttgcacgc ggaaaacctc ccgtggcgcc    168840
     ggcgatccgt ccgctgactg gtgagagttg tcccagaccc gcatttcagc ccgcgtcccg    168900
     atgaatttga ggagattggt cctgctgttg tcgtatcgct cgcggatctt ccgctccggg    168960
     atgtcgtgcc caccccgggc cacccgctca gccacgcgct ggatgtggag atccaccgag    169020
     gcaaggccga catagaagat caggacccga cgctcgagcg cgagagcacg cagcagctcc    169080
     atcgtgatgc ttgcaccgcc aagcgttgtc tcgaaggcga agttgagatt ctggtcgatc    169140
     gctcgctgaa gcccctcgta accgagcccc catgctcgcg cgtttgcctg ctcggtacca    169200
     agcccgatcg ccatgaaact ccgcgcctgt tcgtcgggat tatagtatgc gccgccaagg    169260
     ctccggatca gcggaccaac gattgagctc ttgccggcgc cgttggtccc tgccgcgacg    169320
     atgatccggc cgaccttagc ggccaacacc cgaacccgac cggtgaccgg gcgcccttct    169380
     gcgcgtccgc cgataggcgt ccaccgctgc ctttggcagg tcctccgcag tcagtgcctc    169440
     cagcctctca tacgccgctt cggatcgatc cgactgcata tcctggaaca tctggttgaa    169500
     ggattcctgc atgcgagcca actcgccgac cggaaccgtg cccgccgcct tgaccgcctc    169560
     gtagaggtcc ggcgagatga ccacgaattc gagcttaccg tgtcgggtca cttcgacagg    169620
     tgcccgcctg gcctgttccc cgagctttgc gaagctgctc cgagcggcac tggcctcgat    169680
     gacggctgac ttgctcatgt gaacctcgca attccacttt tgtccaaaat tacccgttct    169740
     gtacgatata ggcaatcggt gtcggcttgc gagtccgtgg gtatcgacac ggctccggat    169800
     cgccctccgg ccacgggccg acaatgtccg tcaagtgctc gccgatcgcc atgaaactgt    169860
     cgttcgttac gcatatggaa cacgcgacct cgggcaagta cctgctccgg ctagagatct    169920
     aggcgctcat agagactgcc gtccgacgtc ggttggatat gcgccggcga agggcgtgct    169980
     ggcgattgcc gcagacgccg gtcgacgtcg tgccatggca ctgaaccagg aattctcagt    170040
     acgatcgaaa cgaccacact tgacataatg gtcgatcgat gttttgcgtt ctgaattcag    170100
     aatgcggtat ttgtcacacc caaggtgact ggtcagttca tcgaaaacga cacttgcaga    170160
     cggggcgagc catacgattt ttgatgtcac tcggaagccg gaccatatct gtttggccgc    170220
     gggccgcctc gcgacgccag aaggctgatc accctcaccc aggtcacccc ggtaaagacg    170280
     gtcaggacca acaaaatctc gccctgccaa tgggtttcct ggtgtcggga cagcagacgc    170340
     atccattcct cgctcaccat gatcagggcg gcgaacagca catagaacac cacgatcagc    170400
     cagcctgatc ggccgacatc gtgcaggcgc cgcacctcca gcgggatcgt cggcaccagc    170460
     aatatcaggg agaccagtgt caccagcaca agcatcggca ccccttgccc tatcggcggg    170520
     ggcatcaaga ccagcctgat gaatgcgaac gcgcctcgca caagcgtggc gaacaagaag    170580
     aaccaccaga attcggatcg ggacgcccgg ccggaatacc gggaccatcc caccgaaccc    170640
     cgcttcacgg attcagtgaa ggtcattacg gctatccatc ctggccacac gcctatcatc    170700
     aggccggcgg atcggaaagc ccgaccggca gtcaacgttc agtgaatatt aaagccgtag    170760
     cagcgaagac agggtcgaac accctgaacc tttccgtcta actgagcatc caggtggccg    170820
     atggggattg atacgggtct ctaagccgca tgcaaactac atacatatta gtcgacgtgg    170880
     ctgacgccgg cgaggtgttc catccgttcc gtatccgcac cgagttcggc ggcggagccg    170940
     tcatagacga cctcgccgtc ggacagcaca taggcgcggt cggcgagctg gagggcgaga    171000
     tgcgcgttct gctcgaccag caggatcgac atcccctcgc ctttcatccg gccgatcgtg    171060
     cgcatcactt cctgcacgat aaccggggca agcccctggg agggttcgtc gaggatcagg    171120
