Dbfetch

ID   CP000689; SV 1; circular; genomic DNA; STD; PRO; 203589 BP.
XX
AC   CP000689; AAOO01000000-AAOO01000076;
XX
PR   Project:PRJNA15753;
XX
DT   12-MAY-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Acidiphilium cryptum JF-5 plasmid pACRY01, complete sequence.
XX
KW   .
XX
OS   Acidiphilium cryptum JF-5
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acidiphilium.
OG   Plasmid pACRY01
XX
RN   [1]
RP   1-203589
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Han C., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Magnuson T., Richardson P.;
RT   "Complete sequence of plasmid1 pACRY01 of Acidiphilium cryptum JF-5";
RL   Unpublished.
XX
RN   [2]
RP   1-203589
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D., Brettin T., Bruce D., Han C., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Magnuson T., Richardson P.;
RT   ;
RL   Submitted (04-MAY-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 16a2b42a2f66e65c23370eacc4bee03c.
DR   BioSample; SAMN02598339.
DR   EuropePMC; PMC4767419; 26677108.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000181
CC   Source DNA and bacteria available from Timothy Magnuson
CC   (magntimo@isu.edu)
CC   Contacts: Timothy Magnuson (magntimo@isu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..203589
FT                   /organism="Acidiphilium cryptum JF-5"
FT                   /plasmid="pACRY01"
FT                   /strain="JF-5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:349163"
FT   gene            155..2215
FT                   /locus_tag="Acry_3105"
FT   CDS             155..2215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3105"
FT                   /product="Uncharacterized membrane-associated protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3105"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28734"
FT                   /db_xref="GOA:A5FT02"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR025902"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT02"
FT                   /protein_id="ABQ28734.1"
FT                   /translation="MLGHLSDTIVHAARTHALLAYGLAFVLTAAEAFPVIGALVPGTAI
FT                   IVGLGALVPTGALHFWPLVAWSTGGAILGDGLPFWFGSRFRHQATGLWPLSLHPDLLPR
FT                   GKAFFERHGGSAVIIARFTPGVRAVVPIVAGVSGMRSLRFYVLDVVSAVIWAPAHVGAG
FT                   VLVGASLAILGVMAGRLEALLIGSIVSLVLLLWLVPRLLRFVISWLESKRGPALAWAHA
FT                   GKGRIRSNVASILDPARTELSGLITLAGALAGSLWLLLGVLQDLIAGDPLVYADHAILH
FT                   FLEPYRSGIPMEAAMACSRLGSGAVTLAVAAVALVWLDRQSAWRGAAYGIAAVIGASLF
FT                   TAGLDLALHRAPPSPIAPGWSLIPFPGGDLATSCAVYGILTVIAGRRLGARPRIGLITA
FT                   TVLFAALQLGSRVYLGLDWFSSELAALGFGFAWAAGLGLAYVARPVEPVAPWRLVAITA
FT                   ATLAIAGTLAVALNRNADLARHDVGRMSTTMTCPDWLQHGWQNLPTRSLGMLGSFSGSL
FT                   TIQWIGPADGLRHALAQLGWRSPAPWTFRNALEFLAPHASPAEIPALPRWDDGRRADLI
FT                   MVFVGHGLAADKRLVLRLWKTSVSVTMPTGSVRTLRIGEIEMQRLRRMVSTLTIPVSEG
FT                   SASTVLPRIAAALPASRLVTRAADGATVLLAGDRAVDTEGCLTQHRGDGAQ"
FT   gene            2212..2889
FT                   /locus_tag="Acry_3106"
FT   CDS             2212..2889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3106"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3106"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28735"
FT                   /db_xref="GOA:A5FT03"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT03"
FT                   /protein_id="ABQ28735.1"
FT                   /translation="MRVLIVEDEAKTAAYLRKGLEENGFTADVATDGETGLEFARHGGY
FT                   DAIILDIMLPRRNGFEILDEIRRRDSQTAVLLLTARDQVTDRVAGLEAGADDYLVKPFA
FT                   FSELLARVRTILRRGHARQPALIQIADLEIDLSGHRATRAGQALDLTPKEFRLLSLLAR
FT                   RAGDVISRTVIAEQVWDINFDSGTNVVDVHMYRLRAKLDDPFSRRLIHTVRGVGYVLED
FT                   CGG"
FT   gene            2918..4261
FT                   /locus_tag="Acry_3107"
FT   CDS             2918..4261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3107"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region, ATPase domain protein; histidine
FT                   kinase, HAMP region domain protein; histidine kinase A
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3107"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28736"
FT                   /db_xref="GOA:A5FT04"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT04"
FT                   /protein_id="ABQ28736.1"
FT                   /translation="MSLRMTAWYAGTAFLLVLLATSLLTWSFGARIARQEDRTLHVLAQ
FT                   IARPLGGAADPSASQAIASALERAGNTREIQFRVIGPHGRITIQSKGNHLPLPSSVGLP
FT                   NVATLDSGGMAFRVLTQPLPNGFMLQIAIASPGSQALLLRYRETLTLILAVSIILCAVL
FT                   GYLIARSGMRPIERIAETAENIRLSTLHERLDVAGLPAELAALANTFNLMLDRLEQSFL
FT                   QLSQFSADLAHELRTPISNLRGELEVALSRPRSDDTYREVLGSALEECTRISRVIQSLL
FT                   FLARAEMVGAPPAVEALDLASEIATVLEFYQPMAAEAGLSLTARVRPGLPIRFDRILLQ
FT                   QALGNLVANAIAHTGTGGQITIEVAEVLEQLSIRIKDTGQGIAPEHLPHVFDRFYRADP
FT                   ARSHVGGNLGLGLAVVRAIMDLHGGRVSIESTQGQGTTVSLLVAATAR"
FT   sig_peptide     2918..3001
FT                   /locus_tag="Acry_3107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.322 at
FT                   residue 28"
FT   gene            4361..5737
FT                   /locus_tag="Acry_3108"
FT   CDS             4361..5737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3108"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3108"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28737"
FT                   /db_xref="GOA:A5FT05"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT05"
FT                   /protein_id="ABQ28737.1"
FT                   /translation="MKKTSRHLRFRPSRVGALALATLLAGCARYQPAPLHPGTSATALL
FT                   GRRLDEPALGQFLAAMGVHPRGHWGLRALTLVAVYERPDLRISVAAYNAAKAAVTTAQQ
FT                   IPNPTLSLAPSFNATQAFPSPIKIGPVISFLVSNLGAREAGIAAARDRQQAARILIAAA
FT                   AWRERSNVRNALLTLWLDERIARIKARVASYAATASRLVAQRVTSGMLADTVLASTTEA
FT                   ANKASFGAAEARVQIGMDRAHLAAAIGMPAAALRGKHLSFTAFEHPLPPANLAALTRTA
FT                   LVTSPSVVGAYKNYRAADASLRKAIDQQFPGFRIGSGYHYDQGASKFILALSLPLPILN
FT                   QNQGPIAEARARRQLAAALFDRAQVRVLHEIDAAKAALQGSVSVARAARLLLATARERE
FT                   RQAIEAYRAGATGQLRMVEAEQQATLVREQELTTDAQRLRALAALADALHHPIFRESHS
FT                   "
FT   sig_peptide     4361..4447
FT                   /locus_tag="Acry_3108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.625 at
FT                   residue 29"
FT   gene            5734..6660
FT                   /locus_tag="Acry_3109"
FT   CDS             5734..6660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3109"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28738"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT06"
FT                   /protein_id="ABQ28738.1"
FT                   /translation="MKQHLQAIAASLSLVCAAAVAHAAALRSVTINAATMSSGLIKTSV
FT                   LRLETKHPGFAAYGMVIDPTPVITLRHRIVSARAKLTLDDANLARARKLYRSGGNVSKA
FT                   SLQQIQAKTAIAQARVEELLAQAKARYGAALGAAIADNGPSFRTISTGGSLVSVVQAVA
FT                   TLVSPPAAFARAPDGSRVTLRPVGSAGRIPKGLLGQTFFYTGPALPIGAPLAITLRAPG
FT                   VVTGYDIPAAALVWHDNGPFIFVRIGASRFAMYRVTRSHPLYHSGTISGFFVPGTDLPA
FT                   HPAIVTAGAGLLNSALAGGDASAANDD"
FT   sig_peptide     5734..5805
FT                   /locus_tag="Acry_3109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.965 at
FT                   residue 24"
FT   gene            6670..9771
FT                   /locus_tag="Acry_3110"
FT   CDS             6670..9771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3110"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3110"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28739"
FT                   /db_xref="GOA:A5FT07"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT07"
FT                   /protein_id="ABQ28739.1"
FT                   /translation="MLSPIVRAALRYRLVVVLLISGLAALQLSRLPTARYDVFPTFTAP
FT                   TVVIQTAAPGFSALQTEQVVTDRIERTLTGLPGLAKMRSSSESGLSVIHLVFHGGTDPY
FT                   QDRQRIAARLSELGGALPAGILPRLAPMQSSTGTALEIGLYPKRDMSLEHLTAIAETGL
FT                   RPALQAVPGVANVVIFGARPPQLDVEVQPRSLIATGFTMQDVARAARQGSAVLGAGFID
FT                   NGNQRFVLAPHGQARTAAALAKTWLGTSDGAPISLGDVASVRLSAPPRYGAALIHGHPG
FT                   LLMIVSSLYGANTLAVADQAARTVARLTPGLEAQGIEIDPKAFTPATFIHVALADLGHV
FT                   LLIGAALILLVLLIALRDWRASVISFVAIPVSLLAATAIITALGITLNTMALAGLAIAL
FT                   GELVDDAVVDVENITRRLRENRIAGSPEPPLRVIFRASLEVRSAIIFASAAVAIAFTPV
FT                   IALGGVAGRLFAPLGIAYIAAIGASLVVALVLTPALAALLLVRPAAAADHTPPIALLRP
FT                   AYRSALGRLEHHGRAFIAGALALILLAGISIPLLQTRFLPRFRENDVIVHYLAAPGTSI
FT                   DAMLAIGRLAIHTLENLPSVGDVVMHIGRASMSNGHAGVNKAEIDITLSKTGNHHVERS
FT                   TRQILASVDHIDGLSWWSRTFLSERVDESLSGVTAPVTVSVFGPSLDAIDIAAARIVAA
FT                   AHGVPGVRAASMAAVQQVPALTIDLNRAAMLRYGITPRAALEAMKIAYSGGTVGHVYRG
FT                   TLVEPIVVTLPAALRHQPAAIGDLPVAAEGGMIVPLDRIATIRQTLVPAQILHNDGRRV
FT                   QVVTVQVAHGQAAPVIRGLRQRLAKLRLGTDVYVRYGGTAVAGGTARRELAVRAAIALA
FT                   GILILMALALRETRAVVLIMVILPVAFSGGIAAIWTFLGGHLELGAMVGLATLFGLTLR
FT                   NGLLLLIHMRRLMEGSGKPWSAEIARQAAADRLPAILITACVTALGLLPLALATGSPGD
FT                   AIEGPMAIVILGGLATATILTLFVLPILAPRLLRIALPKADSLD"
FT   gene            9868..10911
FT                   /locus_tag="Acry_3111"
FT   CDS             9868..10911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3111"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3111"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28740"
FT                   /db_xref="GOA:A5FT08"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT08"
FT                   /protein_id="ABQ28740.1"
FT                   /translation="MAHYAGLDISDKDTAIHVVDDNGKLVWRGKRASEPEVLAAALRRH
FT                   APELVRVGLETGQLAPWLYHSLKDLGFPVICLDARHARVATALQRNKTDAHDAETLAQL
FT                   VRTGWYREARVKGWAAHAMRRLVGARSQLVGISIDLSNQIRSTLKTFGLRATGGAGRVF
FT                   EAKVRIALEGRPEVAGVVEPLLAAWRAVRDQIAVLDRKLMAAVKADPTCRLLMTCPGVG
FT                   VVVAASFSATVEAPAHFRHSRSIGAYLGLTPRRNQSGEIDHSAGVSKRGDRLLRSYLFE
FT                   AAASLLVRVQSSSALKTWGLALVQRLGFKRAAVAVARKIGVVLHAMWKSNQPFEAWHGA
FT                   TPKARAA"
FT   gene            complement(11140..11562)
FT                   /locus_tag="Acry_3112"
FT   CDS             complement(11140..11562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3112"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28741"
FT                   /db_xref="GOA:A5FT09"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT09"
FT                   /protein_id="ABQ28741.1"
FT                   /translation="MCWAPAEPIRWGAPSAMRTLMAAKRAVRRPFVPLRQPSCATGGQR
FT                   GFDAGKKIKGRKRHIITDTIGHLVGAVVHHAGIQDRDGAPDVLKSVKSLYPWLRHGFAD
FT                   GGYAGPKLNGHLAKIGKWIIQIVKRSDTADGLFDRD"
FT   gene            complement(11943..12653)
FT                   /locus_tag="Acry_3113"
FT   CDS             complement(11943..12653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3113"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3113"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28742"
FT                   /db_xref="GOA:A5FT10"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT10"
FT                   /protein_id="ABQ28742.1"
FT                   /translation="MMALTLPARLKGYRFPRSVIAYAVWSYYRFNLSLRDVEDLLAARG
FT                   VIVCYETIRVWVDRFGPQIAAQIRRDRLPAGDKWHLDEMVITIGGEKHWLWRAVDHRGD
FT                   VLEILVQKRRDARAARRFLRKLMRRWGQPRVVVTDKLRSYDVALRTDCRSADHRSHKRL
FT                   NNRIEASHRHTRRREKIMGRFISPGHAQRFLATHDQITTLFRPKRHRLSARSYRHARAD
FT                   AFLLWTDYAANLAA"
FT   gene            12788..13297
FT                   /locus_tag="Acry_3114"
FT   CDS             12788..13297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3114"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3114"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28743"
FT                   /db_xref="GOA:A5FT11"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT11"
FT                   /protein_id="ABQ28743.1"
FT                   /translation="MTVAITRLDLSAMALRERAARATDAKVSRRLLAIALVLEGWSRRD
FT                   AAEACAMDRQTLRDWVHRYNGLGPEGLSAAPRRNGPPPRLSASQQAQIAAWVRQGPDLE
FT                   RDGVVRWRCVDLQRRIKSEFAVTLHETSISRLLRRLKFTRVQPRPYHPKRDAAAQDIFK
FT                   KTSPAW"
FT   gene            13423..13941
FT                   /locus_tag="Acry_3115"
FT   CDS             13423..13941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3115"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28744"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT12"
FT                   /protein_id="ABQ28744.1"
FT                   /translation="MRDNRHDSAYLFGAVCPECCIGATIIMPVVNSEAMAEHLREISTQ
FT                   VAPSAHAVLVLDGAGWHQAGERLPVPDNISMLPLPPYAPELNPVENIWQFLRGNFLSHQ
FT                   VWNSYDEILAACRNAWNKFMQMPEQIASIDLPPSEWSGICFRFWPEGGLGWRGTYGPPR
FT                   PQGVIFIWL"
FT   gene            complement(14156..15196)
FT                   /locus_tag="Acry_3116"
FT   CDS             complement(14156..15196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3116"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3116"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28745"
FT                   /db_xref="GOA:A5FT13"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT13"
FT                   /protein_id="ABQ28745.1"
FT                   /translation="MDIMILGIDLGKNSCSVVGMDAAGRVVLRRRLRRGTLESFVGELG
FT                   SCIVAMEACCGAHHLGRIFAARGHEVRLMSPEYVRPYVKAQKNDDLDAEAIAEAATRPT
FT                   MRFVPVKSQDQSDLQALHRARERLVSERTALINHLRALLLERGIVVPQGRRKLEAELET
FT                   LAEDGGFAALSPRIRTLIEDLRAEWRSLDQRITGFDAEFVQLARDDVAVRRLTKIPGIG
FT                   TINATALAAAVGEAHAFKRGRDMAAWLGLVPRQMTTGGKPRLLGISKRGNRYLRKNLIH
FT                   GARAALPYLVERDTPLGRWARGLLDRAHKNVVVVALAAKLARIAWAVLAHGCDYDAQFE
FT                   AAAAAA"
FT   gene            15245..15412
FT                   /pseudo
FT                   /locus_tag="Acry_3117"
FT   gene            complement(15617..16633)
FT                   /locus_tag="Acry_3118"
FT   CDS             complement(15617..16633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3118"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3118"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28746"
FT                   /db_xref="GOA:A5FT14"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT14"
FT                   /protein_id="ABQ28746.1"
FT                   /translation="MTIDVLGIDLAKNVFQLHGVDRKGHPVFRRRVMRDQLLSVLAGIE
FT                   PCTIAIEACTGAFCWARKFEALGHKVKIVSPQYVKPFVRRQKNDNNDAEAICTAVRQPH
FT                   IPLVPKKTVEQQDVQALHRARQRMVNHRTAVVSQIRGLLLDRGIAFGKSITRARRMIPE
FT                   ILANPDNELTAMAREAIGELWDLFCDLDRRIAIFDAKIAAVFKSSAVCQRIARIKGVGP
FT                   KTATAIVAAVGDGAEFKNGRHMAAWLGLVPRQHSSGDRQIMMGISKRGSQHLRSLLVHG
FT                   ARAVVRTAGTRNDPMNQWVTQLQERRGFNRATVAVANKNARIIWAVLRTGEPYRPAA"
FT   gene            16732..16851
FT                   /locus_tag="Acry_3119"
FT   CDS             16732..16851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3119"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28747"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT15"
FT                   /protein_id="ABQ28747.1"
FT                   /translation="MDQARRMKELERENARLKRLVADLSLDKAILTEAARGNF"
FT   gene            16854..17743
FT                   /pseudo
FT                   /locus_tag="Acry_3120"
FT   gene            18245..18490
FT                   /locus_tag="Acry_3121"
FT   CDS             18245..18490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3121"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28748"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT16"
FT                   /protein_id="ABQ28748.1"
FT                   /translation="MRALVGVLRRTGHHEVASDTGEEHCALMATLIGSARLSGVEPLAR
FT                   LTDVLQRIVAGRTKSDEIGSLMPWNWKTQAALPAAV"
FT   gene            complement(18463..18711)
FT                   /locus_tag="Acry_3122"
FT   CDS             complement(18463..18711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3122"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28749"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT17"
FT                   /protein_id="ABQ28749.1"
FT                   /translation="MPISTEPVVERPGQRQTFSAASAVNAKGGFWYCTYEGGLTAELFV
FT                   HLVCQLVRHRVRPVRNRYLNDGLALASERYTAAGRAA"
FT   gene            complement(18695..20044)
FT                   /locus_tag="Acry_3123"
FT   CDS             complement(18695..20044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3123"
FT                   /product="sodium/proton antiporter, NhaA family"
FT                   /note="PFAM: Na+/H+ antiporter NhaA; TC 2.A.33.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3123"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28750"
FT                   /db_xref="GOA:A5FT18"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FT18"
FT                   /protein_id="ABQ28750.1"
FT                   /translation="MITDQNSKPQQGELPTTHIDALTNSFSQFLRIEATSGAVLLLATV
FT                   VALTLSNSPWSDGFRSLWETPIGIQIGAFQFLRSLRDLINDGLMTLFFFIVALEIKREV
FT                   VLGELRNPRMVAFSVVAAAGGMLVPMGLYLALQHGQPGQHGWGVVMPTDTAFVIGCLAL
FT                   LGSRVPPGLRVFLLSLAVVDDLAAILVVAVGYSRSIDWTALALGAVGLVIIRGMALLGV
FT                   RNIRVYFLAGAIIWLAVNASGIHATIVGVILGLMTPTAGWVSDQRLGEILRKVLSYPPG
FT                   DHWSGDTEDNRALQVAGIAVRETLSPVERLEAMLHPWVAFGVMPLFALANAGVSITIKG
FT                   LINPVSLAVMAGFVLGKPIGVTAFAWLGVRTGVAIRPAGLTWGGLVGGALLTGIGFTMA
FT                   LFIAGQAFQDATLNAAKLGILAASVVSSVAGLTLLCMFPKRDQTLDADFH"
FT   gene            22309..22620
FT                   /locus_tag="Acry_3124"
FT   CDS             22309..22620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3124"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28751"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT19"
FT                   /protein_id="ABQ28751.1"
FT                   /translation="MADFEQPNGLAFTADGATIYVSDTSLSLGEVPGHKAGTKHEIIAF
FT                   DVGDGGMLFNRRFFSHTDHGYPDGFAVDVRGWVWTSVADGVHIWSADRRKLGFVPSRL"
FT   gene            complement(22631..23713)
FT                   /locus_tag="Acry_3125"
FT   CDS             complement(22631..23713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3125"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3125"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28752"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT20"
FT                   /protein_id="ABQ28752.1"
FT                   /translation="MTDAIHFQHTLPLDRSSMTRWRKRIGSERMEALLAETLAAAERGG
FT                   AVAEKHYERVTIDTTVQPKAVTHPTDSKLLHRGIEALARMARKHGITLRQSYRRVARYA
FT                   RQEAARLHHGGKRREAEARVRKLRTWLGRLARDITRKIAGNAEAKATFAETLGLINRLL
FT                   RQKRSDRGADKLYSLHAPEVECIGKGKARTRFEFGVKVSIATTNAAAPGGQFVLGMQSQ
FT                   PGNPYDGHTLAGQIEQVERITGVAVARAYVDRGYRGYGVEAEGRKIFISRQKRGITPTI
FT                   RRELRRRAAIEPVIGHMKTDSHLGRNFLLGVDGDAINAILAGVGHNLRLLRRWLIRLLC
FT                   ALLAWLSAANRSPSLGFAHR"
FT   gene            complement(23752..24960)
FT                   /locus_tag="Acry_3126"
FT   CDS             complement(23752..24960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3126"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3126"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28753"
FT                   /db_xref="GOA:A5FT21"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT21"
FT                   /protein_id="ABQ28753.1"
FT                   /translation="MTEDRLPLAELLAKAGDGDFLHSVAEAVVQLLMETDVDGLIGASR
FT                   YERSGERATYRNGYRERALDTRLGSLQLRIPKLRQGSYFPPFLEARRTSEKALAAVIQE
FT                   AWIGGVSTRRVDELVQAMGLTGISKSTVSKLCKDIDERVNAFLDRPLAGEWPYLWLDAT
FT                   YLKQREGGRIVSVAAIIAVAVNTDGRREIVGLHIGPSEAETFWSTFLKSLVRRGLREVK
FT                   LVISDAHEGLKAAIRRVMGASWQRCRVHWMRNALSYVPKGQQSMVSAALRQAFIQPDRV
FT                   SASQTLRHVADQLRGKWPKLGAFIDDSETDVLAHMDFPAQHRTKIHSTNPLERLNKEVK
FT                   RRADVVGIFPNEGSIIRLIGAVLLEANDEWQTQNRYMQIEGMVELMAPAIDADTPRIST
FT                   VAA"
FT   gene            complement(25032..25379)
FT                   /locus_tag="Acry_3127"
FT   CDS             complement(25032..25379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3127"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28754"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT22"
FT                   /protein_id="ABQ28754.1"
FT                   /translation="MPPKLNASQDDLELFRSRLENIIDQRHPLVRLVRLIDWRVFEERF
FT                   GSLYAEAAGRPALPTRLMVALHLLKHMDGLSDEAICARYLDSPYVQAFCGETHFQGSVR
FT                   GRGGLLGRVTV"
FT   gene            complement(25666..26469)
FT                   /locus_tag="Acry_3128"
FT   CDS             complement(25666..26469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3128"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3128"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28755"
FT                   /db_xref="GOA:A5FT23"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT23"
FT                   /protein_id="ABQ28755.1"
FT                   /translation="MIFEGIAGFRLVTAEPARLAVFYREIGFDVAEAAPISAEEITRLG
FT                   LSGAGSRIAMLLGPSRVELESFDHPGRPYPVDTTACDLVIQHLALVTDDAEAAWRRARD
FT                   AGATPISRARPVTLPKSAGGVTAIKFRDPEGHPLELLQFAPGANSGWKGTGIMGIDHSA
FT                   ISVSDVVASRRFYARHGLGEAGATVNYGPTQDALDGLDGAEVDVVPMNPTGKPPHVELL
FT                   GYRHPVGRALHPLFANDLAATRIVWRSNADALIRDPDGHLHQLSR"
FT   gene            complement(26466..26924)
FT                   /locus_tag="Acry_3129"
FT   CDS             complement(26466..26924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3129"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28756"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT24"
FT                   /protein_id="ABQ28756.1"
FT                   /translation="MSDQTDAAGPRPSVPYWHLYVDGDGTSHQSQCALTDYQLKAVGPA
FT                   DPQWNDKMERSEATVVFTVQPVGWVGDWHENPAPQWIIVLSGRWWIESMDGTRIEQGPG
FT                   DFSFGEDQGCTEVNGKKGHRSGTIGDQPCCLMTVQLHVKPRRGSCHLT"
FT   gene            complement(26921..27385)
FT                   /locus_tag="Acry_3130"
FT   CDS             complement(26921..27385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3130"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3130"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28757"
FT                   /db_xref="GOA:A5FT25"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT25"
FT                   /protein_id="ABQ28757.1"
FT                   /translation="MTTAAIVVLVVRYGLVLLFLPFSALDKFFGFNHAVKQAQSMFKPR
FT                   PIAMAMILIGLFVEVICSLGVVTGIADRASAFVIAGYCAATAVLYKQFWAQGDFWSDPD
FT                   GKGRTLLWDFLKNLSLGAGFLLIVIGTDGMGLAPFIHAPFASSHPYGTHP"
FT   gene            complement(27401..27583)
FT                   /locus_tag="Acry_3131"
FT   CDS             complement(27401..27583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3131"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28758"
FT                   /db_xref="GOA:A5FT26"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT26"
FT                   /protein_id="ABQ28758.1"
FT                   /translation="MLWHYTHTLDPYRRIASNQPALEVLAVGLDWKWLFIYPTRSGYRS
FT                   GKFDNCDRRCGARGR"
FT   gene            complement(27999..29513)
FT                   /locus_tag="Acry_3132"
FT   CDS             complement(27999..29513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3132"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3132"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28759"
FT                   /db_xref="GOA:A5FT27"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT27"
FT                   /protein_id="ABQ28759.1"
FT                   /translation="MQDGVPITKPGDEDRFLRRVRPSDWKNPVPRNPYDIAIVGAGPAG
FT                   LEAAEYAARLGFSVALIERNRLGGNSLNAGSVPSKAIICTARVCSTMRDAEAFGAPIPS
FT                   APSLDFDKVMARMRRIRTRISGYHSVHELAEPGVDIFFGSARFESADTLFVDDAPVHFK
FT                   KALIATGARPGVPNIPGLDQTGYRTSATIFEMAALPTRLAIIGGGPLGCEMAQAFCGLG
FT                   SHVTIVQNDPKFLPREERDAAEILSRSMARDGVDIRLNTTVVGARRVNGIKILETVNND
FT                   VKGDIQADEILLSIGRVPNVEKLNLAAAGVTFDEDHGIKVDDFLRSTNPNVYAAGDVCL
FT                   ALKFTNAAQSSARMAVRNALMQAQQRQSSLVIPWCTYCDPEIAHIGLHVWEARQQSIPI
FT                   KSFTVMMHDVDRAITDGRDTGFVKIHISEGSDRILGATIVSSRASELINEMAVIMSAGI
FT                   GMKALAEVAHTYPAQSEAILLAAQAYTRNFDEAAKRAASGNADNGK"
FT   gene            complement(29516..30799)
FT                   /locus_tag="Acry_3133"
FT   CDS             complement(29516..30799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3133"
FT                   /product="Uncharacterized protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3133"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28760"
FT                   /db_xref="InterPro:IPR016883"
FT                   /db_xref="InterPro:IPR019282"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT28"
FT                   /protein_id="ABQ28760.1"
FT                   /translation="MGDLAQLSDEALTIRLQQAAFSYLIDYANADTGLVADTSRQGSPC
FT                   SIAVVGFALSCYPIAVRNGWLSRTDAATRTLKVLRFFSCSTQSDAPDATGYKGFYYHFI
FT                   DMQTGKRVWQCELSLIDTALLVAGFLVAACYFDGSGEREIRELADALYRRVDWRWAQNG
FT                   TLGLSQGWKPECGFLHYGWEGYNEAALLYVLGLGSPTFPLTPAGYVTWQLTYQWENLLD
FT                   RDVLYSGPLFTHLFSHAWIDFRGIRDEFMREKASDYFENTKSAIAVHREYAERNPYGFE
FT                   AYGRDFWGVTAGDGPTAPEMLENGKDCRFFGYMSRGVPYGPDDGTIAPWAMLATLPFGA
FT                   DAALAGTRGLLELHPKVCHQDRFSSGFNPTLSDGDGGWLSTGWYGLDQGLLVMMIENHR
FT                   TDMIWEIMRHCSYVHDGLQRAGFEDGWL"
FT   gene            complement(30805..32238)
FT                   /locus_tag="Acry_3134"
FT   CDS             complement(30805..32238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3134"
FT                   /product="glycoside hydrolase, family 39"
FT                   /note="PFAM: glycoside hydrolase, family 39"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3134"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28761"
FT                   /db_xref="GOA:A5FT29"
FT                   /db_xref="InterPro:IPR000514"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT29"
FT                   /protein_id="ABQ28761.1"
FT                   /translation="MTAMFSSDLSGRTTDFPHFWEHTVGSGHATLALRADWQAQLKQAH
FT                   DELGMRHVRFHGILSDDMGTLVSEGDTFFYSFFNTDQIFDFLLSIGMKPFVELSFMPSA
FT                   LSSGDQTVFHYRANVGRPRDYAQWAVLIRKLVRHWVDRYGLGEVRQWFFEVWNEPNLTA
FT                   FGNGQQSDYFELYRYTVEAIKGVDAMLKVGGPATAANAWIDDFLAFCKANDLPADFVST
FT                   HHYPTDAFGKPGDDTEAQLAASTRSILREQARDVRKNAGDLPVYYTEWCTSSNPRDPMH
FT                   DDPYAAAFIVKTILEASGLVQGYSYWTFSDIFEENYFPSIPFHGGFGLLNIHGIAKPAY
FT                   RAFQLLHELGTQMMPVKGSHATVDAWFVRGDQRSTLVLTNFALPRHPIETEQVSFELKS
FT                   AKPESMASIQRIDLEHANAKPHWEQRGKPEYLNAATIEELKHLSQFQSEPVPVNGDSGK
FT                   LNIKVSMPPQSVAAIHFSN"
FT   gene            complement(32235..33797)
FT                   /locus_tag="Acry_3135"
FT   CDS             complement(32235..33797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3135"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; FAD
FT                   dependent oxidoreductase; GMC oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3135"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28762"
FT                   /db_xref="GOA:A5FT30"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT30"
FT                   /protein_id="ABQ28762.1"
FT                   /translation="MTQHYDVIIIGSGPGGASVAYRLAPTGKRILLIERGDYLPRSRAN
FT                   WDSQTVFVDGAYQADETWYGKNGETFHPGLHYYVGGNSKVYGAALFRLRERDFGEVQHK
FT                   DGVSPAWPLKYEVFEPYYGEAERLFHVHGQRGEDPNEPPSSGPFPYPPVSHEPRIQTLQ
FT                   DSLARGGLHPFHLPLGILLDEEHGKVTPTSICIRCDAFDGFPCLLNGKADAQVMCVDPA
FT                   LKLHPNLTLLTNGYVSRLGTDAKGSKVKDVAVTRHGSEEHYSADIVVVACGALSSALLL
FT                   LRSANDDHPDGLANGSGQVGRNYMRHNQSILMALMREPNDTVFQKTLAISDFYFGSDDW
FT                   EYPLGLIQMCATSHGAQIRGEALPSWLEWMPKMPFDEMARHSMDFWLSSEDIPRPENRI
FT                   RYDGERVVLDITEGDMEAHHRLKKKLEQILSSAGAHPVLLERSLYLGNDIPIGGTAHQA
FT                   GTARFGTDPANSVLDLDCKAHQLDNLYIADASFFPSIGAVNPTLTIIANALRVADRIKE
FT                   RLK"
FT   gene            complement(33803..34612)
FT                   /locus_tag="Acry_3136"
FT   CDS             complement(33803..34612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3136"
FT                   /product="glucose 1-dehydrogenase"
FT                   /EC_number="1.1.1.47"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3136"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28763"
FT                   /db_xref="GOA:A5FT31"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT31"
FT                   /protein_id="ABQ28763.1"
FT                   /translation="MSDRKLLAKQKALVTGANSGIGEGVAIALGQAGADVVVNYVEGDA
FT                   AANAVVDKIKQFGGNAITHKADVSHEDEVGDMFDRAVREFGTIDILVNNAGMQRDSAFS
FT                   DMTLEKWNKVLGVNLTGQFLCARAAIREFLRRGVVPSVSRAAGKIICMSSVHQVIPWAG
FT                   HANYATSKGGIKLMMESMAQELAPKRIRVNGIAPGAIQTPINTSAWDTPEALKSLLTLI
FT                   PYGRIGLPEDIARAAVWLASDDSDYVVGTTLFVDGGMTLYPGFSTNG"
FT   gene            35025..35339
FT                   /locus_tag="Acry_3137"
FT   CDS             35025..35339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3137"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28764"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT32"
FT                   /protein_id="ABQ28764.1"
FT                   /translation="MKSLSDHPRRLGKPARIERRSSITPATLRCLSDGGCGAARLRRYS
FT                   GVDWRPSTKSRWRGAETDGCPVVTATDVGRTVPAFKPAPGSDNSDQDRSRWRRAYGGAD
FT                   "
FT   gene            complement(35500..35841)
FT                   /locus_tag="Acry_3138"
FT   CDS             complement(35500..35841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3138"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28765"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT33"
FT                   /protein_id="ABQ28765.1"
FT                   /translation="MQSGARGMGRTVRAEDLCSGGAEAGLRRGTGGVPVGTPFSGGGQI
FT                   AGDIDMCSAVAAWRQGLLGEAQLQQPTLDSAQPPREARADDYDMPFLTHNGHENIIRIM
FT                   YNLQTWKVT"
FT   gene            35854..44382
FT                   /locus_tag="Acry_3139"
FT   CDS             35854..44382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3139"
FT                   /product="glycosyltransferase 36"
FT                   /note="PFAM: putative carbohydrate binding;
FT                   glycosyltransferase 36; glycosyltransferase 36 associated"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3139"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28766"
FT                   /db_xref="GOA:A5FT34"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR019282"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT34"
FT                   /protein_id="ABQ28766.1"
FT                   /translation="MNPIVDLRRYSFKRGNRARQGSVWNDASPIREELFGAERLEQHAR
FT                   SLAAAQPITARPPSAPSLHTRLKRNAGVLLAAYRATAADVEAGRTVVPAAEWLLDNYHL
FT                   VEEQVREIRDDLPPSYYRLLPKLAEGPFAGYPRVLGLAWAYVAHTDSHFDPEMLRCFIA
FT                   AYQQVEPLTIGELWAVAITLRIVLIENLRRLADQITAGRRARREADLLADRLLVSGEAR
FT                   AALDADILIRSPEPLDEVFAAQLVKRLRDRDPRITPALGWLETRLGAQGASVEGVVQHA
FT                   QQRLGASNVSVRNVITSMRLISDIDWAEMFESVSLVDDRLRAGSAFAAMDFSTRNLYRS
FT                   AIEQLARGSVASELDIAGRALQAVASVNATTQDASTGPASDPGFYLIGDGRSAFERTIR
FT                   FRPPARLRLSRLSIRLGIGGYIGTIIAVTLGLIALSLWALSSAGLSSGWLVLFAVIGFV
FT                   SASELATALVNRGVAWMFNATSLPGLELAGGVPTSLRTLVAVPTLLTSEADLQEQVERL
FT                   EVHFLSGAGGDITFALLSDGMDADCEVLPDDAPLLELAVQGIEQLNLRHGAGPAGNRFL
FT                   LLHRHRLFNPGEGKWMGWERKRGKLHELNRLLRGADDTSFMAVGGRPPEVPVDVRYVIT
FT                   LDADTRLPRDAALRLIGKMAHPLNRPKFNAAERRVVSGYGILQPRVTPSLPIGREGSFY
FT                   QRVISGGGGMDPYAAAVSDVYQDLFGEGSYTGKGIYEIDAFEASLAGRIPDNTLLSHDL
FT                   FEGVFARAGLASDVEVVEEFPSRYDVVAKRQHRWMRGDWQLLPWIVGDGAGWRGLTTVG
FT                   RGKMLDNLRRSVAGPLTLLALGLCWLFPVPAARIGTLLVISTVAVPSFLPILFSLLPGR
FT                   PDIRVRSHLARLRSDLWLAAAQTLLSLVFLADQAWRAGDAAIRTLLRLLVTRRHLLEWT
FT                   TAAKSSAAPRLDLIGFYRQMSSGTVLGLVITGGALTLSPSIWPLILPFALLWLGAPAIA
FT                   QWASRSPKVPLRLAVGEREARDLRLIARRTWRFFETFVTPADNMLPPDNFQEVPKPVVA
FT                   RRTSPTNIGLYLLSAVAARDFGWAGTIETITRLEATFATLKRLRRFHGHFLNWYGTQDL
FT                   AALPPAYVSSVDSGNLAGHLITLANACEEWRDVPVGASARAGIADALALAREAMAGQSG
FT                   AGGSQGQALTAALDEIDVQLNGVQTLEATAPILKRLTDKATRIVLETIPATGDDGVTDI
FT                   VYWTNALGKAVSEHERDRLELLAVPAATRDRLTALADMARAMAMEMDFAFLLDPERKLL
FT                   SIGYSLAENGRDPSCYDLLASEARLASLFAVAKGDAPTRHWFRLGRLATPLGNASALIS
FT                   WSGSMFEYLMPSLVMRAPASSVLEQTNRLVVERQQSYARSLGVPWGMSESAYNARDIEF
FT                   TYQYANFGVPGLGLKRGLSESVVVAPYATGLASMVNPERARQNYARLVELGAQGRYGFY
FT                   EALDFTRSRLPEDEDVAIVRSFMAHHQGMTIVAIANTLLGGEMRARFHREPMIRASELL
FT                   LQERSPRDVVVARPRAEEVRAAAVDARSEGAMVRRLTAPAPGAPITHLLSNGSYAVMMT
FT                   AAGSGYSRWGDIAVTRWREDATRDDWGSFIFLRDMRGGSIWSATTQPMADAAGESDVVF
FT                   GEDYAEFIRHDVGLTTTMDVIVSGEHNGEVRRVSLTNSGRRTREIELTSYAELVLTTPA
FT                   ADNAHPAFAKMFVETEHLPEFGALIATRRRRAPGEPQIWAAHFAVVEGEVAANPQYETD
FT                   RARFIGRGRSIGTAEAMSGGRPLSNSVGTVLDPIFSLRQSVRIEPGKVARVAFWTVVAS
FT                   SRPELLDLIDAHHDRNAFDRAKTLAWTQAQVQLRHLDVDAEEAADFQRIAAPLLYTDRR
FT                   FRSPSETITRGAGPQSGLWPHSISGDLPIVLLRIDDVEDMAQVRQLLHAHEYWRMKRLA
FT                   VDLVIVNERASSYVQDLQIAIEAAVRTNQSRPLLGKEPAQGSVFMLRADLMSVEAHALL
FT                   RSVARIVLGARGGTIADHFARLGPPSNPPPVQRRARALTPMREPASSREPPKLEFFNGL
FT                   GGFDKDGREYVTILERGHTTPAPWINVVANACFGFQVSAEGSGYSWAQNSRENQLTQWS
FT                   NDAVADPAGEAIYVRDEESSHLWSPTAQPIRGDGTYVARHGFGYSRFEHEANGVALDLL
FT                   HYVPLDDPIKISRLRLTNRSGRPRRLSVTAYAEWVLGTSRGASAPFITTEMDAQSGAML
FT                   ARNRWSVTFGSRVAFADLAGRQTTWTADRTEFLGRDGGPASPLCLASKVPLSGTTGAGL
FT                   DPCAALQTVVELGIGETVDVVSFLGQCSSVDEVRALVDRYRHADLDAALAAVTQHWHDV
FT                   LGAVQVKTPDRAMDIMLNGWLLYQTLACRITARSAFYQASGAYGFRDQLQDGMALTLAL
FT                   PAETRDHILRAAGRQFVEGDVQHWWLPQSGQGVRTRISDDHVWLAFATATYIDGTGDAA
FT                   ILHEPVPYLDGPVLRTEEHEHFFQPMPSDIVEPLYEHCARGLDHAVALIGELGLPLIGT
FT                   GDWNDGMNRVGEAGRGESVWLGWLLVRTIEMFAPFAGERDPERARRWRIHAASVRRALE
FT                   RSAWDGEWYRRATFDDGTWLGSKDSGECRIDSIAQSWAVLSGAADRLRATTAMASLERR
FT                   LLRTDAKLALLFTPPFDHTPLDPGYIKGYPPGLRENGGQYSHAAMWAILAFAKLGAGDK
FT                   AHDLFALLNPINHAFTAEEAERYKVEPYVVAADVYSVAPHVGRGGWSWYTGSAGWMYRA
FT                   GVEGILGIRREGDFLVVAPSIPEAWPGFKATVRLGEGVCRIEVRAIAGGEEPYSVLDGV
FT                   RSPSPDRSARISLNCQSHDLLMSI"
FT   gene            complement(44516..45322)
FT                   /locus_tag="Acry_3140"
FT   CDS             complement(44516..45322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3140"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3140"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28767"