     aacttggggt tgagcagcag cgcgcgggcg atggccagca tttcctgctc gccgccggag    171180
     agtcgcccgc ccttgctcgt cttgcgctcc tcaagccgcg gaaacagctt gtagatcgtc    171240
     tcgatggtcc agggcccctt ggtctcgggg ggaacgagca ggttctcgtg caccgtcatg    171300
     tgcccgaaga tcttgcggcc ctcgggaaca tagccgacgc cggcattggc gatgcgatgg    171360
     gaggcggcct tggtcacatc cttgccgaac agcttgacgt tgccatcgcg gggcggggtg    171420
     aggcccatga cgctgcgcat cgtggtggtc ttgccggcgc cgttgcggcc gagcagggcg    171480
     atcagctcgc cctggttcac cttcagcgag acgccgtgca ggatatggct cttgccgtaa    171540
     taggtctgca ggccctcggc ttcgagaacg gcactcatgc ggcggtctcc tcgatggcgg    171600
     ttccgagata ggcgctctgg acgcgcgggt tggcggagat ttccgccgcc gtgccctcgg    171660
     cgaggaaggt gccgttgtcg agcacggtga tgcggtcggc gatgccgaag acgatcgcca    171720
     tgtcgtgctc gacgaagagc atggtgatgc cctggtcctt gttgagccgg cggatcaggt    171780
     cggtcatgtg gtgcgtttcc tcatccccca tgccggcggt cggctcgtcg agcaggagca    171840
     ggcgcggatg gcgcgacagg gcgatgccga tttccaccac gcgctggtcg ccatgcgaca    171900
     tctcgccgac gatgcggtcc gccttgttgg cgatgcgggt gacctggagc agctcgtcca    171960
     ccttttcatc gaccttcgcg cgcgccgccc gcgagatcca ggggcggagc tgcaggccca    172020
     tcgccgtttc caccgcgacg cggatgtttt cgtagaccga gagcgagagg aagacctggg    172080
     tgatctggaa ggtgcggatg atgccgcggc ggaccagatc gttcgggctg accgcggtga    172140
     tcggctggcc gtcgaagatg atctggccct cggtgggcgg gaagaaaccg ctgatcaggt    172200
     tgaacagcgt ggttttgccc gcgccgttcg gcccgatgat ggcgcgcagc tcgcccggct    172260
     cgaccgcgag cgaaatgtcc ttcagcgcct gcagcgcgcc gaagcggcgg ccgacatgtt    172320
     cgagtttcag aaggctcacg accgcgccct ccccttgatg aagccgagca ggccctgcgg    172380
     gaagaacagc accgacagga cgaagatcag gccgatgaag ctcatccagt tctgggtcac    172440
     gctggagagg tagtcctgcg ccgcgatgta gatgacggcg ccgaggaacg gcccccagaa    172500
     gctgcgcatg ccgccgagca cgcagatgac gacgaaggag ccggagagct gccattgcag    172560
     gtcgtccggc gaggcgaagg cggtcagcat cgcgttcagg ctgccggcga gcgcggtgat    172620
     gaaggccgag atcgcgaagg cgacccagac ctgcttgtcc accgcgacgc cgagaaagcg    172680
     caggcgggtg gtgttctcgc gggtggcgac gaaggcatgg cccatcggcg agcggaggat    172740
     ctgccagacg acgagcatga ccaccgcgaa tagcgccagc acgacataat agaagcgcgc    172800
     cgggccgaga ttgatggctt cgccgccgag atgcagcggc acgcgggaga agccggtcag    172860
     accatcctcg ccgccggtga cggtgttcca gcgcaccgcg aggaagtaga acatctggcc    172920
     gaaggcgatg gtgatcatcg cgaagtagat gcccttgcgc ttcatcacca tcggcccgac    172980
     caggatgccg ccgatgccgc cgagcagcgt gccggcgatg agggcgagcg gcatcgaggg    173040
     aatgacatgg atgatgaaca ggccggtgcc ataggcgccg aggccgaaat aggccgcatg    173100
     gccgaaggac aggccgccgg tgtagccgag cagcaggttc agcccggtcg cggccatcgc    173160
     gtagaccagc acgcgggagg cgagatcggt gaaaccgccg atcgcgggca gccagatcgg    173220
     gacgaagagc agggcgagcc agatgatcgc tgccgaaatc tcgcgcccgc cgatcgaggg    173280
     cgcgggccgc gtggccggct tggtgtcgag tgcagtgctc attcgaacag accttcctgg    173340
     ccgagcaggc cgcgggggcg gatgaccagg accaccgcca tgatgacgta gatgacgact    173400
     tcctgcgcga ccgggtagaa ggccgcggtg aggccggagg cgatgccgat gatcagcccg    173460
     ccgagtacgc tgcccatcag gctgccgacg ccgccgacga tgatggcgac gaaggctggc    173520
     atgatcagcg aatcaccgat cgtcggcgac aggccgagct ggccggcggc gaggatgccg    173580
     gcgacgccgg caaggaagat gccgatgccg aaattcaccg cgcgcagaaa gaagatgttc    173640
     acgccgagag aggagatggt ttcgagatcg gcattgccgg cgcggatgcg gatgccgatg    173700
     cggctgaacc gcagcaccgc gaacagcgcg ccggtgacca gcacggtgat caggatgacc    173760
     acgatgcgga agccggtgag aaagaacatc gaggagctga gcggcgagtt gaggtagttc    173820
     ggcagggcga agggctgccc gatcgagccc cagatggtgc ggatcatgtc ctgcatgatc    173880
     atcgcgaggc cgaaggtcag cagcagcgag aacagcggat cgcgcccgta gagcgggcgg    173940
     atcagcaccc gttcggtcac gaccccgacc accaccgcca gcagcggggc gacgaggagc    174000
     ccgccccaga agccgatata gggttcgagg gtaaaggcga gatagcctcc gagcgccatg    174060
     aaggtgccat gggcgaaatt gatgatgccg ttcaggccga ggatcagcga cagtcccagc    174120
     gccatgagcg catagaagat gccgaccacc aacccgttga aggcgctgta gacaagcaga    174180
     gtttccacgg atcttacttc atatctggcg cccgcgggcg cggctggaga cgaggtcgcg    174240
     cggcggatgc ggcgaaccgg cccacgactt tcgccgtggg ctggcccagt ccgccacgcg    174300
     ggcgggcttc agctcgggta cgtcatcttg cagccggcgg cggccggcga cagggcgatc    174360
     ttctcgctcg gcaccacgtc ggccaccttg aacaggttcg gatagctcgc gtccttgggg    174420
     acgtagccgg ggaacatgtt cgccatcatc tgatggtcac cggcgcggta gtgcaccttg    174480
     cccggctgca gcgcgatctc cggcggcagt tccatgcctt cgagcgcctt gaccaccttc    174540
     agcgagtcga gcgtcttcgc ctgattcgcc gcaagggcga tggaatgagc gcttacataa    174600
     ccgaaccaag accgagcggt tgggactttg tcaccaaatc gacgcttata tgccgtgacg    174660
     aagtcggcaa cgtggggaac gccgggctgg ttccagtacc actcgaaggt ccaccagccg    174720
     agaagggctg ccttcggaag agactctaag acctccattt cctgcagcgc gccggcgatc    174780
     gccatctgct tgtcgaggcc gaactgcacg gcctgcttca gcaggttcac gaggtcgtcg    174840
     cccgcctgca ggcagatcag cacgtccggc ttcgcggcgc gggcgcggat caggtaggag    174900
     gagaagtccg tggtgccgag tggcgcaagc gcattgccta ccgatttgcc acccgccttc    174960
     tgaagttgct ttacataatc cctatgctca gcatgaccaa aagcatagtc aggtgtaata    175020
     aagaaccact tcttgccaaa ctttttgaat agggtctcga agtcaccggc cgtaagcatc    175080
     catgtggtcg agcaggtgcg gaatgtggtc caatgacatt tgctgccggt cacgtcatct    175140
     acgtgaccac cagtatcaat atagagcata ttatgctgca atgcgaattg actaagtgat    175200
     tctgccgtag ctgagttaac tgctcccatc agaaaattga ctttgtcctc agcaacaagc    175260
     ttttgcgctt tcgtcactcc aggacctggc aggctttccg aatcttcaac gaacatctga    175320
     acgggccggc cgagaatgcc gcccttcttg ttgatctcgt cgatagccat tgttgcgcca    175380
     tgaatctcgc taaacccagc agccgcatat gtacccgtac gcggatcgat catgccgatt    175440
     ttgactggct tctcactggc agcccagctg atatttggca gaattaagct tgaagcaccg    175500
     gttgcaccag cggctttaag caaccctcga cggtctaacg atccaggatt taacgatttc    175560
     attcgaactt tccctttccc tcagttgttt tattaattaa gccaaaaatc gcatacataa    175620
     ccagaatatg tttataattc attctccaag aacataattc ttatatcgta atgcgatata    175680
     atcatattat gtgcgaatct ataaagtgag tcaataaata aacggcatga aacgcccccc    175740
     aacatgccat cagtataaat cacatggcta cacgtgaagt ttttcaaaat ctgtaatata    175800