FT                   /db_xref="GOA:A5FT35"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT35"
FT                   /protein_id="ABQ28767.1"
FT                   /translation="MWTPTTRAQHSRTGLRYGSDVTDAEWLLLSPFLPAPSRCGRHRKW
FT                   EMREIVNAIFYVLRGGIAWSLLPKDFPPWPTAYRWFARFRDDGTWERINHHLVMRDRER
FT                   VGREASPTAAVIDSQSVKTTESGGTRGYDAGKKIKGRKRHAMVDTDGRALKLQAHSAAI
FT                   QDRDGAGPLLRASRASWPFVALGYADGGYAGPRVADASPIRIEVVRKANNQVGFAVIAR
FT                   RWVVERFFAWINRNRRLAKDFEATIESVEAFLYAASSILLLRRLAR"
FT   gene            complement(45389..45715)
FT                   /locus_tag="Acry_3141"
FT   CDS             complement(45389..45715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3141"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28768"
FT                   /db_xref="GOA:A5FT36"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT36"
FT                   /protein_id="ABQ28768.1"
FT                   /translation="MTTKILALTDALGNLVRFRLMPGNRYDSIEVPPLIDNVEFGGLIA
FT                   DKAFDSNALVAELNERGARIGISQHPARALKLKIDHETYKWRHLIENFFCMLRGHFGMG
FT                   SERF"
FT   gene            45834..46031
FT                   /pseudo
FT                   /locus_tag="Acry_3142"
FT   gene            complement(46128..47306)
FT                   /locus_tag="Acry_3143"
FT   CDS             complement(46128..47306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3143"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3143"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28769"
FT                   /db_xref="GOA:A5FT37"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT37"
FT                   /protein_id="ABQ28769.1"
FT                   /translation="MFISILKSLVHDGSLGVIDAGGRLHKVGDGSAPSATIRLMSKAME
FT                   YRLAVNPALTVGEAYMNGALRIEEGTLYDFAAVIGRNASQARSLPWLALLNRARRHVRQ
FT                   SNPMSRARRNVAHHYDLSNEFYAMFLDRDMQYSCAYFHSPDDDLETAQANKKRHIMAKL
FT                   LLDRRGLRVLDIGSGWGGMCLDIATHCDAEVTGVTLSTEQYRLSVERAAAAGVAERVGF
FT                   HLEDYRDEAGPYDRIVSVGMFEHVGKRNYAEFFAKLRDLLTDDGVALIHTIGYSDHPAP
FT                   INPFLRKYIFPGADLPSLSEIAAAVEWSGLIITDVEVLRLHYAETLRHWRERFVARRAD
FT                   VVRLYDERFYRMWEFYLVLCEIGFRMRTNVVFQIQLTKRLDALPIRRDYMVD"
FT   gene            complement(47624..47818)
FT                   /pseudo
FT                   /locus_tag="Acry_3144"
FT   gene            complement(48369..50351)
FT                   /locus_tag="Acry_3145"
FT   CDS             complement(48369..50351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3145"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3145"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28770"
FT                   /db_xref="GOA:A5FT38"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT38"
FT                   /protein_id="ABQ28770.1"
FT                   /translation="MIDLSPPRARPGTPAAINDTSGLMTLISVVVAVATLSIARDVLIP
FT                   ITLAVLLSFLLAPLVNLLRRTGLGRVPGVVLAVLLALGVILGTAGLIGTQVADLADDIP
FT                   RYTDTIQQKVDAVQSATFGRLSAFVGSMGSQINRDSHASAGAPASAGTTVSAASAAAPT
FT                   NAAAKPIPVEVHQPEPSLMKLARRVLTPILSPLMTTAIVVVVAIFILLRPEDLRDRLIR
FT                   MLGTGDLHRTMTAMDEAGHRLSRYFLTLLALNTAFGSMIGLGLFVIGVPSAVLWGIMAI
FT                   LMRFIPYIGPWLAAALPLALAAAVDPGWSMLLWTGTLFVVSEGVMGQVIEPMAYGHSTG
FT                   LSPLSVVVAAIFWSWLWGPVGLILSMPLTLCLVILGRHVDRLKFLDVLLGDRSALTPVE
FT                   SFYNRMLAGRLDEVQDDAEQLLKSCTLSAYYDEVAIPGLRLATIDIERGVLTEAQTIRI
FT                   IAGVQGLLEEIGDHDDSDTLLTAAGPARLPSDRQATPESREPGPPAGLGEPVGLSPDWQ
FT                   APSAVLCVAGRGPLDDLASAMLAQLLGKRGIGASVVTHEAVSLRAADTLDIVGVQMVCL
FT                   TYSGIAGTSSDLRYTVRRLRARSPSVCILVGFWPSNMVSDDRLRAAVAADIYAGSLHDM
FT                   VVACLAEALGPASDRVRQLAPVPEP"
FT   gene            complement(50396..51322)
FT                   /locus_tag="Acry_3146"
FT   CDS             complement(50396..51322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3146"
FT                   /product="esterase, PHB depolymerase family"
FT                   /note="TIGRFAM: esterase, PHB depolymerase family"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3146"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28771"
FT                   /db_xref="GOA:A5FT39"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT39"
FT                   /protein_id="ABQ28771.1"
FT                   /translation="MSAGCVSEVVGFGSNPGALRMLVHARARLPAGRPLVVVLHGCGQD
FT                   AAAFANASGWLALADELGFALLVPEQVHANNRGRCFNWFRPDDVRRSGGEAMSIRQMLR
FT                   VAVARYGSDPRRIYIVGFSAGGGMAAAMLAAYPAVFAAGGIVAGMPVGCAQTQVAAMLH
FT                   MRRANMSRSRQALAGDVRAVTQARSRRSWPRVSIWQGGRDRTVDPANAEILAAQWGELH
FT                   GQDTAPRTDNVASGHRHRTWGRPDRPPAVEIWTLPAIGHGFPVDASLPGSGRTSPYLAR
FT                   ADLSAARQIATFWLLNNDHAKRAALHR"
FT   gene            complement(51819..51989)
FT                   /locus_tag="Acry_3147"
FT   CDS             complement(51819..51989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3147"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3147"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28772"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT40"
FT                   /protein_id="ABQ28772.1"
FT                   /translation="MDKDRVAGLAKEIKGAVKEAVGKLVGDAKLQAEGRAGKTEGRVQN
FT                   TVGGLKDSVRK"
FT   gene            complement(52424..52981)
FT                   /locus_tag="Acry_3148"
FT   CDS             complement(52424..52981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3148"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3148"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28773"
FT                   /db_xref="GOA:A5FT41"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT41"
FT                   /protein_id="ABQ28773.1"
FT                   /translation="MDDRTGRPRNIVSLQVASLDAHIGGQITARRAEIGLSRRQLAMTL
FT                   RVPVRGIAAYERGIQHVAPADLFRLAQALGVDLAYFYTDSASSPQAPKAETGCPVGGRA
FT                   AGGVGQAAVDMRQYDDIDQIADRFSRIRNPAIRRCVTRMLDSLAEHEVSSVTVGDVRTE
FT                   PLISAFEELAELAYAPPSASRG"
FT   gene            53133..53585
FT                   /locus_tag="Acry_3149"
FT   CDS             53133..53585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3149"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28774"
FT                   /db_xref="GOA:A5FT42"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT42"
FT                   /protein_id="ABQ28774.1"
FT                   /translation="MVCVVVVTGAPSIGGAAAVAVVEVLVCCVVVVVAVSGEPPPQPAR
FT                   TRTAPLIHVASRMRAAVVLFDRMMSSGSFRGRVWRRCVGRGASVWHRCNRGGAGGLADR
FT                   TVFAAIGRLPRLRRIPGRIDAAAGFGRAQRAARRRHDRRPRHRGRL"
FT   gene            complement(53739..54068)
FT                   /locus_tag="Acry_3150"
FT   CDS             complement(53739..54068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3150"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28775"
FT                   /db_xref="GOA:A5FT43"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT43"
FT                   /protein_id="ABQ28775.1"
FT                   /translation="MRVKHPPTGQHRGAADPTRDHGASIRSFSMRSYRLAWFTVAAGAG
FT                   LLLGGCGYSPGGRALSGAAIGAGTGAVVGSVTGIGPGGGALIGGGVGAAVGGLTSPSTI
FT                   NLSPR"
FT   gene            54440..54811
FT                   /locus_tag="Acry_3151"
FT   CDS             54440..54811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3151"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28776"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT44"
FT                   /protein_id="ABQ28776.1"
FT                   /translation="MRQEVLRGSAHKTRLVKDYVASTAGRLTLHFLPGCAPELNPDKLV
FT                   WSHVKRTGVARNPLRKGEKLRDKIDAQLAAIKRVPALVRSFFLAPSVAYYRLVSKSPVE
FT                   AAYPVDRHVASAAAYSRPV"
FT   gene            complement(55010..55282)
FT                   /locus_tag="Acry_3152"
FT   CDS             complement(55010..55282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3152"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28777"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT45"
FT                   /protein_id="ABQ28777.1"
FT                   /translation="MDHFWRSHMTIANPAAVSPGTHQSAPNHPAAAVHIAAASHHAVAE
FT                   HHHLEAAHHLNMGEHEPAKLHAAAAMAHSEKAHAKTVEAAKPPAR"
FT   gene            55649..55996
FT                   /locus_tag="Acry_3153"
FT   CDS             55649..55996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3153"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28778"
FT                   /db_xref="GOA:A5FT46"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT46"
FT                   /protein_id="ABQ28778.1"
FT                   /translation="MAHYAGLDVSDKDTAIHVVDDYGKLVWRGKRASEPEVLAAALRRH
FT                   APELVRVGLETGQLAPWLYHSLKDVGFPVICLDARHARMATASQRNKTDAPDAETLAQL
FT                   VRTGWYREARV"
FT   gene            56015..57064
FT                   /locus_tag="Acry_3154"
FT   CDS             56015..57064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3154"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28779"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT47"
FT                   /protein_id="ABQ28779.1"
FT                   /translation="MRRLVGARSQLIGISIDVSNQIRSTLKTFGLRATGGAGCVFEAKV
FT                   RIALEGRPEVAGVVEPLLAAWRAVRDQIAVLDRKLMAAVKADPTCRLLITRPGVGVVVA
FT                   ASFSAAVDQINHTQKTALSAAIRVAPADDRQDREQQDTRQLVELPFRAAQIRDFRQDIK
FT                   QRTARGHCNFRIGRLPKNPKPRRSVTPIFPRKSVGTAVFRIGLTPAQKLALNSPEESPA
FT                   SRYHCARLLHDTQYENDNHNQHYQSQKSTADIHGFNPFLISHSDYSTEQHGCRVCPAFA
FT                   GSWTPLPQAVGHNCFETQRIEWNIYRECMPARGESETTQPSQLDTRINPVKVVEFVIMG
FT                   WPAPLVAIG"
FT   gene            57098..58138
FT                   /locus_tag="Acry_3155"
FT   CDS             57098..58138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3155"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3155"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28780"
FT                   /db_xref="GOA:A5FT48"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT48"
FT                   /protein_id="ABQ28780.1"
FT                   /translation="MDIMILGIDLGKNSCSVVGMDAAGRVVLRRRLRRGTLESFVGELG
FT                   SCIVAMEACCGAHHLGRIFAARGHEVRLMSPEYVRPYVKAQKNDDLDAEAIAEAATRPT
FT                   MRFVPVKSQDQSDLQALHRARERLVSERTALINHLRALLLERGIVVPQGRRKLEAELET
FT                   LAEDGGFAALSPRIRTLIEDLRAEWRSLDQRITGFDAEFVQLARDDVAVRRLTKIPGIG
FT                   TINATALAAAVGEAQAFKRGRDMAAWLGLVPRQMTTGGKPRLLGISKRGNRYLRKNLIH
FT                   GARAALPYLVERDTPLGRWARGLLDRAHKNVVVVALAAKLARIAWAVLAHGCNYDAQFE
FT                   AAAAAA"
FT   gene            58472..59488
FT                   /locus_tag="Acry_3156"
FT   CDS             58472..59488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3156"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3156"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28781"
FT                   /db_xref="GOA:A5FT49"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT49"
FT                   /protein_id="ABQ28781.1"
FT                   /translation="MECKRISIDTSKHAFTIHAVDEKERPVLRHDLRRAQIERFFARLA
FT                   PTEVALEACAGAHHWRRRLIALGHLVKLIPPQYVKPFVKRGKNDRNDAEAISEAASRPT
FT                   MPLVPVKTVAEQAAAVIVKHREMLVGQRTQTINVLRGHAAEFGIVAAKGKGNVEALLAA
FT                   LAAEPTIPEIAKAMFAEMGRHVADLDAKIVAVDRQLLEQHKGSPVSQRLWAIPGVGPIT
FT                   AITMALSVNPANFESGRHFAAWLGLTPREHSTGGKHRLGRISKAGNERFRQLLVVGATA
FT                   LIRVAKPGRRSATAWLLGLLERRPRKVAAVALANKVARIIWAMMARGEAYRHQPASA"
FT   gene            59776..60510
FT                   /pseudo
FT                   /locus_tag="Acry_3157"
FT   gene            complement(60649..61905)
FT                   /locus_tag="Acry_3158"
FT   CDS             complement(60649..61905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3158"
FT                   /product="Transposase-like protein"
FT                   /note="FOG: Transposase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3158"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28782"
FT                   /db_xref="GOA:A5FT50"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT50"
FT                   /protein_id="ABQ28782.1"
FT                   /translation="MDEDWQGDLERWLAPYLKGLGNKTRRRMCPAYIAGLIGPGDRKSI
FT                   QPMAARSDAISYDRLHHFIGAGLWDSAPLEATLWDQADKLVGGNEAWLIIDDTALPKKG
FT                   KASVGVAPQYATALGKNANCQTLVSVTLASGAVPLMLSLRLFLPESWTSDIARMDKAGV
FT                   PACFQEYRTKPEIAIEEIDRVIAAGVRFGCVLADAGYGLSAPFRQALSTRGLCWAVGIP
FT                   RHQKVYPADVQLIFPVAGRGRPRVRHVPDVKSMAAQAMLEGAKWRQLGWRKGTKGRLTA
FT                   RFAAMRVRIADGAPQRIGSAGAQHMPGEEAWLVGEHRSNGERKYYLSNLPADTPIRALA
FT                   GAIKARWICEQAHQQLKEELGLDHFEGRSWTGLHRHALMTMMAYAFLQSRRLAQAGRKK
FT                   KSPRSASPTHPASSAPSHP"
FT   gene            62033..62305
FT                   /locus_tag="Acry_3159"
FT   CDS             62033..62305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3159"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28783"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT51"
FT                   /protein_id="ABQ28783.1"
FT                   /translation="MLGSRIHRRKPAGKPMPRHVARANGAKSSIRAHVEHVFAHQKNRF
FT                   GRFIRTITIEEGPPRLAYESQVIQTTQDPAAHNRLCRLSLFADGH"
FT   gene            64741..65721
FT                   /locus_tag="Acry_3160"
FT   CDS             64741..65721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3160"
FT                   /product="sodium/proton antiporter, NhaA family"
FT                   /note="PFAM: Na+/H+ antiporter NhaA; TC 2.A.33.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3160"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28784"
FT                   /db_xref="GOA:A5FT52"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FT52"
FT                   /protein_id="ABQ28784.1"
FT                   /translation="MITDQNSKPQQGELPTTHIDALTNSFSQFLRIEATSGAVLLLATV
FT                   VALTLSNSPWSDGFRSLWETPIGIQIGAFQFLRSLRDLINDGLMTLFFFIVALEIKREV
FT                   VLGELRNPRMVALSVVAAAGGMLVPMGLYLALQHGQPGQHGWGVVMPTDTAFVIGCLAL
FT                   LGSRVPPGLRVFLLSLAVVDDLAAILVVAVGYSRSIDWTALALGAVGLVIIRGMALLGV
FT                   RNIRVYFLAGAIIWLAVNASGIHATIVGVILGLMTPTAGWVSDQRLGEILRKVLSYPPG
FT                   DHWSGDTEDNRALQVAGIAVRETRVGQWGENGWGTNGYKSLIYNG"
FT   gene            65815..67458
FT                   /locus_tag="Acry_3161"
FT   CDS             65815..67458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3161"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3161"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28785"
FT                   /db_xref="GOA:A5FT53"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT53"
FT                   /protein_id="ABQ28785.1"
FT                   /translation="MFVVERVARGHSYLYLVESVRVGKSVRQRTIKPLGRKDVLAASGE
FT                   LDRLVASIARHAERSIILSDIDAGRIAAHRIGGPLLFGRLWDRLGIGEVLNNLLEGRQF
FT                   GFAVERAVFVATLHRLFVSGSDRSCVDWMQSYAIDGAEDLALHHFYRAMAWLGEELGDR
FT                   QAGALAPRCVKDVIEEQLFERRRDLFTDLSLVFMDTTSLSFYGEGGETLGRRGHSKDYR
FT                   PDLAQMILALVIDAEGRPICTEMVPGNTADVKILMPVVTRLRERFGITRACVVADRGMI
FT                   SADTIAALEALGVEYILGARERTSRVIRDVVLKDKAAMVPLVLDRQHGETQLWVKEVRI
FT                   GKGKAAQRYIVTVNEAEARKDREDRQAIIDGLQAQLKKGDKALVGNSAYRRYLRSRGNA
FT                   FEIDPGKLAEEARFDGLSVLRTNARVTPLQAVIRYRDLLEVEALFRAAKASFDTRPIFH
FT                   QADAAIRGHVFCSFLALTLAKELNRLCGARGFQPEWQKLLNDLDRLQQATIEKGGKVIT
FT                   TRTHVTGQVGNVFKAAGIALPHNISEHPAD"
FT   gene            67582..68019
FT                   /locus_tag="Acry_3162"
FT   CDS             67582..68019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3162"
FT                   /product="sodium/proton antiporter, NhaA family"
FT                   /note="PFAM: Na+/H+ antiporter NhaA; TC 2.A.33.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3162"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28786"
FT                   /db_xref="GOA:A5FT52"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FT52"
FT                   /protein_id="ABQ28786.1"
FT                   /translation="MSPVERLEAMLHPWVAFGVMPLFALANAGVPITIKGLINPVSLAV
FT                   MAGFVLGKPIGVTAFAWLGVRTGVAIRPAGLTWGGLVGGALLTGIGFTMALFIAGQAFQ
FT                   DATLNAAKLGILAASVVSSVAGLTLLCALPRSDGTLDADFH"
FT   gene            68003..68251
FT                   /locus_tag="Acry_3163"
FT   CDS             68003..68251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3163"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28787"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT55"
FT                   /protein_id="ABQ28787.1"
FT                   /translation="MPISTEPVVERPGQRQTFSAASAVNAKGGFWYCTYEGGLTAELFV
FT                   HLLRQLVRHRVRPVRKRYLNDGLAFASKRYTAAGRAA"
FT   gene            complement(68806..69588)
FT                   /locus_tag="Acry_3164"
FT   CDS             complement(68806..69588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3164"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3164"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28788"
FT                   /db_xref="GOA:A5FT56"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT56"
FT                   /protein_id="ABQ28788.1"
FT                   /translation="MRHDPASAAVVVMLRGLNMFGMAQAVGELIEQGAPAFDAAVPILS
FT                   QLLKAEVAEREVRSISCQIKAARFPAYKDLAGFDFAASEVNEALIRQLHRGDFMDGADN
FT                   VVLIGGPGTGKSHMATALGVQAVEHHRKKIRLFATVDLVNALEQEKAMNRAGQLAERLL
FT                   RLDLAILDELGYLPFSPSGGALLFHLLSKLYERTSVIITTNLSFSEWAGVFGDAKMTTA
FT                   LLDRLTHHCHIIETGNDSFRFKDSATKPKARKDKSPAA"
FT   sig_peptide     complement(69511..69588)
FT                   /locus_tag="Acry_3164"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.822) with cleavage site probability 0.611 at
FT                   residue 26"
FT   gene            complement(69578..70455)
FT                   /pseudo
FT                   /locus_tag="Acry_3165"
FT   gene            complement(70523..71398)
FT                   /locus_tag="Acry_3166"
FT   CDS             complement(70523..71398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3166"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3166"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28789"
FT                   /db_xref="GOA:A5FT57"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT57"
FT                   /protein_id="ABQ28789.1"
FT                   /translation="MSETARTVDAQRLTLLLNELRLPAIKQVWPDFAARADKEAWPAAR
FT                   LLATLAEHEVAERDRRRIERHLLEARLPPGKTIATFAFEAVPMISKAQVLALCSGDGWL
FT                   DTGANLLAFGPPGGGKSHLAAAIGLALVENGWRVLFTRTSDLVQKLQIARRELALEATI
FT                   AKLDKFHLLILDDLAYVTKDQAETSVLFELISTRYERRSLMITANQPFGEWGKVFPDPA
FT                   MTLAAVDRLVHHATIFEMNVESYRRKTAIQRRTGPGRPPTRATITENGRLSRHDNQVAE
FT                   TRLPASNQSD"
FT   gene            complement(71395..72924)
FT                   /locus_tag="Acry_3167"
FT   CDS             complement(71395..72924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3167"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3167"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28790"
FT                   /db_xref="GOA:A5FT58"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT58"
FT                   /protein_id="ABQ28790.1"
FT                   /translation="MPPRNGETFVPGRHINDHQKRLFMRYRQTDGVALAAARAGFSTAA
FT                   GYRLEQKRHLPSSAKPPRGRRRPDPLAAIFDAEVVPLLEAAPGLRAVAIFEEMCRRHPD
FT                   LAPGVRRTLERRIRTWRALHGPEQEVIFRQTHEPGAMGLSDFTDMNELGIIVAGAPLDH
FT                   RLYHFRLVWSGFEHAHVILGGESYVALAEGLQNALWLLGGAPREHRSDSLSAAFRNLAA
FT                   ENVADLTRRYDALCAHYGMTPSRNNRGVAHENGAIESPHGHLKRVVRDALLLRGSTVFV
FT                   DLEAYRRFIAEIVGRQNRRHAERIDAERAALQKLPEQRTADYEETVVTITSSGGFTLRK
FT                   VFYTVPSRLIGQRLRVRLYDNRLELFLAATPLMTLPRGRPQPDGRHGHVVDYRHVIHSL
FT                   RRKPMALLNLVYRHQLFPRDAYRQTFEHLLEQTPPRDACRIMVELLAIAHERACEAELA
FT                   SVLAADSNAGRQPDLNAIRQRFAPDPASLPALTIPTMPLASYDILLQGAAA"
FT   gene            complement(74089..75303)
FT                   /locus_tag="Acry_3168"
FT   CDS             complement(74089..75303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3168"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28791"
FT                   /db_xref="GOA:A5FT59"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT59"
FT                   /protein_id="ABQ28791.1"
FT                   /translation="MIRSCQVYLWPIIDSMAVQRFGIVIESEDVVEVGKRGAVAVLAEG
FT                   AGAGFAVHQDVEGEAAQSGDDARVGSDPGSILCEGDVSDIVGGIFDAPMCADGLGGDGG
FT                   GEGCVGDVEGGVVCQLEQAGFGIAGGDCALDLNDGGDMGMPVGAGDRAGTMIFYTIVVG
FT                   LLILAIDRVEAIADTRALILLGVGVAAMFVLWPNAIYWVAPTLIVLPLASREMNSISAA
FT                   VALFTIVLLPGFIVVSSMILSGAMFGRPPAEAIAVWNAILHGAAPQEVLHSAWLASFGG
FT                   QFAAAFVALALMCATIAPRSWLIIWRLGLNQREQTQPATALAALLLPPISGALATYFWH
FT                   LNAPMVVVACSLAAVASWTATASLRHGERAAWVLLSLAGTSFGWAAPFLWQDSGLAQLR
FT                   HILLT"
FT   gene            75372..79709
FT                   /locus_tag="Acry_3169"
FT   CDS             75372..79709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3169"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /note="PFAM: CheB methylesterase; MCP methyltransferase,
FT                   CheR-type; regulatory protein, LuxR; response regulator
FT                   receiver; ATP-binding region, ATPase domain protein;
FT                   histidine kinase A domain protein; Sigma-70, region 4 type
FT                   2; PAS fold-4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3169"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28792"
FT                   /db_xref="GOA:A5FT60"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT60"
FT                   /protein_id="ABQ28792.1"
FT                   /translation="MKPPQPAARQTRHQAVTDIAAMTTPGRFLVVGIGASAGGLDACRK
FT                   LLDAMPDGSGMALIVVQHLDPNHPSMMADLLSGHTGMMVREAADGLPVESETVYLIPPG
FT                   TYLAVDSGVLRLSQPLAHHGARLPFDFLLPSLATCYGTQAAAVVLSGTGADGSIGIRSI
FT                   REHAGLVIAQHPGEAAYDGMPSNAIATGMVDAVLSLAEIPARLISYARSLDRSSEREPT
FT                   PDQPPFEAIIAMVLGSTGHDFTPYKRGTLQRRIERRMALAAIDPGNLQAYLDMLRGNAA
FT                   ELDLLAKDLLINVTSFFRDPEIFKTLEEQVIPDLIARHPQDLPIRIWVAGCSTGEEAYS
FT                   LAMLFREALDRAKSQSQIQVFASDIDAEAVAAAREGLYPPRIEAEVTADRLGRFFIREG
FT                   DSYRIVPELRSLVVFTVQDLLTDPPFSRLDFVSCRNLLIYLRPEAQAKVMSLCRFALRN
FT                   GGILLLGTSETTGRADHGFSVISKKERIYQRDGPLMPGDLGFSIGIGDTLRLPPLRRPP
FT                   DGPPRPASLAELCGRLVLHLYAPAAVLINARRETLFSLGPTERFLKVPPGPPSHDLLAM
FT                   VDPGVRARLRGAIQRATEGGGRVVVAGGTVETLSSSMAFDIEVWPVPETGEAALLVCFI
FT                   ERQPDKPRAQGKTGEENAPRVVELEGELAATKTELLGVIRELERAGEDQRAVNEEALSI
FT                   NEEFQSTNEELLISKEELQSLNEELIALNGQLQETLERERNASNDLENVLYSTNVATLF
FT                   LDPALNIRLFTPATRELFNILRGDIGRPLADLTGVAGIETLADDAAAVLQTAIPAAREI
FT                   EAPAGRWLTRRILPYRNHDGGVDGIVVTFADVTEQKLAASALEAARQQAEQATLAKSRF
FT                   LAAVSHDLRQPLQTIALLQELLTETTSGKAALGLIQQIKQTTSVMAGMLNTLLDINQIE
FT                   AGTVKVTVSTFAVDEILRDLHDEFHFQAEERNVQLRVVDSTVVIASDRALLKQMLRNLL
FT                   SNAIKYTQSGRILLGCRRRHGGLSIEVWDTGVGIPEPEWTAIFDEHYQIDNPARERGRG
FT                   LGLGLAIVRRVGELLGHPIELRSRMGRGSMFAVQVPLAPAVSAAAQAEAQTSRAVALAW
FT                   RPKAILLIEDDPDLRRLLVQFLEGMGHRIEAVPDGPAAMARVATSDFRPDLILTDYNLP
FT                   SGMSGTEAVTALRKRLDAPVASLILTGEISSETLAEIEQHGAVRLNKPILPGELAAAIR
FT                   KIETGERSPTNPMHGEACVGIIDDDKPIRDSLSALLGKHGWQVAAYVSAEDFLRDGCQL
FT                   SHACLLLDARLPGMSGIDLLKLLRKEANETPVIIMTGQGNVQQAVMALHAGAADFIEKP
FT                   IAVADLLAGIDAAIELNSNQVRRAQARDDARQRLGMLTDRQREIMMRVLAGHPSKNIAS
FT                   DLGISQRTVEAHRAAIMKRTGVRSLPALTRLVLLTDMFHDKQA"
FT   gene            80154..81200
FT                   /locus_tag="Acry_3170"
FT   CDS             80154..81200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3170"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3170"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28793"
FT                   /db_xref="GOA:A5FT61"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT61"
FT                   /protein_id="ABQ28793.1"
FT                   /translation="MAEVTTIGLDIAKHVFQAHGVDADGHKVFSRRLTRAKVLEFFSAQ
FT                   PRSLVALEACGGAHHWVRELAKLGHDVRLIPPAYVKPFVKRNQKNDANDAEAISEAAQR
FT                   PNMRFVAVKSEEQQASALVFRTRDLLVRQRTQLINAIRGHMAEYGWVAPKGRMWMASLR
FT                   EVIDSDNSLPVAARDMLRVMLVMLDGLDGLDGLDFQIADLDKEIARRAREDEDVRRLMT
FT                   IPGIGPIAATAICALAPPAETFARGRDFAAWVGLTPLQKSTGGKPRQRRTTKMGERTLR
FT                   RLLIIGASTLIRHASKKGPTEGGWLASMLTRKPRMLVTVAQANKTARIVWAVLTKKEDY
FT                   RASVAAAV"
FT   gene            complement(81170..82048)
FT                   /locus_tag="Acry_3171"
FT   CDS             complement(81170..82048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3171"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3171"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28794"
FT                   /db_xref="GOA:A5FT62"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT62"
FT                   /protein_id="ABQ28794.1"
FT                   /translation="MAKPNTLLKRTNNALLDYIRGLSAEPGAFGSESVLARQFGVSRTT
FT                   VRAAIETMIASGILERGPARPRVMRRPKRTDYYTESETDGPQEHIERVFMQRVLLGDWR
FT                   PGHTFSEAELARDSNASTVSVREFLIGFSRFGLIAKQPRGGWILREFHDGFAAEVADMR
FT                   ELIEMAALARMPRAGSAALTEAADAMIARHRDIEAASVDAPRKASANLRVHRCRMLPSV
FT                   RPLGAEMFCGPVWEFADRIQNTTACSRTLVTTGFPTPSRRRLCHTLLRSPTFSASLSSL
FT                   AVYTAAATEAR"
FT   gene            82617..83825
FT                   /locus_tag="Acry_3172"
FT   CDS             82617..83825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3172"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3172"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28795"
FT                   /db_xref="GOA:A5FT63"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT63"
FT                   /protein_id="ABQ28795.1"
FT                   /translation="MTEDRLPLAELLAKAGDGDFLRSVAEAVVQLLMETDVDGLIGASR
FT                   YERSGERATYRNGYRERALDTRLGSLQLRIPKLRQGSYFPPFLEARRTSEKALAAVIQE
FT                   AWIGGVSTRRVDELVQAMGLTGISKSTVSKLCKDIDERVNAFLDRPLAGEWPYLWLDAT
FT                   YLKQREGGRIVSVAAIIAVAVNTDGRREIVGLHIGPSEAETFWSTFLKSLVRRGLREVK
FT                   LVISDAHEGLKAAIRRVMGASWQRCRVHWMRNALSYVPKGQQSMVSAALRQAFIQPDRV
FT                   SASQTLRHVADQLRGKWPKLGAFIDDSETDVLAHMDFPAQHRTKIHSTNPLERLNKEVK
FT                   RRADVVGIFPNEGSIIRLIGAVLLEANDEWQTQNRYMQIEGMVELMAPAIDADTPRIST
FT                   VAA"
FT   gene            complement(84454..85164)
FT                   /locus_tag="Acry_3173"
FT   CDS             complement(84454..85164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3173"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3173"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28796"
FT                   /db_xref="GOA:A5FT64"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT64"
FT                   /protein_id="ABQ28796.1"
FT                   /translation="MMALTLPARLKGYRFPRSVIAYAVWSYYRFNLSLRDVEDLLAARG
FT                   VIVCYETIRVWVDRFGPQIAAQIRRDRLPAGDKWHLDEMVITIGGEKHWLWRAVDHRGD
FT                   VLEILVQKRRDARAARRFLRKLMRRWGQPRVVVTDKLRSYDVALRTDCRSADHRSHKRL
FT                   NNRIEASHRHTRRREKIMGRFKSPGHAQRFLATHDQITTLFRPKRHRLSARSYRHARAD
FT                   AFLLWTDYAANLAA"
FT   gene            complement(86018..86296)
FT                   /locus_tag="Acry_3174"
FT   CDS             complement(86018..86296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3174"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3174"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28797"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT65"
FT                   /protein_id="ABQ28797.1"
FT                   /translation="MQVEWHQLALEDRDVIVAYLELLNPNAASSVLRGLVLAGDSLALF
FT                   PTRGRVGLAAGTRELVAVWPYLIVYEVDTSSDTVRILRIWHEAQDRP"
FT   gene            86302..86592
FT                   /locus_tag="Acry_3175"
FT   CDS             86302..86592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3175"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28798"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT66"
FT                   /protein_id="ABQ28798.1"
FT                   /translation="MTGDRQVQPLDLAQEIGAHLLMRHSRAEIGPGFSDGSFEEPPLGL
FT                   EFKIDLGNGPVHNDSVITYPGTSGATPLFVLCSDLVCVDTFLMEREGYTKG"
FT   gene            86592..86864
FT                   /locus_tag="Acry_3176"
FT   CDS             86592..86864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3176"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28799"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT67"
FT                   /protein_id="ABQ28799.1"
FT                   /translation="MKAARSIQVVAHIPPAAEEEAVAAAHIRLAGEHNTQQAVEGAVVA
FT                   LETTIPKACAGRAPRVVVRVGGPSLEVEDHEDRRPMVAVLLSRCM"
FT   gene            86998..88122
FT                   /locus_tag="Acry_3177"
FT   CDS             86998..88122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3177"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28800"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT68"
FT                   /protein_id="ABQ28800.1"
FT                   /translation="MVLASALADAAAAIARLDQALASHSLAQAFLHRARLEAVRRQAAV
FT                   DGQLINPWHLAATIEDLRLRMDPYLRIIDRGDILDKAKFALTLYQWLVAPDFDQEGEVQ
FT                   RAEAMLAMQPTALPPLIAAARGLRDWIETGETRPAMRAAMIRFWRQRGLLRLPVPLTGA
FT                   AALRAEQSWDRDVWLPAFLKAIAREVADGLDLLYTMERAWFDARRSIAGRRKDSYIAPA
FT                   VDLLAAAAPVLSATTLARALGIAVRNAIRILTELIAAEIAVEDTHRTKRRLFGLKGLAP
FT                   LREVVRPPYRSDPTRSRGRPRQPIEEEEAEVAPPPLSPLTPIERHEFDYTALEEAMAEL
FT                   DTAIRHARLALQARPEPNPPAPSRPVLPEGGAAQ"
FT   gene            88223..88492
FT                   /locus_tag="Acry_3178"
FT   CDS             88223..88492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3178"
FT                   /product="WGR domain protein"
FT                   /note="PFAM: WGR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3178"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28801"
FT                   /db_xref="InterPro:IPR008893"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT69"
FT                   /protein_id="ABQ28801.1"
FT                   /translation="MPEPVQLSLFPERASLVRIRPERNEWRFYRLEILPDLFGYTLLAR
FT                   HWGRIGTKGRIRLDPHLDFGAALNALAALTRRKRRRGYHERAGW"
FT   gene            88768..91056
FT                   /locus_tag="Acry_3179"
FT   CDS             88768..91056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3179"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28802"
FT                   /db_xref="GOA:A5FT70"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT70"
FT                   /protein_id="ABQ28802.1"
FT                   /translation="MTVIATDLAALLGTVRRPGDFYVAGEIAFSPPSLDVASVGPVALP
FT                   LLPIQARQLIDAAEPAPFGRGEQTIIDPTVRRCGQIGPDRVRLGGRHWARTLEDILARV
FT                   SDGLGVDEPIDAEFYKLLIYDQGGFFVSHRDTEKVAGMFATLTVVLPSHFSGGDLIIRH
FT                   KGREACLALHTGDPGDVAFAAFYADCVHEILPVSEGCRLALIYNLLRRSRSGRGRALHP
FT                   PDYTAEQARIAALLRRWTDTAGPDAALPAKLVYPLEHAYTPAELGFASLKGADAAVGGV
FT                   LTGAARDAGCDLHLALLTIEESGAAEYADTYGSRRGRWDTADAFEAGEVFERSVALSDW
FT                   RRPDGTRSDLGEIPVEEDEIAPPGACDDLAPDEEQFHEATGNEGASFERSYRRAALVLW
FT                   PRARLFAVLSQAGLGATLPYLGDLVRRWAAADPDCRAALWRDAQDLAEHMVGRWPKHDW
FT                   RDTERKEPSEAGQILGLLAELGDTATIETVLTGIIAGGFGKADTDAIMAALGQLAPLRR
FT                   VALIELIVAESAAGSLGACANLLARAAVAWATSGNCDLTGAATRLLTALPSGAARATPS
FT                   SGWQQSGRAVVAGVVADLVLGFGAIDPVLAERAIDHVLAWPKVYGMDAVLVPAARCLCQ
FT                   RQLVRGTAALARLRTACLAHLRRRMAEKLAAPTDWRRDSKIPCRCPRCADLARFLANPD
FT                   ASTWVLKAAEAERAHVQHSIRQAGSDVDTTIDRSGRPYRLVCTKNQASHERRLRQRQRD
FT                   LEAVAELTL"
FT   gene            complement(91393..91818)
FT                   /locus_tag="Acry_3180"
FT   CDS             complement(91393..91818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3180"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3180"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28803"
FT                   /db_xref="GOA:A5FT71"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT71"
FT                   /protein_id="ABQ28803.1"
FT                   /translation="MMFVLDTNILSAMMSLRPSPEVTAWIEGQPEELLFTTSITQAEIL
FT                   SGLAIMPDGRRRHDLEAAAAAMFSEDFEGRVLPFDMEAAAAYADIFAARRRGGRPTAAL
FT                   DLMIAAVARSHGASVVTRDTGGFEDCGLTLINPWAVS"
FT   gene            complement(91815..92090)
FT                   /locus_tag="Acry_3181"
FT   CDS             complement(91815..92090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3181"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28804"
FT                   /db_xref="GOA:A5FT72"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT72"
FT                   /protein_id="ABQ28804.1"
FT                   /translation="MQRTGTLTPMATLTIRNIDAAVKERLRVRAAEHGHSMEAEARRIL
FT                   QTALTKDASRSGRSLAERIHARFAALGGVDLELPPRDNAREPPSFE"
FT   gene            complement(92849..93131)
FT                   /pseudo
FT                   /locus_tag="Acry_3182"
FT   gene            complement(93167..93382)
FT                   /locus_tag="Acry_3183"
FT   CDS             complement(93167..93382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3183"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28805"
FT                   /db_xref="InterPro:IPR021558"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT73"
FT                   /protein_id="ABQ28805.1"
FT                   /translation="MTPVAVRVQKRRDALRRAGLRPVQIWVPDTRARGFDEECRRQARL
FT                   VAEADRQDAKLAAFLDAAIADLDGWE"
FT   gene            93525..94280
FT                   /locus_tag="Acry_3184"
FT   CDS             93525..94280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3184"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28806"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT74"
FT                   /protein_id="ABQ28806.1"
FT                   /translation="MAKNSRDGNRLRAARRRAALAERGIKQVLLMAPEQAHPLLKQAAT
FT                   LMTRDDDPLEPLAALRRAGGANEPEPVGASPDLGAELEATKARIAEIERQAEARLAMVI
FT                   EAAERRRRALEAEQEKARANAVEAQKAAKSAQVAAGRAEEALRRAEKAEATDPAGQGDA
FT                   GPQRPAGALSGRRCAEIAGGRCAGLLQWKAPFAPCEASMARKFDSVRQCGGNSGVAEAA
FT                   NGHAATVEIRGVSASMAGAMSSTIPSICI"
FT   gene            complement(94196..95404)
FT                   /locus_tag="Acry_3185"
FT   CDS             complement(94196..95404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3185"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3185"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28807"
FT                   /db_xref="GOA:A5FT63"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT63"