     atctcttatc aatggaattg tatcgatact atgcgaaagt tgaatctgga atacgatatg    175860
     attagcatac tcgaatgcca actgagagcc ggcaagataa aattcaaaca ttctatagaa    175920
     tttatcatca tataaatcaa taatgcgttt ctggttggca caaaaattat gacgccattg    175980
     atacagcgtt tttgaataat gaagtcttaa tatctcaata tcattgtata atagaccaga    176040
     tttttcaata ggtgcaataa cttcggataa tgacggacaa taaccgcccg ggaaaatata    176100
     ttttgaaatc caagggttcg tactcgccgg cggatccagg cggccgattg catgaagtag    176160
     agcaaccccg tctgctttta gacaccgatt gataacctca aaaaaagccg aataatttgg    176220
     tactccgacg tgttcaaaca tgccaacaga aacaattctg tcaaacttat caaatattgt    176280
     acggtaatca catagataaa actggcactt gtgggccaga cctgcatccg cagcacgttg    176340
     gcgagcaacc ataatttgct cttcggatag agtaatacca ataacgttgg catcataatc    176400
     gtgtgccata gttaaagcca tgccgcccca accgcatcca atatccaaaa cattaagatt    176460
     tggtctatct aatattaatt tcgctaatat atgacgcttt ttcgcgattt gtgcaatatc    176520
     tatagtctca tcaccattag gataataagc gcatgaatat tgtaagtcac tatcaaggaa    176580
     tatttgataa acatcattgc caatatcata atgatgcttt acgttacgca tagagcggat    176640
     tttactattt gcttgactaa aagttctata aattctgcga aatattcgac gaatccgcat    176700
     gataaaggtc ccacgatcat acaattccgt atttgacatg aatacgcgta aaacgtcgta    176760
     gacggtgcat tcgacgggct ttaaggtccc gtccatgtaa gcctcgccca tagcaaggtc    176820
     aggattaatt acgagtcttc gagctgtcgc ggcggacttt atctcaaggg ctgcccgagg    176880
     aaactgccca tcgccatatc gagtccagct tccgtctggc caaaaaattt cgacagtacc    176940
     ggtcttgata agccttcgca gatgatagtc gataataagt cttgcaatca tgacattatc    177000
     tcatcatcgc aattcagtgt ctacatcatt ttgtgcgccg ttctgattga ccagaatcgg    177060
     aatcatttgt ggctctgcat tttgcattcc tggaacattc tgtattctat tcttgcgaga    177120
     agaaaacagt ccctgtagaa aaaagcgttc gcggcgggtt tcggcgagca tgacgcgctg    177180
     gtggacgcgc agcaggtcgg cgcgggagac gatgccgagg aggcggcctt ctgcgtcgac    177240
     cacggggatt cgcggggcgt tccgggtgag catccgcacc gcgatggtgt cggccatttc    177300
     gtcgggcgcg gcggtcgtca cctcgcggcc ggcgatcatc gcgcgcaagg gcaggtcgcg    177360
     ccgcacctcg tcgccgatcc agtccaggat gtcggcgcgg gagacgaggc cgagcacgag    177420
     gccgtccggc gccgtcaccg ggaaggcgcg gtgggccgcc gcgtgcgaga ggaagcgctc    177480
     gatcgcagcc cccaccggca ggtccgccgc cagcgtgtcc accttggttg ccatgatgtc    177540
     gcggatgcgg gtcacggcca gcgggtcgat gctgtattcg cgggtgaggt gatggccgcg    177600
     ccgggcgatc ttctcggtca ggatcgagcg tttcatcagc aggacggtca ccgccatgct    177660
     ggccatgctg gcggcgagca ccggcaggag gatgaggtgg ttgccggtga gttcgacggc    177720
     gaacagcgtc gaggtcagcg gggcgcgcat ggtgccgccc atcatcgccg ccatgccgag    177780
     caccgcccag aagccggggg cggcgtgcgg catgacgggg gcgaggaccg cgccgagcgc    177840
     gccgccgatg atcagcagcg gcgcgagcac gccgcccgag gtgcccgagc ccagcgccac    177900
     cgaccagatc acgcccttga ccaggacgag acggatcgcg gccccgccgg cgagcgtgcc    177960
     ggcgagcagg cgcgcgatgt cgggatagcc gacgccgagg gccgccgggt cgaatacgcc    178020
     gccgatgccg acgacgaggc cgcccagcac cggccaccac atccagtgga tcggcagtgt    178080
     ctcgaacccg tcctcggcgg cgtagacgag cacggtgagc agggcggagc cgagcccggc    178140
     ggcaaggccg aggccgagcc agccgagggc gtgcagcgga tcgacgatca ctccgccggc    178200
     atagggaaaa agcggcgccg gcgtcatgca gaggcggcgg aggatcgcgg cggtgatgca    178260
     ggcggtggcg accggaatga tgctgcgcgg cttcagctcg aacagcagga gctcgaccgc    178320
     gagcaggagg gcggcgaccg gggtgccgaa aaccgccgtc atgcccgcgc aggcgccggc    178380
     gacgagcagg gtcttgcgct cggcatcggt cagggtgaag cactgcgcca tcagcgaggc    178440
     ggcggcgccg ccggtcatga tgatcggccc ctcggcgccg aacgggccgc cggtgccgat    178500
     cgagatcgcc gaggagatcg gcttgaggat ggccacacgc aggtcgagcc gggcgccgcc    178560
     gagcaggatc gcctcgatcg cctcggggat gccgtgcccg cggatcttct ccgagccgta    178620
     gcgcgccatc aggccgatcg ccacggcgcc gccggcgggg acgaggatcg tccacagcgc    178680
     gggatggccg cccggcgcgg cgccgcccgg cgccagcatc cgggtcgacc agacgccgta    178740
     ataggcgagg tcgttgatca gcccgatcat gcgcagcagg atccagccgg cgatgacgcc    178800
     gaacaggccg gcgcaggcgc cgaagccgat cagccggaag atcccgcggt cggtcgtgaa    178860
     gtcgccaagc tggatgcggc gcggcgtctg gcgatgtata aatggcatga agatcgtaat    178920
     ccgatataaa ttggacgttg tgcctatatc gcaaaacgat atataagagc aaggctttgc    178980
     tctgaaagga aaatgcatgc ctgatccaca gctcaatgat gacgactacg aaatgctagc    179040
     ctcattccgt tatactctca ggaaatttct tgcatttagt gagaccgccg cccggcgtga    179100
     tgggctcacc ccccgccaac atcaagcact cctcggcata cgtagtatgc aaactcgtgg    179160
     cactgcgagt atttctgatc tggcttcgtt cctaattttg cagcataaca gcacagtcga    179220
     gttggtggat cgtttagtcg catcaggctt ggtattgaga tcgacagacc ccgatgacgg    179280
     gcgacgcgtg cttcttgagg tcacaaatct cggagaaaag ctgcttgcca atctttcgta    179340
     tactcacttg gatgaactcg aattgatcgg acctgagtta cgacgccttc tcgcccgcat    179400
     tcaacgatat agacgtggaa agagcgacaa agcgcaagtc aaaataccaa gcaatacgaa    179460
     gtcatactga tctaaattag acatagtaac aataaaacaa aaatacttaa tatacctaag    179520
     catattatag aaatgtcata tctggtgaac gtaattcctg atttggaccg tttcttcacg    179580
     acaatatctt tttctgatat ttttttattt ataaaaataa tacataatgc gatttcattt    179640
     agaattccta cgattgtagc tgtatacttt cccatcctgc ccttgagcgc ctatctgtgt    179700
     tacagaattt ataaatgcga ttgttggctt gacatatcgt aatgcgacat gtcaagctcg    179760
     gcataggtcg ttatgcagcg agagctcata gcggcttgat cattagatcc agcattgaga    179820
     aaatacgatc tatcgtttgg cctgatgctt actgggtaga tcgtttccca attgggtctt    179880
     ttggtgttct tgttaattca ccctagtaca ctctaggccc catactgtca ggtatggggc    179940
     ctttcttcgc agcagaattc tacccaacgt cagaaccgcc ccgggtttgc cggaggctcc    180000
     aactcccaaa taggatggag ccataacgag tccgacgacg aacaagtttt ctcctgaagt    180060
     ccgcgagcgg gcggtgcgga tggtgctgga gcacgagggc gaacatccct cgcggtgggc    180120
     ggcgatggtg tcgatagcgg cgaagtttgg ccccacttgg acagttggtt ttataaagtc    180180
     tggtgatatc aatagtttat ttgcccgctt gcaggtgtta ccactacatt tttggggcgt    180240
     tgggtcggcg ctgcgtggcc gcggcttcag tctgcggggt gttcgctgat gttgtggggc    180300
     agcgcgatgc cggcggcctt gaagacattg ccgacctggc cggtgacgtg ggtcctcgtg    180360
     gtgatgacct tgccgccctt ttcgatggtt gcctgctgga gcctgtcgag atcgttcagc    180420
     aacttctgcc attcgggctg gaagcccctg gcgccgcaca ggcggttcag ttccttggcg    180480