FT                   /protein_id="ABQ28807.1"
FT                   /translation="MTEDRLPLAELLAKAGDGDFLRSVAEAVVQLLMETDVDGLIGASR
FT                   YERSGERATYRNGYRERALDTRLGSLQLRIPKLRQGSYFPPFLEARRTSEKALAAVIQE
FT                   AWIGGVSTRRVDELVQAMGLTGISKSTVSKLCKDIDERVNAFLDRPLAGEWPYLWLDAT
FT                   YLKQREGGRIVSVAAIIAVAVNTDGRREIVGLHIGPSEAETFWSTFLKSLVRRGLREVK
FT                   LVISDAHEGLKAAIRRVMGASWQRCRVHWMRNALSYVPKGQQSMVSAALRQAFIQPDRV
FT                   SASQTLRHVADQLRGKWPKLGAFIDDSETDVLAHMDFPAQHRTKIHSTNPLERLNKEVK
FT                   RRADVVGIFPNEGSIIRLIGAVLLEANDEWQTQNRYMQIEGMVELMAPAIDADTPRIST
FT                   VAA"
FT   gene            complement(95519..95839)
FT                   /locus_tag="Acry_3186"
FT   CDS             complement(95519..95839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3186"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28808"
FT                   /db_xref="GOA:A5FT76"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT76"
FT                   /protein_id="ABQ28808.1"
FT                   /translation="MAHYAGLDISDKDTAIHVVDDNGKLVWRGKRASEPEVLAAALRRH
FT                   APELVRVGLETGQLAPWLYHSLKDLGFPVICLDARHARVATALQRNKTDAHEAETLAQF
FT                   VR"
FT   gene            complement(96132..96545)
FT                   /locus_tag="Acry_3187"
FT   CDS             complement(96132..96545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3187"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28809"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT77"
FT                   /protein_id="ABQ28809.1"
FT                   /translation="MPDQVIQERPATRKSLKLYQDLSGRWFGRFNRLGMGLLGMRHGRG
FT                   SMQPGGFVLTHVEMVCGLEVMVFCYGVMRCRSDMHGGRRMIGGRLVGAGADRGGIRYCH
FT                   VISPEMVQGYRSWEAYDSLPKNKLKISDHRIAR"
FT   gene            96950..97573
FT                   /locus_tag="Acry_3188"
FT   CDS             96950..97573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3188"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28810"
FT                   /db_xref="GOA:A5FT78"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT78"
FT                   /protein_id="ABQ28810.1"
FT                   /translation="MAAFSSLLDILAEVPDPRRAEGKLYKLPHVLLFSILAIISGSNSY
FT                   RGIVTFIDVHRRRLNRSFGLKWRRAPSHTAIRYILQGLDPGAVEAAFRRHAALLQAART
FT                   KPGTASIALDGKTLRGSFDRFHDRTAAHVLSAFATDTKLVLAHVEIGEKSSEIPAAQAL
FT                   LAELGIAKDTLVTLDALHCQKKPSTSPRRATSASSSRSRTINRR"
FT   gene            complement(97387..98373)
FT                   /locus_tag="Acry_3189"
FT   CDS             complement(97387..98373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3189"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28811"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT79"
FT                   /protein_id="ABQ28811.1"
FT                   /translation="MRQEVLRGSAHKTRLVKDYVASTAGRLTLHFLPGCAPELNPDKLV
FT                   WSHVKRTGVARNPLRKGEKLRDKIDAQLAAIKRVPALVRSFFLAPSVMAVQRFGIVIES
FT                   EDVVEVGKRGAVAVLAEGAGAGFAVHQDVEGEAAQSGDDARVGSDPGSILCEGDVSDIV
FT                   GGIFDAPMCADGLGGDGGGEGCVGDVEGGVVCQLEQAGFGIAGGDCALDLNDGGDMGMP
FT                   VGAGERAGGIEGGDGAGFVTIAAAVAGPEDVVWGARCGDMVDRLLQRRLIVLDLDDEAD
FT                   VARLGDVEGFFWQCRASRVTSVSLAMPSSASSAWAAGISLDFSPIST"
FT   gene            98745..99074
FT                   /locus_tag="Acry_3190"
FT   CDS             98745..99074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3190"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28812"
FT                   /db_xref="GOA:A5FT43"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT43"
FT                   /protein_id="ABQ28812.1"
FT                   /translation="MRVKHPPTGQHRGAADPTRDHGASIRSFSMRSYRLAWFTVAAGAG
FT                   LLLGGCGYSPGGRALSGAAIGAGTGAVVGSVTGIGPGGGALIGGGVGAAVGGLTSPSTI
FT                   NLSPR"
FT   gene            99126..99464
FT                   /locus_tag="Acry_3191"
FT   CDS             99126..99464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3191"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28813"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT81"
FT                   /protein_id="ABQ28813.1"
FT                   /translation="MNRIQVITPLGAGLALATAGANAQTTTTTSTAHTLQPTAMTWTPV
FT                   MPSPSGTLSTTETSRSVDAAGNTSQSRKTTYGSEDGAVSQSTSTTTITPVPHTSTTTDT
FT                   TSPYSTTK"
FT   sig_peptide     99126..99197
FT                   /locus_tag="Acry_3191"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 24"
FT   gene            complement(99418..99723)
FT                   /locus_tag="Acry_3192"
FT   CDS             complement(99418..99723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3192"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28814"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT82"
FT                   /protein_id="ABQ28814.1"
FT                   /translation="MAAHAIALLHRRRARGLRGRGHGRAQHWRRRRGRCGRGARMLRRR
FT                   RRRGVRRTATAAGEDQDGPAHPRGKQNACRGGLVRSHDVLRFISWSSMETLCRSWC"
FT   gene            99832..100389
FT                   /locus_tag="Acry_3193"
FT   CDS             99832..100389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3193"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3193"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28815"
FT                   /db_xref="GOA:A5FT41"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT41"
FT                   /protein_id="ABQ28815.1"
FT                   /translation="MDDRTGRPRNIVSLQVASLDAHIGGQITARRAEIGLSRRQLAMTL
FT                   RVPVRGIAAYERGIQHVAPADLFRLAQALGVDLAYFYTDSASSPQAPKAETGCPVGGRA
FT                   AGGVGQAAVDMRQYDDIDQIADRFSRIRNPAIRRCVTRMLDSLAEHEVSSVTVGDVRTE
FT                   PLISAFEELAELAYAPPSASRG"
FT   gene            100689..100994
FT                   /locus_tag="Acry_3194"
FT   CDS             100689..100994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3194"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3194"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28816"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT84"
FT                   /protein_id="ABQ28816.1"
FT                   /translation="MGSEALLIIEASAGRITRSSIAIDSERAAPGFVQSLSRDRNGSRL
FT                   MDKDRVAGLAKEIKGAVKEAVGKLVGDAKLQAEGRAGKTEGRVQNTVGGLKDSVRK"
FT   gene            101491..102417
FT                   /locus_tag="Acry_3195"
FT   CDS             101491..102417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3195"
FT                   /product="esterase, PHB depolymerase family"
FT                   /note="TIGRFAM: esterase, PHB depolymerase family"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3195"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28817"
FT                   /db_xref="GOA:A5FT39"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT39"
FT                   /protein_id="ABQ28817.1"
FT                   /translation="MSAGCVSEVVGFGSNPGALRMLVHARARLPAGRPLVVVLHGCGQD
FT                   AAAFANASGWLALADELGFALLVPEQVHANNRGRCFNWFRPDDVRRSGGEAMSIRQMLR
FT                   VAVARYGSDPRRIYIVGFSAGGGMAAAMLAAYPAVFAAGGIVAGMPVGCAQTQVAAMLH
FT                   MRRANMSRSRQALAGDVRAVTQARSRRSWPRVSIWQGGRDRTVDPANAEILAAQWGELH
FT                   GQDTAPRTDNVASGHRHRTWGRPDRPPAVEIWTLPAIGHGFPVDASLPGSGRTSPYLAR
FT                   ADLSAARQIATFWLLNNDHAKRAALHR"
FT   gene            102462..104444
FT                   /locus_tag="Acry_3196"
FT   CDS             102462..104444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3196"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3196"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28818"
FT                   /db_xref="GOA:A5FT38"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT38"
FT                   /protein_id="ABQ28818.1"
FT                   /translation="MIDLSPPRARPGTPAAINDTSGLMTLISVVVAVATLSIARDVLIP
FT                   ITLAVLLSFLLAPLVNLLRRTGLGRVPGVVLAVLLALGVILGTAGLIGTQVADLADDIP
FT                   RYTDTIQQKVDAVQSATFGRLSAFVGSMGSQINRDSHASAGAPASAGTTVSAASAAAPT
FT                   NAAAKPIPVEVHQPEPSLMKLARRVLTPILSPLMTTAIVVVVAIFILLRPEDLRDRLIR
FT                   MLGTGDLHRTMTAMDEAGHRLSRYFLTLLALNTAFGSMIGLGLFVIGVPSAVLWGIMAI
FT                   LMRFIPYIGPWLAAALPLALAAAVDPGWSMLLWTGTLFVVSEGVMGQVIEPMAYGHSTG
FT                   LSPLSVVVAAIFWSWLWGPVGLILSMPLTLCLVILGRHVDRLKFLDVLLGDRSALTPVE
FT                   SFYNRMLAGRLDEVQDDAEQLLKSCTLSAYYDEVAIPGLRLATIDIERGVLTEAQTIRI
FT                   IAGVQGLLEEIGDHDDSDTLLTAAGPARLPSDRQATPESREPGPPAGLGEPVGLSPDWQ
FT                   APSAVLCVAGRGPLDDLASAMLAQLLGKRGIGASVVTHEAVSLRAADTLDIVGVQMVCL
FT                   TYSGIAGTSSDLRYTVRRLRARSPSVCILVGFWPSNMVSDDRLRAAVAADIYAGSLHDM
FT                   VVACLAEALGPASDRVRQLAPVPEP"
FT   gene            complement(104657..105187)
FT                   /locus_tag="Acry_3197"
FT   CDS             complement(104657..105187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3197"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3197"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28819"
FT                   /db_xref="InterPro:IPR024501"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT87"
FT                   /protein_id="ABQ28819.1"
FT                   /translation="MTSERDTSRRWAGHGPAAVAGAASSAAAQLASAWPEYMIDAFQRG
FT                   VLFLELLQQRVNEEIASTAWLMSTALRFDHEMVMSDSALLLPMNYSLLRITPPPGMIAD
FT                   PRKRLVVVVDPRAGQGPGIGGFKVERGISGAVHCTSPCGHGTGGHRHPNKNIAYELKIS
FT                   QRTVENPRTEIME"
FT   sig_peptide     complement(105086..105187)
FT                   /locus_tag="Acry_3197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.550 at
FT                   residue 34"
FT   gene            105560..105916
FT                   /locus_tag="Acry_3198"
FT   CDS             105560..105916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3198"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28820"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT88"
FT                   /protein_id="ABQ28820.1"
FT                   /translation="MSSGRRQVGSAAAIAHLLEMNQGGQRQVLALHPPQSTGLGISLDH
FT                   RCPLNQRVPPPTSQLARRGARSDRHDTAHRLHLRLIRWGLLFGLRRTGNDRCHNQCDHR
FT                   NGPYHQDPPLPSMR"
FT   gene            complement(105997..106335)
FT                   /locus_tag="Acry_3199"
FT   CDS             complement(105997..106335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3199"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28821"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT89"
FT                   /protein_id="ABQ28821.1"
FT                   /translation="MTRPQLNARSPFDAFLFATMGEDSKGLVGSVLSALARLDFEPWQE
FT                   AVQTRLAAMIADLPNWSPLQRSQPPSRPRCWPSCPIGSDTRELLMPRRLSARRLPRRKA
FT                   RPTGARLP"
FT   gene            106952..107788
FT                   /locus_tag="Acry_3200"
FT   CDS             106952..107788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3200"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="PFAM: band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3200"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28822"
FT                   /db_xref="GOA:A5FT90"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT90"
FT                   /protein_id="ABQ28822.1"
FT                   /translation="MFLYVVPVLVLAALVVLAATVKILREYERAVVFTLGRFQRVRGPG
FT                   LVLLLPFFQEMVRVDLRIRVIEIPSQDVISHDNVSMKVDAVLYFNVVDPEKAIIHVQNY
FT                   LPATNMLAQTTLRAVLGQHELDEMLSERKKLSADVQSILDAQTETWGIKVSNVEIRTVE
FT                   LTDNMVRAIAKQAEAERDRRAKIIHAEAEFQASQTLVNAAQILGSVPAAMQLRYLQTLT
FT                   EIGAEQNSTVVFPMPIDIIKPFLELLDKAGKPAGANGADRALPLKGVPLSVPDANA"
FT   sig_peptide     106952..107008
FT                   /locus_tag="Acry_3200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.979 at
FT                   residue 19"
FT   gene            108038..109294
FT                   /locus_tag="Acry_3201"
FT   CDS             108038..109294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3201"
FT                   /product="Transposase-like protein"
FT                   /note="FOG: Transposase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3201"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28823"
FT                   /db_xref="GOA:A5FT50"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT50"
FT                   /protein_id="ABQ28823.1"
FT                   /translation="MDEDWQGDLERWLAPYLKGLGNKTRRRMCPAYIAGLIGPGDRKSI
FT                   QPMAARSDAISYDRLHHFIGAGLWDSAPLEATLWDQADKLVGGNEAWLIIDDTALPKKG
FT                   KASVGVAPQYATALGKNANCQTLVSVTLASGAVPLMLSLRLFLPESWTSDIARMDKAGV
FT                   PACFQEYRTKPEIAIEEIDRVIAAGVRFGCVLADAGYGLSAPFRQALSTRGLCWAVGIP
FT                   RHQKVYPADVQLIFPVAGRGRPRVRHVPDVKSMAAQAMLEGAKWRQLGWRKGTKGRLTA
FT                   RFAAMRVRIADGAPQRIGSAGAQHMPGEEAWLVGEHRSNGERKYYLSNLPADTPIRALA
FT                   GAIKARWICEQAHQQLKEELGLDHFEGRSWTGLHRHALMTMMAYAFLQSRRLAQAGRKK
FT                   KSPRSASPTHPASSAPSHP"
FT   gene            109482..110726
FT                   /locus_tag="Acry_3202"
FT   CDS             109482..110726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3202"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3202"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28824"
FT                   /db_xref="GOA:A5FT92"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT92"
FT                   /protein_id="ABQ28824.1"
FT                   /translation="MGYAIDSAEDLALHHFYRVMAWLGEELGDRQAGALAPRCVKDVIE
FT                   EQLFERRRDLFTDLSLVFMDTTSLCFYGEGGETLGRRGHSKDYRPDLAQMILALVIDAE
FT                   GRPICTEMVPGNTADVKILMPVVTRLRERFGITRACVVADRGMISADTIAALEALGMEY
FT                   ILGARERTSRVIRDVVLKDKAAMVPLVLDRQHGETQLWVKEVRMGKGKAAQRYIVTVNE
FT                   AEAKKDRENRQAIIDGLQAQLKKGDKALVGNSAYRRYLRSRGNAFEIDPGKLAEEARFD
FT                   GVSVLRTNARITPLQAVIRYRDLLEVEALFRAAKASFDTRPIFHQADAAIRGHVFCSFL
FT                   ALTLAKELKRLCGARGFQPEWQKLLNDLDRLQQATIEKGGKVITTRTHVTGQVGNVFKA
FT                   AGIALPHNISEHPAD"
FT   gene            111082..111759
FT                   /locus_tag="Acry_3203"
FT   CDS             111082..111759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3203"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28825"
FT                   /db_xref="GOA:A5FT93"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT93"
FT                   /protein_id="ABQ28825.1"
FT                   /translation="MARAQFNTRSPFDAFLFAPIGEDSKGLIVSVLSALARLDFDPWQE
FT                   AAVFARLPKEAAQARLTRMIADLPNTSPLQMEPGTIATQVLALLPDRPEPTVVPDATAT
FT                   VRNSTTVLRPAGLLVALGPIVLLIASAVVFALWSASIITMASQRVPTAKASQVDIRGGN
FT                   RPDAARVPLSAATGIAATAGAGRATDGRGTSTTETGDGGDAHARTDMPAASGPATRSII
FT                   SPH"
FT   gene            111777..112193
FT                   /locus_tag="Acry_3204"
FT   CDS             111777..112193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3204"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28826"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT94"
FT                   /protein_id="ABQ28826.1"
FT                   /translation="MMRAIAMIALVMAPIVAGAAQTEEKAAAYQAQMQPMSRIVAVAAR
FT                   AASCEVRSRQWNALIQGASVIQAYALAGALWGMQGKYLSPAGLVHFEKMGDALQQIRLA
FT                   AARKTPDACASLRNDPSIMRSLDHLAAMEGWPEH"
FT   sig_peptide     111777..111836
FT                   /locus_tag="Acry_3204"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.463 at
FT                   residue 20"
FT   gene            112483..114747
FT                   /locus_tag="Acry_3205"
FT   CDS             112483..114747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3205"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28827"
FT                   /db_xref="InterPro:IPR024501"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT95"
FT                   /protein_id="ABQ28827.1"
FT                   /translation="MTIDFAARHKPAPGRAGRGPAIAAGNAGPAAVQLATAWPNYMIDA
FT                   FQRSVLFLELLRQRGNDEIAITARPVATVLRFDHDLVMSGQALPRPMNYSLLRITPPPG
FT                   VITDLRKRPVVVVDPRAGQGPGIGGFKAESEIGDALDAGHPVYFISFAATPEPGQQFLD
FT                   VVEGQVAFFERVVALHPGAPRPFAIGNCQAGYQTLMVAMLRPDLFGPCLVAGSPMSYWQ
FT                   GVHGKYPMRYAGGLLGGSWLTAMSSDLGRGRFDGTALVMNFDSLNPANWLWGKQYDVYT
FT                   HIDTGGARYLAFEKWWGDFIQLNGDELQFLVDNLFIGDKLTRGQLASSDGRIFDLRNIR
FT                   SPIIAFASTADNISPPPQSLGWILDLYRNVDEIRAADQTIVYCLDHKIGHLAIFVSTKV
FT                   GAEQDEEFVQMIDVIDCLPPGLHEMIISPRPAETPRGGFVTGDWIARFETRSLDDIRAL
FT                   GRNSPEDDRAFAAVARLSALNLAAYRRILQPLVRALANQPMADLTRALNPLRLSYTIFA
FT                   DRNPWMQVVRTMAAGVDAARRPVAADNPFLALQTQVSDQIIAGLDAYRAARDVMAEQVF
FT                   FGVYGSPFVQALLGITDRTEARPTPGPSPEQRALQEVHAKVYAAKLKSGGFDEALTRAV
FT                   LYVLAADHVLDQRCALALNAARWTIMHLSLAAFKAVVRDQAFLLLLEREQAIAALAVLV
FT                   PEADARTALLSQVRAIVGAAGPPSSAESDRLLRLKQALAPPPRRPTATAAASGKPQAVS
FT                   H"
FT   gene            114877..117558
FT                   /locus_tag="Acry_3206"
FT   CDS             114877..117558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3206"
FT                   /product="plasma-membrane proton-efflux P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; plasma-membrane proton-efflux
FT                   P-type ATPase; PFAM: cation transporting ATPase domain
FT                   protein; Haloacid dehalogenase domain protein hydrolase;
FT                   E1-E2 ATPase-associated domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3206"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28828"
FT                   /db_xref="GOA:A5FT96"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006534"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT96"
FT                   /protein_id="ABQ28828.1"
FT                   /translation="MTKTAVGHADAPASKPNAEAVATAGSKSEAKDDLKTLPLAAVEKE
FT                   LRSSPDGLSQAEAERRLKQYGPNEIEEKKTSELLTFLSYFWGPIPWMIEVAVILSAVAR
FT                   HWPDFVIILVLLLANALVGFWEEHEAGSAIAALKATLAVKTRVLRDGKWVAPAARELVP
FT                   GDVIRVRLGDIVPADARLLDGDPVEVDQSALTGESLPATRKSGEAIFSGSIIRRGEIGA
FT                   LVYATGAKTYFGRTAELVQGAKSVSHFQRAVLKIGNYLIILAVVMVSAIIAVAVIRGDP
FT                   ILTTLQFALVLTVAAIPVAMPTVLSVTMAVGARMLARKKAVVTRLVAIEELAGVDVLCA
FT                   DKTGTLTQNKLTLGDPFGVDGVTPAEVVLAGALASRVDNDDTIDLAVLGGLKDDQALKG
FT                   YEPGHFQPFDPVHKRTEAAVTGPDGKLFKVTKGAPQVIMALAANAPQVKSAVDKAVGDF
FT                   AARGFRALGVARAEGDGDWQFLGVLPLFDPPREDARATIAAAERMGVKVKMVTGDALAI
FT                   AQETAGKLGIGCNILDAGTLGDEAQQKTPAAAKAIDDAEGFAQVFPEHKFHIVAALQSR
FT                   GHIVGMTGDGVNDAPALKQADCGIAVASATDAARAAAAIVLMTPGLSVIIDAIQESRKI
FT                   FQHMNSYAIYRIAETLRVLLFMTLAILIFNFYPLTAVMIVFLALLNDGAILSIAYDNVR
FT                   YKNAPEVWNMRLVLGIATVLGAVGPIAAFGLFFLGNRVFHLSHPQLQTMMYLMLSVAGL
FT                   MTIFQARTHGPWWSIRPAPIFLGAVTGAWTVATLLVLFGVLMAPLDWRLVLFVWAYALA
FT                   WFLVTDPVKLLAYRLLDPVKDASRPEPETGAKARHKPDSRARPTATTEVGANATATSEA
FT                   GPDATTQGKSAAAPKPEPESPL"
FT   gene            complement(117812..118915)
FT                   /locus_tag="Acry_3207"
FT   CDS             complement(117812..118915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3207"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3207"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28829"
FT                   /db_xref="GOA:A5FT97"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT97"
FT                   /protein_id="ABQ28829.1"
FT                   /translation="MAAPLGMIERGCVCIGRKHRGGAAVEYFAGLDVSLEETAVCVVDG
FT                   TGGIVREARVASEPEALVAFFGASGMEMARVGLEACSLTAWLQAGLSDAGIPAICIEAR
FT                   QAKAAMGAMPNKTDRNDARGIAQIMRTGWYRAVHVKSPPCRSWRALLTARRMLLNKRRD
FT                   VENGIRALLREVGLKVGTPSRKDFGARVRELVADDPVLVSLAGSLLAAVETMTREVERL
FT                   TRRVLDEVRVEPTCRRLMTVPGVGPLTALAFRATIDQPDRFRRSRDVGAHLGLTPRRYQ
FT                   SGETDVQGRISRCGDELARTALYEAAHSLLIRSTKWSALRAWGMNVAKRRGMARARVAV
FT                   ARKLAVILHRMWIDGSEFCWGKQATVA"
FT   gene            complement(118968..119774)
FT                   /locus_tag="Acry_3208"
FT   CDS             complement(118968..119774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3208"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3208"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28830"
FT                   /db_xref="GOA:A5FT98"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT98"
FT                   /protein_id="ABQ28830.1"
FT                   /translation="MWTPTTRAQHSRTGLRYGSDVTDAEWLLLSPFLPAPSRCGRHRKW
FT                   EMREIVNAIFYVLRGGIAWSLLPKDFPPWPTAYRWFARFRDDGTWERINHHLVMRDRER
FT                   AGREASPTAAVIDSQSIKTTESGGPRGYDAGKKIKGRKRHAMVDTDGRALKLQAHSAAI
FT                   QDRDGAGPLLRASRASWPFVALGYADGGYAGARVANASPIRIEVVRKADNQVGFAVISR
FT                   RWVVERFFAWINRNRRLAKDFEASIESVEAFLYAASSVFLLRRLAR"
FT   gene            complement(120083..120739)
FT                   /locus_tag="Acry_3209"
FT   CDS             complement(120083..120739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3209"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3209"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28831"
FT                   /db_xref="GOA:A5FT99"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT99"
FT                   /protein_id="ABQ28831.1"
FT                   /translation="MQAGGGAVLSAFRGRHFDDEIVLWAVRWYCRYGISYRDLEQMRGE
FT                   RGVNVDHSTIYRWVQRYAPEIEKLLRWQWRRPASTSWRVDETYIKVRGEWAYLYRAVDK
FT                   HGNTIDIYLSPTRNAKAAKRFLGKALNGLKDWEKPEVINTDKAPTYAIAIAELKAEGKC
FT                   PEVTLHRQVKYLNNVVEADHGKLKQLTRPVRGFKTLKTAYATSKGFEVMRALRKG"
FT   gene            120766..120921
FT                   /pseudo
FT                   /locus_tag="Acry_3210"
FT   gene            121146..121988
FT                   /locus_tag="Acry_3211"
FT   CDS             121146..121988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3211"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28832"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTA0"
FT                   /protein_id="ABQ28832.1"
FT                   /translation="MPPKLNASQDDLELFRSRLENIIDQRHPLVRLARLIDWRVFEERF
FT                   GSLYAEAAGRPALPTRLMVALHLLKHMDGLSDEAICARYLDSPYVQAFCGETHFQHTLP
FT                   LDRSSMTRWRKRIGPERMEALLAETLAAAERGGAVAEKHYKRVTIDTTVQPKAVTHPTD
FT                   SKLLHSGIETLARMARKHGITLRQSYRRVARYARQEAARLHHGGKRREAEARVRKLRTW
FT                   LGRLARDITRKIAGNAEAKATFAETLGLINRLGSVRNSVYGRRLNIRPPWPLRSDRRR"
FT   gene            complement(121948..123171)
FT                   /locus_tag="Acry_3212"
FT   CDS             complement(121948..123171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3212"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3212"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28833"
FT                   /db_xref="GOA:A5FTA1"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTA1"
FT                   /protein_id="ABQ28833.1"
FT                   /translation="MARRRAPAIPDELLDQLLAGGDAAAALNSGDLVNALKKALAERAL
FT                   SAEMDYHLSDEAEAENSRNGYGRKSVSTGTGKIEIAIPRDRAGSFDPQLIAKYQRRFPG
FT                   FDDKIISMYARGMSTREIAEHLREIYGMDASAELISTITDAVLDEVTSWQQRPLDPVYP
FT                   LVFFDAIRVKIRDEGVVRNKAIHIALGVMADGTKVVLGMWIEQNEGAKFWLRVMNELKN
FT                   RGVEDILLAVVDGLKGFPEAITAVFPETIVQTCIVHLLRNSMDFVSYKDRKAVATALKD
FT                   IYRAVDARAAGAALAAFEAGPWGQKYPAIGQSWRRVWQEVIPFFGFPGDVRRIIYTTNA
FT                   IEALNSKLRRAIRARGHFPSDEAAAKLLYLILNRSEKEWVMPPREWAMAKAQFAVIFGD
FT                   RFVRAMAA"
FT   gene            123296..123841
FT                   /locus_tag="Acry_3213"
FT   CDS             123296..123841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3213"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3213"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28834"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTA2"
FT                   /protein_id="ABQ28834.1"
FT                   /translation="MECIGKGKARTRFEFGVKVSIATTNAAAPGGQFVLGMQSQPGNPY
FT                   DGHTLAGQIEQVERITGVAVARAYVDRGYRGHGVEAEGRRIFISRQKRGITPTIRRELR
FT                   RRTAIEPVIGHMKTDGHLGRNFLLGFDGDAINAILAGAGHNLRLLRRWLIRLLCAIFTW
FT                   LSAARPSPDLRLPNYHIA"
FT   gene            complement(123843..124535)
FT                   /locus_tag="Acry_3214"
FT   CDS             complement(123843..124535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3214"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein,
FT                   Crp"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3214"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28835"
FT                   /db_xref="GOA:A5FTA3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTA3"
FT                   /protein_id="ABQ28835.1"
FT                   /translation="MGRILVEALEFQAAIRTTCGQLGYHARALEAGTTIFMENQIADKM
FT                   YQIVSGIVRLSKGLQDGRRQVLGFLFAGDFFVPSGFVVGINKNATCTAEALTDMQIISL
FT                   PLRNLDALLTDQPKFASDLLLATERSLIQAQQQMLRLGRMSATERVTWFLLMMKEQQDD
FT                   DGDASIHLPMSRIDIADYLGIRSETISRVLRWLRDHRMITVSDRATITIIDSASMCHVS
FT                   GGFYPSRL"
FT   gene            127229..128599
FT                   /locus_tag="Acry_3215"
FT   CDS             127229..128599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3215"
FT                   /product="sodium/proton antiporter, NhaA family"
FT                   /note="PFAM: Na+/H+ antiporter NhaA; TC 2.A.33.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3215"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28836"
FT                   /db_xref="GOA:A5FTA4"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FTA4"
FT                   /protein_id="ABQ28836.1"
FT                   /translation="MITDQNSKPQQGELPTTHIDALTNSFSQFLRIEATSGAVLLLATV
FT                   VALTLSNSPWSDGFRSLWETPIGIQIGAFQFLRSLRDLINDGLMTLFFFIVALEIKREV
FT                   VLGELRNPRMVALSVVAAAGGMLVPMGLYLALQHGQPGQHGWGVVMPTDTAFVIGCLAL
FT                   LGSRVPPGLRVFLLSLAVVDDLAAILVVAVGYSRSIDWTALALGAVGLVIIRGMALLGV
FT                   RNIRVYFLAGAIIWLAVNASGIHATIVGVILGLMTPTAGWVSDQRLGEILRKVLSYPPG
FT                   DHWSGDTEDNRALQVAGIAVRETLSPVERLEAMLHPWVAFGVMPLFALANAGVPITIKG
FT                   LINPVSLAVMAGFVLGKPIGVTAFAWLGVRTGVAIRPAGLTWGGLVGGALLTGIGFTMA
FT                   LFIAGQAFQDATLNAAKLGILAASVVSSVAGLTLLCALPRSDGTPMFRGRRGGGEHP"
FT   gene            129492..130319
FT                   /locus_tag="Acry_3216"
FT   CDS             129492..130319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3216"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3216"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28837"
FT                   /db_xref="GOA:A5FTA5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTA5"
FT                   /protein_id="ABQ28837.1"
FT                   /translation="MATAADTAIQPHNLRAAAIWNVAGDAYDEISRGIADSIDHAVRRL
FT                   APGPGERVLDVATGTGWTARSIARSGAIVSGVDLGVDLVTAAQNRARAEGLNIDYRVGD
FT                   AEALAYDDATFDAAISTYGVMFASHPEAAAAELARVTRPGGRLVLTTWRPDSSVFGMFR
FT                   VLREFMPPPPDPAPPSPFEWGREDRVTALLGEAFDLEFEPGISVYRVADGETAWSTFVL
FT                   GYGPARTLAASLDERRRADLQRAFVQFHENFRDGDEILVPREYLLSYGTRRGD"
FT   gene            complement(130377..130631)
FT                   /locus_tag="Acry_3217"
FT   CDS             complement(130377..130631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3217"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28838"
FT                   /db_xref="GOA:A5FTA6"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTA6"
FT                   /protein_id="ABQ28838.1"
FT                   /translation="MSDRVRCDLRMARRVQHAKLAGSAQINPYIRQSVERLDRRHSMHH
FT                   AYPQKTKSDNRSEAIGVLLMGGASLIGLAFFALFRMHSG"
FT   gene            complement(131326..131589)
FT                   /locus_tag="Acry_3218"
FT   CDS             complement(131326..131589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3218"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28839"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTA7"
FT                   /protein_id="ABQ28839.1"
FT                   /translation="MAAIVPDPRHPLLWMAYVSLSCIHGGRRIRYFNAAPDTEMLASLA
FT                   RYVEEGVVRPHVDGVYELARIADAHRAFETSGSRGKQIIMLA"
FT   gene            131729..132937
FT                   /locus_tag="Acry_3219"
FT   CDS             131729..132937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3219"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3219"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28840"
FT                   /db_xref="GOA:A5FT63"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT63"
FT                   /protein_id="ABQ28840.1"
FT                   /translation="MTEDRLPLAELLAKAGDGDFLRSVAEAVVQLLMETDVDGLIGASR
FT                   YERSGERATYRNGYRERALDTRLGSLQLRIPKLRQGSYFPPFLEARRTSEKALAAVIQE
FT                   AWIGGVSTRRVDELVQAMGLTGISKSTVSKLCKDIDERVNAFLDRPLAGEWPYLWLDAT
FT                   YLKQREGGRIVSVAAIIAVAVNTDGRREIVGLHIGPSEAETFWSTFLKSLVRRGLREVK
FT                   LVISDAHEGLKAAIRRVMGASWQRCRVHWMRNALSYVPKGQQSMVSAALRQAFIQPDRV
FT                   SASQTLRHVADQLRGKWPKLGAFIDDSETDVLAHMDFPAQHRTKIHSTNPLERLNKEVK
FT                   RRADVVGIFPNEGSIIRLIGAVLLEANDEWQTQNRYMQIEGMVELMAPAIDADTPRIST
FT                   VAA"
FT   gene            complement(132991..133173)
FT                   /pseudo
FT                   /locus_tag="Acry_3220"
FT   gene            133465..134994
FT                   /locus_tag="Acry_3221"
FT   CDS             133465..134994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3221"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3221"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28841"
FT                   /db_xref="GOA:A5FT58"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT58"
FT                   /protein_id="ABQ28841.1"
FT                   /translation="MPPRNGETFVPGRHINDHQKRLFMRYRQTDGVALAAARAGFSTAA
FT                   GYRLEQKRHLPSSAKPPRGRRRPDPLAAIFDAEVVPLLEAAPGLRAVAIFEEMCRRHPD
FT                   LAPGVRRTLERRIRTWRALHGPEQEVIFRQTHEPGAMGLSDFTDMNELGIIVAGAPLDH
FT                   RLYHFRLVWSGFEHAHVILGGESYVALAEGLQNALWLLGGAPREHRSDSLSAAFRNLAA
FT                   ENVADLTRRYDALCAHYGMTPSRNNRGVAHENGAIESPHGHLKRVVRDALLLRGSTVFV
FT                   DLEAYRRFIAEIVGRQNRRHAERIDAERAALQKLPEQRTADYEETVVTITSSGGFTLRK
FT                   VFYTVPSRLIGQRLRVRLYDNRLELFLAATPLMTLPRGRPQPDGRHGHVVDYRHVIHSL
FT                   RRKPMALLNLVYRHQLFPRDAYRQTFEHLLEQTPPRDACRIMVELLAIAHERACEAELA
FT                   SVLAADSNAGRQPDLNAIRQRFAPDPASLPALTIPTMPLASYDILLQGAAA"
FT   gene            134991..135866
FT                   /locus_tag="Acry_3222"
FT   CDS             134991..135866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3222"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3222"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28842"
FT                   /db_xref="GOA:A5FT57"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT57"
FT                   /protein_id="ABQ28842.1"
FT                   /translation="MSETARTVDAQRLTLLLNELRLPAIKQVWPDFAARADKEAWPAAR
FT                   LLATLAEHEVAERDRRRIERHLLEARLPPGKTIATFAFEAVPMISKAQVLALCSGDGWL
FT                   DTGANLLAFGPPGGGKSHLAAAIGLALVENGWRVLFTRTSDLVQKLQIARRELALEATI
FT                   AKLDKFHLLILDDLAYVTKDQAETSVLFELISTRYERRSLMITANQPFGEWGKVFPDPA
FT                   MTLAAVDRLVHHATIFEMNVESYRRKTAIQRRTGPGRPPTRATITENGRLSRHDNQVAE
FT                   TRLPASNQSD"
FT   gene            complement(135929..137575)
FT                   /locus_tag="Acry_3223"
FT   CDS             complement(135929..137575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3223"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3223"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28843"
FT                   /db_xref="GOA:A5FTB1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTB1"
FT                   /protein_id="ABQ28843.1"
FT                   /translation="MFVVERVARGHSYLYLVESVRVGKSVRQRTIKPLGRKDVLAASGE
FT                   LDRLVASIARHAERSIILSDIDAGRIAAHRIGGPLLFGRLWDRLGIGEVLNNLLEGRQF
FT                   GFAVERAVFVATLHRLFVSGSDRSCVDWMQSYAIDGAEDLALHHFYRAMAWLGEELGDR
FT                   QAGALAPRCVKDVIEEQLFERRRDLFTDLSLVFMDTTSLSFYGEGGETLGRRGHSKDYR
FT                   PDLAQMILALVIDAEGRPICTEMVPGNTADVKILMPVVTRLRERFGITRACVVADRGMI
FT                   SADTIAALEALGVEYILGARERTSRVIRDVVLKDKAAMVPLVLDRQHGETQLWVKEVRI
FT                   GKGKAAQRYIVTVNEAEARKDREDRQAIIDGLQAQLKKGDKALVGNSAYRRYLRSRGNA
FT                   FEIDPGKLAEEARFDGLSVLRTNARVTPLQAVIRYRDLLEVEALFRAAKASFDTRPIFH
FT                   QADAAIRGHVFCSFLALTLAKELNRLCGARGFQPEWQKLLNDLDRLQQATIEKGGKVIT
FT                   TRTHVTGQVGNVFKAAGIALPHNISEHPADL"
FT   gene            137757..138104
FT                   /locus_tag="Acry_3224"
FT   CDS             137757..138104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3224"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3224"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28844"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTB2"
FT                   /protein_id="ABQ28844.1"
FT                   /translation="MTPKGKQPFAFARPDRETMAFAGIWESWVTPGTAKVLRTFAIITT
FT                   AANATAAPVHDRMPVIIRQEDWPIWLGEAAGESAGLLHPPPDELIEAWPVGQAVNSPRN
FT                   NGPDLLATAAE"
FT   gene            complement(138372..139010)
FT                   /locus_tag="Acry_3225"
FT   CDS             complement(138372..139010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3225"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28845"
FT                   /db_xref="GOA:A5FTB3"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTB3"
FT                   /protein_id="ABQ28845.1"
FT                   /translation="MDDVSVNLFLVQVAVIFLPGIIWAKLDATYAAKVKPSEIEFVVRA
FT                   FVFGLTVYVVEYMVFEWLHWPFPIVDLAAADSHEVLTAPIAHEVLGAVGISLIMALLWL
FT                   YASTYKLLTRFLQLIKATKKYGDEDVWDFMLNSGEAAVEYAHVRDLDHGFLYAGWVDTF
FT                   SETDKLRELVLLRVIVYNLDGEQLYETPRLYLARAPEKINIEFPHEAGG"
FT   gene            complement(139096..144141)
FT                   /locus_tag="Acry_3226"
FT   CDS             complement(139096..144141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3226"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3226"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28846"
FT                   /db_xref="GOA:A5FTB4"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTB4"
FT                   /protein_id="ABQ28846.1"
FT                   /translation="MADHLMTMTLPGFEQDMAAYYQRGMTVDGGLWQPGTAAAEDNAAA
FT                   TALDAARPGTIPEPRRDMHPTVAAALGIDTSRPLTRDEIAELLAGNRADGEKIAGKQYQ
FT                   RAVTPLAEVFGFDPMRLPTRAELENLLAGKRADGFDLPAAPVEAAPAITPQTAAPKAVE
FT                   PNEAEDRDAALAAEAAALGELGRAADGPPPWPDDFAPPPMEEVVGHDRDAALAADWQAD
FT                   IARGGEPAVPPRGPAAEERPAEPRAIDVAAALDAAGVPYRTSGGRLRLQATWRGGESWT
FT                   VSVNATTGQWTDFAASEGGRFESLVRRLGVKAEAVELDPEAAKAARAAEVRRSAFRKSI
FT                   AGKLWDEAIPGTGELRAPRLHGAVGQKLQQRAAHAARVDEAEALRASARAYLSGRGLDA
FT                   DWLMSHVRLVRPHPNYDSAEVSAGAAVVMLTPMFGQDEDGRVRLTGVQRTYLTEGGEKI
FT                   GRRMLGASGAWLLHPPAGAAVPIGGHDQARVAGEGFETVASVVQETRQAGVVGYNAGGL
FT                   VAWAGQFTGSTPVALLADRDNARLHNGRDVGEAGQKAAAKAAALIEANGGEAVYLEPPA