     agtgtcaggg ccaggaagga acagaaaacg tggccgcgga tcgcggcgtc agcctggtga    180540
     aagaccggcc gtgtatcgaa gctggccttg gcggcgcgga acagggtcct gagcacgctg    180600
     aggccatcga agcgggcctc ctcggccagc ttgcccggat cgatctcgaa ggcgttgccg    180660
     cggctgcgga gataacgccg gtaggccgag ttcccgacca gcgccttgtc gcccttcttc    180720
     agctgggcct gcagcccgtc gatgatggcc tggcggtcct ccctgtcctt tttcgcctcg    180780
     gcctcattga ccgtgacgat gtagcgctgg gccgccttgc ccttgccaat ccggatctcc    180840
     ttcacccaca gctgggtctc gccatgctgg cgatcgagca cgagcgggac catcgcggcc    180900
     ttgtccttca gcacgacgtc gcggatcacc cggctggtgc gctcgcgcgc gccgaggatg    180960
     tattccatcc ccagcgcgtc cagtgccgcg atggtatcgg cgctgaccat gccgcggtcg    181020
     gcgaccacgc aggcgcggtt caatcaagat gggtaagcag gttggtttat gaaaagagtc    181080
     aatacgccgt attcggcggg atcgatacct gatgcgaaag caggacggcg aataggggcc    181140
     cgtagaccgc gaggataaga agaaaggcca ccagggtcca caaacccagc cggtccatca    181200
     gccgcaccca gcgcgagtct tcagcaacgg gagcattgcc aaaggggatt tccgtcacct    181260
     ctgaagcaac tacgggtcgt gacgccagtg tgccaaccgt taccaccacg aagcatatca    181320
     gggcagtcag cagcaccagg ccggctgcag cggtgatcgc catcgggatc ggatggacga    181380
     acggatcggg tgaaagcgag ctgatccaat cgcgccgcgg agtgccgtaa agcccctgcc    181440
     acattagccc gacgccaatg cccatcatcc cacccatgcc gcccatcatc ccgccgcccc    181500
     atccggctcc ccacggctgg gcaagcgcga ccgccgacgc agcgagcagg cccgcgatcg    181560
     cggcaccggt cagaagacgc cagcgaggcg cgcggtcgcg accgaagacg ttcggaaacc    181620
     gtgacgatct gctgcggtat ccgctcatgt cgatcccgat ctctcagttg tcgttgacag    181680
     ccaagcagat ccgccggcat cgcgcattga tcgacgtcaa tctcgatctc gcaccggcga    181740
     tcgggggcgc ggtagatcgc gcatgagcca aaggcccgag ccggcgacga ggacggcgga    181800
     gatccagagt gccggaaggg ttgcgtgggc gaactgcgcg atgaggccga gcgcgacggc    181860
     gccgagcgcg tagccggtgt cgcgccagta gcggtaggtg ccgagggcct tgccgcggat    181920
     caatggcgcc gcctggtccg acatcgcggc gatcaagtta gggtagagca gtgccattcc    181980
     gatacccatg acgatcgccc ccggcagcca tagcgacgca tcgcgcccgg ccgccgtgat    182040
     cgcgatgccg gcggccagga ggaagaaccc ggcgatcact ggggcgcggc ggccgacccg    182100
     gtcgcccaga tggccggtcc agagctgcga gacgccccag accatggcgt aggtcccggt    182160
     cagccagccg atttccacca gctttgcacc acgcgccttg aagaacagtg ggaacatcac    182220
     ccagaccagc gtgtcggcga tcttgttgac gaccccgccc tggcagatcg cccgcccgac    182280
     ccgatcgcgt aaagagatcc ggacgaagat cgcgccgagc gtgagcgtat gatcctgcga    182340
     tgcgccagca ccggcctcgg catgttcggc cttcacccag gcaagcgtgt cgcgcacacg    182400
     ggtgatcgtg gcgaaggcca gaccaatcgt ggccatgccg aaaatcagca gggcatcacg    182460
     cgcgccgacc gcctcggcca gcaaggcagc acaagcaccg gcgaggccga cggcaacata    182520
     tccagtagcc tcgttgatgc cgacggcaag cccgcgctgg tgactgccgg cgaggtcaat    182580
     ctggctggtc accgtcatcg tccaggtgaa gccctggctg atcccgagaa acacgttcgc    182640
     gatcacgatc caccaccagt tgggtgccgc ccagatcagc agcgggatgg gaatggctgc    182700
     gatccagcct gcgatgagga caggcttgcg gccgaaccgg tcggcgagcc cgccggcgac    182760