FT                   DVAGGAKGADWADALREGGAAGLRQALAAAEASGAADRARIEAKLAPASPSAAPDGPPA
FT                   QEAEQSPPAPHPELVRLYKALGAKDGRVLSETERANILDGKRADGKALDAADWRNAVNR
FT                   SKTPIGYVDFTFSADKTISLAWAFAPTEAERNQLAQAHKDAVAATMAEIEQVIGQARKG
FT                   KGGKEGTEQGRIGWITFDHYTARPTLEIARETADGRTETEIVSVKVAGDPQLHTHVAVP
FT                   NVIVTESGRVVSLNTLQMHGRIHEWGAIYQAHLAQNLRRAGASIELDRATGAARLSAVP
FT                   EEIRAAFSKRTRDALSDAKAYAASLGADWDRMTGDERIKLLKGGAFASRSAKADDLSDF
FT                   ASWRRQAEARGYQHKSVLQDAAPAEKMTEAARLDLAYEAASRVLGEQFARRAVIKAEDE
FT                   RVAAARGLVAAGIKDGGDVDQVIARLRARGVVETGGAGGNGESARTQIIAVETERDDPD
FT                   NPDVTITTTRLTTRAHVEQESALVELSGQAGRDRRGTLNPVQIKRGIEASGLSFTGAHG
FT                   AAQRRMIDHLGMGGRFAVGIGAAGAGKTTLLKPLVAAWRDQGADIHGISLGWRQARELR
FT                   EAGLNTEAETGGRDTIAAVSVFINRVESGRLDLSNRSVVVIDELGTIGTRQMLDLLRLQ
FT                   EQHGFRMVAIGDPKQCQSIEAGQVIGLLEKGLGEVPSIESSVRQTNERAREITGLLRKG
FT                   GAEAVGKALDMKRQDGTAEIVAGGHNEVIARAAALWDERRKANADRPRFTLSISTPTNQ
FT                   DARAIGEAIRQRLLASGELGQSRMTLAAIDKNTGEHYAMPIATGEKIRLFARTNAAMLD
FT                   GGKGAIGDNGSILEITSIREEGLVLRNDHGREGFVKWDTLADKETGRMRLAYGYAMTTN
FT                   TAQGITTTEHIFVTPGGSQTTDGFKTYVSGSRHRERDYWLTSEGAERQEIGGRRPLGDP
FT                   RPIREHDIWANWTRNIARQPEKTNALDLVKIGEEARRNAARAFLKGLAADEKRAAAGLP
FT                   ADLSQRFARSQVRAGAQGGLADTMARAGEEKGQTLARIERAPPAVRAAVAAGWERARPL
FT                   IEAAHRSARARLQKALEGHRRQAQRQAEERPLEQESRKRGRGR"
FT   gene            complement(144189..144527)
FT                   /locus_tag="Acry_3227"
FT   CDS             complement(144189..144527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3227"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28847"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTB5"
FT                   /protein_id="ABQ28847.1"
FT                   /translation="MPEPETAPPPPKDDRLDAVIQAMRLMIETQNTHSQMLARLIELAT
FT                   PSEESPLEDALAGIAGALRDQTTALLQIGTTLDGLGAEVEAGVMRGLATALEPGDDGSQ
FT                   SGAGGETC"
FT   gene            144665..145345
FT                   /locus_tag="Acry_3228"
FT   CDS             144665..145345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3228"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28848"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTB6"
FT                   /protein_id="ABQ28848.1"
FT                   /translation="MLCLCCEFASYLLRKWRTLCCEYAVVVLRSIDVQRLKSVGFPMPV
FT                   PDLDIEKLGAAMASGLRRRSPLMVWFIEHHDEFAALLDKHGAHWKGLAEHFAAAGLVSR
FT                   TGQPLTPRTVENYWLRARRLVAKRRAEGRPVAAAPAGTPEPEPRFKPFTMSNEGHGVSA
FT                   AEPQAPGTPAAPADQAAQPTPKFQRSWMRNEGRGVSPAERRALGDPTAPADPDDPKWRG
FT                   DKSR"
FT   gene            145355..146245
FT                   /locus_tag="Acry_3229"
FT   CDS             145355..146245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3229"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTB7"
FT                   /protein_id="ABQ28849.1"
FT                   /translation="MTEAPSSEKKPNGAHKPTTPVFRPGSVAAGLKSAEIKPLLTREQS
FT                   SSEPVAQGLDLADRPKIILTAGRGKTGKTTFLRWIAEMAQRDGKAPLLADIDPTNATFS
FT                   TYFGGVARPDTFNQAAVRDWLQDFMEFAIAEKQTAIVDLGGGDTILRTIAGEMPGFDAM
FT                   IEDAGMAVVMFYLAGPHPEDLTPAATLGALGFKPRARAFVLNEGMAQAGQSRDQAFGRL
FT                   TSSNVYRDETADGALTLWMPRLHAAEAVEARTASFIAARDGQTEPPLGVFNRSRVGHWL
FT                   KAMDEQFAGVKSWMP"
FT   gene            146461..146946
FT                   /locus_tag="Acry_3230"
FT   CDS             146461..146946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3230"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28850"
FT                   /db_xref="GOA:A5FTB8"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTB8"
FT                   /protein_id="ABQ28850.1"
FT                   /translation="MRQARDGLAQTIDQAFKAAKAQAEAAHADLSRQFVASFAKEAEQR
FT                   LKSMSRWIWWRTIASGAALAIVILSLGFGLGYWRGNAAGYSEAAGTIHATGAVEQSVLA
FT                   SQGPAGLAQWHQLMRDNAILDTMKSDCTGKNVAHQDGRTACHLWLWTTPNVASAAHG"
FT   gene            146951..147355
FT                   /locus_tag="Acry_3231"
FT   CDS             146951..147355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3231"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28851"
FT                   /db_xref="GOA:A5FTB9"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTB9"
FT                   /protein_id="ABQ28851.1"
FT                   /translation="MEERFTPTADGSARSAGFVSQLGRVLLGLLRGTLRFLLVAVLDVL
FT                   ILAVRFMLWFRRLLFWLGLFSALSCILNYQAHKPLLAAFALGAGILMMTLSRASLLLND
FT                   RLRFCQLQLHAWAQGWPVARYAFTALPPRR"
FT   gene            complement(147377..147694)
FT                   /locus_tag="Acry_3232"
FT   CDS             complement(147377..147694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3232"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28852"
FT                   /db_xref="GOA:A5FTC0"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTC0"
FT                   /protein_id="ABQ28852.1"
FT                   /translation="MLGAPLLGLIAQFVQAPLPTLWIPAILVAASGVWLMRDDLRATSS
FT                   VGFGECPLECRATGMGAKSPVRVGIERLVSEADNPPSSDQDRFVPYQHNNMLTCHRSAA
FT                   G"
FT   gene            complement(147823..148968)
FT                   /locus_tag="Acry_3233"
FT   CDS             complement(147823..148968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3233"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3233"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28853"
FT                   /db_xref="GOA:A5FTC1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTC1"
FT                   /protein_id="ABQ28853.1"
FT                   /translation="MAVLLIACPCALVISTPAAIASGLASGARYGLLIKGGAALETLGK
FT                   IRTVAFDKTGTLTMGQPQVTDVVPVEGDVANVLAKAAAVERGSSHPLGAAIVKEAELRG
FT                   LDMPRVFGGTVAAPGKSVMGRISSGFVTVASPLHAAEQALLDDTAQERISALEDEGKTV
FT                   VTVCEGKRLIGLIALRDELRADASEAVRTLRALGIRPVMLTGDNLRCAQGIADAAGIEV
FT                   RASLLPDDKLAAISGYKAEAPIAMVGDGINDAPALAASSVGVAMGSGTDVALETADAAL
FT                   LKNRVTGVAEMVTLSRATIINIWQNIALALGLKSVFLVTSLSGITPLWMAILADTGATV
FT                   LVTANALRLLRFKPQTQENAIIVHSSINANGSRPKISSQIA"
FT   sig_peptide     complement(148903..148968)
FT                   /locus_tag="Acry_3233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.899 at
FT                   residue 22"
FT   gene            complement(149080..149886)
FT                   /locus_tag="Acry_3234"
FT   CDS             complement(149080..149886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3234"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3234"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28854"
FT                   /db_xref="GOA:A5FTC2"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTC2"
FT                   /protein_id="ABQ28854.1"
FT                   /translation="MRHDPAAGALVIMLRSLKMHGMAQAVDELAQQGAPAFEAAIPVLS
FT                   QLLKAETAEREVRSMAYQLKAARFPAYRDLAGFDFASSEVNEALVRQLHRCDFIEPADN
FT                   VVLVGGPGTGKTHIATALGVQAVEHHKKRIRFFSTVELVNALEQEKAQGKAGQIAGRLI
FT                   HADLVILDELGYLPFSASGGALLFHLLSKLYERTSVAITTNLSFSEWAAVFGDAKMTTA
FT                   LLDRLTHHCHILETGNDSFRFKNSSVQKSQNERRKAALDPIMKPKS"
FT   gene            complement(149876..151402)
FT                   /locus_tag="Acry_3235"
FT   CDS             complement(149876..151402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3235"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3235"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28855"
FT                   /db_xref="GOA:A5FTC3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTC3"
FT                   /protein_id="ABQ28855.1"
FT                   /translation="MAFLSIIRRWHKREYVPIREISRRLGVSRNTIRKYLRSDQIEPKF
FT                   QVPDRPSKLDPYAEKLALWLRREGNRPRKQRRTVKQLHGDLVSLGYDGSYNRVAAFARA
FT                   WKEECKLLQQTAGRGTFVPLSFAPGEAFQFDWSEDFAVIGSARVKLQVAHTKLCYSRAF
FT                   IIRAYLLQTHEMLFDAHNHAFRALGGVPRRGIYDNMSTAVDKVGRGKERSVNLRFQAMT
FT                   SHYLFEPDFCNRAAGWEKGQVEKNVQDARHRLWQSMPPFETLDALNDWLEQRCRELWEQ
FT                   TAHGGEPGSIADVWAQEVESLMPVGRPFDGFVEFTKRVSSTCLIHLERNRYSVPASFAN
FT                   RPVSLRVYPNRLVVAAEGQIICEHPRVVERTHGPGRTIYDWRHYLAVIQRKPGALRNGA
FT                   PFLELPDAFRHLQRHLLQHPGGDRDMVEILALVLHHDEQLVLMAAELALADGVPSKTHI
FT                   LNRLHRLIDGKQAPPPVITAPQALTLAHEPRADVERYDTLRQTGETRHAS"
FT   gene            complement(151500..152534)
FT                   /locus_tag="Acry_3236"
FT   CDS             complement(151500..152534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3236"
FT                   /product="E1-E2 ATPase-associated domain protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   E1-E2 ATPase-associated domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3236"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28856"
FT                   /db_xref="GOA:A5FTC4"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTC4"
FT                   /protein_id="ABQ28856.1"
FT                   /translation="MAAAISVKLKIEGMDCGGCAVKIENAMKRLPGVTDVSVSFSTASL
FT                   SLMLDEDRTARTMIEARIRALGFTPLGGTRQADADKVRTESASGNVWWKTRKVRLVGVT
FT                   GLLLALGFVVTQAEPAWSPWPYVAAALVGLLPIVRRALAGMRTGTPFTMETLMSIASIG
FT                   ALAIGEGADAAIVVFLFALGELLEGVAAGRARAGIEGLIGLVPRTARRVRGDAIETVPV
FT                   ETLAIGDVVTVRAGDRVPSDGTVVGGTSQVNEAPVTGESAPVVKAEGAPVYAGSIAGHG
FT                   ELRIEITRTSADNTIARIIHMVEEAQATKAPTARFIDRFSRWYTPAAMAFSALVMLGPP
FT                   VDFH"
FT   gene            152615..153028
FT                   /locus_tag="Acry_3237"
FT   CDS             152615..153028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3237"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3237"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28857"
FT                   /db_xref="GOA:A5FTC5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTC5"
FT                   /protein_id="ABQ28857.1"
FT                   /translation="MAIGELGRQTATRVETIRYYERIGLLPAPARTAGNYRAYGPEHLN
FT                   RLSFIRRSRDLGFSLDQVRALLDLADERARSCEAVDAIARDHLAEIDRKIADLRALRRE
FT                   LGNMISQCRQGTVAECRIIDALSPGASQKKRRK"
FT   gene            complement(153038..154276)
FT                   /locus_tag="Acry_3238"
FT   CDS             complement(153038..154276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3238"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3238"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28858"
FT                   /db_xref="GOA:A5FTC6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTC6"
FT                   /protein_id="ABQ28858.1"
FT                   /translation="MANASDHIRGIAANRGQFTLQALQVFFVGLVIGMERAVLPTLAHE
FT                   FGVAPGAFLFLASFVLSFGLVKGALNLVAGGLADRFGRKPVLIAGWIAAIPIPLLIWAA
FT                   PNWWWIVIANVFLGISQGFTWTMTVTSQIDLAGSHQRGLAVGINEATGYVAVGLAGAVA
FT                   ALLAEAVGARNALLIFGMATIVLAFATITRVRDTLAWVKAEHAEAGAGASQDHTLTLRE
FT                   IFVRISFRDRVGRAICQGGIVNKIADTLVWVMFPLFFKSHGAKLIEIGWLTGTYAMVWG
FT                   VSQLWTGHLGDRVGRRAPVIVGFFLLAAGIAITAAGRDASLWLPGAIVMGLGMALLYPN
FT                   LIAAMSDRAAPLIRGKALGTYRYWRDTGYALGAVALGLIAQFAQATLPTLWITAVLVAG
FT                   SGIWLMRDLPRPQ"
FT   gene            complement(154282..155013)
FT                   /locus_tag="Acry_3239"
FT   CDS             complement(154282..155013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3239"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3239"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28859"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTC7"
FT                   /protein_id="ABQ28859.1"
FT                   /translation="MILRQFLHTDPTAASYLLGCVGKGAGVVVDPLFPIEPYLQAASAS
FT                   ATPIRQVIDTHLHADHRSAGRALAEAAGAEYAIHESAKVGYACRRLADGERLELGNVVL
FT                   EVLHTPGHTPEHLCLTVTDRTRADEPWSVLGGHTLMVGDVGRTELATDAARGARDLFAS
FT                   LVRLKALPDHIEVLPGALAGSVCGRGLSGKPVSTIGFERRYNPAFRIDDAERFVAFMLE
FT                   NIPPAPEGAAELRAWNAGFTA"
FT   gene            155099..155764
FT                   /locus_tag="Acry_3240"
FT   CDS             155099..155764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3240"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: Rhodanese domain protein; regulatory protein,
FT                   ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3240"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28860"
FT                   /db_xref="GOA:A5FTC8"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTC8"
FT                   /protein_id="ABQ28860.1"
FT                   /translation="MKSSSGPKQQIFSHLAEIAAALAHPHRIEIIELIAQGERSVEDLA
FT                   ERIGLSLSNTSRHLQVLRRARLAAPRREGKNMFYSLVSETEVVTLLGSLGRVGERNIAE
FT                   IDQVLQAYFRARDSLEPVSRLTLLERLREGSVTLLDVRPADEFARGHLPGALNIPLDQL
FT                   DAALGHFTENIPVVAYCRGPYCVLSYEAVAQLRARGVQASRLEDGYPEWKGAGLPIET"
FT   gene            complement(155937..156224)
FT                   /locus_tag="Acry_3241"
FT   CDS             complement(155937..156224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3241"
FT                   /product="putative plasmid maintenance system antidote
FT                   protein, XRE family"
FT                   /note="TIGRFAM: addiction module antidote protein, HigA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3241"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28861"
FT                   /db_xref="GOA:A5FTC9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTC9"
FT                   /protein_id="ABQ28861.1"
FT                   /translation="MMNNPPHPGELLREDVIGELGLSVTEAAQRLAMSRAALSRVLNAR
FT                   AAISPDLAIRLEQAGVSTAQAWLGMQANYDLWLARQHQQPPVRRFQENAA"
FT   gene            complement(156236..156514)
FT                   /locus_tag="Acry_3242"
FT   CDS             complement(156236..156514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3242"
FT                   /product="plasmid maintenance system killer"
FT                   /note="PFAM: plasmid maintenance system killer"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3242"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28862"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035095"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTD0"
FT                   /protein_id="ABQ28862.1"
FT                   /translation="MILSFRHKGLEAFYRTGSMRGIQAAQAGKLKRILGLLDVAQTPQD
FT                   MNIPAFKLHPLKGDLAGHWSVWVNGNWRVTFRFVEAGVELVNYQDYH"
FT   gene            156663..156833
FT                   /pseudo
FT                   /locus_tag="Acry_3243"
FT   gene            complement(156837..157073)
FT                   /locus_tag="Acry_3244"
FT   CDS             complement(156837..157073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3244"
FT                   /product="phage integrase domain protein SAM domain
FT                   protein"
FT                   /note="PFAM: phage integrase domain protein SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3244"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28863"
FT                   /db_xref="GOA:A5FTD1"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTD1"
FT                   /protein_id="ABQ28863.1"
FT                   /translation="MTEMGPLRRRMIEDMTVRNLSPATQRSYVHAVAKFGRFFSRSPEK
FT                   LGLEEVRAFQVHLVAGGMSWPALNQTVCALRFL"
FT   gene            complement(158590..159335)
FT                   /pseudo
FT                   /locus_tag="Acry_3245"
FT   gene            complement(159353..159736)
FT                   /pseudo
FT                   /locus_tag="Acry_3246"
FT   gene            159794..161017
FT                   /locus_tag="Acry_3247"
FT   CDS             159794..161017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3247"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3247"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28864"
FT                   /db_xref="GOA:A5FTD2"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTD2"
FT                   /protein_id="ABQ28864.1"
FT                   /translation="MARRRAPAIPDELLDQLLAGGDAAAALNSGDLVNALKKALAERAL
FT                   SAEMDYHLSDEAEAENSRNGYGRKSVSTGTGKIEIAIPRDRAGSFDPQLIAKYQRRFPG
FT                   FDDKIISMYARGMSTREIAEHLREIYGMDASAELISTITDAVLDEVTSWQQRPLDPVYP
FT                   LVFFDAIRVKIRDEGVVRNKAIHIALGVMADGTKVVLGMWIEQNEGAKFWLRVMNELKN
FT                   RGVEDILLAVVDGLKGFPEAITAVFPETIVQTCIVHLLRNSMDFVSYKDRKAVAAALKD
FT                   IYRAVDARAAEAALADFEAGPWGQKYPAIGQSWRRVWQEVIPFFSFPGEVRRIVYTTNA
FT                   IEALNSKLRRAIRVRGHFPSDEAAAKLLYLILNRSEKEWVMPPREWAMAKAQFAVIFGD
FT                   RFVRALAA"
FT   gene            complement(161021..161698)
FT                   /locus_tag="Acry_3248"
FT   CDS             complement(161021..161698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3248"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3248"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28865"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTD3"
FT                   /protein_id="ABQ28865.1"
FT                   /translation="MPVERIAMRDVREIVRLRMAGLSTRQVGIRVGVAASTVRLTLRRL
FT                   EAAGLDGPGALALSEAALERRLFEGSAGKRPGHRRVDEPDWGRIRRELQRKHVTLSILW
FT                   DEYIAEHPDGYRYSRFCELYRSWEARLPVTMRQTHASGKKLFVDYAGDTVPVVIDRLTG
FT                   ETRAAQIFVAVLGASSFTYAEATWTQTLPDWIEAHNRTLAAIGGVPALLVPALSGIPCM
FT                   GGG"
FT   gene            161920..162135
FT                   /locus_tag="Acry_3249"
FT   CDS             161920..162135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3249"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28866"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTD4"
FT                   /protein_id="ABQ28866.1"
FT                   /translation="MWITLDDGRVLGVPLAWFPRLFYATPEQRVACRISSRGLHWEGLD
FT                   EDISIAGLLAGRGNQTHRPRSIPSAA"
FT   gene            162308..162586
FT                   /locus_tag="Acry_3250"
FT   CDS             162308..162586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3250"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3250"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28867"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTD5"
FT                   /protein_id="ABQ28867.1"
FT                   /translation="MQVEWHQLALEDRDVIVAYLELLNPNAASSVLRGLVLAGDSLALF
FT                   PTRGRVGLAAGTRELVAVWPYLIVYEVDTSSDTVRILRIWHEAQERP"
FT   gene            162993..163553
FT                   /locus_tag="Acry_3251"
FT   CDS             162993..163553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3251"
FT                   /product="Heme NO binding domain protein"
FT                   /note="PFAM: Heme NO binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3251"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28868"
FT                   /db_xref="GOA:A5FTD6"
FT                   /db_xref="InterPro:IPR011644"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTD6"
FT                   /protein_id="ABQ28868.1"
FT                   /translation="MLGIIPHTIDQYLKTRVPPEARAGILGRAGFPDGQTFRLDTEYDD
FT                   ESCCALVDAIAAETGTTTEAVFDEISAFFLDWAERTFSGFFKVAPDTRGFLLLQPEIHS
FT                   SLACGLRASGQRKVADKFRVEALPDGVRIHYRSSNRLGYFYCALAHCLAARRGEVAEIS
FT                   FLDGDVGSAAAIIEVRLKPALAA"
FT   gene            163559..165421
FT                   /locus_tag="Acry_3252"
FT   CDS             163559..165421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3252"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3252"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28869"
FT                   /db_xref="GOA:A5FTD7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTD7"
FT                   /protein_id="ABQ28869.1"
FT                   /translation="MDQAETLDRAAVEALCEAMCGVVSGDLSVRLRTASADLTVQKLSL
FT                   LANFMLETAQRAVERSLAYAGALDNVQRIARLSAWQLVLPDQEVVPVGTAAGLPDAAAA
FT                   PLQGTAWFLDRVGPGCRAAMAALFQGDGGTLEWLAADGEAWFRTEVAALRDEGRLAGYL
FT                   VITQDISERRRATERIRYLAEHDPLTGLANRRRLHEQLEGELEAGRRQGTKFAVHVIDV
FT                   DRFKTVNDLFGHAAGDRLLVDLATCLRQEARESDMIARIGGDEFVVLQVGIGDARDAGA
FT                   LAGRLVGAVSARLAEPGARALAATVSIGIALAPDDGTTAEALLSHADMALYQVKSTGRN
FT                   GFAFFNTEINEAQLARRRMEAELRGACERGEMAVHYQPLFEIASDRVVGFEALVRWRRD
FT                   GEDVSPAVFIPIAEESGSIIEIGRFVLREACREAAGWPVKLRVAVNISALQIQDGGLPD
FT                   LVATVLEETGLEAGRLELEVTESLLLANAEAATEVLARIRALGVTISLDDFGTGYSSLA
FT                   TLRMFPFDKIKLDRSFVNDLGRLGEAEAIVMAVLGLGRALDVSVVAEGVETEEQAAMLR
FT                   AAGCSLLQGYLIGRPAPIARFSAEVGRDVTSRMTKTPIPADSPG"
FT   gene            complement(165732..166985)
FT                   /locus_tag="Acry_3253"
FT   CDS             complement(165732..166985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3253"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3253"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28870"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTD8"
FT                   /protein_id="ABQ28870.1"
FT                   /translation="MASSDIFTLGLGLTPPWRVVDQRLETDYQPHELHLAVAADPGARF
FT                   PCPTCGRLCKPHDWKELSWRHLNFFQHACIIEARVPRTDCPEHGVLRIAVPWARPDSGF
FT                   TLLFEQAALALMREMPVAAAARIIGVTDQRLWRILRYYVGRAIERLDLSGVEAIALDET
FT                   AAKRGHSYVTVFIDLDAAERPVLFVTPGKGKECMTAFRAFLAEHGGEARRIAEVVCDMS
FT                   AAFLAAAAESFPQASVTVDWFHVVQIFTTAVEQVRRAEAHQHNLPKGVRWATLKRPENL
FT                   TMAQRQALDQLENSGFATAEAYRAKEMLRWVRLAATPQAARWRLTNFLNHVTARLDDPD
FT                   HLLDPVRQAVDTVRRNAKRIIRRWKSGHSNARLEALNGLFQAARARARGYRNTATFACI
FT                   IYLLGAPINAMLDVFHST"
FT   gene            complement(167133..167327)
FT                   /pseudo
FT                   /locus_tag="Acry_3254"
FT   gene            167568..168053
FT                   /pseudo
FT                   /locus_tag="Acry_3255"
FT   gene            complement(169564..169914)
FT                   /locus_tag="Acry_3256"
FT   CDS             complement(169564..169914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3256"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: helix-turn-helix, Fis-type; Resolvase
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3256"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28871"
FT                   /db_xref="GOA:A5FTD9"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTD9"
FT                   /protein_id="ABQ28871.1"
FT                   /translation="MEGGRLSCQNLEVSQLRRFSLAERWADTTTPAGRMVLTVFAGMAD
FT                   FERSLIVERTSTGRIAAKARGVRFGPRPALAAEQIAHARQLIETDGKPVAEVARLLGVH
FT                   RATLYRALEKHQ"
FT   gene            complement(169881..170546)
FT                   /locus_tag="Acry_3257"
FT   CDS             complement(169881..170546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3257"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: Rhodanese domain protein; regulatory protein,
FT                   ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3257"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28872"
FT                   /db_xref="GOA:A5FTE0"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTE0"
FT                   /protein_id="ABQ28872.1"
FT                   /translation="MKSSSGPKQQIFSHLAEIAAALAHPHRIEIIELIAQGERSVEDLA
FT                   ERIGLSVSNTSRHLQILRRARLAAPRREGKNMFYSLVSETEVVTLLGSLGRVGERNIAA
FT                   IDQVMQAYFRARDSLEPVSRLTLLERLREGSVTLLDVRPPEEFAQGHLPGALNVTLDHL
FT                   DAMLDSLASRSPIVAYCRGPYCVLSFEAVARLRTRGIEAMRLEEGYPEWKAAGFPVKI"
FT   gene            170632..171363
FT                   /locus_tag="Acry_3258"
FT   CDS             170632..171363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3258"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3258"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28873"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTE1"
FT                   /protein_id="ABQ28873.1"
FT                   /translation="MILRQLLHTDPTAASYLLGCVGKGAGVVVDTLFPIEPYLHAASAS
FT                   GSPIHLVIDTHLHADHRSAGRALAEAAGAEYAIHESAEVSYACRRLADGERLELGNVVL
FT                   EVLHTPGHTPEHLCLTVTDRTRADEPWSVLGGHTLMVGDVGRTELATDAARGARDLFTS
FT                   LARLKALPDHIEVLPGALAGSVCGRGLSGKPVSTIGFERRHNPAFRIDDREQFVAFMLE
FT                   NIPPPPEGAAELRAWNSGFTA"
FT   gene            171369..172604
FT                   /locus_tag="Acry_3259"
FT   CDS             171369..172604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3259"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3259"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28874"
FT                   /db_xref="GOA:A5FTE2"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTE2"
FT                   /protein_id="ABQ28874.1"
FT                   /translation="MTNASAHIRGIAANRCQFTLQALQVFFVGLVIGMERAVLPTLAHE
FT                   FGVAPGAFLFLASFVLSFGLVKGALNLVAGGLADRFGRKPVLIAGWIAAIPIPLLIWAA
FT                   PNWWWIVIANVFLGISQGFTWTMTVTSQIDLAGSHQRGLAVGINEATGYVAVGIAGACA
FT                   ALLAEAVGARDALMIFGMATIGLAFATITRVRDTLAWVKAEHAEADAGASQDHTLTLRA
FT                   IFVRISFRDRVGRAICQGGVVNKIADTLVWVMFPLCFKAHGAKLIEIGWLTGTYATVWG
FT                   VSQLWTGHLGDRVGRRTPVIAGFFLLAAGIAITAAGRDVSLWLPGAIVMGIGMALLYPN
FT                   LIAAMSDQAAPLIRGKALGTYRYWRDTGYALSALLLGLIAQFAQATLPTLWITAILVAA
FT                   SGGWLMRDLSRK"
FT   gene            173493..173891
FT                   /locus_tag="Acry_3260"
FT   CDS             173493..173891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3260"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28875"
FT                   /db_xref="GOA:A5FTE3"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTE3"
FT                   /protein_id="ABQ28875.1"
FT                   /translation="MVESFMKNIFGCINLANSRNARTRIMEVRRKSPGIDAHGTGSLSK
FT                   IQVEPPRQPDQRTQGMLKHRPPNHAEVFAVWIQLMQIDVGVISRLSAAARYIRHEDAER
FT                   LAWPKAALLIFLVSIAAWAVILALFIWF"
FT   gene            complement(174594..174902)
FT                   /locus_tag="Acry_3261"
FT   CDS             complement(174594..174902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3261"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28876"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTE4"
FT                   /protein_id="ABQ28876.1"
FT                   /translation="MMLLTEGQMSDHKGATMMLPTLPLARELLADRGYDSDAFRAALLE
FT                   RGITPLHSINPEQERAATARQGALPAAPPHREHVRSAQGQPPLRLAPGTRPITASGV"
FT   gene            complement(174947..175102)
FT                   /locus_tag="Acry_3262"
FT   CDS             complement(174947..175102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3262"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28877"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTE5"
FT                   /protein_id="ABQ28877.1"
FT                   /translation="MFSRIFAALAAEADTPERLMFDATHLKAHRTTACLLQEGLFPAVS
FT                   GGPRGA"
FT   gene            complement(175195..175518)
FT                   /locus_tag="Acry_3263"
FT   CDS             complement(175195..175518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3263"
FT                   /product="Antirestriction protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3263"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28878"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTE6"
FT                   /protein_id="ABQ28878.1"
FT                   /translation="MIADKLGIGHDPGQHAAYVGSWIKALQQDAREIFRAAADAEKISG
FT                   YLMALRAEQKAGQAVGRGDSQAGEQARGYWQRAAESGAEIRRAERTEQPEQERQARRTT
FT                   AGR"
FT   gene            175771..176982
FT                   /locus_tag="Acry_3264"
FT   CDS             175771..176982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3264"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3264"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28879"
FT                   /db_xref="GOA:A5FTE7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTE7"
FT                   /protein_id="ABQ28879.1"
FT                   /translation="MPQYLQTCIEPYLDSFAESFAAENYTAGTVKTYQSILRKVGHAMD
FT                   VEGISPSALTLDMAEHLGRKVPRKKTGSVWPYRLARRFAQHLLDIGVTQPVPLTEAQQA
FT                   RATLLANFETYLVKHRGLSPRTIYHTLRFANRFLDHRFGDAIVDPGRLRPADVISFIEH
FT                   VLAGARRDKTVATHVRIFLQYLFGSGATATNLALSVPRAAKRWGARLPRHLSPEGVEAV
FT                   LACVRDSPRHGARDYAMLLIMARLGLRAAEVIAIQLDDIDWRAGELLVRGKGKLHDRVP
FT                   ISAEVGEALCRYLREERGPASCRTMFVTHRAPYRPFKDSQIVNAVLKDALKATGQKPVT
FT                   PYVGSHLLRHSLATQLVNSGASLDEVGDVLRHRSRTSTMIYARLDIDGLRSVAMPWPVA
FT                   GGAQ"
FT   gene            176979..177920
FT                   /locus_tag="Acry_3265"
FT   CDS             176979..177920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3265"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3265"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28880"
FT                   /db_xref="GOA:A5FTE8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTE8"
FT                   /protein_id="ABQ28880.1"
FT                   /translation="MSLTFQLDRYLAVRRRLGYDLSTSERILRRFTRFADSERVTHIDT
FT                   ALFLRWHATLGEANGMTRAARLTAVRLFAQWLSSFDPAHEPPPRGLLPDTVMRSRPHIY
FT                   SNAEVASIIAAAKALPSICGLRGLTCSTLFALIAVTGLRISEALALDGNDLDADNGVLR
FT                   VRQGKNGKERLLPLDPSTVERLLNYRIERDRLIGHPAVPLFVTDKATRLTDCTARYNFA
FT                   QACQQIGLRSEQQYHRHGRGPRIHDLRHTFAVRTMIDWYRTGKDPAREMIRLTTYLGHS
FT                   SPSRTYWYLEAVPELLDLAIARATASGGEMAQ"
FT   gene            177917..178909
FT                   /locus_tag="Acry_3266"
FT   CDS             177917..178909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3266"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3266"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28881"
FT                   /db_xref="GOA:A5FTE9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTE9"
FT                   /protein_id="ABQ28881.1"
FT                   /translation="MNAVTLPALIQRFFTDRLCTQLEASRHTVAGYRDTFRLLLRYASA
FT                   RRKKPPVNLTVEDIDADLVADFLAHTETARGNSARSRNTRLAAIRSFFRFVAMTDPTWL
FT                   LHCQRILAMPNKRYVKRAVTFLDAEEMAALLAAPDRTTWAGRRDHALLLLAVQTGLRAS
FT                   ELVGLTRGDVVLGTGAHIRCMGKGRKERATPLRRETAKLLATWIGNDKDEGKPLFPSIR
FT                   GERLSRDALEHLVRKHCLTASRACPSIGTKQVTPHTLRHSTAMDLLHHGVDPAVIALWL
FT                   GHENVETTQIYIHADMRMKEKALARVAAPATPSGRFRPDDQLLAFLEGL"
FT   gene            complement(178677..179702)
FT                   /locus_tag="Acry_3267"
FT   CDS             complement(178677..179702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3267"
FT                   /product="domain of unknown function DUF1738"
FT                   /note="PFAM: domain of unknown function DUF1738"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3267"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28882"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTF0"
FT                   /protein_id="ABQ28882.1"
FT                   /translation="MRKRHSMRRMPGSPMRTWRIPTRPPMAGDYAQTVAASIVKQLEDG
FT                   TAPWVKPWEPSGLRFIPYNAITGKDYQGGNAIWLMAVAEMKGYSDPRWTTYKQAQSLDA
FT                   QVMKGEKGTLIQYFKKFDRVPVKDEQGRPVKDAEGNQVYRSVELERPRVFSAVVFNAEQ
FT                   IAGMPKIEARPALAEWERHAAAEQIMSNSGVPIIYRPGDRAFYTLAQDRVTMPEREQFK
FT                   TADRFYSTALHELGHNAAIRIMPHGLRWRPDSPALAMRLFGIIRALPGTRGVDRRAGTG
FT                   PTAWLERRRERAPFPSSACRHGCRFGWSRRSRDQARARSPQDQRRGGAGPSPCCGAAYV
FT                   A"
FT   gene            complement(180289..180699)
FT                   /locus_tag="Acry_3268"
FT   CDS             complement(180289..180699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3268"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3268"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28883"
FT                   /db_xref="GOA:A5FTF1"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTF1"
FT                   /protein_id="ABQ28883.1"
FT                   /translation="MIFIDASALIAMIAGEEDADMLADLLAQERTRLVSPVAMWEATAG
FT                   LCRSFGLSMDGARQKVKSFMSALGIEVISLGEREYDLAIQAYADFGKGRHPAALNMGDC
FT                   FAYGAAKSYRAALLFKGDDFSKTDIRRAEMNL"
FT   gene            complement(180696..181016)
FT                   /locus_tag="Acry_3269"
FT   CDS             complement(180696..181016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3269"
FT                   /product="Rv0623 family protein transcription factor"
FT                   /note="PFAM: Rv0623 family protein transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3269"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28884"
FT                   /db_xref="GOA:A5FTF2"
FT                   /db_xref="InterPro:IPR011660"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTF2"
FT                   /protein_id="ABQ28884.1"
FT                   /translation="MFWWISLLQAEYRDISKQIFEYLEAPMPLYIRDDATAELVAKLAK
FT                   ERGLTKQDAVRLAVQAELDRTREAKPLRERLREWREANPLPPPTGLKADKAFFDDLSGE
FT                   GE"
FT   gene            complement(181131..181652)
FT                   /locus_tag="Acry_3270"
FT   CDS             complement(181131..181652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3270"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3270"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28885"
FT                   /db_xref="GOA:A5FTF3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTF3"
FT                   /protein_id="ABQ28885.1"
FT                   /translation="MSYLPLSEPEPLTADHDVSEFSCGKSPLDHWLKSRALSNQQKGFT
FT                   AVVVVHEAGRVVGYYGLAPTAIVPTVLPRSIRTGQPPNPVPCMLLGQLAIDTRWAGLGI
FT                   GTGLVKHALQRCVQAASLIGGRALMVNAVDREAAEFWRRRGFEQSRDDPLVLLRSIGDI
FT                   AASLGVRGGN"
FT   gene            complement(181649..181948)
FT                   /locus_tag="Acry_3271"
FT   CDS             complement(181649..181948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3271"
FT                   /product="Uncharacterized protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3271"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28886"
FT                   /db_xref="GOA:A5FTF4"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTF4"
FT                   /protein_id="ABQ28886.1"
FT                   /translation="MATVAERKEYPISMRLPEADVAMIDRAASLRGRSRTDFVRDAAVR
FT                   AAEEVVMEQGLIRMSAEGFAEFMDVLARPAAPVPEMVEVLKRPAPWEPGYVAKR"
FT   gene            182342..182608
FT                   /locus_tag="Acry_3272"
FT   CDS             182342..182608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3272"
FT                   /product="WGR domain protein"
FT                   /note="PFAM: WGR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3272"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28887"
FT                   /db_xref="InterPro:IPR008893"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTF5"
FT                   /protein_id="ABQ28887.1"
FT                   /translation="MQLALFPEQIRLIRVRPEHNEKRYYQIEIVTDLFGAVGLARTWGR
FT                   IGRSTHSRFDPLPDLGTAIDALRRLARAKRRRGYQDYPSTGWF"
FT   gene            182886..185081
FT                   /locus_tag="Acry_3273"
FT   CDS             182886..185081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3273"
FT                   /product="helicase, RecD/TraA family"
FT                   /EC_number="3.1.11.5"
FT                   /note="TIGRFAM: helicase, RecD/TraA family; SMART:
FT                   Helix-hairpin-helix DNA-binding, class 1; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3273"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28888"
FT                   /db_xref="GOA:A5FTF6"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTF6"
FT                   /protein_id="ABQ28888.1"
FT                   /translation="MASRPADTAPAQAPDREVLAGLVERVTFHNAENGFCVLRVKARGH
FT                   RDLVTVIGHAATISAGEWLTASGEWVNDRVHGQQFRSKFLRTSAPTTAEGIERYLASGM
FT                   IRGIGPVYAKKLIRAFGDTVFDVIEAKPERLREVPGIGAVRAGRIVNAWAEQKVVREIM
FT                   VFLHSHGVSTARAVWIFKTYGADAVQVMSENPYRLARDIRGIGFRTADAIAEKLGIARD
FT                   AMIRVRAGIGHALATAMDDGHCGLPAGELVSLAETLLEVPAPLIGTALDLELAEGTVIA
FT                   DQVAGTDCVFLAGLYRAEQGIAERLRIIASGATSWPSIDADKAIGWVESHLGMNLAASQ
FT                   SEAVRLALTAKLLVITGGPGVGKTTIVRAILRILAAKSVRILLAAPTGRAAKRLAETTG
FT                   FEAKTIHRLLEVDPASGGFRRGVDHSLECDLLVIDETSMVDVPLMHALTRAIPDEAALL
FT                   VVGDVDQLPSVGPGQVLADLIGSGAVPVVRLTEIFRQAAASRIITVAHSVNRGEIPDLG
FT                   RADPESDFHFVAADEPETAVERIVELVKTRIPRRFRLDPIRDIQVLCPMARGGVGARSL
FT                   NITLQAALNGAAEPRVERFGWTYAPGDKVMQIENDYDREVYNGDIGFIARVDAEAGEIA
FT                   VGFDGREVVYGLGELDALVPAYAATIHKSQGSEYPAVVIPVLTQHYVMLQRNLLYTGIT
FT                   RGRRLVVLVGSRRAVAIAVRNISGRRRWSKLREWLGQ"
FT   gene            complement(185171..186562)
FT                   /locus_tag="Acry_3274"
FT   CDS             complement(185171..186562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3274"
FT                   /product="replication protein C"
FT                   /note="PFAM: replication protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3274"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28889"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTF7"
FT                   /protein_id="ABQ28889.1"
FT                   /translation="MDTVQRGERVGLGHAPGLRKLTPKMLETIEVAETHRFTSEMLPGQ
FT                   VLAAFKAAAPHLGLRPSVVHAIDWLFRFTNAVDWQPSSRPIVWPSAIMQQQELGLGPSQ
FT                   VKNLNRHLVELGLVVMKDSPNGKRYGRRDSKGRIIEAYGFDLSPLASRFTEFRAVAEEG
FT                   REERARLQALKRRATIARNGIRQLLDTAVEQGISGEEWETHRVASAVASRGIAGRNRSI
FT                   EMEMAVAGLEQALSDMRRYLEFVLDARRTKEAQESTELVNLGPKGLENCPHITTTNHLQ
FT                   NLKDTVFASKKSSHSPVLPGKDRPSKGLGNHLNSSKTAHEQQRPGKVRMDTGSLLKITP
FT                   MELIKLAPRLKTYLNNQTPTWPEIVDAADWLRDEMGISKFIWGDACLVMGREQAAIAVA
FT                   VVSAKPLDHFRSTPGGYFHGLISKAKIGELHLARTIWGMRGAGERHPKCDRDHLPPSPD
FT                   PRSYV"
FT   gene            complement(186750..187718)
FT                   /locus_tag="Acry_3275"
FT   CDS             complement(186750..187718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3275"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; RepB plasmid partition"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3275"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28890"
FT                   /db_xref="GOA:A5FTF8"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR011111"
FT                   /db_xref="InterPro:IPR017819"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTF8"
FT                   /protein_id="ABQ28890.1"
FT                   /translation="MGRKHLLEHLISPPETSASAPQAIRKPMPRGVGLVGAMSESVETM
FT                   VADLRDAKEKLETGDVIVEIDTDLIDPSFITDRIGEDDEMDAFVATIRDQGQRTPILLR
FT                   PHPESRGRYQIAFGHRRYRALKRLGRPVRAMVKHLTDEELVVAQGQENQDRLDLSYIER
FT                   ALFAARLEARQFQRDVICLALSIDKTEVSRMISIATALPAELVEAIGPAQKTGRRKWMI
FT                   LAKTVKEIRWPTEMERLLQVCKSGGAADSDQRFDLVLKALSRCKSPAQADDQGGGRHSF
FT                   TVDKKPGVIRIRFDETSLPKDMVEDLMSRVRHVCTSFGAKT"
FT   gene            complement(187721..188953)
FT                   /locus_tag="Acry_3276"
FT   CDS             complement(187721..188953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3276"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="PFAM: regulatory protein, MerR; Cobyrinic acid
FT                   a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3276"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28891"
FT                   /db_xref="InterPro:IPR017818"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTF9"
FT                   /protein_id="ABQ28891.1"
FT                   /translation="MPSPKQRAVDTSSTDTTVGRTMLHDLIAGDATGLSEKLQEHRLKL
FT                   FPPKAQKTLRRFTSTETAKIVGVADSYLRQLSIEHKGPTPQTTAHGRRSYSFADIRALR
FT                   EFLDESGKGDRRYLPHRRPDQHLQIICVANFKGGSAKTTTSANLAQYLALRGYRVLAVD
FT                   LDPQASLTALHGLQPEFDLGPDETLYGAIKYGEGRRRTAEVVRETYFPGLDLIPGNIEL
FT                   MEFEHESPIAMAEKRAGATMFFSRVSQALAEVADRYDVVILDCPPQLGFLTLSALCAST
FT                   ALLVTVHPEMLDIMSMCQFLLMTSELLGVVAKAGGDMQYDWMRYLVTRYEPTDGPQTQM
FT                   VAFMRSLFGERVLTNAMVKSTAISDASITKQTLYEVPREQFTRSTYDRALESMNQVNAE
FT                   IEALVEKAWSN"
FT   gene            complement(190843..191970)
FT                   /locus_tag="Acry_3277"
FT   CDS             complement(190843..191970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3277"
FT                   /product="phage integrase domain protein SAM domain
FT                   protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3277"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28892"
FT                   /db_xref="GOA:A5FTG0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTG0"
FT                   /protein_id="ABQ28892.1"
FT                   /translation="MPDDTEIAPREIPDAPSAGSLVPSPPPLAGDGHAVRRWFSEIEDE
FT                   PVPVADGTLAGARSAASAYARRAKADNTRRAYRAAVRVWCLWCDRHGLTPLPASGADVA
FT                   AFLADERGRGVSTETLKLRRAAIRYLHRLAGCPVPTDDACVAETMAGIQRDAASRGEIR
FT                   RKKVAATATVIRRLLAPIGDTELTDLRDRALILVGFAGALRRSELAGIRIEHLTPSERG
FT                   LRLTLPQTKGSQTEAVTVALPYGDTELCPVHALERWRVAAGLQRGPLFRRIWSPPSGRK
FT                   GRERTEPPGPVIGEQALTPQSVALIIQRRAMAAGFGRRDLGGHSLKRGALTTGMERGVH
FT                   PARLKRLGRHKSYDVLGEYLEFGDIFDGHPLDGVL"
FT   gene            complement(192085..192663)
FT                   /locus_tag="Acry_3278"
FT   CDS             complement(192085..192663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3278"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28893"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTG1"
FT                   /protein_id="ABQ28893.1"
FT                   /translation="MKHIADRFVVVLDANVLYPFRMRDILLCFYHAGLFRGRWSKSILE
FT                   EWTSNLLAEKPGLHHSIRSQLQKMSFEFPEALVTGYESLIGSLDLPDQNDRHVLAAAIR
FT                   CGAQHIVTQNLNDFPPEALEPFSVEAIHPDEFLSRTFELYPTEATEILGKLRRSYQNPP
FT                   YTPSEFVLDLTAKGLPKLASQIRPMRSFL"
FT   gene            complement(192660..193109)
FT                   /locus_tag="Acry_3279"
FT   CDS             complement(192660..193109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3279"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3279"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28894"
FT                   /db_xref="GOA:A5FTG2"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTG2"
FT                   /protein_id="ABQ28894.1"
FT                   /translation="MAKAATDLTHRLPTSDEVRSANDAAIALARAKSRDGALILGEGSS
FT                   EQLRLAPAISELLVDILGHIARGEMVTFVPVGSMLTTQQAADLLNVSRPYLSGLLKNGE
FT                   IPFVPIGSHRRVKFEDLIAYKNRRDSSRETALDELARLGQEFDAS"
FT   gene            complement(193143..193394)
FT                   /locus_tag="Acry_3280"
FT   CDS             complement(193143..193394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3280"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28895"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTG3"
FT                   /protein_id="ABQ28895.1"
FT                   /translation="MPDDTAFAPQDRPDTPSAGSLVPSPPPLAGNRFLQLGRLKKCRQP
FT                   TARSPTHTTPAPSDISDMSFTLITPFSFISLVGEGLLP"
FT   gene            193781..194983
FT                   /locus_tag="Acry_3281"
FT   CDS             193781..194983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3281"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28896"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTG4"
FT                   /protein_id="ABQ28896.1"
FT                   /translation="MDGRRSTVSTKCLCTLTISPVRTAGPRHFMAPPEMQAQQKLMIAF
FT                   ERAAGAFARLDQALSMHPLRGAFLYRFRLDAVRRQAMVDGQLIEPWHLAALLEGVRLRM
FT                   DPWLSLAERGDIFDAARHAFSMHQWIVEPDFDQEGEIQVAMKAIERDVARASPLLGAAH
FT                   AAHAWLAGGGRRAPLRGALIRFWQQSGLLHLPVPITGPQALGGDLPFDRESWIPLLLHA
FT                   LANEAAAAQDLLRDLERAWQVARGSIGKRRKNSRAATAVDILAATPIISAKSLADRLGM
FT                   NVANAHALLGELLEAGLVVELTHRSKRRLFGLSGMGRMRDYVAPPRRPQPGRGRGRPRI
FT                   EPEMPHSAPPADLPPAPSGGVLPRLAFDFSDLEEAMAAADEAIRETRISLDRIRQAGPP
FT                   E"
FT   gene            195252..195728
FT                   /locus_tag="Acry_3282"
FT   CDS             195252..195728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3282"
FT                   /product="Beta-lactamase class C and other penicillin
FT                   binding protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3282"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28897"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTG5"
FT                   /protein_id="ABQ28897.1"
FT                   /translation="MDKGSGGSVGMSAGRLERIGAAMQGYVDRGIYAGINTVVARRGVV
FT                   VQQGQYGFRDKEAGLPMAADTIFRLYSMTKPVVCTALMTLVEEGRLRLFDPVARYVPAL
FT                   AGLTVLRPDGSRTAPARPVMVRDLMTHTSGLSYHFLEETPVGPMYADSIVRLTW"
FT   gene            195752..196462
FT                   /locus_tag="Acry_3283"
FT   CDS             195752..196462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3283"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3283"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28898"
FT                   /db_xref="GOA:A5FT10"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A5FT10"
FT                   /protein_id="ABQ28898.1"
FT                   /translation="MMALTLPARLKGYRFPRSVIAYAVWSYYRFNLSLRDVEDLLAARG
FT                   VIVCYETIRVWVDRFGPQIAAQIRRDRLPAGDKWHLDEMVITIGGEKHWLWRAVDHRGD
FT                   VLEILVQKRRDARAARRFLRKLMRRWGQPRVVVTDKLRSYDVALRTDCRSADHRSHKRL
FT                   NNRIEASHRHTRRREKIMGRFISPGHAQRFLATHDQITTLFRPKRHRLSARSYRHARAD
FT                   AFLLWTDYAANLAA"
FT   gene            196416..198830
FT                   /locus_tag="Acry_3284"
FT   CDS             196416..198830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3284"
FT                   /product="assimilatory nitrate reductase (NADH) alpha
FT                   subunit apoprotein"
FT                   /EC_number="1.7.1.1"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; BFD domain protein
FT                   [2Fe-2S]-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3284"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28899"
FT                   /db_xref="GOA:A5FTG7"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTG7"
FT                   /protein_id="ABQ28899.1"
FT                   /translation="MHFCSGPTTPPISPPDRSRLGQITPRSINLTIPSGQFLTEDYYVA
FT                   NKLMKGFIGSANIDTNSRLCMASAVAAHRRCFGEDVVPGIYEDFDEAELIIFAGSNAAW
FT                   CHPVLFQRALAARATRGTRIVVIDPRRSATAEFADLHLAVRPGGDLALFCALLAACADR
FT                   GALDRDYIARHTAGFDAALAAARQAEHGIDPAAFETLAGWVASTPRMVTAFSQGVNQSE
FT                   TATDAIGAILNLHLATGRIGRPGAGPFSLTGQPNAMGGREAGGLANQLAAHLGFDDPDD
FT                   HATLSEFWGAPNLVRRPGLKAVDLFRAVADGKIRALWIAGTNPAESLPASLDVRDALSR
FT                   CPHLVVADCWPTATTAHAHVLLPAAGWSEKDGTVTNSERMISRQRAFRPAPGAARPDWW
FT                   MFAELARRLGHGAAFAWDGPAAIFREHAALSAFRNFGRRRFNIGGLAAIPDDDYDAMRP
FT                   LRWPLAGDRLFAEGNFPTPDGRARFVAISPLRHARTDFTLNTGRLRDQWHTMTRTGRVA
FT                   ELMAHQDAATLELAPTDAARLGVLPGDLVAAGSEGARIVFPAAISPGQCEGSVFAAIHW
FT                   TAAQGSAGSVNRLTVSATDPISGQPAFKHSPVKLAAVPTLWRAIAIGRAASCAMTAGKQ
FT                   AVWSQALRPGGLALSRFTGFAPLAARSAVDAARWLLVLPEGAEFLDYADPARGVFRLAV
FT                   LDRAGVQLLLHVAPAELALPDPEALEALFAAPQAGADPTLLLGQPARATATRGRQVCVC
FT                   NAVAEPAIRAAIRAGCRSVEAIGAATGAGTGCGSCHSELKGFLRHDLVAAE"
FT   gene            198808..199593
FT                   /locus_tag="Acry_3285"
FT   CDS             198808..199593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3285"
FT                   /product="uroporphyrinogen-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3285"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28900"
FT                   /db_xref="GOA:A5FTG8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTG8"
FT                   /protein_id="ABQ28900.1"
FT                   /translation="MTSLPPNSKAHPVILAGTGPGDPDLLTLRAVRAIGAAEIILHDAL
FT                   VDARILVLAAPDAVLIHVGKRCGRHAMSQTEINRRLVECARTGARVLRLKGGDPMIFGR
FT                   AGEEIAALRAAGIAVEVIPGITAASAAAASACVSLTARGRARAVTLVTGHTADGGLPPQ
FT                   DWAALARLDSTLVFYMGSRHARAIADRLIEAGLDPATPAMLLTNVSRPGETRRLARLID
FT                   LADGIAAADLAAPALILIGAALDAAVPVATIQADARELS"
FT   gene            complement(199562..200146)
FT                   /locus_tag="Acry_3286"
FT   CDS             complement(199562..200146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3286"
FT                   /product="precorrin-2 dehydrogenase"
FT                   /EC_number="1.3.1.76"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3286"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28901"
FT                   /db_xref="GOA:A5FTG9"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTG9"
FT                   /protein_id="ABQ28901.1"
FT                   /translation="MIPIVLDPSYCRLGVCGNGPMSLRRLRALCEGGADAALLFSEDPD
FT                   AATIAEAGAALCRRMPTGDDLARLHALWIVDVPDVVRAGLVAAARAARVLVNVEDRLPD
FT                   CDFHSVAQVRRGDLLLTVSTGGQAAGLSSVLRRHLEVEFGADWAARLSEIAVLRERWRA
FT                   EGMSMPETARRIADHVEARGWLTTARGRPPE"
FT   gene            200332..200640
FT                   /locus_tag="Acry_3287"
FT   CDS             200332..200640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3287"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28902"
FT                   /db_xref="GOA:A5FTH0"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTH0"
FT                   /protein_id="ABQ28902.1"
FT                   /translation="MAAWLGLVPRQMTTGGKPRLLGISKRGNRYLRKNLIHGARAALPY
FT                   LVERDTPLGRWARGLLDRAHKNVVVVALAAKLARIAWAVLAHGCDYDAQFEAAAAAA"
FT   gene            200895..202065
FT                   /pseudo
FT                   /locus_tag="Acry_3288"
FT   gene            202096..202473
FT                   /pseudo
FT                   /locus_tag="Acry_3289"
FT   gene            202493..202732
FT                   /locus_tag="Acry_3290"
FT   CDS             202493..202732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3290"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28903"
FT                   /db_xref="GOA:A5FTH1"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTH1"
FT                   /protein_id="ABQ28903.1"
FT                   /translation="MIAGYPIDAIIAAFGAVPRIRNETVALAHISLNYTPILNILLLAV
FT                   SSLLALRFLSTGAPDMLRMMVALSEGQDHHHDHI"
FT   gene            202859..203581
FT                   /locus_tag="Acry_3291"
FT   CDS             202859..203581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3291"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3291"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28904"
FT                   /db_xref="GOA:A5FTH2"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTH2"
FT                   /protein_id="ABQ28904.1"
FT                   /translation="MVQGNKPNPARLRIVLAFGALGLFAVAGVVALAAGLSFHGLTASP
FT                   DAIVRIIRSWGAWGALAAISLMIAHSFLPLPAEVIAVANGMIFGPVWGTVITWTGAMLG
FT                   AWAAFGLARLFGRPLVETFVPARYRHTLDDWAETRGAIPLLILRLIPIVAFNLINYAVG
FT                   LARISWWTFTWTTGLGILPMTLLMVVLGDRLASVSGEAGLVVLAGVLLAWLAVKLLRKR
FT                   LPPHRPGRRSPARPRSGS"
FT   sig_peptide     202859..202960
FT                   /locus_tag="Acry_3291"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 34"
XX
SQ   Sequence 203589 BP; 37979 A; 64001 C; 62903 G; 38706 T; 0 other;
     gatgtattgg ctcgccagta atgaacgccg caaagcgggg gcagttgggt tcgactgcac        60
     ccgcgcccga tctcgccgct agtattcccc gccaggcaaa gtttggagta gttcatgggg       120
     cgggcgatga ccacaaaaac ggagccttcg ggatttgctg ggtcacctct ctgacacgat       180
     cgttcatgca gcccggacgc acgcgctact ggcgtatggt ctagccttcg tgctgaccgc       240
     ggcggaagcg tttcccgtca tcggcgcgct ggtgcctgga accgccatta ttgtcggatt       300
     gggcgctctc gtgccgacgg gcgccctgca tttctggccc ctggtggcct ggtcgacggg       360
     aggagccatc ctgggcgacg ggctgccctt ctggtttggc tcccggttcc ggcaccaggc       420
     gacagggctc tggccactga gcctgcatcc ggatctgctg ccgcgaggca aggcattctt       480
     cgagcgccat ggcgggtccg ccgttatcat cgcacggttc acgccaggcg tgcgggctgt       540
     tgtgcccatt gtggccggag tcagcgggat gcgttcgctc cgcttttatg tgctcgacgt       600
     cgtttcagcg gtcatctggg cgcccgcgca tgtcggcgcc ggggttctcg ttggcgcctc       660
     gttggccatt ctgggcgtca tggcaggcag gctcgaggcc ctgctcatcg gctcgatcgt       720
     cagcctcgtg ctcctgctct ggctggttcc acggcttctc cgttttgtga ttagctggtt       780
     ggaaagcaag cgcgggccag cgctagcctg ggcccacgcc ggcaaaggca ggattcgcag       840
     taacgtggct tccatcctcg atccggcacg gacggaactg tccggcctga tcaccctcgc       900
     cggggctctt gcgggcagcc tctggctttt gctcggcgtt ctgcaggacc tgatcgccgg       960
     agatccgctg gtttatgccg atcacgcgat tctgcatttc cttgagccct atcgaagcgg      1020
     cataccgatg gaagcggcga tggcgtgctc ccggcttggc agcggtgcgg tcacgcttgc      1080
     tgtcgcagcg gtcgcgctcg tctggctcga ccggcagagt gcgtggcgtg gtgcggccta      1140
     tggtattgcc gctgtgatcg gtgcctccct gttcaccgcg gggctcgatc ttgccctgca      1200
     tcgcgcgcca ccgtcgccga ttgcgcccgg ctggagcctt attccgtttc ccggcggcga      1260
     tcttgcaacc tcatgcgcgg tttatggcat cctgaccgtc atcgccggcc gacggctcgg      1320
     cgcgcgccca cgtattgggc tgatcacggc aacggtcctt ttcgctgcac tgcagctcgg      1380
     cagtcgggtc tatctcgggc tggactggtt ttcatccgaa ctggctgcgc tgggcttcgg      1440
     gttcgcgtgg gcggccggtc tcggcctcgc ctatgttgcg cgtccggtcg aaccggtggc      1500
     accctggcgc ctcgtcgcca ttacggcggc tacgctcgcc atcgccggta cgctggcggt      1560
     cgccctcaac cgcaatgccg atctggcgcg tcatgacgtg gggcgcatga gcacgacgat      1620
     gacgtgccct gactggcttc aacacggttg gcaaaacctg ccaacacgca gcctcggcat      1680
     gctcggcagt ttttccggct cactgacgat ccagtggatt ggcccggccg acgggcttcg      1740
     gcacgctctc gcccagctcg gctggcgctc gcccgcgccc tggacatttc gcaatgctct      1800
     tgaatttcta gccccgcacg caagcccagc cgagatcccg gcgctgccac gctgggatga      1860
     cggccgacgc gcagacctga taatggtttt cgtcggacac ggccttgccg ccgataaacg      1920
     gctggtgctg cgcctctgga agacgagtgt atctgtaacc atgccgacag gatcggtacg      1980
     gacgctcagg atcggggaga tcgagatgca aaggctgcga aggatggtct caaccctgac      2040
     aatccctgtc tcggaaggtt ccgcttctac cgtcctgcct cgaatcgcgg cggcattgcc      2100
     tgcctcgcgg ctggtgacgc gtgccgccga tggcgccacc gtcctgctcg ccggtgatcg      2160
     tgccgtggat acggagggat gcctgacgca gcaccgtggg gacggtgcgc aatgagggtt      2220
     cttatcgtcg aggacgaggc gaagaccgcg gcttatctcc gaaagggtct cgaagagaac      2280
     ggcttcacgg cggatgtggc tactgatgga gagacggggc tcgaattcgc ccgccacggc      2340
     ggctacgatg ccattattct cgacatcatg ctgccacggc gcaacggctt cgaaatcctc      2400
     gacgaaatcc ggcggcgaga cagtcagacc gccgtgcttc tactcacggc gcgggaccag      2460
     gtgacagatc gcgtcgccgg gctggaggcc ggggctgacg attacctcgt caagcccttc      2520
     gcgttttccg agctgcttgc ccgtgtgcgc accattctgc ggcgagggca cgcgcggcaa      2580
     ccggcgctga tccagatcgc cgatctcgag atcgacctct cgggacaccg ggcaacgcga      2640
     gcgggtcagg cgctcgatct gacgccgaag gagttccgcc tgctttcgtt gttggcccgc      2700
     cgcgcgggcg atgtcatctc ccgaacggtc attgccgaac aggtctggga catcaatttc      2760
     gattctggca cgaacgtcgt cgacgtccac atgtaccgcc tccgcgccaa gctggacgac      2820
     ccgttctccc gccgcctgat ccacaccgtt cgtggcgtgg gttacgtgct cgaagactgt      2880
     ggcggctgat cctgaagcgc cgagcgctgg cggatcgatg tccctgcgga tgaccgcgtg      2940
     gtatgcaggg acggcgttcc tgctcgtcct gctggccact agtctcctga cctggtcgtt      3000
     tggcgcgcgc atcgccaggc aggaagaccg cacgctgcac gtgctcgcac agatcgcccg      3060
     cccgctgggc ggcgctgccg atccgtccgc atcgcaggcc attgcatcgg cgcttgagcg      3120
     agcgggcaac acccgcgaga tccagttccg cgtcatcggc ccgcacggtc ggatcacaat      3180
     ccagtcaaag ggcaatcatc tgcctctgcc atcatcggtc ggcttgccga acgtcgccac      3240
     gcttgatagc ggcgggatgg cgtttcgtgt tctcacccag cccctgccga acggcttcat      3300
     gctgcagatc gccatcgcca gccccggctc gcaggccctc ctgctccgtt accgcgaaac      3360
     ccttaccctg attcttgcgg tgtcgatcat cctctgcgcc gtgctcggat atctcatcgc      3420
     ccgttcgggc atgcgcccga tcgagcgcat tgccgaaacg gccgaaaaca tccgcctttc      3480
     gaccctgcat gaacgtctcg acgtcgcagg gcttcccgcc gaactcgccg cgctcgccaa      3540
     cacgttcaac ctgatgttgg accggcttga gcaatccttc ctccagctct cccaattctc      3600
     ggctgacctc gcgcacgagc tgcgcacgcc gatcagcaat ctgcgcggcg agctggaagt      3660
     tgcgttatcg aggccccgct ctgacgatac ttatcgggaa gtcctcggct ccgcactcga      3720
     ggaatgcact cgcatcagcc gggtcattca gagcctcctg ttccttgccc gcgccgagat      3780
     ggtcggggct ccacccgccg ttgaagctct tgatcttgcc agcgagatcg caacggttct      3840
     cgaattctac cagccgatgg cggcggaggc ggggctgtcg ctgaccgccc gcgtccgccc      3900
     gggactaccg atcaggttcg accgcattct cctccagcag gcgctcggca atctggtggc      3960
     caatgcaatc gcccataccg gcaccggcgg gcagatcacc atcgaagttg cggaggtgct      4020
     ggaacagctc tccatccgca taaaggatac cgggcagggg atcgcacccg agcatctgcc      4080
     gcatgtgttc gaccggttct atcgcgccga tcccgcgcgt tcgcatgtcg gcggcaatct      4140
     cgggctcggc ctcgccgtgg ttcgcgcgat catggacctg cacgggggcc gggtttccat      4200
     tgaaagcacg cagggtcagg gcaccaccgt atcgctactg gtggcagcga ccgcgcgcta      4260
     atcccgaaac ggtgagccca aactgacgaa atcgtcattc tggcgaggcg gaaacgtcat      4320
     tctcgccggc taaagcgcga actcttttcc gcttgaagcc atgaagaaaa cgtcccgaca      4380
     cctccgtttc agacccagcc gcgtcggtgc tcttgcgctt gcgacactgc ttgccggctg      4440
     tgcgcggtat cagccggcgc cgttgcatcc cggtacttcg gccacggcac tgctcggccg      4500
     ccgtctcgac gagccggcgc ttggccaatt cctcgcggct atgggcgtgc atccgcgcgg      4560
     acactgggga ttgcgggctc tgacgctcgt cgccgtctat gagcggccag atctgcggat      4620
     cagcgtcgcc gcctataacg ccgcgaaggc ggcggtgacg acggcccagc agatcccgaa      4680
     ccccacgctt tccctcgcgc ccagcttcaa cgcgacgcaa gccttccctt cgccaatcaa      4740
     gatcgggccg gtcatcagtt ttctcgtctc caatctcggt gctcgcgagg ctggcatcgc      4800
     cgccgcgcgg gatcgccagc aagccgcgcg aatactcatc gctgccgcgg catggcggga      4860
     acgcagcaac gtccgcaacg cgctgctcac actctggctc gatgaacgga tcgccaggat      4920
     caaggcgcgc gtcgccagct atgccgcgac agcgtcccgc ctcgtagcac agcgcgtgac      4980
     ctctgggatg cttgctgata ccgtgctcgc cagcacaacc gaggcggcga acaaggcaag      5040
     ctttggcgcc gctgaagcgc gggtccagat cggaatggac cgggcccact tggccgctgc      5100
     gatcggaatg ccggcggcgg cgcttcgagg taagcacctt tcattcaccg cctttgagca      5160
     tccgttgccg ccggccaatc tcgccgctct tacacgcacg gcgctggtaa ccagtccatc      5220
     agtcgtcggg gcctacaaga attatcgcgc ggccgacgct tctctccgca aagcgatcga      5280
     ccagcagttt ccaggctttc gtattggctc cgggtatcac tacgatcagg gcgctagcaa      5340
     gttcatactt gccctctcgc tgccgctgcc aattctcaac cagaatcagg gcccgatcgc      5400
     cgaggcgcgt gcaaggcgcc agcttgcggc ggccctgttc gatcgggcgc aggtgcgcgt      5460
     tctccacgag atcgacgcag ccaaggccgc tctgcaaggc agcgtgagcg ttgcgcgcgc      5520
     ggcacggcta ctcctcgcaa ccgcccgcga gcgcgaacgc caggctattg aagcttaccg      5580
     cgccggtgcg accggccagc tgcgcatggt cgaggccgaa cagcaggcaa ccctggtccg      5640
     cgaacaggag ctgaccacgg atgctcagcg attacgcgcc ctcgcagccc tggccgacgc      5700
     gctccatcac cccattttcc gggagagcca ctcatgaagc agcatctgca ggccatcgcg      5760
     gcaagcctat cacttgtttg cgccgcagct gtcgcgcatg ccgcggccct gcgcagcgtg      5820
     acgatcaatg cggccacgat gagcagcggc ctcatcaaga cgagcgtcct gcgccttgag      5880
     actaaacatc ccggcttcgc ggcttacggc atggtgatcg atcccacgcc ggtcatcacc      5940
     ttgcggcacc ggatcgtctc agcacgcgca aagctgacgc tggacgatgc aaatctcgcc      6000
     cgcgcccgga agctttatcg atctggaggt aacgtctcca aggccagcct gcagcagatc      6060
     caggctaaaa ccgccattgc gcaagcgcgt gtcgaggaat tgctggccca ggcgaaagcg      6120
     cgctatggcg ccgccctcgg agcggcgatc gccgataatg gcccctcgtt caggacaatc      6180
     agcactggcg gttcgcttgt ctcggttgtg caggcagttg ccacacttgt atccccgccg      6240
     gccgcattcg ctagggcgcc ggatgggtct cgcgtcacgc tacgccctgt cgggtctgcc      6300
     ggcaggatcc cgaagggctt gctggggcaa acctttttct acactggccc cgcactgccc      6360
     atcggcgcac cgctcgccat cacgctccgc gcgcctggcg ttgtcaccgg ctacgatata      6420
     cccgcggctg cgctggtctg gcacgacaat gggcccttca tcttcgtccg gatcggcgcc      6480
     agccgtttcg cgatgtaccg tgttaccaga tcgcacccgc tgtaccattc gggcaccatc      6540
     tcgggcttct tcgtgcccgg cacagacctg ccggcccacc cggcgatcgt aacggcgggg      6600
     gccggactgc tgaactcggc gctggccggc ggcgacgcat ccgctgcgaa cgacgactga      6660
     gataatctta tgctgtcccc tatcgtccgt gccgccctgc gctaccgcct cgtcgtcgtg      6720
     cttctgatct caggcttggc agccctccag ctctcccgac tgcctaccgc ccgctatgat      6780
     gtcttcccga ccttcaccgc ccccaccgtc gtgattcaga cagcggcgcc cggcttcagc      6840
     gcgctgcaga ccgagcaagt ggtcaccgat cgcatcgaac gcacccttac cggcctgccc      6900
     ggccttgcga agatgcgctc atcctcggag tcgggcctgt ccgtcatcca tctcgtcttt      6960
     cacggcggca ccgatccgta tcaggacagg cagcgcatcg ccgcgcgcct gagcgagctt      7020
     ggcggggctc tcccggccgg gatcctgccc cgcctcgcgc cgatgcagtc ctccaccggc      7080
     actgcactcg aaatcggcct ctatcccaag cgcgacatgt cgctcgaaca tctgaccgcc      7140
     atcgccgaaa ccggactgcg acccgccctg caggcggtgc ccggcgttgc gaatgtcgtt      7200
     atcttcggcg cacgcccgcc acagctggat gtcgaggtcc agccccgatc tctcatcgcc      7260
     acgggcttca ccatgcagga tgtggcgcgt gccgccaggc aaggcagcgc cgtgcttggc      7320
     gccggcttca tcgacaacgg caaccagcgg tttgtgcttg cccctcacgg ccaggcacgc      7380
     actgctgccg ccctcgcgaa gacctggctc ggcaccagcg atggtgcgcc gatcagcctc      7440
     ggcgatgtgg caagtgttcg gttgtcggca ccgcctaggt acggcgcggc gctgatccac      7500
     ggtcatcctg gcctgctgat gatcgtctcc tcgctctacg gcgcgaacac gcttgcggtg      7560
     gccgaccagg cggcccgaac ggtcgcgcgg ctgacgccgg gccttgaggc gcaagggatc      7620
     gagattgatc ccaaagcctt cacgccggct acgttcattc atgtcgcact ggccgatctc      7680
     ggccatgtgc tgctgatcgg cgcagcgctc atcctgcttg tcctgctcat cgcgctgcga      7740
     gactggcggg cctcagtcat ctcttttgtg gctatcccgg tctcgctgct tgccgccact      7800
     gcgatcatca cggccctcgg gatcacgctg aacacgatgg cgctcgcggg gcttgcgatc      7860
     gcactcggcg aactcgtcga tgatgcggtc gtcgatgtcg aaaacatcac ccgccgcctg      7920
     cgcgagaacc gtatcgccgg cagcccggaa ccaccgctcc gcgtcatctt cagggcatcg      7980
     ctggaagtgc ggagtgccat cattttcgcc agtgccgccg tcgccatcgc cttcaccccg      8040
     gtgatcgcac tcggcggtgt cgcaggccgg ctcttcgccc ccctcgggat tgcctacatc      8100
     gccgcgatcg gcgcgtcact cgtcgtcgcg ctggtcctta ctccggccct cgccgcgctg      8160
     ctcctggttc ggcccgccgc ggcagcggac cacacgccgc cgatcgcact gctgcgcccg      8220
     gcttatcgca gcgcgctcgg caggctggaa catcacggac gtgccttcat cgccggcgcg      8280
     ctcgccctga tcctgctggc cggtatcagt atcccgctgc tgcaaactcg gttcctgccg      8340
     cgctttcgag aaaacgacgt catcgtccat tatctcgccg cacctggcac gtcgatcgac      8400
     gcgatgctcg ccattggcag gctcgcgatc cacacgctcg agaacctccc ctcggtcggg      8460
     gatgtcgtga tgcatatcgg ccgcgcttcg atgagcaacg gccatgctgg ggtgaacaag      8520
     gccgagatcg acatcacgct cagcaaaacc ggcaaccacc atgtcgaacg atcgacgcgg      8580
     cagatcctgg cgtcggtcga ccatatcgac ggtctgtcct ggtggtcgcg cacattcctc      8640
     agcgagcgtg tcgatgaaag cctttccggc gtcaccgccc cggtgaccgt ttcggtattt      8700
     ggcccctccc tcgatgcgat cgacatcgca gcggcgcgga tcgtggcggc ggcacacggg      8760
     gtgcctggcg tgcgcgcagc aagcatggcg gctgtccagc aggtgcccgc cctcacgatt      8820
     gacctgaacc gcgcagcgat gctgcgatac ggcatcaccc ctcgcgcggc gctcgaggcg      8880
     atgaagatcg cttattcagg cggcaccgtc ggccatgtct atcgcggtac tctcgttgag      8940
     ccgatcgttg tcacgctgcc cgcagcactc cgccatcaac cggctgcgat cggcgacctc      9000
     ccggtcgcgg cggaaggcgg catgatcgtg cccctcgacc gtatcgcaac aattcgccag      9060
     acgctggttc cggcgcagat cctgcacaac gacggtcgac gcgttcaggt cgtcactgtc      9120
     caggttgcgc atggccaggc agccccggtg atccgcggcc tacgccagcg gcttgccaag      9180
     ctgcggctgg gcacggatgt ttacgtccgc tatggcggca cggccgttgc cggaggcact      9240
     gctcggcgcg agcttgccgt ccgcgccgcc atcgctcttg ccggcattct gatcctgatg      9300
     gcgctcgccc tgcgcgagac acgagctgtc gtgctcatca tggtgattct tccagtcgcc      9360
     ttctcgggcg gcatcgcggc gatatggacc ttcctcggcg gccatctcga acttggcgcc      9420
     atggtcggac tcgcgacgct gttcggcctc acgctgcgca acggcttgct gctcctgatt      9480
     cacatgcgcc ggctcatgga gggcagcggc aaaccatggt cagcagagat agcacgccaa      9540
     gccgcggccg accggcttcc ggcaatcctg atcaccgcct gtgtaaccgc cctcggcctc      9600
     ctcccgctcg cactggctac cggctccccc ggcgacgcca tcgaggggcc aatggcgata      9660
     gtcatcctcg gcggcctcgc aaccgcaacg atcctgacgc tgttcgtcct gccgatcctt      9720
     gcgccgcgcc ttctgcggat cgccttacct aaagccgata gcctcgattg aaggaacatg      9780
     cggtgatcgc gatccggcgg tttgatctgt caaactgggg cgcgaagcga gcgggtggtc      9840
     cgcttgttgg agccgaggga ggcaatcatg gcgcactacg caggactgga catttcggac      9900
     aaagacaccg ccattcacgt tgtggacgac aacgggaagc tggtctggcg gggcaagagg      9960
     gccagcgagc cggaggtgct cgccgcggcc ctgcgccggc atgcgcccga actcgttcgg     10020
     gtcgggctcg agaccggaca gttggcgccg tggctctacc attcgctcaa ggacctcggt     10080
     tttccggtga tctgcctcga tgcgcgccat gcacgcgtgg cgacagcgtt gcagcggaac     10140
     aagactgacg cacacgacgc tgaaactttg gcgcagttgg tccggactgg ctggtatcgg     10200
     gaggctcgtg tgaaaggctg ggccgcacac gccatgcgcc gtctggtcgg tgcccgttcg     10260
     caactcgtcg gcatttcaat cgatttgtcg aaccagatcc gcagcacgct gaagacgttt     10320
     gggctgaggg cgacaggcgg ggccggacgc gtcttcgaag cgaaggtgcg catcgcgctg     10380
     gagggccggc ccgaggtcgc cggcgtggtc gagccgttgc ttgcggcctg gcgcgccgtc     10440
     cgcgatcaga tcgccgtact cgaccgcaag ctgatggccg cggtcaaggc cgacccgaca     10500
     tgtcggctgc tgatgacctg tccgggtgtc ggcgtagtgg ttgccgcgag cttcagcgcc     10560
     accgtcgagg ccccagcgca tttccggcac tcacgctcga tcggcgccta tctcggactt     10620
     acgccccgac gcaaccagtc cggcgaaatc gaccacagcg ccggcgtgtc caagcgcggg     10680
     gaccggttgc tgcggagcta cctgttcgag gcggcggcct cgctgctggt gcgggtgcaa     10740
     agctcatcag cattgaaaac atgggggctg gcactcgtgc aacgacttgg tttcaagcgg     10800
     gcagccgttg ccgtcgcccg taagatcggc gttgtgctgc acgccatgtg gaagtccaac     10860
     cagccgttcg aggcttggca cggcgcaaca cccaaggccc gagccgcctg acggtttcgc     10920
     cagtttactg aatccgcccc tcaggcggac gcaggcgtcc tcgccggacg cgacgaggct     10980
     accccgagtt gggtcttgct gccggactat ccggaccgcg ctctcgacat ggtgggcctc     11040
     gccttcgaaa agcatgttgc ggcgaccaac gagggtcgac cccggaaaca accaagatcc     11100
     ggcgatgatg cagcaagctg caagaaagga gttgacaggt cagtcgcgat caaacaaccc     11160
     gtcggcggtg tcggagcgtt tgacgatctg tatgatccat ttgccgattt tggcgaggtg     11220
     tccattgagt ttgggaccgg catagccgcc gtcggcgaat ccgtgccgca accaaggata     11280
     cagggatttg accgatttga gcacgtcggg cgccccatcc cgatcctgaa tgccggcatg     11340
     atgaacgacg gcgccgacga ggtggccgat tgtatcggtg atgatgtggc gcttgcgccc     11400
     cttgatcttc tttccggcat caaacccgcg ctgcccgccg gtggcgcagc tcggttggcg     11460
     caagggaaca aaggggcgtc tgacagcccg ctttgccgcc atgagggtac gcattgctga     11520
     tggcgcgccc cagcgaatcg gttctgccgg tgcccagcac atgccgggag aggaagcctg     11580
     gctggtgggt gagcatcgct cgaatggcga acgaaaatat tatctctcga acctgcctgc     11640
     cgacaccccg atcagagctc tggctggcgc catcaaggcg cgctggatct gcgagcaggc     11700
     ccatcagcaa ctcaaagagg aactcggctt ggaccacttc gagggccgat cctggactgg     11760
     cctccaccgc catgccctga tgacgatgat ggcctacgcc ttcttgcaat cccgaaggct     11820
     cgctcaggcg ggacggaaaa aagagtcccc ggtccgcctc cccaacccac cctgccagca     11880
     gtgcgccaag cgggattgtc aggttgatcg aacgaggtgt gatttgaccg agacgcgatc     11940
     gatcaggcgg cgagattggc ggcgtagtcg gtccagagca aaaatgcatc ggctcttgcg     12000
     tggcggtagg atctggcgga gaggcgatgg cgttttgggc ggaacagggt ggtgatctgg     12060
     tcgtgggtgg cgagaaatct ctgggcatga cctggggata tgaaccgacc cattatcttt     12120
     tctcgtcgcc tggtgtgacg atgggatgct tcgatccggt tgttcagccg cttgtgcgat     12180
     cggtgatcgg cgctgcggca atccgtgcga agggcaacgt cgtagctccg tagcttatcg     12240
     gtcaccacga cgcgcggctg accccatcgg cgcatcagct tgcggagaaa acgccgggcg     12300
     gctcgggcat ctcgccgctt ctggaccagg atttccagca cgtcaccgcg atgatcaact     12360
     gcccgccaaa gccaatgctt ctcgccgcca atggtgatca ccatttcatc gaggtgccat     12420
     ttgtcgccgg ccggcagccg atcgcgacgg atttgcgcgg cgatctgcgg gccaaaccga     12480
     tcgacccaga cgcggatcgt ctcgtagcat actatcacgc cgcgagcggc cagaagatcc     12540
     tcaacgtccc gcaggctgag attgaaccgg taatagctcc agaccgcata cgcgatcacc     12600
     gatcgaggga agcgatatcc cttcaaacgt gcaggcagag tcaaagccat catccgaaat     12660
     cgctacgggc acacgatcac cacgtcaacc tgacaatgct ctcgcactca ttactatccc     12720
     aaagcattga acagccctgc ggcttgggcg ggtatgattc gctgagcttc cccgaaggag     12780
     gtttgcgatg acggtagcga taacgcgttt ggacttgtcg gctatggcgc tgcgcgagcg     12840
     ggcggctcgt gcgacggatg cgaaagtttc gaggcggctg ctggcgattg ctcttgttct     12900
     cgaaggctgg tctcggcgcg atgcggccga ggcttgtgcc atggaccggc agacgctgcg     12960
     cgactgggtg caccgttaca atggattggg gcctgaagga ctgagcgccg cgccgcgccg     13020
     caacggcccg ccaccccgat tgtcggcttc gcagcaggca cagatcgcgg catgggtcag     13080
     gcagggtccg gacctggagc gtgacggcgt ggtgcggtgg cgctgtgtcg acctgcagcg     13140
     gcggatcaag tccgagtttg cggtcaccct gcacgagacg tcgatcagcc gactgttgcg     13200
     gcggctcaag ttcacgcggg tccagccacg tccgtatcat ccgaagaggg acgctgcggc     13260
     acaggacatt tttaaaaaga cttcgccggc ctggtagcgg cggcgatccc ggccagggcg     13320
     gcccgtaagc cgatcgaggt gtagttcgcc gatgaggccc gtgtcggtca gaagggaacc     13380
     ctgagctatg tctgggcaga gcggggttcc cgaccactgg ctgtgcgcga caaccgccat     13440
     gattccgcct atctgtttgg tgccgtctgc ccggaatgct gtattggtgc caccatcatc     13500
     atgccggtgg tcaacagcga ggcgatggcc gagcatcttc gggaaatcag cacgcaggtc     13560
     gcgccgagcg cgcacgccgt gctggtgctt gacggtgccg gctggcatca agccggcgaa     13620
     cgtttgccag tgccagacaa tatcagcatg ctgccgctgc caccctatgc gccagagctc     13680
     aacccggtcg aaaacatctg gcaatttctg cgcggcaact tcctcagcca tcaagtctgg     13740
     aacagctacg acgaaatcct tgccgcctgc cgaaacgcct ggaacaagtt catgcagatg     13800
     ccagaacaaa tcgcttcaat tgatctgccc ccttctgagt ggtccgggat ctgttttaga     13860
     ttttggcctg aaggaggact gggatggcga ggaacgtatg gcccgccccg tccgcaaggg     13920
     gtgattttca tctggctcta atcagtctgc ttcaacgtat ccggtctcgg gcttcgaacc     13980
     cggccaagat ggagatccgc gcggcctgat cctcataatc acaccggcct cggaggccgt     14040