     aaggttgagc gcacccttca ccaggccgaa ggagagcacg aaactcgcga gaaagagaaa    182820
     ggcaccgggt gcgacgccga actcgtgcgc gagggtcggc aggaccgcgc gctccatgcc    182880
     gatgacaaga ccgacgaaga agacctgtag cgcctgtagg gtaaactggc agcgattggc    182940
     cgcaatgccg cggatatgag ccgcggcgtt cgccaccgtg gtcacgcggt gaagcccgca    183000
     ttccaggcac gcagttcggc tgcgccatcg ggggcgggcg ggatattctc gagcatgaag    183060
     gcgacgaagc gctcggcatc gtcgatgcgg aaggcggggt tgtgccgccg ctcaaagccg    183120
     atggtggaca ccggtttgcc cgagagacct cggccacaga cagagccagc cagagcaccg    183180
     ggtagcacct cgatatgatc cggcagcgcc ttgagccgga cgaggctggc gaagaggtcg    183240
     cgcgcgccgc gcgcggcgtc ggtcgcaagc tcggtccggc cgacatcgcc caccatgagc    183300
     gtgtggccgc cgagcacgct ccatggctca tctgcgcggg tgcgatcggt caccgtgagg    183360
     cagagatgct ccggcgtgtg accgggcgtg tgcagaacct cgagcacgac attgccgatt    183420
     tcgagccgtt cgccgtcagc gaggcggcgg cacgcatagc cgacctcggc ggattcgtgg    183480
     atggcgtatt cggcgccggc cgcttcggcc agcgcgcggc cggcggagcg gtgatcggca    183540
     tgcagatgcg tgtcgatcac gaggtggatc ggcgagccgg aggccgaggc ggcgtgcaga    183600
     taaggttcga tcggaaacag cgggtcgaca accacgccgg cgcccttgcc gacacagccg    183660
     agcagatagg aggccgccgt gggatcggtg tgcaggaact gtcgcaggat catgagtgtt    183720
     gctcccggct gaggtggcga tcttgtcgcc agcgcgctat cacattatca ttcgcgatat    183780
     tgatcgaatg agtcgaagat gaagtcaagc agcggtccaa agcaacagat tttcagccat    183840
     ctcgccgaga tcgccgcggc gcttgcgcat ccgcacagga tcgaaattat cgaactgatc    183900
     gcccaaggtg agcgcagcgt ggaggatctt gccgaacgga ttggcctgtc gctctcgaac    183960
     acgtcccgcc acctgcaggt cttgcgccgt gcccgccttg cggcgccgcg gcgagagggc    184020
     aagaacatgt tctatagcct ggtctccgag accgaggtgg tgacgttgct gggcagcctg    184080
     ggtcgagtgg gcgaacggaa catcgcggaa atcgaccagg tgctgcaggc gtatttccgg    184140
     gcgcgggatt gtctcgagcc cgtatcgcgc ttggccctgc ttgaacgcct ccgggacggc    184200
     agcgtgacac tcctcgatgt ccggccggcg gacgagttcg cccggggcca cttgccgggt    184260
     gcgttgaaca ttcccctcga tcagctggat gcggcgctgg gcggcttcac cgagaatgtc    184320
     caggtcgtcg cgtattgccg gggaccctat tgcgttctgt catatgacgc cgtggcgcag    184380
     ttacgggcgc gtggcgtgcg ggccatccga ctggaggatg gttatccgga gtggaaggcg    184440
     gcgggcttac ccgtcgagac ttgatcgctc gtggatctca cccgcaggcg gggtgatttc    184500
     acgctatgtg gcattgacgg ccttatagag cgcagtgttt ccggttagga tccctggcac    184560
     acatttgagg ttgcgattta gggagaatat gaatccgctc cgctcactga cccctggcaa    184620
     ggcatcatga atcagtggct caggatacca atcggcgttt agacccatcg ccgaataacc    184680
     gtcggatttg cttgggcatg agcggaaacc cgccattccg ctttcgtgaa gagtttcggg    184740
     cgccgtgagg cgtacgaaag tccccgagga aggaacccgc ggtgagcgag cactggccta    184800
     tggggaattc gattttgggc tggtgggctg gatgtatcgc ttggtacggc tgtcgggctg    184860
     gtgactggcg gcgacgcgag gctggtgcac ggcgtggtgg tgttttctgg tcgggtcgtc    184920
     gtcggatgag gcgattggat cagggtttgc cgccacgggc gcaggattgg cggttggccg    184980
     aagcacggtg gctgcggcgc tggtagcgag ttgcggatgt cgtctgcgcc gggtcacggc    185040
     gaatgtattc cggcggatga cgtgcgctgc ggtggggccc tgggctgaga ccagcgggcg    185100