     tcactgcgtc aggttttcaa gccgccgttc gactgtcagg ccatcttcct ttcacctcac     14100
     gcagacatcg actgcccttt cgcgcccaac tgtgagcgct gttcgggcga ttccgtcatg     14160
     cggccgcagc cgccgcttcg aattgggcgt cgtaatcgca accgtgcgcc aaaacggccc     14220
     atgcgatccg agccagcttc gcggccagcg cgactacgac cacgttctta tgcgctcgat     14280
     cgagcaatcc ccgcgcccag cggcccaacg gcgtatcacg ttcgacaaga taaggcagcg     14340
     ccgctcgtgc gccatggatc aagttcttcc gcaaataacg attgccgcgt ttgctgatgc     14400
     cgagcaggcg cggttttcca cccgttgtca tttgccgtgg aacgagcccc agccacgccg     14460
     ccatgtcccg cccacgtttg aatgcatgcg cctcgccgac cgccgcagcc agcgccgtag     14520
     cgtttatcgt tccaattcct gggattttgg tcaaacgtcg cacagccacg tcgtcacgag     14580
     ccaactgaac gaactcggcg tcgaagccgg tgatcctctg gtcgagtgaa cgccattccg     14640
     cccgaagatc ttcgatcaac gtccggatgc gcgggctcaa cgcggcaaaa ccgccatctt     14700
     cggccaatgt ctcaagctcg gcttccagtt tcctccggcc ttgcggaacg acgatccctc     14760
     gctccagcag caacgcccgc aagtgattga tcagcgccgt ccgttccgag acgaggcgct     14820
     cccgggctcg gtgcaaagcc tggagatcag attggtcctg gctcttcaca ggcacgaaac     14880
     gcatcgttgg ccgcgtcgca gcctctgcga tcgcctccgc gtcgagatca tcgttcttct     14940
     gcgccttcac gtacggacgg acatattccg gcgacatcag ccgcacctcg tggccccgcg     15000
     cggcgaaaat ccgcccgagg tgatgagcgc cgcaacatgc ttccattgcc acaatgcacg     15060
     acccaagctc gccaacgaaa ctttccaacg ttccccgccg aagtctccgc ctcaaaacaa     15120
     cccggccggc ggcgtccatg cccaccacgc tgcaagagtt cttcccaaga tcgatgccga     15180
     gaatcatgat atccatcggt ctgctcctct ctccaaacca gcggcgatac tacccgatcg     15240
     ccacgagagg ggcgggccat cccataatca caagccggaa gagatcatcg gcaagttgcg     15300
     cgaggctgag attgttctgg cgcagggcgg gacggttgcg gatgcatgcc gtcggatcgg     15360
     cgttaccgag cagagctatt atctctatgg acggctctcc cgttgcaagt agattttgaa     15420
     tgatcctgcg tgatcagttg caaacatcta tccggcgtca gccggccttg gccggagcgc     15480
     ccaaatggca aatccgcacg cgcgcacctc tacagctggt aggcttcgga agcctcgata     15540
     atagtcaggt tcgtcacgcg ccggttcgat cagtgcagcc catttctccg tctacccgca     15600
     aactgtagtc caaccttcag gcggccgggc ggtacggttc gcccgttcgc agcacggccc     15660
     agatgatccg tgcattctta ttggcgaccg caaccgttgc ccggttgaag ccccgccgct     15720
     cctgaagctg ggtgacccat tggttcatgg gatcattcct tgtcccggca gttcgaacca     15780
     ccgcgcgtgc gccgtgaacg agcaggctgc gcaagtgctg gctcccacgc ttggagatgc     15840
     ccatcatgat ctgccgatcg ccgctcgaat gctggcgcgg gaccaacccg agccaagcgg     15900
     ccatatgacg gccgttcttg aattcagcgc catcaccgac ggcggcgacg atcgcggtgg     15960
     cggtcttggg gccgacgccc ttgatgcggg cgatacgctg gcaaactgcg ctgctcttga     16020
     acacggctgc gatcttcgcg tcgaaaatgg caatacgtcg gtcgaggtcg caaaacaggt     16080
     cccagagctc gccgattgcc tcccgggcca tcgccgtcag ttcattgtcc ggattggcca     16140
     atatctccgg aatcattcgc cgcgcgcggg tgatggactt gccgaaggcg atgccgcgat     16200
     caagcaggag tccgcggatc tggctgacca cagcagtgcg gtggttcacc atgcgctggc     16260
     gcgcccgatg cagggcctgg acatcctgct gctcgactgt cttcttcggc accagcggaa     16320
     tatgcggttg gcgaaccgcc gtgcagatcg cctccgcatc attgttgtcg ttcttctgcc     16380
     gacggacgaa cggcttcacg tattgcgggc tgacgatctt caccttgtgc ccgagcgctt     16440
     caaacttcct cgcccagcag aaggcaccgg tacacgcctc gatcgcgatc gtgcagggct     16500
     caataccggc cagcaccgac aacaactggt cacgcatgac ccggcgcctg aagacaggat     16560
     gccccttccg gtcgaccccg tgcagctgaa acacgttctt cgccagatca atccccagaa     16620
     catcaatcgt catggtcgct ctcctccagg ttcaacaacg gcacagcctg ccggtgggga     16680
     gggagagccg tccatcccat taggtggcgc aaggagtatg gcggcctgaa gatggaccag     16740
     gcgcgtcgca tgaaggaact ggagcgggag aacgcccggc tgaagcgtct ggtggccgat     16800
     ctgtcgctgg acaaggcgat cctgacggag gcggcacggg gaaacttctg agccccgcgc     16860
     ggcgccggcg ctgtatcgat cacatcagag gaacgatgtc tgtctccgag cggcgggtgt     16920
     gccgcgtgct cggacagcat cgatcgacgc agcgcaaggt gccacgcggg gcggatgacg     16980
     aggcggccct gaccggggac atcatcgcct gacccggcaa tatggtcgtt acggttatcg     17040
     gcgggtgacg gccttgctgc gggatgcggg atggcatgtg aaccgcaagc gggtggagcg     17100
     gatctggcgg cgcgagggtc tcaaggtgcc gcaaagacag ccgaagcgct cacgcctctg     17160
     gctcaatgac gggtcgtgta tccggctgcg gcctgagtat cccggccatg tgtggtccta     17220
     cgattttgtg gaaggacgga cccacgacgg ccgcaagttc cggatcctgt cgatcatcga     17280
     cgaggccagc cgggagtgcc tggccctgcc ggtcgcgcgc cggctcagga gcgaggatgt     17340
     gctgggcgct ttggcagaac tgttcgtcac cagagggcca ccggcgcata tacggtcgga     17400
     taatggtcct gaattcatcg cccgggcggt gcggcaatgg ctcgggaagg tcggtgtgaa     17460
     gacgctctac atcacgccag gttcgccatg ggaaaacggc tactgcgagt ccttcaacgg     17520
     ttcgctgcgc gatgaactgc tcaacgggga ggtcttctac tccctggcgg aagcgcagat     17580
     cctgatcgag gcctggcggc ggcactacaa taccgtcagg ccacacagtt cgctcggata     17640
     tcgtccgccg gccccggaaa ccgcgacgcc gccacggccg ccctccggtt ccgcttcgct     17700
     ccaccgacag ccggccatgg cggcggagac aacaatgcac taacttccaa cacggaccac     17760
     tcaatggggg ccggtcacaa tcacccaacg agactggatc aaaaaagtca tcggataggc     17820
     agattggtat aacgcctata tcctgttgtt tttgcttgta tattccaagt tgtctgtcgg     17880
     tgagagaaaa tccggcggtt caaagagttc aatgatggcg cagcaagctg ggaccgcgtc     17940
     gagcggatca tcgcccgtgt cgaggccggc gggaggacta tcacgtctcg accgtgcgca     18000
     ggctggcgcg gaggctgcat cacagacctg agacgaaacg aaataaatcg gttactaaag     18060
     caggttatat gtacccgatt gatatttcct gttttcccga ctggctatac gtttcagcca     18120
     aacttcttct tcaacccctg ttgttaattt cagtccagaa tggccccgga gtgatccggg     18180
     gttttttttc tcagggcaag gatcaaaagc aaagtggagc cggttgaggc gataggagcc     18240
     gctcttgcga gcactcgtag gagtgcttcg aaggaccgga catcatgagg tcgcatcgga     18300
     caccggcgaa gagcactgtg cgctgatggc gacgctgatc gggtccgcca ggctcagcgg     18360
     cgtcgaaccg ctcgcccggc tcaccgacgt actccaacgc atcgtcgccg gacgcaccaa     18420
     gtccgacgaa atcggcagcc tgatgccgtg gaactggaaa actcaggccg ctctgccagc     18480
     cgccgtgtag cgctcgctcg ccaaagcaag gccgtcattc agatagcgat tacgcaccgg     18540
     gcgcacgcga tggcgcacca actgacacac cagatgcacg aacagttcgg cggtcaggcc     18600
     gccctcatag gtgcagtacc agaacccgcc cttggcgttg acggccgacg cagcgctgaa     18660
     cgtctgacgc tgacccgggc gctcgacgac cggttcagtg gaaatcggca tcgagcgttt     18720
     ggtcacgctt ggggaacatg cacagcagcg tgagaccagc aacagaagag acgactgagg     18780
     cagcaaggat acccagtttc gctgcgttga gggtggcatc ttgaaatgcc tggccggcga     18840
     taaacagcgc catggtgaat ccgataccgg taagaagagc cccaccgaca agtccccccc     18900
     aggtgagccc cgccggccga atggcgacac ccgtgcgcac ccccagccat gcgaatgctg     18960
     tgacgccgat cggcttgccg aggacgaagc ccgccatcac cgccagcgag actgggttga     19020
     taagtccctt gatcgtgatc gatacccccg cgtttgcaag cgcgaaaagc ggcataacgc     19080
     cgaaggcgac ccagggatgg agcatggcct cgagcctctc gacgggcgac aacgtctcgc     19140
     gcaccgcgat accggcaacc tgcagcgccc ggttatcctc ggtatcgcca ctccaatgat     19200
     ctcccggggg ataggagagc acctttcgca agatttcccc cagacgctgg tcgctcaccc     19260
     agccagccgt cggtgtcatg agcccgagga taacaccaac aatcgtcgcg tggatgccgg     19320
     acgcattgac ggcgagccag attattgccc cagccagaaa gtagacgcgg atgttacgaa     19380
     cgccgagtaa tgccatcccc cgaattatca ccagtccgac ggcgccgagc gcaagggcag     19440
     tccagtcgat tgatcgactg taaccgacgg cgaccacgag gatggcggca aggtcgtcga     19500
     cgaccgcaag cgatagcagg aagacgcgta ggcccggagg cacacgcgaa ccaaggagcg     19560
     ccaggcagcc gatgacgaaa gctgtgtcgg tcggcatcac gacgccccaa ccatgctgcc     19620
     caggttggcc atgctgcagc gccagataca agcccatggg cacaagcatg cctcctgccg     19680
     cagctacgac cgagaaagcc accatgcgcg ggttccgaag ttcaccaagc accacttcgc     19740
     gcttgatctc gagcgcaacg atgaagaaga acagcgtcat cagaccgtcg ttgatcagat     19800
     cccgcaacga gcgcaaaaac tggaacgcac cgatctgaat gccgattggt gtctcccaaa     19860
     gagatctgaa gccatcggac cagggtgagt tggaaagcgt caatgcaacg acggtggcca     19920
     acaggagaac ggcaccactc gtggcttcga tgcgcaggaa ctgcgaaaac gagttggtca     19980
     gcgcgtcgat gtgtgtggtc ggcagttcgc cttgctgcgg tttactgttc tggtccgtaa     20040
     tcaaatcggc catctcccct tatatctcga gaaaacccac cccgcccggg gtgtcgaggc     20100
     ggttacccgt cccggcaagc ccaatttttc ccggcatcag gctgaatgcg ggcagtgcgt     20160
     gtcggaatat gccgtagcca gcactctcgc aggatgcgga tccggcgtcc ggaatccacc     20220
     cgaacggggt cggaccacac cgatcaatgg gacatcgggc cgtgaaaact tccaccaaac     20280
     aacaggaata gcacgaggat gacaatgagc agggtcagga tgccccccat agccgcgtcc     20340
     tccataataa cccgaccggt aaccggactg atcgaaatac gctctaagtg tatccgtgag     20400
     cgcgctagcc gcccgacgag gtgcgcgtcg tccaacgaat gccctcggca tcagagcgaa     20460
     aacgcaccgt aacgtttcta tccgaatggg ttactgacca atcaatcccc gcctttccga     20520
     attccttcga gagaagttgc aaccatgtca tattacggct gcgatcataa tagcctttcg     20580
     gcatcggata ctgctgtgat tgcaaggcga ctctttccac tgagcctggc ggaaatggcg     20640
     caatcatttg ttcgttggct aacatgaatt cattccttca acttgagacc atggcgatcc     20700
     tccagtcgat tttcctatcc tacaggaaac acattgcaat cttgccagta cggggtggag     20760
     cgtccgcgtt ggctgtaggc ttgatagcca attaaggagc cagcggcccg cctggcatct     20820
     cagcaaccgt taccccatga tctccctagc gatctgatac tgcaaagtac gaataacggc     20880
     gcacccctcg aaagagacgt ctacagggac actgccagag cgtgctcgca caagccaaaa     20940
     ggcacctagc tgcggtcagt attagaccca gcgatgaatg ccgccgaata gcattatcag     21000
     aaccaaggcg atgatggtta ggccgagtag ccctcaaaag ctacgaccgc tataatagat     21060
     gcaaaagtaa ccgtagtaac agtcgccacc ctacaagagg acgattggaa gtatcagaat     21120
     gatcgacgca atggatcatg attcttcgaa atgggtagca gctaggccga tgggtctcgc     21180
     tgcggacgtg attgctatac gccgacgttc gcttgtcgtc gagcaacacg gtcgccgtta     21240
     tcgagatttt ggccgacgcc ttggtagtat atgttatgcg gatcttttac acacacacag     21300
     atcatcgttg ccagggtaag gatctgcgtt atggccttgt tttggattga tttggtgcgg     21360
     gccgtcatgg cgtgtgcttt accgcgctgt ttgtgagcgc attgcctccc gaagagatgt     21420
     ccctaccgac accggcagtc gtatggcagc cgtcaagcag tggcgctacg gctatcaaga     21480
     cgagtagcgc cagtgcaatc gtgaaactct tttgcatggt aatcatcctt tccgttttcc     21540
     gtcgtaagat gacgagtgga tcccgatgtg taattggacg gttccctgaa accactgttt     21600
     gacgtaatgc ccgccccgaa cgcacaagtg tatctgcgat agtcggcggg tggtatgcac     21660
     ctagtctgac gaacaaaaat ttactcgtcg gtctggtttt aagccgacag cgtattagtg     21720
     ggcacgcaga tgtagcgccg attgtttcag cttcagtgcc aaaaaaaatt gtcgaccgct     21780
     gcgtgggttc gtcgcaattc agatcagggg caacacggca ggcggatcgc ggtgggcgtg     21840
     gtctactcga cggtgtcgat cggttgtccc aggggcgctt agccatcgcc gtatgtgctt     21900
     tgtgggcccg tctagcatac cggaacaaat ccgaagattt ggctgcattt tgtataattc     21960
     ctggtggatc cactggcggg attgtgcgcg gttggatcgc cggacaactg gcttacgatg     22020
     tggtcgtttc cgcaagcgac gtcgtcatca tggcggatac tcccgaaaca ccgtttcgaa     22080
     ggcgatcgct cgcgtgttca gttttacaaa ataggtgatt cgcgccgaca atgatagtat     22140
     cggaaattac ttagtgtccg tacgtaaaca aactgagtcg gccgattcgg ttatgcgccg     22200
     cagggtcttg cgtcgtctga atcacttgtg ttggggtgga cggcccaccg gcatcgaatg     22260
     tgccgatata aggtcgagca acgaacctaa tgaaagggcc gcctccggat ggcggatttc     22320
     gagcagccca atggcctcgc cttcaccgcc gatggcgcga cgatctacgt atccgacacg     22380
     tcactgtcgc tcggcgaggt gcccgggcat aaagccggaa cgaagcacga gatcatcgca     22440
     ttcgatgtgg gcgatggcgg catgctcttc aatcggcgct tcttctccca caccgaccac     22500
     ggctatcccg acggatttgc ggtcgatgtg cgcggctggg tgtggacgag tgtggcagac     22560
     ggcgtgcata tctggtccgc ggatcggcgc aagctgggct tcgtaccaag tcgcctgtga     22620
     actatgtgat ctagcggtgg gcgaagccga ggcttggtga gcggtttgcg gcagagagcc     22680
     atgcgaggag ggcacaaaga agcctgatca accatctgcg gagcagccgg aggttgtgtc     22740
     cgacgccggc gaggatggcg ttgatggcat caccgtcgac gccgagcagg aagttccgcc     22800
     ccagatggct gtcggtcttc atgtggccga tgacgggttc gatggcggcg cgtcggcgca     22860
     actcgcggcg gatggtgggg gtgatgccgc gtttctggcg ggatatgaag atctttctgc     22920
     cctcggcttc gacgccgtag ccgcgatagc cgcggtcgac ataggcgcgg gcgacggcaa     22980
     cgccggtgat ccgctcgacc tgctcgatct ggccggccag ggtgtggccg tcatagggat     23040
     ttcccggctg gctctgcatg ccgagaacga actgaccgcc gggtgcagcg gcgttggtgg     23100
     tggcgatgga gaccttcacg ccgaattcga agcgcgtcct ggccttgccc ttgccgatgc     23160
     actccacctc aggcgcgtgc agggaataga gcttgtcggc accgcgatcg gagcgcttct     23220
     ggcgaagcag gcgattgatc aggcccagcg tttcggcgaa cgtggccttc gcttcagcgt     23280
     tgcctgcgat cttgcgggtg atgtcacgcg ccagccggcc cagccaggtc cgcagcttgc     23340
     gcacgcgagc ctcggcctcg cggcgtttgc caccatgatg caggcgggcc gcctcctgcc     23400
     tggcgtagcg cgcaacccgg cgatacgact ggcgtagcgt gataccgtgc ttgcgcgcca     23460
     tgcgagcgag tgcctcgatg ccgcggtgca gcagcttgct gtcggtcgga tgcgtcactg     23520
     ccttcggctg gaccgtggta tcgatggtga cccgctcgta gtgcttctcc gccacggcgc     23580
     caccccgctc ggcggccgcc agcgtctcgg cgagcagggc ctccatccgc tcggacccga     23640
     tccgcttgcg ccagcgcgtc atcgaggatc gatcaagcgg cagcgtgtgc tggaaatgga     23700
     tagcgtccgt caatgtggtg gaaattctgg tgtagctgaa gcggccaatg gtcacgcggc     23760
     gacggtggaa attcgtggtg tatcggcatc gatggcgggt gccatgagtt cgaccattcc     23820
     ctcgatctgc atatagcggt tctgtgtctg ccattcgtcg ttggcctcga gcagcacggc     23880
     cccgatcagg cggatgatcg aaccttcatt gggaaagatg ccgacgacat cggcgcggcg     23940
     cttgacctcc ttgttcaggc gttcgagcgg gttcgtcgag tgaattttgg ttcggtgctg     24000
     ggcgggaaag tccatgtgcg ccagcacgtc ggtttcactg tcgtcgatga acgcgccaag     24060
     ttttggccat ttgccccgga gctggtcggc cacatggcgc agggtctggc tggcactgac     24120
     gcgatccggc tggataaacg cctgacgcaa cgctgcagac accatgctct gctgcccctt     24180
     cggcacatag gacaaggcgt tgcgcatcca gtgaacgcgg catctttgcc aggatgcccc     24240
     catcacccgg cggatcgccg ccttcaaccc ttcatgagca tcggagatca ccagtttcac     24300
     ctcacgcaac ccacggcgga ccaagctctt gagaaaggtc gaccagaagg tctccgcctc     24360
     ggacgggccg atgtgcaggc cgacgatctc gcgccgaccg tcggtgttca ccgccactgc     24420
     gattatcgct gcaactgaga cgatccgccc accttcgcgc tgcttgagat aggtcgcatc     24480
     caaccacaga tacggccact cgccggcgag tggccggtcg aggaaggcgt tcaccctctc     24540
     atcgatgtcc ttgcacagtt tcgagaccgt gctcttgctg atccccgtca gccccatggc     24600
     ctgcaccagc tcgtctaccc gccgggtcga gacgccgcca atccaggctt cctggatgac     24660
     cgcggccagc gccttctccg aggtccggcg agcttccagg aacggcggga agtagctccc     24720
     ctgccgcagc ttcgggatcc gaagctgcaa gctgccaagc cgcgtgtcca atgcgcgttc     24780
     ccggtagccg ttgcgatagg tcgcgcgctc gccgctgcgc tcgtagcggc tggcgccgat     24840
     cagcccatcc acatccgtct ccatcagcag ttgaaccacc gcctccgcaa cgctgtgcag     24900
     aaaatcgccg tccccggctt tggccagtag ctcagccagt ggtaatctat cttcggtcat     24960
     cgggttctcc aggcttcagg ttgaagtctc gcaactccac catagccgac tgatccgatg     25020
     gccacctcaa actacaccgt tacacggccc aaaagtccac cacgaccccg gacactaccc     25080
     tggaaatgcg tctcgccgca gaatgcctgg acatacggac tatcgagata gcgcgcgcag     25140
     atcgcttcgt cggacagccc atccatgtgc ttgagaagat gcagcgccac catcaggcgg     25200
     gtcggcagtg ccggacgtcc cgccgcctcg gcgtagagtg agccaaagcg ttcctcgaag     25260
     acccgccagt cgatcagccg gaccagccgc accaggggat gccgctggtc gatgatgttc     25320
     tccagccgcg agcggaacag ttcgagatca tcctgcgagg cattcagctt cggcggcatt     25380
     ctttcctcca cgtcaaacgc atgatgttcg gcatcaacgg gagagaatca cgatcgcgac     25440
     caccgcgcaa cgctccaacg gttttgcaag gtttttcccc tcaggccaca cagaccttgc     25500
     aaatcccaat attgcccgcc gctaaaaagt catgactaga tcagcaaagt tcgatttttc     25560
     acaggtgact accaacaccg gcggtcgcct cgaactgcac gtttggcggc gcggacggac     25620
     ggcggctgtt catcacagca acacaatatc tgctcgcgat cgatcttatc ggctgagctg     25680
     atgaagatgc ccgtcgggat cgcggatcag tgcgtcggca tttgatcgcc aaacgatacg     25740
     cgtggcggcg agatcatttg cgaagagagg gtgaagcgca cggccgacgg gatggcgata     25800
     gcccagcagt tcaacgtgcg gcggcttacc cgtggggttc atcggcacca catcgacttc     25860
     ggcgccgtca agcccgtcga gcgcatcctg cgtcgggcca taatttaccg tagcgcctgc     25920
     ctcgcccagc ccgtgacgcg catagaagcg tcggctggct acgacatcgc tgaccgagat     25980
     cgcgctatgg tcgatcccca tgatgccggt acccttccag cccgaattgg cacccggcgc     26040
     gaattggagc aattcgagcg gatgaccttc aggatcgcgg aacttgatcg cggttacccc     26100
     gccagcggac ttgggaagcg ttactgggcg cgctcggctg atcggcgtgg cgccggcgtc     26160
     gcgcgcgcga cgccatgcgg cctccgcatc gtcggtgacg agcgcgaggt gctggatgac     26220
     gagatcgcaa gcagtcgtgt caaccggata ggggcgtccc ggatggtcga aactttcgag     26280
     ctccacgcgg cttgggccga gcaacattgc gatgcgcgaa ccggcgcctg agaggccgag     26340
     gcgtgtgatt tcctcggcgg aaatgggcgc agcctcggcg acgtcgaaac cgatctcgcg     26400
     ataaaagaca gccaaccgcg ctggctcagc agtaacgagc cgaaagcctg ctatcccctc     26460
     gaaaatcatg tcaggtgaca tgacccgcgt ctcggtttga catgaagttg gacggtcatc     26520
     aggcagcacg gttgatcacc aatcgttccg gatctatggc ctttcttacc gttcacctcg     26580
     gtgcagccct gatcctctcc gaacgagaag tcacccggtc cctgctcgat gcgcgtaccg     26640
     tccatgcttt cgatccacca acggccagat agcacgatga tccattgcgg cgccggattc     26700
     tcgtgccagt cgcccaccca gccgaccggt tggacggtga agacaacggt cgcctcgctg     26760
     cgttccatct tgtcattcca ctgcggatcg gccgggccta cggccttgag ttgataatcg     26820
     gtgagcgcgc attgcgattg atgactggtg ccatcgccat cgacataaag atgccaatag     26880
     ggaaccgagg gccttgggcc tgccgcgtcg gtttgatcgc tcatgggtga gttccataag     26940
     gatggctgga ggcgaagggt gcatgaatga agggtgccaa ccccatcccg tccgtgccga     27000
     taacgatcag caggaaaccg gcgccgagcg ataggttttt cagaaaatcc cacaggagcg     27060
     tacggccttt gccgtcggga tcagaccaga aatcgccctg tgcccagaat tgtttatata     27120
     gaaccgccgt cgccgcgcag tagccggcaa tgacgaaggc actcgcccga tcggctatgc     27180
     cagtgacgac gccaaggctg caaatcacct ccacgaagag gccgatcagg atcatcgcca     27240
     tcgcgattgg gcgcggcttg aacatgctct gcgcctgttt gaccgcgtga ttgaagccga     27300
     aaaacttgtc gagtgcgctg aacgggagga ataacagcac gaggccatag cggaccacga     27360
     gcacaacgat tgctgctgtc gtcatagctg gtccctgatg ttatcgacca cgcgctccac     27420
     atcgtcgatc gcaattgtcg aatttaccgc tccgatatcc gctgcgggtc ggatagatga     27480
     acagccattt ccagtcgagc cccaccgcca gaacttcgag ggccggctgg ttggacgcaa     27540
     tacgtcgata gggatcaagc gtgtgagtat agtgccagag caagaagccg agaccgatga     27600
     cgatgccgat cggcgggacc agataaagcc ttcgatagtc caggaaaaat cccgcttcgg     27660
     cctgaacgcg ctatgcttgt tggacagtcg ataatgccaa gcgatgagtg gagtgagcag     27720
     cagcaccgga cagcaacgaa gaccagcacg atgccgacga tgacgtagag gtgccattgg     27780
     ctcgcagcga tcggaccccg catgattcat cacatcgaac ttcagcgcgt cgcatccggt     27840
     gagcaggaac ggggacagta tcgcgaaaag caaaggctgc cccttcgata ccttgatccg     27900
     gaagctcgtt gattcacaag ccgggatcag aacgagccag cgtttatcag acccagattg     27960
     gtaaaggcct gaagaatttt tccggtcaac ctgcggcctc attttccatt gtccgcgttt     28020
     ccagatgcag ccctttttgc cgcctcatcg aaattgcgcg tataggcttg tgccgcaagc     28080
     aggattgcct cggattgcgc cggataggtg tgtgccacct ctgccagcgc cttcatgccg     28140
     atgccggcgc tcattatgac ggccatctcg ttaatcaact cgctcgcccg cgaggagacg     28200
     atggtcgcgc ctaaaatcct gtcggaccct tccgatatgt ggatcttgac gaagcccgtg     28260
     tcccgtccat cggtgatcgc gcgatcgacg tcgtgcatca tcacggtgaa actcttgatg     28320
     ggaatcgatt gctggcgcgc ttcccagacg tgcagaccga tatgcgcgat ttcgggatcg     28380
     caataggtgc accagggtat gaccaagctg ctttgtcgct gttgtgcctg catcagcgca     28440
     ttccgaaccg ccatgcgcgc tgaggactgt gcggcgttgg tgaatttaag cgccaagcag     28500
     acgtcacctg cggcgtacac atttggattt gtgctgcgca gaaaatcatc aactttgatt     28560
     ccatggtcct cgtcaaaagt gacgccggcg gctgcaagat tgagcttttc gacatttgga     28620
     acccggccga tgctcaacag gatttcgtcg gcttgaatgt cgccctttac atcgttattg     28680
     acggtctcca gaatcttgat gccgttcacg cgccgcgccc cgaccaccgt ggtgttcaga     28740
     cggatatcga ctccatcgcg cgccatggag cgggatagga tttccgcggc gtcacgttcc     28800
     tcgcgaggca ggaatttcgg atcgttctgc acgatggtta cgtgcgatcc cagcccgcaa     28860
     aaggcttgcg ccatttcgca acccagcggg cctccgccga tgatggcgag acgcgtcggc     28920
     agtgctgcca tctcgaagat cgtcgcgctc gtgcgataac ccgtctgatc gaggcccgga     28980
     atattgggca ccccgggacg cgcgcctgtg gcgatgagcg cctttttgaa atgcacgggc     29040
     gcgtcgtcca caaacagcgt atccgcgctc tcgaaccggg cagaaccgaa aaaaatgtcg     29100
     acacccggtt cggcgagttc gtgaaccgaa tgatatcccg atatgcgcgt ccgaatccgg     29160
     cgcatgcgcg ccatcacctt gtcaaaatcg agagacggcg cagacgggat cggcgctccg     29220
     aacgcttcgg catcccgcat cgtgctacaa acgcgcgcgg tgcagatgat tgccttggat     29280
     gggaccgacc ctgcattcag cgaatttccg cccaggcgat tgcgctcgat gagtgcgacg     29340
     gagaacccca gccgcgcggc gtactctgcc gcttccagtc cggccgggcc cgctccgaca     29400
     attgcgatgt cgtaggggtt ccgtggcacc gggtttttcc aatctgaagg gcgtaccctc     29460
     cgaaggaagc gatcctcgtc gccaggtttc gttattggga cgccatcttg cattgctaaa     29520
     gccacccgtc ttcaaaaccg gcgcgttgga gcccatcgtg cacgtaactg caatgccgca     29580
     tgatctccca gatcatatca gtgcgatgat tttcaatcat catcacgagc aggccctggt     29640
     cgagcccgta ccatcctgtg gaaagccagc cgccgtcgcc atccgacagt gtcggattga     29700
     agccgcttga aaatctgtcc tggtggcaga ctttcggatg caactcgaga agaccgcgcg     29760
     tgccggcgag cgcggcatcg gccccaaagg gcagtgttgc aagcatggcc caaggcgcga     29820
     tcgttccgtc atcgggaccg tacggtacgc cgcgcgacat gtagccgaag aagcggcaat     29880
     ccttaccgtt ctcgagcatc tccggggcgg tcgggccatc tcctgccgtt acaccccaga     29940
     agtcgcgacc ataggcttcg aacccgtatg gattgcgttc ggcgtattcg cgatgaacag     30000
     cgatggcgct cttcgtattc tcaaaatagt cgctcgcctt ctcacgcatg aactcatcgc     30060
     ggataccgcg aaagtcgatc cacgcatggg agaacaggtg cgtgaaaagc ggaccggaat     30120
     agagaacatc gcggtccagc agattttccc actgataggt cagctgccat gtaacgtatc     30180
     cggctggcgt gagcggaaag gtcggcgagc caagacctag aacgtagaga agcgccgctt     30240
     cgttgtatcc ttcccagcca taatggagaa acccacactc gggtttccat ccttgcgaaa     30300
     ggcctagtgt gccgttctgg gcccatcgcc aatcgacgcg gcgatacaac gcgtcggcca     30360
     gttcgcgaat ttcacgctcg ccactgccgt cgaagtagca tgcggccacc aggaaaccgg     30420
     cgaccagcag cgcggtatcg atcagcgaga gttcgcattg ccagacgcgc ttgcccgtct     30480
     gcatgtcaat aaagtgataa tagaagccct tgtagccggt cgcgtcgggt gcatcgctct     30540
     gagtgctgca tgaaaagaat ctgagaacct tgagcgtgcg ggtagctgca tccgtgcgtg     30600
     acagccaacc attccggacc gcaataggat agcaggacag cgcaaacccg accacggcaa     30660
     tactgcacgg cgacccctgg cgggacgtgt ccgcgacaag gccggtatcg gcgttagcgt     30720
     agtcgatcag ataggaaaaa gccgcctgct gcaggcggat cgtgagtgcc tcgtccgaaa     30780
     gctgcgccag atcgcccatc ccggtcaatt cgagaaatgg atcgcggcga ccgattgtgg     30840
     cggcatcgac actttaatgt tcaacttccc ggagtcacca ttgaccggaa ccggttcgct     30900
     ctggaactgc gacagatgct tgagttcttc aatggtcgcg gcgttcaaat attcaggctt     30960
     gccccgttgc tcccaatggg gcttcgcatt ggcgtgctcc aggtcgatcc gctgaatgga     31020
     cgccatcgat tccggcttcg cggacttgag ctcgaaggaa acctgctctg tctcgatcgg     31080
     atgccgcggc agcgcaaagt tcgtcaatac cagcgtggaa cgctgatcgc cgcgcacgaa     31140
     ccaggcatcg acggttgcgt ggctcccctt gaccggcatc atctgcgtgc ccagttcatg     31200
     cagcaactgg aaggctcgat aggcgggctt ggcgatgcca tgaatgttga gcaacccgaa     31260
     tccgccgtgg aatgggatcg aagggaaata gttttcctcg aaaatgtctg agaacgtcca     31320
     atagctgtat ccctgaacca gcccactggc ttcgaggatc gttttgacga taaacgcggc     31380
     ggcgtaggga tcgtcatgca tcggatcgcg cggattggag gatgtgcacc actccgtgta     31440
     gtagaccggc aaatcgccgg cgttctttcg gacgtcgcgg gcctgttcgc gcaggatgct     31500
     gcgcgttgag gccgctaatt gagcttcggt gtcgtcgccc ggtttgccga atgcatccgt     31560
     gggataatga tgtgtactga cgaaatcggc cggcaggtca ttggccttgc agaatgccag     31620
     aaaatcatcg atccacgcat tcgccgccgt ggcgggaccg ccgactttca gcattgcgtc     31680
     aacgcccttg atggcctcca cggtgtagcg gtacagctcg aaataatcgc tctgctgacc     31740
     gtttccgaat gccgtcaggt tcggttcgtt ccagacctcg aagaaccact gccgcacttc     31800
     gcccaatccg taacggtcca cccaatgacg taccagcttt ctgatcagca cggcccattg     31860
     cgcatagtcc ctgggacggc cgacattggc tcggtagtga aaaaccgtct gatcaccgga     31920
     ggacagagca gacggcatga aactcaattc gacaaaaggc ttcatgccga tcgacagcag     31980
     gaaatcgaag atctggtcgg tattgaaaaa cgaatagaag aacgtgtcgc cctcactcac     32040
     cagcgttccc atgtcatcgc tcagaatgcc gtgaaaccgg acatgccgca tgccaagttc     32100
     gtcatgcgcc tgcttgagtt gcgcctgcca atcagcccgc aaagcaagtg tcgcatggcc     32160
     gctgccgacc gtatgctccc agaaatgcgg aaagtctgtg gtgcgtccgc tcaggtcgct     32220
     tgagaacatg gccgtcattt cagtctttcc ttgattcggt cggcgacacg aagcgcgttg     32280
     gcgatgattg tcagcgtcgg attgaccgcc ccgatcgatg gaaagaagct ggcatccgca     32340
     atgtacaggt tatcgagttg atgggccttg cagtcgaggt ccagcaccga gttcgcggga     32400
     tcggtcccga agcgcgccgt ccctgcttga tgcgccgtgc cgccgatcgg aatgtcattg     32460
     cccagataaa ggctgcgctc caggagtact ggatgagcgc ccgcgctgct caatatctgc     32520
     tcgagctttt tcttgagccg atgatgagct tccatatcac cttcggtgat gtccagaacg     32580
     acacgctcgc catcgtagcg aatgcggttt tccggccgcg gaatatcctc gctcgacaac     32640
     cagaaatcca tcgagtggcg cgccatctca tcgaacggca tctttggcat ccattccagc     32700
     cagctcggca gcgcttcgcc cctgatttgc gcgccatgcg acgtggcgca catctgtatt     32760
     aacccgagcg gatattccca gtcatccgat ccgaagtaga aatcggagat cgcgagggtt     32820
     ttctggaata ccgtgtcgtt gggttcgcgc atcagcgcca tcagaatgga ctgattgtga     32880
     cgcatgtagt tgcgcccgac ctggccggaa ccgttggcga ggccatcggg atgatcgtcg     32940
     ttcgcggagc gcagcagaag cagcgccgag gacagcgcgc cgcacgcgac gactacgata     33000
     tcggccgagt agtgctcttc actgccatgg cgcgtcaccg cgacgtcttt cactttgctg     33060
     cccttggcgt ccgttccgag cctggagaca tacccgttgg tcagcaacgt caggttgggg     33120
     tgcaacttaa gtgccggatc gacgcacatg acctgcgcgt ccgccttgcc gttcagaaga     33180
     cagggaaatc catcaaacgc gtcgcagcgg atgcagatgc tggtcggcgt gacttttcca     33240
     tgctcctcat caagaagaat accaagaggg agatgaaacg ggtgcaagcc gcctctcgcc     33300
     aggctgtcct gtagcgtttg gatgcgcggc tcgtgggaaa ccggcggata gggaaaggga     33360
     ccgcttgaag ggggctcgtt cggatcttcg ccgcgttggc cgtgaacgtg aaacagccgc     33420
     tcggcctcgc cgtaataggg ctcgaacacc tcgtacttta gaggccatgc aggagagacg     33480
     ccgtccttgt gctggacttc gccgaaatct cgctctcgca gtctgaaaag cgccgcgcca     33540
     tagacctttg agttgccgcc gacataataa tgcaggccgg gatgaaaagt ctcgccattc     33600
     ttgccatacc acgtctcatc agcttgatag gcgccatcga cgaacaccgt ctgcgagtcc     33660
     cagttcgcac gcgaacgcgg cagataatcg ccacgctcaa tcagcaagat gcgtttgccg     33720
     gttggcgcga ggcgatacgc gacagatgcg ccaccagggc cgcttccgat gatgatgacg     33780
     tcgtaatgct gcgtcatcgt cttcaaccgt tggtcgagaa gccggggtaa agcgtcatgc     33840
     ccccgtcaac gaagagtgtg gtgcctacga cgtagtcgga atcgtcagac gccagccaaa     33900
     cggcggcgcg tgcgatatct tcgggcagtc cgatccttcc atagggaatt agcgtcagca     33960
     gactcttgag ggcctccggc gtgtcccagg cggaggtatt gattggcgtc tgtatcgcgc     34020
     ctggtgcgat gccgttgacg cggatgcgct tgggggcaag ctcctgcgcc atgctctcca     34080
     tcatcaattt gatgccgccc ttcgaggtgg cgtaattcgc gtgacctgcc cacgggatca     34140
     cttggtgcac cgaactcatg caaatgatct taccggctgc gcgcgacacg gatgggacca     34200
     cgccgcggcg caggaactcg cgtatggccg cccgcgcgca gagaaactgg ccggtcaaat     34260
     tgacgccaag gactttgttc cacttttcca gggtcatgtc agaaaatgca gagtcgcgtt     34320
     gcataccggc attgttgacg aggatgtcga tcgtgccaaa ttcgcgtacg gctcggtcga     34380
     acatgtcgcc gacctcatct tcatgcgaaa catcggcctt gtgtgtgata gcgttgccgc     34440
     cgaactgctt gatcttgtca accacagcgt tcgcggcggc gtcgccctcg acataattca     34500
     ccactacatc ggcgcccgcc tggccgagag caattgcgac gccctcgccg atgccggagt     34560
     tggccccggt aacgagcgcc ttctgtttgg ccaagagctt gcgatcggac atgggggttc     34620
     tttcacaaat accgcaaaag gtcgggcaac ccttgcgaga gggtggcgac ctcttgaaga     34680
     gacaagtttg acggtccggt gcttgccgga ctggccgcaa cctttatcgg cgaagccggc     34740
     ggcaaacccc aggcctttct tcagtggatc ggccgctcgt ctgaggatgc cggcgtttgg     34800
     gcgatcgcgg caggctcgga atctacctag tcggcccaaa tgccgctggt cgcactcgtt     34860
     ggctcaccgc cgatttccgg aatacgcgtt cctcttgatc aaggagggca aaatcggggt     34920
     catgtgaacc cagtattcgt actgctcgat gagggccgtc cgcctccagc ttcacggcct     34980
     agcccaatac ttggccaatt tcgtccgcat cccggcgcta tcaggtgaaa tcactcagcg     35040
     atcacccgcg acgcttgggc aaaccggcca gaatcgagcg aaggtcatcg atcacgccgg     35100
     cgacgctacg ctgtctttca gatggcggtt gcggcgccgc gcgacttcgg cggtattctg     35160
     gtgttgactg gcggccttcg accaaaagcc ggtggcgcgg tgctgagaca gatggttgtc     35220
     ccgtcgtcac cgccaccgac gtcgggcgca ccgtgcccgc cttcaaaccc gcgccgggtt     35280
     cagacaattc tgaccaggat cgaagccggt ggcgccgagc gtatgggggt gctgattaat     35340
     tgagtatttt ccgagtcttg tcttactctt acgatcccgc cgtaatcagc ttatcgcaac     35400
     tcactctaat ccgattgctg tgacgagcga gaaacgacca tggaacggga attgctgatg     35460
     gggttcggga cgctattgac gccattgcca cggaccacgt caggtcacct tccaagtttg     35520
     caaattgtac atgatccgta tgatattttc gtgtccgttg tgagtaagaa acggcatgtc     35580
     gtaatcatcg gcgcgggctt cgcggggcgg ctgcgcactg tcgagggtcg gctgttgcag     35640
     ctgcgcttct ccgagaagtc cctggcgcca agctgcgacg gcgctgcaca tgtcgatgtc     35700
     gccggcgatc tgcccgccgc cgctgaatgg cgtgccgacc gggacgccgc ccgtcccgcg     35760
     ccgtaatccg gcttctgccc cgcctgagca aaggtcctcc gcccggaccg tccggcccat     35820
     gcctctcgcg ccactctgca ccggaaggca taaatgaatc cgatcgtcga ccttcgccgc     35880
     tactccttca aacggggcaa ccgcgcccgg cagggctccg tctggaacga cgcctcgccg     35940
     atccgcgagg aattgttcgg tgccgagcgg ctggaacagc acgcacgaag cctcgctgcc     36000
     gcccagccca tcaccgcccg gccgccttcc gccccttcgc tgcatacccg cctgaagagg     36060
     aatgccggtg tgctactcgc cgcctaccgg gcaacggctg ccgatgtcga ggcaggccgc     36120
     accgtggtgc cggccgccga gtggctgcta gacaattatc atctcgttga ggaacaggtc     36180
     cgggagatcc gtgacgacct cccgcctagc tattaccggt tgctgccgaa gctcgccgag     36240
     gggccgttcg ccggctaccc tcgcgtgctc ggcctcgcct gggcctatgt cgcccatacc     36300
     gacagccatt tcgatcccga gatgttgcgc tgcttcatcg cggcctatca gcaggtcgag     36360
     ccgctgacca tcggcgagct gtgggctgtg gccatcacac tgcgcatcgt gctcatcgag     36420
     aacctgcgcc ggctggccga ccagatcacc gccgggcgtc gggcgcgccg agaggccgac     36480
     ctgctcgccg accggcttct cgtctcgggc gaagcccggg ccgcgctcga cgccgacatc     36540
     ctgatccgct cgccggaacc gctggacgag gtcttcgccg cccagctcgt caagcggctc     36600
     agggaccggg acccgcggat cacgccggca ctgggatggc tggagacacg actgggagcc     36660
     caaggcgcat cggtcgaagg tgtggtgcag catgctcagc agcggcttgg cgcctccaac     36720
     gtcagcgtgc gcaacgtcat caccagcatg cggctgatct ccgacatcga ctgggccgag     36780
     atgttcgaga gcgtcagcct ggtcgatgat cggctgcggg cggggagtgc cttcgccgcg     36840
     atggattttt ccacgcgcaa cctctaccgg agcgcgatcg agcaactcgc ccgcggctcc     36900
     gtggcatccg agctcgacat cgccgggcgg gcgctgcagg ccgttgcgtc ggtgaacgcc     36960
     acaacgcagg atgcgtcgac cgggccggcc agcgatcccg gcttttatct catcggcgat     37020
     gggcggagcg cattcgaacg gacgatccgt ttccgcccgc ccgcccggct tcgccttagc     37080
     cgcctcagca tccggctcgg cataggtgga tatatcggca cgatcatcgc cgttacgctg     37140
     ggcctcatcg cgctgtcact ctgggcactc tcatccgccg gcctttccag cggctggctc     37200
     gttttgttcg cggtcattgg cttcgtctcg gcaagcgaac tggcgaccgc actggtcaac     37260
     cggggcgtgg catggatgtt caatgccacc agcctgccgg gcctcgaact cgcgggcggc     37320
     gtcccgacct ccttgcgcac tctcgtcgcc gtgccgacgc tgctcaccag cgaagccgac     37380
     cttcaggaac aagtcgaaag gctggaagtt catttcctct ccggtgccgg cggcgatatc     37440
     acttttgccc ttctgtcgga tggcatggac gccgactgcg aggtcctgcc ggacgatgcg     37500
     ccattattgg agctcgccgt gcaagggatc gagcaactta atctgcgtca cggcgccggc     37560
     ccggccggca accgcttcct cctgctgcac cgccatcgcc tgtttaatcc gggcgaagga     37620
     aaatggatgg gatgggagcg caagcgcggc aagctgcatg agctcaaccg cctgctgcgc     37680
     ggcgcggacg acacctcctt catggccgtt ggtggccggc ctccggaggt cccggtggat     37740
     gtgcgctacg tgattacgct cgatgccgac acccgcctac cgcgcgacgc cgcgctccgg     37800
     ctcatcggca agatggcgca tccgctgaac cggccgaaat tcaacgctgc cgagcggcgg     37860
     gtggtaagcg gctacgggat cctccaaccg cgggtgacgc cctcgttgcc aatcggccgc     37920
     gagggctcgt tctatcagcg ggtcatctcc ggcggcggcg gcatggaccc ctatgcggcg     37980
     gctgtttccg acgtctatca ggacctcttc ggcgaaggtt cctacaccgg aaaaggcatc     38040
     tatgagatcg atgccttcga ggcatcgctt gccggacgca tccccgacaa cacgctgctc     38100
     agccacgatc tcttcgaggg cgtgtttgca cgcgctggcc ttgcgtcgga tgtcgaggtc     38160
     gtcgaggaat tcccttcgcg ctacgatgtc gtcgccaagc ggcagcatcg ctggatgcgc     38220
     ggcgactggc agttgctgcc gtggatcgtg ggtgacggtg caggatggcg cggcctgacc     38280
     acggtcgggc gcggtaagat gctcgacaat ctgcgtcgct ccgtggcggg gccgcttaca     38340
     ttgctggcac tgggcttatg ctggctgttt cccgtgccgg cggcacggat cggcacgctt     38400
     ctggtcatct ccactgtcgc ggttccctcc ttcctgccga tcctcttcag cctgcttccg     38460
     ggccgccccg acatacgcgt acgcagccac ttggcccggc tgcggtccga tctgtggctc     38520
     gccgcagccc agacattgct gtcgctcgtc tttctcgccg atcaggcatg gcgtgcgggc     38580
     gatgccgcga tccgcacgct gctgcggctg ctcgtgacgc gccgccatct gctcgaatgg     38640
     acgacggccg ccaaatcctc ggcagcgccg cgactggatc tcatcggctt ctatcggcag     38700
     atgtcgagcg gcacggtgct cggcctggta attacagggg gcgcgctcac cctctcgcca     38760
     tccatctggc cgctcatcct gcctttcgcc ttgctctggc tcggcgcgcc cgcgatagcg     38820
     caatgggcga gccgttcgcc aaaggtgccg ctgcgcctcg ccgtcggtga acgggaagca     38880
     cgcgacctgc ggctgattgc ccggcgcacc tggcgcttct tcgagacctt cgtcaccccg     38940
     gccgacaaca tgctgccgcc ggacaatttc caggaagtgc cgaagccggt ggtcgcgcgc     39000
     cgcacctcgc cgaccaatat cggcctctat ctgctctcgg ccgtcgccgc ccgcgacttc     39060
     ggctgggccg gcacgatcga gaccatcacg cggctggagg cgaccttcgc cacgctgaag     39120
     aggctgcgcc gcttccacgg gcacttcctc aactggtacg gcacgcagga cctcgcggca     39180
     ttgccgcccg cctacgtctc gtccgtcgac agcggcaatc tcgccggtca tctcatcacg     39240
     ctggccaatg cctgcgagga gtggcgggat gtccccgtcg gcgcgagtgc gcgcgcgggc     39300
     atcgctgatg ctttggcctt ggcccgcgag gcgatggccg gccagtccgg tgcgggcggt     39360
     tcgcaggggc aggcgctgac tgcggcgctg gacgagatcg acgtccaact gaacggcgtg     39420
     cagacgctgg aagcgacggc tccgattctg aaacggctta ccgacaaggc cacgaggatc     39480
     gtgctggaga ctattccggc gacgggcgac gacggagtca ccgacatcgt ctattggaca     39540
     aacgcgctcg gtaaggcggt gagcgaacat gagcgcgacc gcctcgagct tctggcagtg     39600
     cctgccgcta cacgggatcg cctgaccgcg ctggcggata tggcacgggc catggccatg     39660
     gagatggact tcgccttcct gctcgatccc gagcggaagc tgctctccat cggctattcg     39720
     ctcgccgaga acggccgcga tccaagctgc tacgaccttc tggcgtccga agcgcgcctc     39780
     gccagcctgt tcgccgtcgc caagggcgat gcgccaaccc gccattggtt ccgactcggg     39840
     cggcttgcga cgccactcgg caacgcctcg gcactcatct cctggtcggg atcgatgttc     39900
     gaatacctca tgccgtcgct ggtgatgcga gcgccggcca gcagcgtgct cgaacagacc     39960
     aaccgcctgg tggtcgagcg ccagcaatcc tacgcgcggt ctctcggcgt tccgtggggc     40020
     atgtcggaat ccgcctacaa tgcgcgcgac atcgaattca cctatcaata cgccaatttc     40080
     ggcgtgcctg gcctcggcct caagcgcggc ctctcggaga gcgtcgtcgt ggcgccctat     40140
     gcgaccggcc ttgccagcat ggtgaatccc gagcgcgcgc gacagaacta tgcccgtctc     40200
     gtcgagctgg gcgcgcaggg ccgctacggc ttctatgaag cgctcgactt cacccgttcg     40260
     cggcttccgg aagacgagga cgtcgccatc gtccgcagct tcatggccca tcaccagggc     40320
     atgaccatcg tcgccatcgc caacacgctg ctgggcggcg agatgcgcgc ccgattccat     40380
     cgcgagccga tgatccgggc gagcgagctg ctgttgcagg aacgctcgcc gcgcgacgtc     40440
     gtcgtggccc gtccccgcgc cgaggaagtt cgggccgccg ccgtcgatgc ccgcagcgag     40500
     ggggcgatgg tgcgccgcct gaccgcgccc gctcccgggg cgccgattac gcatctgctc     40560
     tccaatggca gctacgccgt catgatgacc gccgccggca gcggctacag ccgctggggc     40620
     gacatcgcgg tgacgcgctg gcgcgaagac gccacgcgcg acgactgggg ttccttcatc     40680
     ttcctgcgcg acatgcgggg cggcagcatc tggtccgcca ccacgcagcc gatggcggac     40740
     gctgcgggtg aaagcgacgt ggtgttcggc gaggactacg ccgagttcat ccgtcacgat     40800
     gtcggcctga ccacgacgat ggatgtcatc gtctccggcg agcacaacgg cgaggttcgg     40860
     cgcgtctcgc tgaccaatag cggccggcgg acccgcgaga tcgagctgac ctcctatgcc     40920
     gagctcgtcc tgaccacgcc ggccgccgac aatgcccacc cggccttcgc caagatgttc     40980
     gtcgagaccg agcatctgcc tgagtttggt gctctcatcg ccacgcggcg acgtcgggcg     41040
     ccgggcgaac cgcagatatg ggccgcgcat ttcgcggtgg tggaaggcga ggtcgccgca     41100
     aatccgcaat acgagaccga ccgcgcgcgt ttcatcggac gtgggcgcag catcggcacg     41160
     gccgaggcta tgtcgggcgg ccggccgctc tcgaacagcg tgggaacggt gctggaccca     41220
     atcttctcgc tgcgtcagag cgttcgaatc gagccgggca aggtcgcgcg tgtggcattc     41280
     tggaccgtcg tcgcgtcgtc gcggccggaa ctgctcgatc tgatcgatgc ccatcatgat     41340
     cgcaacgcgt tcgaccgtgc taagaccctg gcgtggacac aggcgcaggt ccagcttcga     41400
     cacctcgacg tggacgcaga agaagccgcc gactttcaga gaatcgccgc gccgctgctc     41460
     tataccgacc ggcgcttcag gtcgccgtcc gagacgatca cgcgcggtgc cggcccgcag     41520
     tctggtctgt ggccgcactc gatctctggc gacctgccga tcgtgctgct tcggatcgac     41580
     gatgtcgaag acatggcgca ggtgcgccaa ttgctgcacg cccatgaata ttggcgcatg     41640
     aagcgcctcg ccgtggacct cgttattgtg aacgagcggg cttcctccta tgtgcaggac     41700
     ctgcagatcg ccatcgaggc cgcggtacgg accaatcagt cgcgtccgct gctgggcaag     41760
     gaaccggcgc aggggtccgt ctttatgctg cgcgccgatc tcatgagcgt ggaggcgcat     41820
     gcgcttctgc gctcggtcgc ccggatcgtc cttggggccc gcggcggcac tatcgctgac     41880
     catttcgctc gcctgggtcc gccgtcgaat ccgcctccgg tccagcgccg ggcgcgggct     41940
     ttgaccccga tgcgtgaacc cgcgtcgtcg cgcgagccgc cgaagctcga attcttcaat     42000
     ggcctgggcg gattcgacaa ggacgggcgg gaatatgtga ccatcctcga acgcggccac     42060
     accactccgg caccgtggat caacgtcgtc gccaatgcct gctttggttt ccaggtttcg     42120
     gctgagggca gcggctacag ctgggcgcag aacagccgag agaaccagct cacccaatgg     42180
     tcgaacgacg cggtcgccga cccggcgggc gaggcgatct atgtgcggga cgaggagagc     42240
     agccatctgt ggagcccgac cgcgcaaccg atccgaggtg acggcaccta tgtcgcgcgg     42300
     cacggcttcg gctatagcag gttcgagcat gaagcgaacg gcgtcgccct ggacctgctg     42360
     cactacgtgc cgctcgacga tccgattaaa atctcgcgct taagacttac caatcggtcc     42420
     ggccggccgc gccggctttc cgtcaccgcc tatgcggaat gggtactcgg cacttcgcgc     42480
     ggggcgtcgg ctccgttcat caccacggag atggacgcgc agtccggagc gatgctggca     42540
     cgcaatcggt ggagcgtcac cttcggctct cgcgtcgcct tcgccgatct cgcggggcgg     42600
     cagaccacct ggaccgccga ccgcaccgaa ttcctcggcc gcgatggcgg acctgcgtct     42660
     cctctctgcc ttgcaagcaa ggtgcctctg tccgggacga ccggcgccgg cctcgatccg     42720
     tgcgctgcgc tgcagactgt agtcgagctc ggcatcggcg agacggtcga tgtcgtctcc     42780
     ttcctcggcc agtgcagctc agtagacgag gtgcgggcac tcgtcgatcg ctatcgccac     42840
     gccgatctcg atgctgcgct cgccgccgtg acgcagcact ggcatgacgt gctcggcgcg     42900
     gtccaggtga agacgccgga ccgggcgatg gacatcatgc tgaatggctg gttgctctac     42960
     cagacgctcg cctgccgcat aaccgcacgc tcggccttct atcaggcgag cggcgcctat     43020
     ggcttccgcg accagttgca ggacggcatg gcgctgacgc tggctctgcc cgcggagacg     43080
     cgggaccata tattgcgcgc cgccgggcgg cagttcgtcg agggcgacgt ccagcattgg     43140
     tggctgccgc aatcgggcca gggagttcgc acccgcatct ccgacgatca tgtatggctc     43200
     gccttcgcca ccgcgaccta catcgacgga accggagacg ccgcaatcct ccacgagccc     43260
     gtgccttatc tcgacggccc ggtcctgcgg accgaagagc atgagcattt ctttcagccg     43320
     atgccctcgg atatcgtgga gccgctctac gagcattgcg cccgcggcct agatcatgcc     43380
     gttgctctca tcggcgagct cggcctgcct ttgatcggca ccggcgattg gaacgacggc     43440
     atgaatcgcg tcggcgaggc cggcaggggc gaaagcgttt ggctcggctg gctcctcgtc     43500
     cggaccatcg agatgtttgc gcccttcgcc ggcgaacgag atcccgagcg cgcccgccgc     43560
     tggcggattc atgctgcctc ggtaaggcgg gccctggagc gctcggcctg ggacggcgaa     43620
     tggtatcggc gggcgacgtt cgacgacggc acttggctcg gctcgaagga cagcggcgag     43680
     tgccgcatcg attccatagc acagtcctgg gctgtgctgt cgggcgccgc tgatagactg     43740
     cgcgccacca ccgccatggc ctcgctggag cgtcgtctgc tccgcaccga cgccaagctt     43800
     gccttgttgt tcacaccacc cttcgaccat acgccactag atcccggcta catcaagggc     43860
     tatccgccgg gcctgcgcga gaatggcggg caatacagcc acgccgcgat gtgggcgatc     43920
     ctcgcctttg caaagctcgg cgccggcgac aaggcgcatg atctgttcgc gcttctcaat     43980
     ccgatcaacc atgccttcac cgcggaagag gccgagcgct acaaggtcga gccctatgtc     44040
     gtggccgccg acgtctattc cgtcgctccg catgtggggc gcggcggctg gagctggtac     44100
     accggctcgg ccgggtggat gtatcgggcc ggcgtcgagg gcattctcgg catccgccgg     44160
     gagggggatt tcctcgtcgt cgctccctcg attccggagg catggccggg attcaaagcg     44220
     acggtgaggc tgggtgaggg ggtctgccga atcgaagttc gcgctatcgc cgggggcgag     44280
     gagccttatt cggtgctcga cggcgttcgc agcccgtcac cggacagatc ggctcgtatt     44340
     tccctcaact gccagagtca tgatctgctc atgtccatct agggcttgtg gggattcatc     44400
     gtgagttgat gacggctgcg gcgaggtgga tcattgcctg gaagctctgg tctgttttgc     44460
     aggcgcgcag ggcgatgcgt ttgaactcct ttagagtcca tttcgaatcg gattattaac     44520
     gagccaatct gcgtagcagg agaatgctgg acgcggcgta gaggaaggcc tcgacactct     44580
     cgatagtggc ttcgaaatcc tttgccagcc gcctgttgcg attgatccag gcgaagaacc     44640
     gttcgacgac ccagcgtcga gcgatgacgg cgaagccgac ctggttgttg gccttgcgca     44700
     ccacctcgat gcggatcggg ctggcgtcgg cgacacgggg cccggcatag ccgccatctg     44760
     cgtagcccag cgccacaaac ggccaactcg cacgcgacgc acggagcagc ggtccagccc     44820
     cgtcacgatc ctggatggcc gccgaatggg cctgcagctt gagcgcccgg ccgtcggtat     44880
     cgaccatggc gtgccgcttg cgccccttga tcttctttcc agcatcgtac ccccgcgtgc     44940
     cgccactctc tgtcgtcttg acgctttgac tgtcgatcac ggccgccgtc ggactggcct     45000
     cgcgacccac cctctcgcgg tcgcgcatca ccagatggtg gttgatccgc tcccaggtgc     45060
     cgtcgtcgcg gaaccgggca aaccagcgat acgccgtggg ccacggcgga aagtccttcg     45120
     gcagcaggct ccaggcaatc ccaccacgca agacgtagaa gatcgcgttg acaatctcgc     45180
     gcatctccca cttccgatgc cggccgcatc ggctcggcgc gggcaggaac ggcgacagga     45240
     gcaaccactc cgcgtcggtc acgtcacttc catagcgcag tccggtgcgg ctatgctgcg     45300
     cacgggtggt tggcgtccac atggtgtctc cggcaaggct tcgaacacct gcccggaatc     45360
     acatttggcc caaccatcca acccctcatc aaaaacgttc cgaccccatt ccgaaatggc     45420
     ctcttagcat gcagaagaaa ttctcgatca gatgacgcca tttgtaggtt tcgtggtcga     45480
     ttttcagctt cagtgcccgg gccgggtgct gggaaatgcc gatcctggcg cctctttcgt     45540
     tgagttctgc gaccagagcg ttgctgtcga atgccttgtc tgcgatcaat ccaccgaatt     45600
     cgacgttgtc gatcagtggc gggacctcga tgctgtcata gcgattgccc ggcatgagac     45660
     gaaagcgcac aaggttgccc aaggcatccg tcagcgccag aattttggtt gtcatgccac     45720
     ctttggaacg gcctatggcc tggctttgag tccccctttt gcgccctggc cgtgacggtg     45780
     gactttgacg atcgtggcgt cgaccatggc gtattccatg tcgggttcat cagataccgc     45840
     gtcgaaaatc cgatggccat ctcggaagaa acttcctgct cggcgtcgac ggtgatgcca     45900
     tcaacgccgt cctcgccggc gtcggacaca acccccgcct cctccgcaga tggttgatca     45960
     ggcttctttg tgccctcctc gcatggctct atgccgcaaa ccgctcacca agcctcggct     46020
     tcgcccaccg ccagatcaca tagttcacag gtgaccacct aaattcaact tgagacgtcg     46080
     tgctatccgt ccggcagcac gaagctggtc gccagtcgaa ctggaagcta atcgaccatg     46140
     taatcacggc gaattggcaa cgcgtccagc cgctttgtca actggatctg gaacactacg     46200
     ttcgtccgca tccggaagcc gatctcgcac aggacgagat agaattccca catccggtag     46260
     aaccgctcgt catagaggcg caccacatcc gcccgccgcg cgacgaaacg ctcgcgccag     46320
     tgccgcagcg tctcggcata atgcagccgc agtacctcaa catcggttat gatcaggccg     46380
     ctccactcca cagcggcggc aatctccgac agggatggca ggtcggcccc gggaaagatg     46440
     tatttccgca gaaacggatt gatcggcgcg ggatgatccg aatacccgat cgtgtggatc     46500
     aacgcgacgc cgtcatccgt cagcaggtcg cgcagcttcg caaagaactc tgcatagttc     46560
     cgctttccca catgctcgaa catcccgacc gaaacgatgc ggtcataagg acccgcttcg     46620
     tcgcggtaat cctccagatg aaaccccacg cgctcggcaa ccccggctgc cgcggcccgc     46680
     tcgacgctca gtctgtactg ctcggtgctg agtgtcacgc ccgtaacctc ggcatcgcag     46740
     tgcgtcgcga tatcgaggca catgccgccc cagcctgagc cgatgtcgag aacccggagt     46800
     ccgcgccggt cgagcagcag cttcgccatg atgtgccgct tcttgttcgc ctgcgccgtc     46860
     tccagatcat cgtccggcga gtggaaatag gcgcaggaat actgcatgtc ccggtcgaga     46920
     aacatcgcat agaattcgtt cgacaaatcg taatgatggg cgacgttgcg ccgcgcccgc     46980
     gacatcgggt tcgactgccg cacgtggcgc cgggcccggt tgagcagcgc aagccatggc     47040
     agcgaccgcg cctgacttgc attgcgcccg atcacggcag cgaagtcata gagcgtgccc     47100
     tcttcaatcc gcagtgcgcc gttcatgtat gcctcgccca ccgtgagcgc cggattgacg     47160
     gcaagccgat actccatggc cttcgacatc aacctgattg tcgcgctggg cgcggagccg     47220
     tcgccgacct tgtgcaagcg gcctccggca tcgatcacgc cgaggctgcc gtcgtgcacg     47280
     agcgatttca atatcgaaat aaacattgcg cccgttcggt tcgcgtcttt ccatatgcca     47340
     acgggagatt ggctcgtccg acacaatgat atcgccaatg agccacggtt cgcaaccgtt     47400
     catggtccgt tggccggatc agccgcttct cgttctactc gatccgcgtg aggccttagg     47460
     gcctgataac gggcgcgaag acgccggcac cgagcagcac tgaacgtccg cttccgggat     47520
     cactcgaacg gccgttcaac ggcagccgtg ggtcagggtg aactttggct gcgcgacggc     47580
     aaggctgaag cggccctcga tccatggccc gggctgggcg gggcagtgca gcactgcgcc     47640
     attccgctgt cccaccctcg ggttttggtg tccgcccccg tggtaccgtg atctcgagcg     47700
     ggccgaacga gccgaggatt tgccgatgac gggtaccatg gcgatatccg acggccgctt     47760
     cgccaccccg gcggtattgc ccccgcccga gcgccatcgt cagctcttcc tcaagcatga     47820
     tccttgccat gctccagcac catccggacc gctcgctccc gcacctcagg cgaataccgt     47880
     accgatgtct gccacttttc cattgctcca tcctcaatag ttggagcctc agggattccc     47940
     ggcgcggttc atttcaatga aaccgccgat ccgatcccgg acgcctgtct cgatcgggtc     48000
     gaaccacgcc gtcgcgtcaa acaagctggt tctcgttgac cccgtgctat tcttctccat     48060
     ggcgtgatct ccatcggcgc tcgaacgtcg aatctggtgg ttgaactcac cttggcatta     48120
     cgccacccag aatttccaca cacttcaaaa cgccaccaaa accagcgcta ccaccgtcag     48180
     ccaggaccgc taccgcgctg cccttgccgg actcgaacac attttcaccc tcattactat     48240
     cccaaagcgt tgaacagccc tcactgcggc agtagctggg cgtctctgtc acggtgagtc     48300
     gaatactatg acgcggtgaa tgtgacggtg gcgggccctg ctgccatcgg gcgcacgccg     48360
     tcgtccggct acggctcggg gacaggtgcc aactgacgca ctctgtcgct tgccgggcca     48420
     agcgcctccg cgaggcaggc gacgaccatg tcgtgcagcg aacctgcata gatatcggcg     48480
     gccacggcag cacgcagcct gtcgtcactc accatgttgg agggccaaaa tccgacaaga     48540
     atgcaaaccg acgggctgcg tgcccgcagc cgacgcacgg tgtagcgcag atcggaggat     48600
     gtgccggcaa tgccggaata ggtcaggcag accatctgca cgcccacgat gtcgagcgtg     48660
     tcggccgcac gcaggctaac ggcttcatgc gtcacgacgc tggcgccgat cccgcgcttg     48720
     ccgagcagct gagcgagcat cgccgacgcc agatcatcga gcgggccgcg gccggccacg     48780
     cacagcaccg cggaaggggc ctgccagtcc ggcgacaggc cgaccggctc gcccagcccg     48840
     gcaggcggcc cgggctcgcg cgattccggc gttgcctgcc gatctgacgg cagcctcgcc     48900
     ggtcccgcgg cagtcagaag cgtatcgctg tcgtcatggt cgccgatttc ctccagcagt     48960
     ccctgcaccc cggcgatgat ccgaatggtc tgcgcctcgg tcagcacccc gcgctcgatg     49020
     tcgattgtgg ccagtcgcaa gccggggatc gcgacctcat cgtagtatgc cgacagcgta     49080
     cacgacttca gcagctgctc ggcgtcgtct tgcacttcgt ccagtcggcc tgccagcatc     49140
     cggttgtaga agctctctac cggcgtcaac gctgaacggt cgccgagcag cacgtcgagg     49200
     aacttcaatc gatccacatg gcggcccaga atgaccagac agagtgtgag cggcatcgac     49260
     aggatcagcc cgaccggccc ccacagccag ctccagaaga tcgccgcgac cacgacggac     49320
     agcggcgaca atccggtgct gtgcccatat gccatcggct cgatcacctg gcccatcacg     49380
     ccctcgctaa ccacgaacag ggtccccgtc cacagcagca tcgaccaacc cggatcgact     49440
     gccgcggcaa gcgcaagcgg tagcgcggcc gcgagccacg ggccgatata cggaatgaag     49500
     cgcatgagga tcgccatgat gccccacagc accgcgctcg gcacgccgat gacgaacaga     49560
     ccgaggccga tcatgctgcc gaatgcagtg ttcaatgcca gcagggtcag gaagtaccgg     49620
     ctcaggcggt gcccggcctc atccatcgcg gtcatcgtcc ggtgcagatc gccggtgccg     49680
     agcatgcgga tgagtcggtc gcgcagatcc tcgggccgca gcagaatgaa gatcgccaca     49740
     accacgacga tggccgtagt catcaacggc gataggatcg gcgtgaggac gcgcctcgcc     49800
     agcttcatca gcgacggttc cggctgatgg acctccaccg gtatcggctt cgcggccgcg     49860
     ttggtgggtg ccgcggcgga cgctgcactg acggtcgtgc cggcgctcgc cggcgcgccg     49920
     gccgacgcgt ggctgtcgcg attgatttgg ctgcccatgc tcccgacgaa agcggagagg     49980
     cggccaaacg tcgcgctctg aacggcatcg accttctgct ggatggtgtc cgtataacgc     50040
     gggatgtcgt cggcaagatc ggcgacctgg gtgccgatca ggccggcggt gccgaggatg     50100
     acgccgagcg ccaacagcac tgcgagtact acccccggca cccgccccag cccggtgcgg     50160
     cggagcagat ttaccagcgg ggcgagcagg aacgacagca gcaccgccag cgtgatcggg     50220
     atcagcacgt cgcgggcgat cgacagcgtg gcgaccgcca ccaccacgct gatcagcgtc     50280
     atcagccccg aggtgtcatt gatcgcggct ggcgtgcccg gtcgcgcccg tggcggcgac     50340
     agatctatca tcaacgtagc cgtggtactg gtgttacgag catcggcgaa cccattcagc     50400
     ggtgcaaggc cgcgcgtttg gcgtggtcat tgttcagaag ccagaacgtc gcgatctggc     50460
     gcgcggcgga cagatccgcg cgcgccagat acgggctggt gcggccgctc ccgggcaggc     50520
     tggcatcgac gggaaagcca tgcccgatcg cgggcagcgt ccagatctcg acggcgggcg     50580
     gtcgatcggg ccggccccag gtccgatgcc gatgccccga tgccacgttg tcggtcctcg     50640
     gcgccgtatc ctggccatgc aactcgcccc attgcgccgc gagtatttcg gcgttcgccg     50700
     gatcaaccgt gcgatctcgg ccgccttgcc agatcgagac gcgtggccac gaccgtcgtg     50760
     aacgggcctg cgtcactgca cggacgtcgc cagcgagcgc ctgccgcgac cgcgacatgt     50820
     ttgcccgtcg catgtgaagc atcgctgcga cctgggtttg cgcgcagccg accggcatgc     50880
     ccgcgacaat gccccccgca gcgaacaccg cagggtatgc ggcgagcatc gcagcggcca     50940
     tgccgccgcc ggcagaaaat ccgacaatgt agattcgtct tgggtcggac ccatagcgtg     51000
     cgaccgcgac tctcagcatc tggcgaatcg acatcgcctc gccgccgctc cggcggacgt     51060
     catcagggcg gaaccagttg aagcagcggc cacggttgtt cgcgtgaacc tgttcgggca     51120
     ccagcagcgc gaaccccaac tcgtccgcca gcgcgagcca gccggacgcg ttggcaaagg     51180
     ctgcggcatc ctggccgcag ccgtgcagga cgacgaccag cggccggccc gcgggcagcc     51240
     gggcgcgggc atgaaccagc atcctcaatg cgccgggatt ggagccgaac ccgacgactt     51300
     ccgacacgca acctgccgac atgcgagccg ccgacaccgg ccgatccacc aacgcccgct     51360
     tccagacgcg ggcggcatcc tttaccagcg ccgcggcctg ccgccgcgcg actttggtgg     51420
     cgcgggagtg gcgtgcgata gcgttcgccc cacccagcca catgcgcatg aatggggtct     51480
     ttccagtcaa ccttttcgac aagacactca cctcacgtct gcaacacctt cttgtccgca     51540
     ccaacggccg gcttggtgca ctgtctgtct caccgcgtga gctgtctgat agcgtgacta     51600
     tcatccgatc atatgcttca atccgatcgg ctgttgctct tgaagcgaat gtatctgtga     51660
     tgttctcaga catgggcacg cttgggcagg ttgcgatcaa ccaccgccga gcgccgatgg     51720
     atctgccttg gcgtcgcgcc agacatcggg tggggcactc aagcgcgcgc tgcggatgtg     51780
     aacgcagccg tcccacatag tagcgcgcgt gcggaatgct atttccggac ggaatccttc     51840
     agaccgccga ccgtattctg caccctgccc tcggtcttgc cggcacgtcc ttcggcttgc     51900
     agcttggcat cgccgacgag tttaccgacg gcctctttca cggcgccctt gatctctttc     51960
     gccaatccag ctacgcgatc cttgtccatc agccggctcc cgttacgatc tctgctaagg     52020
     ctttgcacga aacccggtgc ggctcgttcg ctgtcgatcg ctatactgga tcgtgtgatc     52080
     cggcctgccg aggcctcaat aattagcagg gcctcacttc ccatagaagg ctcggaaact     52140
     acgcatctcc ggctctgcgt actcgccccg tggaggccgc gccagggcgg gcgtctcgag     52200
     gaggcttatc acacttcatc aaagcgttcg acgatgcggt cgcggcatac cccggcgcgg     52260
     cgaccagctc agccgccacc tgcggctcca atgtagggca cacatatacg ctccgacgcc     52320
     cgcgagaggc ccgccaggcc acggcccgag cgttccgcga agggcgcgtg gcgggcgtcc     52380
     ggttcggcat gccttcacgc gcacgcgcgc cggcgcgacg cgctcatccg cgcgatgccg     52440
     agggcggcgc atatgccaac tcggcgagct cttcgaacgc ggagatcagt ggctcggtcc     52500
     ggacatctcc gaccgtgaca ctcgatacct catgctcggc aaggctgtcc agcatccggg     52560
     taacgcatcg ccgaattgcc ggattccgaa tccgactgaa tctatcggcg atctggtcga     52620
     tatcgtcata ttggcgcatg tccacggcgg cctgcccgac gccgcccgcg gcgcgaccgc     52680
     cgaccggaca cccggtttcg gcctttggcg cctgcggcga ggacgccgaa tccgtgtaga     52740
     aataggcgag gtccacgccg agcgcctgcg ctaaccggaa caggtccgct ggtgcgacat     52800
     gctgtatgcc gcgctcgtag gcggcgatcc ctctcactgg cacgcgcagt gtcatcgcca     52860
     gttgccggcg agagagtcca atttccgcgc gccgtgccgt gatctgaccg ccgatatggg     52920
     cgtcgagaga tgcgacctgc aatgacacta tgttgcgcgg acggcctgtt ctgtcatcca     52980
     tgttccatac cccacctatt gacggcacgc gcgaagcgag cggtcgagcc tacaatctgg     53040
     cagacccgac cgctcgccgg acagcctcgg aaattactca tgcagcgcgg tggcggcgca     53100
     cgccatcgcg ctactccatc gtcgtcgagc gcgtggtctg cgtggtcgtg gtcacgggcg     53160
     cgcccagcat tggcggcgcc gccgcggtcg ctgtggtcga ggtgctcgta tgttgcgtcg     53220
     tcgtcgtcgt cgcggtgtcc ggcgaaccgc caccgcagcc ggcgaggacc aggacggccc     53280
     cgctcatcca cgtggcaagc agaatgcgtg ccgcggtggt cttgttcgat cgcatgatgt     53340
     cctccggttc atttcgtggt cgagtatgga gacgttgtgt cggtcgtggt gctagtgtgt     53400
     ggcacaggtg taatcgtggt ggtgctggtg gactggctga ccgcaccgtc ttcgctgcca     53460
     taggtcgtct tccgcgattg cgacgtattc ccggccgcat cgacgctgcg gctggtttcg     53520
     gtcgtgctca gcgtgccgct cggcgacggc atgaccggcg tccacgtcat cgcggtaggc     53580
     tgtagcgtat gggcggtgga tgttgtggtc gtcgtctgcg cgttcgcgcc agccgtcgcc     53640
     agagcgaggc cggcgccgag cggcgtgata acctgaatgc ggttcatgga ttctttcctg     53700
     ctttcagggt gtttaaacgt cacctgggcg ggttccggtt aacggggcga gaggttgatc     53760
     gtgctcggac tggtgagacc gccgacggct gcacccacgc caccgccgat cagcgcgcca     53820
     ccacccggcc cgatgccggt caccgaaccg acaaccgcgc ccgtccctgc gccgatcgca     53880
     gcaccggaca gggcacggcc tcccggcgaa tagccgcagc cgccgagtag caacccggct     53940
     ccggcggcaa cggtgaacca agccagtcta tacgatctca tgctaaagct cctgatggac     54000
     gcgccatggt cgcgcgtcgg gtccgcagca cctctgtgtt ggccggtagg cgggtgtttg     54060
     acgcgcatgc cgagatagtc gcactgctca acatggcgac ccgcgaaacg atcatgcagg     54120
     accggaatct acgtagttcc cagtggaaga aatccgatct cgccaatgtg gccgaggctt     54180
     ccgagcgcgc gcgataccga gccttgcaaa gccggggcgc ggcattgtgg gctatttggc     54240
     cggagtcttg tccacctcga cggtcttgga gtgggccctt ctcagcgtgc gccgtgggcg     54300
     cagtcgaaaa ttcctcccac tatgtccaag acgtcacctt cgccgagaac gttggcgtct     54360
     tggattgtgt ggaaattgcc tgtggcggcg tctctggttt ggggagcctg acgaggtcag     54420
     gcgacgagat taagatgcat tgaggcagga ggttctccga ggctctgccc acaagacgcg     54480
     cctggtcaag gactacgtgg cctcgaccgc ggggcgtctg acgctgcatt tccttccagg     54540
     ctgcgcgccg gaactgaacc cggacaagtt ggtctggagc catgtgaagc gcaccggcgt     54600
     ggccaggaat ccgctgcgca agggtgagaa gctgcgtgat aagatcgacg cccaactcgc     54660
     cgccatcaag cgagtacctg cactcgtgcg ctcattcttc ctcgccccca gtgtagccta     54720
     ttacagactg gtgagtaaga gtccggttga ggctgcctac ccagttgatc gtcacgttgc     54780
     atccgcagcc gcatattcac gacctgtgtg aatatgcgat atgcatgtgt tagacagaca     54840
     gcccctatgc agcgatccca agttcctgcg ccgatcgttc ctgttattgt ccgcatcgac     54900
     tgtctcggca ccgcaggccc gctccgaaaa acatgatacc gagaattgcc agatcaggta     54960
     attcaggaac gatcggccac tcggaaaagt tcgtaagctt taccgagacc tatctggcag     55020
     gtggtttggc cgcttcaacc gtcttggcat gggccttctc tgaatgcgcc atggccgcgg     55080
     cagcatgcag ctttgcgggt tcgtgctcac ccatgttgag atggtgcgcg gcctcgaggt     55140
     gatggtgttc tgctacggcg tgatgcgatg ccgcagcgat atgcacggcg gccgccggat     55200
     gattgggggc cgattgatgg gtgccggggc tcacagcggc gggattcgct attgtcatgt     55260
     gacttctcca gaaatggtcc aaggttaccg ttcgtgggag gcatatgata gcttgcccaa     55320
     gaacaaactc aagatatcag accatcgcat tgcccgggag gctcgggaaa tacttacatc     55380
     gacaactatc cgacgtcaca cttagagtcg gtccaagatg atattctgtt ctgacagagc     55440
     cttcgtagca tcagccgaat tgaggcccag aggatgaatg ccagggcgtt tcggttgagg     55500
     cactcccaat ccatgctcag gcctggcatc ggttcaacca ggcaatgatg cgttccccat     55560
     gcggtgatcg cgatccggcg gtttgatctg tcaaactggg gcgcgatgcg agcgggtggt     55620
     ccgcttgttg gaacccaggg aggcaatcat ggcgcactac gcaggactgg acgtttcgga     55680
     caaagacacc gccattcacg ttgtggacga ctacgggaag ctggtctggc ggggcaagag     55740
     ggccagcgag ccggaggtgc tcgccgcggc cctgcgccgg catgcgcccg aactcgttcg     55800
     ggtcgggctc gagaccggac agttggcgcc gtggctctac cattcgctca aggatgtcgg     55860
     ttttccggtg atctgcctcg atgcgcgcca tgcacgcatg gcgacagcgt cgcagcggaa     55920
     caagactgac gcacccgacg ctgaaacttt ggcgcagttg gtccggactg gctggtatcg     55980
     ggaggctcgt gtttagggct gggccgcaca cgccatgcgc cgtctggtcg gtgcccgttc     56040
     acaactcatc ggtatttcaa tcgatgtgtc gaaccagatc cgcagcacgt tgaagacgtt     56100
     tgggctgagg gcgacaggcg gggccggatg cgtcttcgaa gcgaaggtgc gcatcgcgct     56160
     ggagggccgg cccgaggtcg ccggcgtggt cgagccgttg cttgcggcct ggcgcgccgt     56220
     ccgcgatcag atcgccgtac tggaccgcaa gctgatggcc gcggtcaagg ccgacccgac     56280
     atgtcggttg ctgataaccc gtccgggtgt cggcgtagtg gttgccgcaa gcttcagcgc     56340
     cgccgtcgac cagatcaatc atactcagaa gaccgccctt tctgccgcga tacgagttgc     56400
     tcccgctgat gatcgccagg atagagaaca gcaggacacg cggcagcttg tagagcttcc     56460
     cttccgcgca gcgcagatcc gggacttccg ccaggatatc aagcaacgga ctgcacgtgg     56520
     gcactgcaac ttccgaatcg gtcgccttcc caagaatccg aaaccccgcc ggtcggtaac     56580
     ccctatattc cccagaaaat cagttggcac cgcggtgttt cgcatcggac tcaccccggc     56640
     tcagaaatta gcgttgaaca gtcctgagga atcccccgcg agtcggtatc attgtgcaag     56700
     gctattacat gacacgcaat acgagaacga taatcacaac cagcactacc agtcccagaa     56760
     gtccaccgcc gatatacatg gcttcaatcc ctttctgata tcccacagtg attattcgac     56820
     tgagcaacac gggtgtcggg tgtgccccgc atttgctgga tcgtggacgc cccttccaca     56880
     ggccgttggc cacaattgtt ttgagacgca gagaatagag tggaacattt atcgggaatg     56940
     tatgccggcg cggggagagt cggaaactac tcaaccttcg cagctggaca cccgcattaa     57000
     ccctgtgaag gttgtagaat tcgtgattat gggatggccc gcccctctcg tggcgatcgg     57060
     gtaggatcgc cgctggtttg gagagaggag cagaccgatg gatatcatga ttctcggcat     57120
     cgatcttggg aagaactctt gcagcgtggt gggcatggac gccgccggcc gggttgtttt     57180
     gaggcggaga cttcggcggg gaacgttgga aagtttcgtt ggcgagcttg ggtcgtgcat     57240
     tgtggcaatg gaagcatgtt gcggcgctca tcacctcggg cggattttcg ccgcgcgggg     57300
     ccatgaggtg cggctgatgt cgccggaata tgtccgtccg tacgtgaagg cgcagaagaa     57360
     cgatgatctc gacgcggagg cgatcgcaga ggctgcgacg cggccaacga tgcgtttcgt     57420
     gccggtgaag agccaggacc aatctgatct ccaggctttg caccgagccc gggagcgtct     57480
     cgtctcggaa cggacggcgc tgatcaatca cttgcgggcg ttgctgctgg agcgagggat     57540
     cgtcgttccg caaggccgga ggaaactgga agccgagctt gagacattgg ccgaagatgg     57600
     cggttttgcc gcgttgagcc cgcgcatccg gacgttgatc gaagatcttc gggcggaatg     57660
     gcgttcactc gaccagagga tcaccggctt cgacgccgag ttcgttcagt tggctcgtga     57720
     cgacgtggct gtgcgacgtt tgaccaaaat cccaggaatt ggaacgataa acgctacggc     57780
     gctggcggcg gcggtcggcg aggcgcaggc attcaaacgt gggcgagaca tggcggcgtg     57840
     gctggggctc gttccacggc aaatgacaac gggaggaaaa ccgcgcctgc tcggcatcag     57900
     caaacgcggc aatcgttatt tgcggaagaa cttgatccat ggcgcacgag cggcgctgcc     57960
     ttatcttgtc gaacgcgata cgccgttggg ccgctgggcg cggggattgc tcgatcgagc     58020
     tcataagaac gtggtcgtag tcgcgctggc cgcgaagctg gctcggatcg catgggccgt     58080
     tttggcgcac ggttgcaatt acgacgccca attcgaagcg gcggctgcgg ccgcatgacg     58140
     gaatcgcccg aacagcgctc acagttgggc gcgaaagggc agtcgatgtc tgcgtgaggt     58200
     gaaaggaaga tggcctgaca gtcgaacggc ggcttgaaaa cctgactcat tgaacggcct     58260
     ccgaggccgg cgtgattatg aggatcaggc cgcgcggatc tccatcttgg ccgggttcga     58320
     aacccgagac cggatacgtt gaagcagact gattagagcc agatgaaaat caccccttgc     58380
     ggacggggcg ggccatacgt tcactgaggc ccgccggcat cgaatgtgcc aaggtagggt     58440
     cgaataacca atccgatgaa agggccgcca gatggaatgc aagcggattt cgatcgacac     58500
     gtccaagcat gctttcacga tccacgcggt ggacgagaaa gaacgaccgg ttttgcgcca     58560
     cgacctccgg cgcgcgcaga tcgagcggtt cttcgcccgg ctggcgccga ccgaggtggc     58620
     gctcgaagcc tgtgccgggg cgcaccactg gcgccggcgg cttatcgcct tgggccacct     58680
     ggtgaagctg atcccgccgc aatacgtgaa gcctttcgtc aaacgcggca agaatgatcg     58740
     caacgatgct gaggccatca gcgaggcggc gtctcggccg acgatgccgt tggtgccggt     58800
     gaagacggtg gcggagcaag ccgcggcggt catagtcaag catcgagaaa tgctggttgg     58860
     gcagcggacc cagacgatca acgtgctccg cgggcacgcg gcggagttcg gtatcgtcgc     58920
     ggccaaaggc aaaggaaatg tcgaagcgct gctcgctgcc ctggcggccg agccgacgat     58980
     cccggagatt gcgaaggcga tgttcgctga aatgggtcgg cacgtcgccg atcttgatgc     59040
     gaagatcgtg gcagtcgacc gacaactcct cgagcagcac aagggaagtc cggtcagcca     59100
     gcgactttgg gcgatccccg gtgtcggacc gatcaccgcg atcaccatgg cgctgtcggt     59160
     caacccggcg aacttcgaga gcgggcggca tttcgcggcc tggctcgggt tgacgccacg     59220
     ggagcattcc acggggggca aacatcgcct ggggcggatt agtaaagccg gcaatgagag     59280
     gttccgacag ctgctagtgg tgggggcaac ggcattgatc cgcgtcgcca agccagggcg     59340
     gcggtcggcc accgcttggc tgctgggact gctggagcgc aggccacgga aagtcgcggc     59400
     ggtcgctctg gccaacaaag tcgcccggat catctgggcg atgatggcgc gtggtgaggc     59460
     ttaccggcat cagccggcct cggcctgatc cacgcaccgg tgccggggtt caagggcgtt     59520
     aggagaagat gacgatcggt cgatccgacg aatggcacac atccagtgcg cgacaaaggc     59580
     atctcaaatg ccggttgatt gttttggaat gccattcgcg gaacccatct gggccggcgg     59640
     ccgtgatgcc gcatcaagag gccggacaca ttaccgcagt cgaaccgccc ccaaatcttc     59700
     ccgccgtcca cttgaacccc gcgggccgtc cacacatgtc gcgcgacaga ggcggtcgtg     59760
     acttggggcg ggtggatgga ggcgtggtcg ctattcgggc tttcggagca tattgagcgt     59820
     ctgagcaaga ctggggaccc gctggaggtt ctggaggcgc aggtcgattt ctagcatttc     59880
     cgtggctggc tggttgaatg gctgggttac ggcgccggag ccacgtgcgg ccgtcctccc     59940
     ttcaatcctg tttcgatgtt caaggcgccg atccttcggg accagcacaa tctgagcgat     60000
     gccaggatgg agttcatgat ccgtgaccgc ctgtcctgga cgcgcttcct gcgctttgat     60060
     cttggcgtac cgacgccgga tgagaacacg atccggctgt tccgtaacaa actgaccgag     60120
     accggcacgc tggagcgagt gatgagggcg ttcgactggc ggttgcagaa caagggctac     60180
     atcccgatgt cgggccagat cgtcaatgcg tcgctggtgc cgatgcaacg gaacacggac     60240
     gcggagaagg aagcgatcaa ggctggcaag acggcccgtg agatctggcc gaatgagcag     60300
     aacaaggcgg cccagaagga cacggatgcc cggtggacgc tgaaaattgg tggcaagatc     60360
     cggtatcggc cggacggcac gccactgccc cagattgcgc tgccggtgtt cggctacaaa     60420
     tcccacatcg ccatcgaccg gcgcttcggc ttcatccacg agagtgctgt gacctcggcc     60480
     gcgcagccgg atgggaggat gctgtcatga ctggtgagca cacagaattc ctcttcggag     60540
     gtttgggcgg acagtgccta tcactacttt ggcagaagtt tgttgtgatg tccgatgagg     60600
     ctacatccgc aatgagggca atgccgcggc ggtgagcgag aaagacggtc aaggatggct     60660
     tggcgcactg ctggcagggt gggttgggga ggcggaccgg ggactctttt ttttccgtcc     60720
     cgcctgagcg agccttcggg attgcaagaa ggcgtaggcc atcatcgtca tcagggcatg     60780
     gcggtggagg ccagtccagg atcggccctc gaagtggtcc aagccgagtt cctctttgag     60840
     ttgctgatgg gcctgctcgc agatccagcg cgccttgatg gcgccagcca gagctctgat     60900
     cggggtgtcg gcaggcaggt tcgagagata gtattttcgt tcgccattcg agcgatgctc     60960
     acccaccagc caggcttcct ctcccggcat gtgctgggca ccggcagaac cgattcgctg     61020
     gggcgcgcca tcagcaatgc gtaccctcat ggcggcaaag cgggctgtca gacgcccctt     61080
     tgttcccttg cgccaaccga gctgccgcca cttcgcgcct tcgagcatcg cttgtgccgc     61140
     catggatttg acgtcgggca catgacgcac ccgtgggcga ccgcggcctg cgaccgggaa     61200
     gatcagctgc acatccgccg gatagacctt ctggtgccgg gggatgccga cagcccagca     61260
     aaggccgcgt gtactcagcg cctgccggaa cggagccgac agcccgtaac cggcatcggc     61320
     cagcacacag ccgaagcgca cgccggcagc gatgacgcga tcgatctcct cgatcgcgat     61380
     ctcgggcttt gtgcggtatt cctggaaaca ggcaggcacg cccgccttgt ccatgcgcgc     61440
     gatatcgctc gtccagcttt ccggcagaaa taaccgcaag ctcagcatga gcggaactgc     61500
     gcccgaagcc agcgtcaccg acaccagcgt ctgacagttg gcattcttgc cgagcgccgt     61560
     agcatattgc ggcgcgacgc caaccgaggc cttacccttc ttgggcaagg cggtgtcgtc     61620
     gatgatcagc caggcttcat tgccaccaac caatttatcc gcttggtccc acaaggtcgc     61680
     ttccagtggc gcgctgtccc acagaccagc cccgatgaaa tgatgcagcc ggtcatagga     61740
     aatggcgtcc gaccgggccg ccatgggctg gatgcttttg cgatcacccg gcccgatcaa     61800
     gccggcgata taagccgggc acatccgtcg tcgcgtcttg ttgcccagac ctttcagata     61860
     aggggcaagc caccgctcca gatctccctg ccagtcctcg tccatcgcca gcctccatca     61920
     aagctggctc cccatgaatc acgcaatccg tgccatggga atcctaaaaa tcagatttct     61980
     gccaaagtag tgctatcgcc cgcagacaaa cgagaaatgg ctgccatcac cgatgttggg     62040
     cagccgcatt caccggcgca agccggccgg caagccgatg ccgcgacatg tcgcgcgggc     62100
     caatggcgcg aaatcgtcga tccgcgccca tgtcgaacac gtcttcgccc atcagaagaa     62160
     cagattcggc cggttcatcc gtaccatcac catcgaagaa gggccgccac gcctcgctta     62220
     cgaatcacaa gtgattcaga cgacgcaaga ccctgcggcg cataaccgac tctgccgact     62280
     cagtttgttt gcggacggac actaagtaat ttccgatact atcagtgtcg gcgcgaatca     62340
     tctattctat aaaattgaac acgcgagcga tcgccttcga aacggtgttt cgggagtatc     62400
     cgccatgatg acgacgtcgc ttgcggaatc ggcagtgtcg acgctgatga tcagtcatac     62460
     agacgttgcg gaaacgacca catcgtaagc cagttgtccg gcgatccaac cgcgcacaat     62520
     cccgccagtg gacccaccag gaattagaca agatgcagcc aaatcttcag atttgttccg     62580
     gtaggctaca cgggcccaca aagcacatac tgcgatggct aagtgccccc gggacaaccg     62640
     atcgacaccg tcgagtagac cacgcctacc gcgatccgcc tgccttgttg cccctgatct     62700
     gaattgcgac aaacccacgc agcggtcgac aatttttttg gcactgaagc cgaaacaatc     62760
     ggcgctacat ctgcgtgccc actagtgcgc tgtcggctta aaaccagacc gacgagtaag     62820
     tttttgttcc tcagaactgg gtgcatacca cccgccgact atcgcagata cacttgtgcg     62880
     ttcggggcgg gcattacgtc aaacagtggt ttcggggaac cgtccaattg cacatcggga     62940
     tccactcgtc atcttacgac ggaaaacgga aaggatgatc accatgcaaa agagtttcag     63000
     gattgcactg gcgctactcg tcttgatagc cgtagcgccc ctgcttgacg gctgccatac     63060
     gactgccggt gtcggtaggg acatctcttc gggaggcaat gcgctcacaa gcagcgcggt     63120
     aaagcacacg ccatgacggc ccgcaccaaa tcaatccaaa tcaaggccat aacgcagatc     63180
     ctgaccctgg caacgatgat ctgcgtgtgt gtaaaggatc cgcataacat ataacgccaa     63240
     gacgtcggcc aaaatctcga taacggcgac cgtgttgctc gacgacaagc gaacgtcggc     63300
     gtatagcaat cacgtccgca gcgagaccca tcggcctagc tgctacccat tacgaagaat     63360
     cccgatccat tgcatcgatc attctgatac ttccaatcgt cctcttgtag ggtggcgact     63420
     gttactacgg ttacttttgc atctattata gcggtcgtag cttttgaggg ctactcggcc     63480
     taaccatcat cgccttggtt ctgataatgc tattcggcgg cattcatcgc tgggtctaat     63540
     actgaccgca gctaggtgcc ttttggcttg tgcgagcacg ctctggcagt gtccctgtag     63600
     acgtctcttt cgaggggtgc gccgttattc gtactttgca gtatcagatc gctagggaga     63660
     tcatggggta acggttgctg agatgccagg cgggccgctg gctccttaat tggctatcaa     63720
     gcctacagcc aacgcggacg ctccaccccg tactggcaag attgcaatgc gtttcctgta     63780
     ggataggaaa atcgactgga ggagcgccgt ggtctcaaat tgaaggaatg aactcatgtt     63840
     agccaacgaa caaatgattg cgccatttcc gccaggatca gtggaaagag tcgccttgca     63900
     atcacagcag tatccgatgc ccaaaggcta ttatgatcgc agccgtaata tgacatggtt     63960
     gcaacttctc tcgaaggaat tcggaaaggc ggggattgat tggtcagtaa cccattcgga     64020
     tagaaacgtt acggtgcgtt ttcgctctga tgccgagggt attctttgga cgacgcgcac     64080
     ctcgtcgggc ggctagcgcg ctcacggata cacttaatcc aaacggcgta cctcgaacta     64140
     cctcgtccgt ggcggcacca gtgctgccag tgcaaggcac cacgaccacg cagatcttac     64200
     gttcgacaac aactcagtaa ggtcgggaag ttaggtatca attggctgca tcaacatttg     64260
     ctgattgatc tcgcaccgat ccggtgcagc cgggcatcgg tcacggtgta ggcaacactt     64320
     gaccagattg acctgcaaaa tagtttggaa cggatacgct catgggcctc atcctgctta     64380
     tattggtgct gatttttctc tttggcggtg gaggatacta cggttaccgg tcgggttatt     64440
     atggaggacg cggctatggg ggaatcctga ccctgctcat cgtcatcctc gtgctattcc     64500
     tgttgtttgg tggcagcttt cacggcccga tgtcccattg atcggtgtgg tccgaccccg     64560
     ttcgggtgga ttccggacgc cggatccgca tcctgcgaga gtgctggcta cggcatattc     64620
     cgacacgcac tgcccgcatt cagcctgatg ccgggaaaaa ttgggcttgc cgggacgggt     64680
     aaccgcctcg acaccccggg cggggtgggt tttctcgaga tataagggga gatggccgat     64740
     ttgattacgg accagaacag taagccgcag caaggcgaac tgccgaccac acacatcgac     64800
     gcgctgacca actcgttttc gcagttcctg cgcatcgaag ccacgagtgg tgccgttctc     64860
     ctgttggcca ccgtcgttgc attgacgctt tccaactcac cctggtccga tggcttcaga     64920
     tctctttggg agacaccaat cggcattcag atcggtgcgt tccagtttct gcgctctttg     64980
     cgggatctga tcaacgacgg tctaatgacg ctgttcttct tcatcgtcgc gctcgagatc     65040
     aagcgcgaag tggtgcttgg tgaacttcgg aacccgcgca tggtggctct ctcggtcgta     65100
     gctgcggcag gaggcatgct tgtgcccatg ggcttgtatc tggcgctgca gcatggccaa     65160
     cctgggcagc atggttgggg cgtcgtgatg ccgaccgaca cagctttcgt catcggctgc     65220
     ctggcgctcc ttggttcgcg tgtgcctccg ggcctacgcg tcttcctgct atcgcttgcg     65280
     gtcgtcgacg accttgccgc catcctcgtg gtcgccgtcg gttacagtcg atcaatcgac     65340
     tggactgccc ttgcgctcgg cgccgtcgga ctggtgataa ttcgggggat ggcattactc     65400
     ggcgttcgta acatccgcgt ctactttctg gctggggcaa taatctggct cgccgtcaat     65460
     gcgtccggca tccacgcgac gattgttggt gttatcctcg ggctcatgac accgacggct     65520
     ggctgggtga gcgaccagcg tctgggggaa atcttgcgaa aggtgctctc ctatcccccg     65580
     ggagatcatt ggagtggcga taccgaggat aaccgggcgc tgcaggttgc cggtatcgcg     65640
     gtgcgcgaga cccgagttgg acagtggggt gagaacggat ggggaacgaa tggatataag     65700
     tcattgatat ataatgggtg acatttgggc gcgaaaaatg tgtagtaaca acagttttgg     65760
     ctgaatggca gttttttgtt gaattcggca tggcattgcc gtcacaacat cagcatgttc     65820
     gtcgtcgaga gagtcgcccg cggccacagc tatctctacc tcgtcgaaag cgtgcgcgtg     65880
     ggcaaatccg tccgccagcg caccatcaaa cccctcggtc gcaaggatgt cctcgccgca     65940
     tccggcgaac tcgacaggct cgtcgcctcc atcgcacggc acgccgaacg ttccatcatc     66000
     ctctccgata tcgatgccgg ccggatcgcc gcccacagga tcggtggccc cctgctgttc     66060
     ggccgcctct gggaccggct cggcatcggc gaggtgctca acaacctcct cgagggccgc     66120
     cagttcggct ttgccgtcga gcgcgccgtc ttcgtcgcca cactgcaccg gctgttcgtc     66180
     tcgggctccg accgctcctg tgtcgactgg atgcagagct acgccatcga tggcgcggag     66240
     gatctggcgc tgcaccactt ctatcgcgcg atggcctggc tgggcgagga actcggcgac     66300