     aaggtctcga cgatgatcat gtggccgccg cagcacgggc acggcggacg ggtatcgagc    185160
     acttcttccg gcctgttatc atcgggtgga gatgctgcga cggcgagcag ttcgcgtgcg    185220
     tgcgcgagat tggccttgcg ggtgatgccg gcgagcaggc cgtagtggcg gatgcggtgg    185280
     aacccacgag gcaggacgtg gagcaggaag cggcggatga actcgccggc ggcaagcgtc    185340
     atgacctgat agcgatcggc gccatcgcgg cgataatcct tgtagcggaa cgtgacgccg    185400
     gtttcgttga aggcgagcag ccgccggttc gagatggcga cgcgatgggt atagcgcgag    185460
     agataggcga gcactgcttc ggagccaccg aagggcggct tggcgtagac gacccagcgt    185520
     ttgtggcgga ccggcgagag gtggcgcaga aaggctcgtc ggtctgtgag tggtgcgagg    185580
     ccgccgaaga aggcgagctt gccggcatca aagagcgcga gcaggccggt gacgaacagg    185640
     cggcggaaca acttgcccag gacgcgcacc ggcacgagga aggccggccg cgtggagacc    185700
     cagcgctcac cgtcgagcga gatgccgccg cccggcacga tcatgtgcac gtgtgggtgg    185760
     tgggtcagtg ccgaccccca tgtatggagc acggcggtga tgccgatccg tgcgcccaga    185820
     tgccggggat cggcggcgat cgtcagcatc gtcttggccg cggcgtggaa cagcaggtca    185880
     tagacggcag ccttgttgtg gaaggcgatg tcggcgatcg cggccggcac ggtgaagacg    185940
     acatggaaat atccgaccgg cagcaggtcg gccttgcgcg cggtgagcca ggagcgtgcg    186000
     gcggcaccct ggcacttggg gcagtgccgg ttgcggcagc tgttataagc gatccgccga    186060
     tggccgcagt cttcgcaggc ttcgacatga ccgcccaggg cggcggtgcg gcaatgctcg    186120
     atcgccgaca tgaccttgag ctgatgcagg ctcagctgcc cagcatgggt ggcccgataa    186180
     acggggccgg cggcgcggaa gatatcggcg acctcgagcg aggcgcccac cgcctcagcc    186240
     ggcggggcgc tcctggtcgg cggtcacgat ccccagcctg tccagcggac tgatcacggc    186300
     gcgcacggtg cgcgtggcga ccttggtgta gagcgcggtg gtattgaggt ggctgtggcc    186360
     gagcagggcc tggatcacgc ggatatcgac gccgtcttcc agcaggtggg tcgcgaagct    186420
     gtggcgcagc gtgtgcgggc cgaccctctt ggtgatctcc gcggcccgtg ccgcctcgac    186480
     gacgacgcga tgcaactgcc gggtgctgat cggcttcgtc acttgctggc ccgggaacag    186540
     ccagccttgt gcgtgcatca cgccctgttg atggccgatc ttccaccatt cacgcagcaa    186600
     gatcagcaga tccgctggca ggatggcatt gcgatatcgg ccccctttgc cccgctcgac    186660
     gcggatcagc atgcgctcgc tgtcgatgtc gctgaccttc agtgccgcga cctcggccac    186720
     gcgcatgccg gcaccataag cgaccgaaag agccgcctga tgcttgaggc aggtggtcgc    186780
     gttgagcagc cgtgcgacct catcccgact gagcacgacg ggcaggttgc gagggtgcgg    186840
     cgtccggatc agcttgcgcg ccagatcagg ccggtcgatc gtttgcgtga aaaagaaccg    186900
     tagcgccgag acgatgctgt tcatggtcgg tgtcggcacc ccggcatcgc gctgctcgat    186960
     ctggaagcgg cgaagatctt ccgccgtcgc cgtatcgggt gaacgcccca ggaatgtggc    187020
     gaagcgcccc acgtcacgaa ggtaattgcg gtgtgtctct cgcgagaacc gacgcatgtt    187080
     catatcgtcg atcaaacgct ggcgcagcgg gctgatcgca gcagtgcgga ttgattcgtt    187140
     catcgttcgg ctcctttcgg ttgaaagaac caaagatgct ccgtcaccgc cggaatgcgc    187200
     tcaatccagc cacaacggcc aggtctctag ccgatccccc cccctcccgc gcagcgggtt    187260
     cgttcttcgg cccgatcaag ctataaggtg gacctcgcgt tttctcctac tttcctgaac    187320
     gggctgatga atttgcctgt catgtcatta tcgcagagcg gtgtcacgcc tatcccatca    187380
     ggaattgtac ccgtcggctc aagtaacgca gacgcgacgg tt                       187422
//