     aggcaagcgg gcgccctcgc gccacgttgc gtcaaggacg tgatcgagga gcaactcttc     66360
     gaacgccggc gcgacctgtt caccgatctc agcctggtgt tcatggatac gacctcgctc     66420
     tccttctacg gcgagggcgg cgagacgctg ggccggcgtg gccattcgaa ggattatcgc     66480
     cccgacctcg cgcagatgat cctggccctg gtgatcgatg ccgaagggcg gccgatctgc     66540
     accgagatgg tgccgggcaa caccgccgac gtgaagatcc tgatgccggt ggtcacgcgc     66600
     ctgcgcgagc gcttcggcat cacccgcgcc tgcgtggtcg ccgaccgcgg catgatcagc     66660
     gccgatacca tcgcggcact ggaagcgctg ggggtggaat acatcctcgg cgcgcgcgag     66720
     cgcaccagcc gggtgatccg cgacgtcgtg ctgaaggaca aggccgcgat ggtcccgctc     66780
     gtgctcgatc gccagcatgg cgagacccag ctgtgggtga aggaggtccg gattggcaag     66840
     ggcaaggcgg cccagcgcta catcgtcacg gtcaatgagg ccgaggcgag aaaggacagg     66900
     gaggaccgcc aggccatcat cgacgggctg caggcccagc tgaagaaggg cgacaaggcg     66960
     ctggtcggca actcggccta ccgacgttat ctccgcagcc gcggcaacgc cttcgagatc     67020
     gatccgggca agctggccga ggaggcccgc ttcgatggcc tcagcgtgct caggaccaac     67080
     gcaagggtca cgcccctgca ggccgtgatc cggtatcgcg acctgctcga ggtcgaggcc     67140
     ctgttccgcg ccgccaaggc cagcttcgat acaaggccga tctttcacca ggctgacgcc     67200
     gcgatccgcg gccacgtttt ctgttccttc ctggccctga cactcgccaa ggaactgaac     67260
     cgcctgtgcg gcgccagggg cttccagccc gaatggcaga agttgctgaa cgatctcgac     67320
     aggctccagc aggcaaccat cgaaaagggc ggcaaggtca tcaccacgag gacccacgtc     67380
     accggccagg tcggcaatgt cttcaaggcc gccggcatcg cgctgcccca caacatcagc     67440
     gagcaccccg cagactgaag ccgcggccac gcaccgccga cccaacgccc caaaaatgta     67500
     gtggcaacac ccgcacgcgg gcaaataaac tattgatatc accagacttt ataaaaccaa     67560
     ctgtccaagt ggggcgagac gttgtcgccc gtcgagaggc tcgaggccat gctccatccc     67620
     tgggtcgcct tcggcgttat gccgcttttc gcgcttgcaa acgcgggggt accgatcacg     67680
     atcaagggac ttatcaaccc agtctcgctg gcggtgatgg cgggcttcgt cctcggcaag     67740
     ccgatcggcg tcacagcatt cgcatggctg ggggtgcgca cgggtgtcgc cattcggccg     67800
     gcggggctca cctggggggg acttgtcggt ggggctcttc ttaccggtat cggattcacc     67860
     atggcgctgt ttatcgccgg ccaggcattt caagatgcca cgctcaacgc agcgaagctg     67920
     ggtatccttg ctgcctcagt cgtctcttct gttgctggtc tcacgctgct gtgcgcgttg     67980
     cctcggagtg acggaacgct cgatgccgat ttccactgaa ccggtcgttg agcgcccggg     68040
     tcagcgtcag acgttcagcg ctgcgtcggc cgtcaacgcc aagggcgggt tctggtactg     68100
     cacctatgag ggcggcctga ccgccgaact gttcgtgcat ttgctgcgtc agttggtgcg     68160
     ccatcgcgtg cgcccggtgc gtaagcgcta tctgaatgac ggccttgctt ttgcgagcaa     68220
     gcgctacacg gcggctggca gagcagcctg agttttccag ttccacggca tcaggctgcc     68280
     gatttcgttg gccttggtgc gtccggcgac gatgcgttgg attacgtcgg tgagccgggc     68340
     gagcggttcg acgccgctga gcctggcgga cctgatcagc gtcgccatca gcgcacagtg     68400
     ctcttcgccg gtgtccggtg cgacctcatg atgcccggtc cttcgaagca ctcctacgag     68460
     tgctcgcagg agcggctcct atcgcctcaa ccggctccac tttgaaaata acaggaacac     68520
     agacgtcgct catgcccaca aacatcagcc tcagacgaca ttacagcaat aaagtcgtcc     68580
     ccactgtcgc gcgacgatca acgtgagaat ccggcgtcat atgtggacgg cctcgttggc     68640
     aagacatttt ttgtgctgaa caaactggtc ggcagcggtc atatgtccgg ccttccggtg     68700
     cggtgcattt gaccgctggc ctgttgattt ccaccgagat ctgacccggg attttcatcg     68760
     agaattgatc cgggttgaag gtatgtcccg cgttgcgagg gacggtcaag ctgctggtga     68820
     tttatccttt ctggctttgg gtttggtggc gctgtccttg aagcggaagc tgtcattgcc     68880
     ggtctcgatg atgtggcaat gatgggtcag gcggtcgagc agggctgtgg tcatcttggc     68940
     atccccgaac acgccggccc attcgctgaa gctgaggttg gtggtgatga tgacgctggt     69000
     gcgttcgtaa agcttggaga gcaggtggaa gagcagtgca ccgcctgacg ggctgaacgg     69060
     caggtagccg agttcatcga ggatagcgag gtcgaggcgc agcaggcgct cggcgagctg     69120
     gcctgctctg ttcattgcct tttcctgttc aagagcattg accagatcga cggtggcaaa     69180
     taacctgatc tttttgcggt gatgttcgac cgcctggacg cccaaggcag tggccatatg     69240
     gcttttgcca gttccggggc cgccgatgag cacaacatta tcggctccat ccatgaagtc     69300
     gccgcggtgc agttgccgga tcagggcttc gttcacctcg ctggcggcaa aatcgaagcc     69360
     ggccaggtcc ttgtaggcgg ggaaccgggc tgctttgatc tggcaggaga tggacctgac     69420
     ctcgcgctcg gccacctccg ccttcagcag ctgggagaga atgggcacag ccgcatcgaa     69480
     ggcgggggcg ccttgttcga tcagctcgcc aacggcctgg gccatgccga acatattgag     69540
     gccgcgcagc atcaccacca cggcggcgct tgcaggatca tgacgcatgg cgctggtccc     69600
     tgtcgcgcag ggcgtcatag cgctcgacat tggcaaccgg ctcgcgtgtc agacgcagga     69660
     cctgaggtgc gtcgatgggg gctgccggcg gtgtcttccc gtccgtcagc cggtgcagaa     69720
     cgttgatgac atggatcttg gtggcaacgc ccgcctcgag cgccagttcc acggcgcaca     69780
     gcgccgcctg ctcgtcatgc tgaagcacaa gggcgaggat ctcgaccacc tcacggtcgc     69840
     cgccggggcg cttgagaagc tgggtctgca attgcctgaa ggcttccggc agctcagcga     69900
     agggcgcgcc attgcgcaaa gccccaggct tgcgctgaag gacggcgaga taatgccgcc     69960
     agtcataaac cgtttgcccg gcaggtgatg accgcgctct ataatccgcg gatgctcgca     70020
     cagaatctgc ccctccgcgg cgacaacgat ccgttccgga tagacccgca ggctcaccgg     70080
     ccggttcgca aaggatgccg gcacgctgta gcggttgcgc tcaaaatgca cgaggcaggt     70140
     cggtgacaca cgtttggtgt gctcaacaaa gccatcgaag gaacgcccca gcggcatcag     70200
     gctagcgcgc tcggtctcat gcacgtcggc gatggtgcca ggcagagtgc cgtgctggat     70260
     ttgcccccat tgctcgatgc aacatgcctc aagccaggcg ttgagcgcag ccaggtcagg     70320
     gaagctgggc agagactgcc atagccggcg ccgtgcatcc tgcacgttct tctcaacctg     70380
     tcccttctcc caccccgatg ccgggttgca aaaatccgtc tcgaacagat aatggctggc     70440
     catggcggca aagcgtgtag cgcgacaatc aggatgagaa gcgcgacgat caggatgaga     70500
     aagtgatcgc gacctcggaa cgttaatcgg attggtttga tgctggcaag cgggtttcgg     70560
     cgacttgatt gtcgtggcgc gacaatctgc cgttttcggt gattgtcgct cgtgtgggtg     70620
     ggcgtcctgg tccggttcgt cgttggatgg cggttttgcg gcgatagctt tcgacgttca     70680
     tctcgaagat ggtggcgtgg tggacgaggc ggtcaacggc ggcgagtgtc atggcgggat     70740
     cggggaacac ctttccccac tcgccgaagg gctggttggc ggtgatcatc agggaccggc     70800
     gctcgtagcg tgtgctgatg agttcgaaga ggactgaggt ttcggcctga tccttggtga     70860
     cgtaagcgag gtcgtcgagg atcagcaggt ggaatttgtc gagcttggcg atggtggcct     70920
     cgagggcgag ttcgcgacgt gcgatctgga gcttctggac gaggtcggag gtgcgggtga     70980
     acagcacgcg ccagccattc tcgacgaggg cgaggccgat ggctgcggcg agatgggact     71040
     ttcctccgcc gggtgggccg aaggcgagga gattggcgcc ggtatcgagc catccgtcgc     71100
     cggagcagag ggcgaggacc tgggccttgg agatcatcgg cacggcctcg aaggcgaaag     71160
     tggcgatggt ctttccgggc ggcagcctgg cttcgaggag gtggcgctcg atgcgcctgc     71220
     ggtcgcgctc ggcgacctcg tgctcggcga gcgtggcgag gaggcgtgcg gcgggccatg     71280
     cttccttgtc ggcgcgggcg gcgaagtcgg gccagacctg cttgatggcg gggagcctga     71340
     gctcgttgag cagcagggta aggcgctggg cgtcgacggt gcgtgcggtc tcgctcatgc     71400
     ggctgctccc tggagcagga tgtcatagct ggcgagcggc atggtcggga tggtgagtgc     71460
     gggcaggctg gcgggatcgg gtgcgaagcg ctggcggatg gcattgaggt cgggctgtcg     71520
     gccggcgttg ctatcggcgg cgaggacgct ggcgagttca gcctcgcagg cacgctcatg     71580
     ggcgatggcg aggagttcga ccatgatcct gcacgcgtcc ctgggcggtg tctgctcgag     71640
     caggtgctcg aaggtctggc gataggcatc gcgcgggaag agctggtggc gatagacgag     71700
     attgagcagc gccatcggtt tgcggcgcag gctgtggatg acgtggcggt agtcgacgac     71760
     gtggccgtgt ctgccatccg gttgtggccg gccgcggggg agtgtcatca gcggggtggc     71820
     ggcgaggaac agctcgagcc ggttgtcata gaggcggacg cggagccgct ggccgatcag     71880
     gcgggagggg acggtgtaga agaccttcct gagggtgaag ccgccggagg aggtgatggt     71940
     gacgacggtc tcctcgtaat cggcggtgcg ctgctcgggg agtttctgca gggcggcgcg     72000
     ctcggcgtcg atgcgctcgg cgtggcgccg gttctggcgg ccgacgatct cggcgatgaa     72060
     gcggcgatag gcttcgagat cgacgaagac tgtgctgcca cgcaggagaa gggcgtcgcg     72120
     gaccacgcgc ttgagatggc cgtgggggct ttcgatggcg ccgttctcat gagcgacacc     72180
     gcgattgttg cgcgacgggg tcatgccgta atgggcgcag agcgcgtcat atcggcgggt     72240
     caggtcggcg acgttctcgg cggccaggtt gcggaaggcg gcggagaggc tgtcgctgcg     72300
     atgttcgcgc ggggcgccgc ccagaagcca gagggcgttc tgcagcccct cggcgagggc     72360
     gacgtagctc tcgccgccca ggatgacatg ggcgtgctcg aagccggacc agaccaggcg     72420
     gaagtgatag agccggtggt cgagcggggc gccggcgacg atgatgccga gctcgttcat     72480
     gtcggtgaag tcggacaggc ccatcgcgcc cggctcatgg gtctggcgaa agatgacctc     72540
     ctgctccggc ccgtgcagcg cgcgccaggt gcggatacgc cgctcgagcg tccgccggac     72600
     acccggggcg agatcgggat gccgccggca catctcctcg aagatcgcca cggccctgag     72660
     gccgggcgcg gcttccagca gcggcaccac ctcagcgtcg aagatcgccg ccagcggatc     72720
     cgggcggcgc cggccgcgtg gcggcttcgc cgatgatggc aggtgccgct tctgctccag     72780
     ccggtagccc gcggccgtgc tgaagccggc cctggcggcc gccagggcaa cgccgtctgt     72840
     ctgtcgatat ctcatgaaaa gcctcttctg gtggtcgttg atgtggcggc cgggcacgaa     72900
     ggtctccccg ttgcgaggag gcatcctccg cgacccggcc ggccgcgacc acggcggcgc     72960
     cctggcaagg acgccgcccg gctggggagg caccggctcc gggctacgcc cttcgccggt     73020
     gcctccccag ccgtcttctc atcctgattg acgccggatt ctcacgttga tcgtcgcgcg     73080
     acaccggggt gcataacccc gccgtgaaag cggcgatgac cgacaacgtg aacatgcggc     73140
     tgccagtgcc ggtgcggatc gttcatgcgg cgatttatca gcgcgactat aatgacctcg     73200
     gcttcgtgtg cgggcaggta aagcacgggc agtggcagtt ttacgtggtg gatatgagcc     73260
     tagtgcaggt aggaaaatat gcccaaacgg tgcgccggct gccatgagac ttgtgcgcgg     73320
     ataggcgacg atactggaaa atgtgaggag tgcgccgggc tccgtcaggt tgccgagtct     73380
     tggtgtggca cctaccccgg gtcttgatga tcgacatcga agccccgccg ctcaaagggt     73440
     accgcttccc ggggtcatgt gtggaacggc cctggattca agatcgacgg tgcgagaatt     73500
     tggcggcggc acgaatgcgg tcatgtgtcc ggcctgttgg cgcggcatca tggccgctgg     73560
     cccagatggg ttccgcgaat gacgtccaaa cacttctgcg gcacgagggc gtagaagccg     73620
     ataatcaccg cgtcagcctg atcgaactgg gcttcgagga gggacagggc ggcttgttcg     73680
     cgacgccgat gagtggtgac gcactgcacg actggcttcg gggtgagggc gatgcgtgag     73740
     gacggcgatg atcagggtct cggggttgga gccgaccgag cgtcctcagc cgggatcgaa     73800
     ttgctgcgac ggatccggaa ggagcaatcc cacctcgctc ggctacgtct tcggggtcga     73860
     ccggcgcctg ccgtcttgga ggccgtcctc acagcccaat aaagcgacaa catcgcagcc     73920
     tcgcggccac aacaaccttt ggctcgtcag gctatttgca ccaaagccac ctaaatttca     73980
     gttacgggca aagtcaaggc aattcacatc cgatgccgtg ggccgtccca cctcaatact     74040
     tttcagtggc aatcagaaga cgatcatcaa cacgcgatca atgtcccctt atgtcagcag     74100
     tatatggcgc aattgagcaa gtccggagtc ctgccacaaa aatggtgccg cccatccgaa     74160
     ggatgttccg gccagcgaga gcaataccca ggctgctcgt tcgccgtgtc gcaggctcgc     74220
     tgtggcggtc caactggcga ccgcagccag gctgcatgca acgacgacca ttggtgcgtt     74280
     gaggtgccag aaatatgtcg ccaaggcgcc cgaaatcggt ggcagcaaca gggccgcaag     74340
     cgccgtggcc ggttgggttt gttcccgctg gttgagcccg aggcgccaga tgatcagcca     74400
     gcttcttggc gcgatagttg cgcacatcag cgccagcgca acaaacgctg ccgcgaactg     74460
     gccgccaaac gaggccagcc aggcgctgtg aaggacttcc tgtggagccg ccccgtgcag     74520
     gatcgcgttc catacagcga tcgcttcggc gggcgggcgc ccaaacatcg caccgcttaa     74580
     tatcatcgat gatacaacaa tgaagcctgg tagaagtaca attgtgaata gtgcgactgc     74640
     agcggaaatg ctgttcattt cacgagaggc aagtggcaag acgattaatg tgggcgctac     74700
     ccagtagatt gcatttggcc aaaggacgaa catcgcggcg acgccaactc cgagcagtat     74760
     aagtgcccgc gtatcggcga tcgcttcgac gcgatcgatc gccagaatca ggaggcccac     74820
     cacgatcgtg taaaatatca ttgtgcctgc gcggtcgccg gcaccgactg gcatccccat     74880
     gtcgccgcca tcattcaggt cgagcgcgca atcgccaccc gcaatcccga aaccggcctg     74940
     ctcaagctga cacacgacac cgccttctac gtcgccaaca catccctcac cgccgccatc     75000
     gccgccaagg ccatccgcgc acattggggc atcgaaaatt cctcccacta tgtccgagac     75060
     gtcaccttcg cagaggatcg atcccggatc cgaaccaacc ctggcgtcat cgcccgattg     75120
     cgcagcttcg ccttcaacat cctgatgaac agcaaaccca gcgccagcac cctcagccag     75180
     gaccgctacc gcgccgcgct tgccgacctc taccacatcc tcgctctcaa tcactatccc     75240
     aaagcgttga acagccatgg agtctattat gggccaaagg tatacttggc agcttcggat     75300
     caattcgttg ttattttggt tgagacagcg tattggttga gtaattgatc cggaacagga     75360
     gtatcggcgc catgaaaccg ccgcagcctg ccgcccggca aacgcgccat caggcggtaa     75420
     cagatatagc agccatgaca acgccggggc gattccttgt cgtgggcatt ggcgcgtccg     75480
     caggcggact cgatgcatgc cgcaagttgc tcgacgcgat gcccgatggg tccgggatgg     75540
     cgctgatcgt cgtccagcat ctcgatccca accatccgag catgatggcc gatctgctgt     75600
     cggggcatac cggcatgatg gtgcgcgagg cggcggacgg attgccggtc gagtctgaaa     75660
     ccgtctatct cataccaccc ggcacgtatt tggcggttga cagcggtgtg ctgcgcctgt     75720
     cgcaacctct ggcccaccac ggggcacgcc tgccgtttga tttcctgttg ccctcgctgg     75780
     ccacctgcta tgggacgcag gcggcggcgg tcgtgctctc gggcaccggc gcggatggca     75840
     gcatcggcat ccgttcgatc cgcgaacatg ccgggctcgt catcgcccag catccgggcg     75900
     aggccgcgta tgatggcatg ccgtccaatg cgatcgcgac cggcatggtc gacgccgtat     75960
     tgtcgcttgc cgaaatcccc gcccgcctga tcagctacgc tcgttccctc gatagatcgt     76020
     ccgaacgtga acccaccccc gatcagccgc cgttcgaggc catcatcgcg atggtgcttg     76080
     gcagcaccgg gcatgatttc acgccctaca agaggggcac cctgcagcga cggatcgagc     76140
     ggcggatggc gctcgccgcc atagatcccg gcaacttgca ggcctatctc gacatgctgc     76200
     gcggcaatgc ggccgaactc gacctgctgg caaaggactt gctgatcaac gtcaccagtt     76260
     ttttccgcga tccggagatc ttcaagaccc tggaggagca ggtgatcccg gatctgatcg     76320
     cccgccaccc ccaagacctg ccgatccgca tctgggtcgc cgggtgcagc acgggcgagg     76380
     aagcctattc cctggcaatg ctgtttcgtg aggcgctgga ccgcgcgaaa tcgcaaagcc     76440
     agattcaggt cttcgcctcc gacatcgatg ccgaagccgt tgctgctgcg cgcgagggtc     76500
     tttatccgcc gaggatcgaa gccgaggtca cggcagatcg gctcggccgc ttcttcatcc     76560
     gcgaaggcga cagctatcgc atcgtgcccg agttgcgttc gctcgtggtg ttcaccgtcc     76620
     aggacctgct gaccgacccg ccgttctccc ggctggattt tgtttcgtgc cgcaacctgc     76680
     tgatctatct gcggccggag gcacaggcga aggtcatgtc cctgtgccgc ttcgcactgc     76740
     gtaatggcgg catcctcctg ctaggcactt cggagacgac cggccgcgcc gaccacggtt     76800
     tctcggtcat ctccaagaag gagcgaatct atcagcgcga cggcccgctc atgccgggcg     76860
     atctggggtt ctcgatcggg atcggcgata cgctacggct accgccgctg cgccgccctc     76920
     ctgacggtcc gccacgcccg gcgagcctcg ccgaactttg cggcagactc gtgctccacc     76980
     tttatgcgcc ggccgctgtg ctgatcaatg cgcgtcgcga aaccctgttc tcactggggc     77040
     cgaccgagcg ctttctcaag gtgccgccag gtcctccatc ccatgacctg ttggctatgg     77100
     tcgaccccgg ggtccgtgcc aggctgcgcg gggcgatcca gcgcgccaca gagggcggtg     77160
     ggcgcgtcgt ggtcgcgggc ggcaccgtgg agaccctgag tagcagcatg gcgttcgaca     77220
     tcgaggtctg gccggttccg gagaccgggg aagcggcgct gctggtctgt ttcatcgaac     77280
     gccagccgga caaaccgcgc gcgcaaggca agaccggcga ggagaatgcc ccgcgggttg     77340
     tcgaactgga gggcgaactt gccgccacca agaccgagct gctcggggtg attcgcgaac     77400
     tggagagagc cggcgaagat cagcgcgcgg tcaacgagga agcgctgtcg atcaacgagg     77460
     agttccagtc taccaatgag gagttgctta tctccaagga ggagctgcaa tcgctgaacg     77520
     aggaactgat cgcactgaac ggccagctgc aggaaaccct cgaacgcgag cgaaacgcct     77580
     ccaatgacct tgagaacgtg ctttacagca ccaacgtggc aacgctgttc ctcgacccgg     77640
     cgctcaatat aaggctgttc acaccggcca cgcgggaact gttcaatatc cttcgcggcg     77700
     atattggtcg gccgctcgcc gatctgaccg gggttgcagg catcgaaacc ctggctgacg     77760
     atgctgctgc ggtcttgcag actgcaattc cggcggcgcg cgagatcgag gcgccagcag     77820
     gccgctggct gacacgtcga atcctgccgt atcgcaacca tgacggcggg gttgacggca     77880
     tcgttgtcac cttcgccgac gtcaccgaac agaagcttgc ggcaagcgcc ctggaggccg     77940
     cccgacagca ggctgagcag gcgacgctcg cgaaatcgcg attcctcgct gcggtaagcc     78000
     acgatctgcg ccagcctctg caaacgatag cgctcctgca ggaactactg acggaaacga     78060
     caagtggcaa agccgcgctg gggctgatcc agcagatcaa gcagaccacc tcagtgatgg     78120
     ccggcatgtt gaacaccctg ctcgacatca atcagatcga ggccggcacc gtgaaggtta     78180
     cggtttcgac gttcgcagtc gacgagatcc tgcgcgatct tcacgatgaa tttcattttc     78240
     aggcggagga gcggaacgtc caactgcgcg tcgtagacag caccgtggtg atcgcgagcg     78300
     accgtgcgct gctcaagcag atgctgcgca acctgctgtc gaacgccatc aagtacacgc     78360
     aatccggcag gatcctgctc ggctgtcggc gtcggcacgg cggactcagc atagaggtct     78420
     gggacaccgg cgtcggcatt cccgaacccg aatggactgc tattttcgac gaacattatc     78480
     agatcgacaa tccggcccgc gaacgtggcc gcggcctcgg gctcgggctt gcgatcgtcc     78540
     ggcgcgttgg tgagttgctc ggacacccga tcgaactgcg ttcgcgcatg ggcagggggt     78600
     cgatgttcgc ggtccaggtg ccgttggccc cagctgtgtc ggccgcggca caggcggaag     78660
     cccagacctc ccgagccgtc gcactggcgt ggcgtcccaa ggcaattctc ttgatcgaag     78720
     acgatcccga tctgcgccga ctcctcgtgc agtttctcga aggcatgggg caccggattg     78780
     aggcagtgcc agacggacca gcagcaatgg cgcgggtcgc taccagcgac ttccgacccg     78840
     acctcattct tactgactac aatttgccga gtggcatgtc gggcaccgag gcggtgacgg     78900
     cgttgcgcaa gcggctggac gcgccggtcg ccagcctgat cctgaccggc gaaatttcca     78960
     gtgagacgtt ggccgagatc gagcaacacg gggccgtccg gctcaataag ccgatcctgc     79020
     ccggcgaatt ggccgcggcg atcaggaaga tagaaaccgg cgagcggtcg ccgacgaatc     79080
     ccatgcacgg cgaggcgtgc gtcggcatca tcgatgacga caagcctatt cgtgacagcc     79140
     tgtccgccct gctcggcaaa cacggatggc aggttgccgc ttacgtcagc gctgaggatt     79200
     tcctgcgcga cggctgccag ctttcccatg cctgtctgct actcgacgcg cgcctgcccg     79260
     gcatgtcggg catcgacctt ctgaaactgt tgcgcaagga agcgaacgag acgccggtca     79320
     ttatcatgac cggccagggt aatgtccagc aggcagtcat ggcgcttcat gcgggcgctg     79380
     cggatttcat cgaaaagccc attgcggttg cagatctact ggcgggtata gacgccgcga     79440
     tcgaactgaa ctcgaaccag gtccgccggg cccaggcgcg cgacgatgcg cggcagcgcc     79500
     tgggcatgct gacagaccgg caacgcgaaa tcatgatgcg tgtgcttgcc ggccacccga     79560
     gcaagaacat cgcttccgat cttggcatca gccagcggac cgtcgaggcg catcgcgccg     79620
     cgatcatgaa gaggactggt gtaaggtcac tccctgccct gacacggctg gtgctgttga     79680
     cggacatgtt ccatgataaa caggcataga tcgatcctga tcggaaaacg cttgctgatt     79740
     ccgggctcaa ttcgcccggg attccgagat taactcgccc gggatttcgg gaattattcg     79800
     cccacctgtt ccgactttta ttcgcccagg cgggcggggt tggccggatc ggattgaggt     79860
     ctctgctggc tggttcaggt tccctccctt tggctgatcg agggagcgga cgaatgccag     79920
     tggagcggat tgcgatgcgc gatgtgcgcc aaatattctg acgacggaca ggaaatgtct     79980
     tcaaggccgc cggtatcgcg ctgccccaca acattagcga acaccccgca gactgaagcc     80040
     gcggccacgc accgccgacc caacactcca aaaatttatt gatggggtgg acgccccccg     80100
     acggcatcta tgtgccaagg taggtgtcaa cacacctgca ggaggaggcg tccgtggccg     80160
     aggttactac aattggactc gatatcgcaa agcacgtttt ccaggcgcat ggcgttgatg     80220
     ccgatggcca caaggtcttc agccggcggc tcacgcgggc aaaagtgctg gagttcttct     80280
     ctgcgcagcc tcgcagcctg gtggcgctgg aggcctgcgg cggcgcacac cactgggttc     80340
     gcgaacttgc gaaactgggg catgatgtcc gtttaatccc gccagcttac gtcaagccgt     80400
     ttgtcaagcg caaccagaag aacgacgcaa atgatgccga agcaatcagc gaagccgcgc     80460
     agcggccgaa catgcgtttt gtcgcggtca agagcgagga gcagcaggcc tcggcgctgg     80520
     ttttccgtac ccgagatctt ctggtgcggc agcgcacgca actgatcaac gcgatccgcg     80580
     gtcacatggc cgaatacggc tgggttgctc cgaagggccg gatgtggatg gcgtcgctgc     80640
     gcgaggtgat cgatagcgac aactcgctgc cggtagcagc ccgcgacatg ctccgggtca     80700
     tgctggtcat gctcgatggg ctcgatgggc tcgatgggct cgattttcag atcgctgatc     80760
     tcgacaagga aatcgcccgg cgagctcgcg aggacgagga tgtgcggcgc ctaatgacga     80820
     tcccgggcat cggcccgatc gcggcgacgg ctatttgcgc tctggcgcca cccgcggaga     80880
     ctttcgcgcg agggcgggac tttgccgcct gggtagggct cacaccattg caaaaatcga     80940
     ctggcggcaa gcccaggcag cggcggacaa cgaagatggg cgagcgaacc ttgcggcgtt     81000
     tgctgattat cggcgcgagt accttgatcc gacacgctag caagaaaggc ccgaccgaag     81060
     gaggctggct tgcttcgatg ctgacacgca agccgcgaat gttggtcacg gttgcacagg     81120
     ccaacaagac cgcacgcatt gtgtgggccg tgctcacaaa gaaagaggat tatcgagctt     81180
     cggtagctgc agcagtataa actgccaagc tactgaggct ggcggagaag gtaggcgatc     81240
     gaaggagagt atgacacaac cgtcggcgag acggggtcgg aaaaccagtt gttaccaatg     81300
     tgcgcgagca cgctgtagtg ttttggatcc gatccgcgaa ctcccataca ggcccgcaga     81360
     acatctctgc acccagaggc cggacagatg gcagcatccg acacctgtgc accctcaaat     81420
     ttgcgcttgc tttccgcggg gcgtccacag atgccgcctc gatgtcgcgg tggcgggcga     81480
     tcatcgcatc cgccgcctcg gtgagggcgg cgctgccggc gcggggcatg cgcgcgaggg     81540
     cggccatttc gatcagttcg cgcatgtcgg ccacctcggc ggcgaaaccg tcatggaatt     81600
     cccgcaggat ccagccgccg cgcggctgct tggcgatgag cccgaagcgg gagaagccga     81660
     tcaggaattc gcggacggaa acggtgctgg cattgctgtc gcgcgccagt tcggcttcgg     81720
     agaaggtgtg cccgggccgc cagtcgccaa ggaggacgcg ctgcatgaag acgcgttcga     81780
     tatgctcttg cggcccgtcg gtttccgact cggtgtaata atccgtgcgt ttggggcggc     81840
     gcatgacgcg ggggcgggcc ggcccgcgct cgagaatccc gctcgcgatc atggtttcga     81900
     tggcggcgcg caccgtagtg cggctcaccc cgaactgacg ggcaagcacg ctctccgacc     81960
     cgaatgcgcc tggctctgcc gaaaggcccc tgatgtagtc gagcagggcg ttattcgttc     82020
     gcttcagcaa cgtgttcggc tttgccattc cttctgctcg gcgcggttca ggggacaaga     82080
     aaaaggcggc cacatgtcga gaaccgccag gaaagggaaa tgtttttcac gggtgtatga     82140
     cagaaaagcg taaccaaggc cccttctccc aatatcgaca ttgcgcctga ctcgccgcgc     82200
     cttcaagggc caaagagcta cctcgtccac aatacctctg gatcgtgccc cggcacgctc     82260
     gtctggggca gacctgaggg gcaggagggg gacgagaaaa aggcgacccg ggtccgatcc     82320
     gccttatcag gttctattgc gcaagaatgg ataaggcaga tcccatgacg ccttcgtcca     82380
     agagggtcac attgtgaccg ccccgtcggg tcttcaagcg ggatcgatgt tttgtgttgt     82440
     gctgggggga ggttgcggga gggagcggga tctccccatg tccttttccg aattttcggt     82500
     agtgtccggg gtcgtggtgg acttttgggc cctgtaacgg tgtagtttga ggtggccatc     82560
     ggatcagtcg gctatggtgg agttgcgaga cttcaacctg aagcctggag aacccgatga     82620
     ccgaagatag attaccactg gctgagctac tggccaaagc cggggacggc gattttctgc     82680
     gcagcgttgc ggaggcggtg gttcaactgc tgatggagac ggatgtggat gggctgatcg     82740
     gcgccagccg ctacgagcgc agcggcgagc gcgcgaccta tcgcaacggc taccgggaac     82800
     gcgcattgga cacgcggctt ggcagcttgc agcttcggat cccgaagctg cggcagggga     82860
     gctacttccc gccgttcctg gaagctcgcc ggacctcgga gaaggcgctg gccgcggtca     82920
     tccaggaagc ctggattggc ggcgtctcga cccggcgggt agacgagctg gtgcaggcca     82980
     tggggctgac ggggatcagc aagagcacgg tctcgaaact gtgcaaggac atcgatgaga     83040
     gggtgaacgc cttcctcgac cggccacttg ccggcgagtg gccgtatctg tggttggatg     83100
     cgacctatct caagcagcgc gaaggtgggc ggatcgtctc agttgcagcg ataatcgcag     83160
     tggcggtgaa caccgacggt cggcgcgaga tcgtcggcct gcacatcggc ccgtccgagg     83220
     cggagacctt ctggtcgacc tttctcaaga gcttggtccg ccgtgggttg cgtgaggtga     83280
     aactggtgat ctccgatgct catgaagggt tgaaggcggc gatccgccgg gtgatggggg     83340
     catcctggca aagatgccgc gttcactgga tgcgcaacgc cttgtcctat gtgccgaagg     83400
     ggcagcagag catggtgtct gcagcgttgc gtcaggcgtt tatccagccg gatcgcgtca     83460
     gtgccagcca gaccctgcgc catgtggccg accagctccg gggcaaatgg ccaaaacttg     83520
     gcgcgttcat cgacgacagt gaaaccgacg tgctggcgca catggacttt cccgcccagc     83580
     accgaaccaa aattcactcg acgaacccgc tcgaacgcct gaacaaggag gtcaagcgcc     83640
     gcgccgatgt cgtcggcatc tttcccaatg aaggttcgat catccgcctg atcggggccg     83700
     tgctgctcga ggccaacgac gaatggcaga cacagaaccg ctatatgcag atcgagggaa     83760
     tggtcgaact catggcaccc gccatcgatg ccgatacacc acgaatttcc accgtcgccg     83820
     cgtgaccatt ggccgcttca gctacaccag aatttccacc acattgacgg acgctatctg     83880
     gtatcgggac cgccggtcgg taacccctat atccccaaat aatcagttcg caccgcggtg     83940
     tttcgcatcg gactcacccc ggctcagaaa atagcgttga acagccccgg ggaatctccc     84000
     gcgagtcagt atcattgcgc aagattatta tatgacacgc aatacgagaa cgataatcac     84060
     aaccagcact accagtccca gaagtccacc gccgatatac atggcttcaa tccctttctg     84120
     atatcccata gtgatttttc gacaatgcaa cacgggtgcc gggtgtgccc cgcatttgct     84180
     ggatcgtggc cgccccttcc acaggccgtt ggccacaatt attttgaaac gcagagaata     84240
     gagtggaaca tttatcgggc atgtatggcg gcgcggggag agtcggaaac tactcaatgg     84300
     cggcggtact cgggatgatg cgcaagcttg agcttccccg cctgctgggc cggagggcgt     84360
     cgcgcgagcg caatctcgcc ctggcgctga ttgcgggccg tggggattgt caggttgatc     84420
     gaacgaggtg tgatttgacc gagacgcgat cgatcaggcg gcgagattgg cggcgtagtc     84480
     ggtccagagc aaaaatgcat cggctcttgc gtggcggtag gatctggcgg agaggcgatg     84540
     gcgttttggg cggaacaggg tggtgatctg gtcgtgggtg gcgagaaatc tctgggcatg     84600
     acctggggat ttgaaccgac ccatgatctt ttctcgtcgc ctggtgtgac gatgggatgc     84660
     ttcgatccgg ttgttcagcc gcttgtgcga tcggtgatcg gcgctgcggc aatccgtgcg     84720
     aagggcaacg tcgtagctcc gtagcttatc ggtcaccacg acgcgcggct gaccccatcg     84780
     gcgcatcagc ttgcggagaa aacgccgggc ggctcgggca tctcgccgct tctggaccag     84840
     gatttccagc acgtcaccgc gatgatcaac tgcccgccaa agccaatgct tctcgccgcc     84900
     aatggtgatc accatttcat cgaggtgcca tttgtcgccg gccggcagcc gatcgcgacg     84960
     gatttgcgcg gcgatctgcg ggccaaaccg atcgacccag acgcggatcg tctcgtagca     85020
     tactatcacg ccgcgagcgg ccagaagatc ctcaacgtcc cgcaggctga gattgaaccg     85080
     gtaatagctc cagaccgcat acgcgatcac cgatcgaggg aagcgatatc ccttcaaacg     85140
     tgcaggcaga gtcaaagcca tcatccgaaa tcgctacggg cacacgatca ccacgtcaac     85200
     ctgacaatgc tcgccaagcc atccttgacc gtcttgctgc aacaatggcg acccgttggc     85260
     ggagcccaat ccttgtccat gtcaacatcg actatgccct atcgtaaaga tgcttttgac     85320
     gcctgcgctt acgtcaggga tgaacttgtc tatcatcttt atatgaagat attcataata     85380
     tctaaaatct tgtcacgaaa tcgaaaatct acggctgatg gtcctgcgat ctacctgaag     85440
     cgtgtcccta aggaatgatt ggctcccaga accggcatta cggcccgtcc cggaagtagc     85500
     agggggtggc gtcagatagt caccgcacag gccgccggcg aaccccagag cccgccccat     85560
     agactgtcaa aacaccccgc cacaagctcg ccaggatggc aggcacgaat cctttctcac     85620
     ggctctttcg ccggccgcgt gattgatggc ccctgatcgc ctttcgccgc ggggagtgtc     85680
     gcgtctggtg tggtgcagac aagaaaaagg ggaccccatg gccggggtcg ccgagtggca     85740
     gatcgctaaa cgctgagacg attggaaagg caacccaaaa gccttgtcca agcttggagg     85800
     tgcgttttcc agccttggtt tcaaggcgag attacgctct cgtgtcatgg cggcagactg     85860
     accggcgtgc cacatcacat cttaaaacac gcatattgcg gccccgccaa accgggccat     85920
     atctgaccgt gaagcggaaa gcgatctccg ctgaggttcc ctcccaatct cttaacttgg     85980
     cggcctctaa ggccgccatt ttcctttttg gcattcgtca cggtcggtcc tgggcttcgt     86040
     gccagatacg gagaatccgc accgtatcgg atgacgtatc gacctcatac acgatcagat     86100
     acggccacac cgccaccagt tcccgggtgc cggcggccaa gcccacgcgg ccccgggtgg     86160
     gaaacagcgc caggctgtcg ccggcgagaa ccagtccacg cagaacgctt gaggctgcgt     86220
     tcgggttgag cagttcgaga taagcaacaa tgacatcacg atcttccagg gcaagctgat     86280
     gccattcgac ctgcatgctc agtgaccggc gatcgccagg ttcagccgct tgatctcgcg     86340
     caggagatcg gcgcgcacct gctcatgcgg cacagccggg cggagatcgg tccgggcttc     86400
     agcgacggca gcttcgagga gccgccgctc ggcctcgagt tcaagatcga tctggggaac     86460
     ggtccggttc ataacgatag tgtgataacc tatcctggaa cttcaggggc aactcctttg     86520
     ttcgttttat gttctgatct tgtctgtgtc gatactttcc taatggagag ggaaggttac     86580
     accaaaggat agtgaaggcg gcccgaagta tacaggtggt ggcgcatata ccaccggcgg     86640
     cggaggagga ggcggtggcg gcggcacata tacgactggc gggggagcat aatacacaac     86700
     aggcggtgga gggggcggtg gtggccctgg agaccaccat ccccaaggcc tgtgcgggcc     86760
     gtgcgcccag ggtggtggtc cgggtgggtg gccccagcct ggaggtggag gaccatgagg     86820
     accgccggcc catggtggcg gtcctgctat cgcgatgcat gtagaaccag cgatggctag     86880
     ggtgaagagg ccgacaatga gtccaaggtg cttggctttc atgattttca tcccctgctg     86940
     gaggcagctt gcacatgaat tatggcgtgt ttttggtggg cataaacgcc cgatccgatg     87000
     gtgctggcgt cggcgctcgc ggacgccgcc gccgccatcg cccggctcga ccaggccctc     87060
     gccagtcatt ccctggccca ggcttttctc caccgtgccc gcctcgaggc ggtccgccgg     87120
     caggccgcgg tcgacggcca actcatcaac ccctggcatc ttgccgcgac gatagaagac     87180
     ctgcgcctgc gcatggatcc ttacttgcgc atcatcgacc gcggcgacat cctcgacaaa     87240
     gcaaagttcg ccctcaccct gtaccagtgg ctcgtcgcgc ctgatttcga tcaagagggc     87300
     gaggtccaac gcgctgaggc gatgctggca atgcagccga ctgccctgcc gccgctgatc     87360
     gccgcggcgc ggggtttgcg ggactggatc gagacgggcg aaacccgtcc ggctatgcgc     87420
     gcggcgatga tccgcttctg gcgccagcgc ggcctactac gcctgcccgt cccactcacc     87480
     ggcgccgcag cgctcagggc cgaacaaagc tgggaccgcg acgtttggtt gccggctttc     87540
     ctgaaggcga tcgcgcgtga agtggcggat ggtctcgact tgctctacac catggagcgt     87600
     gcctggttcg atgcccggcg cagcatcgcc ggtcgccgca aggactctta catcgctccc     87660
     gccgttgatc tgctggcggc ggcggcgccg gtgctctccg cgaccacgct cgcccgcgcc     87720
     ctcggcatcg cagtgaggaa cgccatacgc atcctcaccg aactgattgc ggccgaaatc     87780
     gcggtcgagg acacgcaccg caccaagcgg cgcctgttcg ggctcaaggg cctggcgccg     87840
     ctgcgcgagg tggtgcgccc accctatcgg tcggatccga cccgtagccg cggccgtccc     87900
     cgccaaccca tcgaggagga ggaggccgag gttgcgccgc ctccattatc gcccctcacg     87960
     ccaatcgagc gccacgaatt cgattacacc gcgctcgagg aagcgatggc tgaactcgat     88020
     accgcgatcc gccatgcccg cctggcgctt caggcccggc cggagccaaa cccgccggcg     88080
     ccgtcccgcc ccgttttacc cgagggtggg gctgctcaat aatgcaccgc ggtttggcaa     88140
     acgccggtcg gaccttctgg cggcagggtc gccgagctga tagattcgct tgattgtttg     88200
     ccgataccac gggagcgcgc cgatgcccga gccagttcag ctttcgcttt tccccgaacg     88260
     ggcgagcctg gtgcgcatcc gccccgagcg caatgaatgg cgcttctacc gcctcgaaat     88320
     cctccccgat ctctttggct acaccctgct cgcccggcac tggggcagga tcggcaccaa     88380
     gggccgcatc cgcctcgacc cgcatctgga ttttggcgcc gccctcaacg ccctcgccgc     88440
     tttgacccgc cgcaagcgcc gccgcggcta tcacgagcgg gcagggtggt aacttccgcc     88500
     tgaaagaaag catggagagt gacttcaccc ggcgaaacgc cagggcggtt cacttcatgc     88560
     cggacaggcg aacggaattt ccccgacccg gtcgccggga gtttcggctg gccgtcacct     88620
     gccaagcgtg ggagagtgtc ggcgagatat cgcggaggtg cccgtcattg ccggaattga     88680
     gagcatgaac agccgacctg tgatggcgcg tgacagggct ggcgccgcag cccgcgcttg     88740
     tcaggccgcg tgccactggt gcgcgccatg acggtaatcg caaccgatct tgccgccctg     88800
     ctcggcacgg tgcggcgccc cggcgatttc tacgtggccg gcgagatcgc gttttcgccc     88860
     ccgtcgctgg atgtcgcgag tgtcggcccg gttgccctgc cgctgctgcc catccaggcc     88920
     cggcaactga tcgacgccgc ggaaccggcg ccctttggcc gcggcgaaca gaccatcatc     88980
     gacccgacgg tgcggcgctg tggccagatc ggcccggatc gcgtgcggct cggcggccga     89040
     cattgggcca ggacgctgga agatatactg gcccgggtca gcgacggcct cggcgtggac     89100
     gagccgatcg acgccgaatt ctacaagctg ctgatctacg accaaggcgg cttcttcgtc     89160
     agccaccgcg ataccgagaa ggtggccggc atgttcgcca ccctcacggt ggtattgccg     89220
     tcgcatttca gcggcggcga cctgatcatc cgacacaagg ggcgggaagc gtgccttgct     89280
     ctgcacaccg gcgacccagg agatgtggca ttcgctgcct tctatgccga ctgcgtacac     89340
     gagattctgc cggtcagcga aggctgccgc ctggccctga tctacaacct cctgcgccgg     89400
     agtcgctctg gccgcggtcg cgcgctgcac cccccggact acacggcgga acaggcccgc     89460
     atcgcggccc tgctgcggcg ctggacggac accgccggcc ccgacgctgc cctgccggcc     89520
     aagctggtct atccgctgga acatgcctac acgccggccg aactcggttt cgcgtcgctg     89580
     aaaggtgctg atgcggcggt tggcggtgtg ctgacgggcg cggcgcggga cgccgggtgc     89640
     gatctgcacc tggcgttgct gaccatcgag gaaagcggtg cggcggagta tgctgatacc     89700
     tatggatcgc gacgcggccg gtgggacacg gcggatgcct tcgaggccgg cgaggttttc     89760
     gagcgcagcg tggcgctgtc cgactggcga cggcctgacg gcacgaggtc cgatctgggc     89820
     gaaattcccg ttgaggagga cgagattgcg ccacccggcg cctgcgacga tctagcgccg     89880
     gacgaggagc agttccacga ggcgaccggc aacgaaggtg cttccttcga gcgcagctac     89940
     cgccgtgccg ccctggtgct ctggccgcgg gctcgtctgt tcgccgtgtt gagccaggct     90000
     ggactgggtg cgacactgcc atatctcggc gatctcgtcc ggcgctgggc cgctgccgat     90060
     cccgattgtc gcgccgcgct ctggcgcgat gcgcaagacc tcgccgaaca catggtcgga     90120
     cgctggccaa agcatgattg gcgggacacc gagcgcaagg aaccgagcga agccggacaa     90180
     atactcggcc tgctcgccga gctcggcgac acggccacga tcgaaaccgt tctgaccggg     90240
     atcatcgccg ggggcttcgg caaggcggac acggacgcga tcatggcggc gctcggccaa     90300
     ctcgcgccgc tccggcgcgt ggcgctgatc gagttgatcg tcgcggagtc ggcagccggc     90360
     tccctcggcg cctgcgccaa tctgctggcc cgcgcggcag tcgcctgggc cacatcgggt     90420
     aattgcgatc tgaccggcgc cgcaacgcgc ctgctgacgg cactgccgtc aggtgcggcg     90480
     cgcgcgacgc catcgtcggg atggcaacag agcggtcgcg ccgtggttgc cggcgtcgtc     90540
     gccgacctgg tgcttggctt cggcgcgatc gatccggttc tggccgagcg ggcgatcgac     90600
     catgtcctgg cttggccgaa ggtctacgga atggacgccg tgctggtccc cgcagcccgg     90660
     tgcttgtgcc agcggcagtt ggtgcggggg acggcggcgc tggcgcggct gcgaaccgcc     90720
     tgcctcgccc atctgcgacg ccggatggcc gaaaagctgg ccgccccgac ggactggcgc     90780
     cgtgacagca agatcccgtg ccgctgccca cgctgtgccg atctcgcgag atttctggcg     90840
     aatccggacg ccagtacctg ggttctgaag gccgccgaag ccgagcgcgc gcatgtccag     90900
     cacagcatac gacaggcggg cagcgacgtg gacacgacga tcgaccgctc cggccgcccc     90960
     tatcggctgg tctgcaccaa gaaccaggcc agccatgagc gccgcctgcg tcagcgccag     91020
     cgcgatctgg aggccgtggc cgagcttacg ttatgaagac gcgtgcagcc ccgacatacg     91080
     ccatgtagcg gaagctggcc cacgaggtcc ggctggtttt tacaccgcca ccccggcctg     91140
     gttttgatcc gccgttgaca agccgcctat ccggcgggga gggcctatca ggcgggcgcg     91200
     ggttgttcgt cgcagccagc cggcttgctc gccctcattg gcgatcagag ctggcaccaa     91260
     atggatttcg tcgagagagg gaccagagca cctgagggga tgatcgcggg aagctgcgcg     91320
     gacatgtcaa gcacctttgc tcggcgtgcg cgcgcccctg aaggtgattg tcacaggatt     91380
     gcgcgacatg cctcatgaaa cagcccaagg gttgatgaga gtgaggccgc aatcctcaaa     91440
     gccgcctgtg tcgcgcgtca ccacgctcgc gccatgggag cgtgcgaccg cagcaatcat     91500
     tagatcgagt gccgctgtcg gtcggcctcc gcgccttcgg gccgcgaaga tatcggcgta     91560
     agcagcggcg gcctccatgt cgaagggcag gacacgtcct tcgaagtcct ccgaaaacat     91620
     tgccgctgct gccgcttcaa gatcatgacg acggcggccg tctggcatga tcgcgaggcc     91680
     cgacaaaatt tcggcctgag tgatcgatgt cgtgaaaaga agctcttctg gctggccctc     91740
     tatccaagcc gtcacctctg gcgacggccg aaggctcatc atggcggaca ggatgttggt     91800
     atcgaggacg aacatcactc gaagctcggc ggctcgcgtg cgttgtctcg cggcggcaac     91860
     tcaagatcaa cgccgccaag cgcggcgaag cgcgcgtgga tccgctcggc cagactacgt     91920
     cccgagcgcg acgcgtcctt ggtgagcgcc gtctgaagga tgcgcctggc ttcagcctcc     91980
     atggagtgcc cgtgttccgc tgcgcgaacg cgaagacgct ccttcaccgc cgcatcaatg     92040
     ttgcggatgg tcagggtagc cattggtgtc aatgtcccag tgcgctgcat gcctgcatcg     92100
     taatcgatgc gttcattgaa tgcaacgcat aatgcccacc ccgttctctg atatcaaaca     92160
     tgataaagga cgttatcatg cgcgaccgtc aactcgcagc gttccgtaat tgaagatttc     92220
     cggctggttt ttacaccgcc accctggcct ggggttacgc atgaaagatg ctgatcgcag     92280
     cttgagtatg gaaaacggta gtcggtcgaa tatttccaat tctgtccgtt tgcttgaatg     92340
     ggagtggttt tggcccgggc cgccggctca tcaacgtcct caatccgctc ttcaaaaatg     92400
     ccgctatcga gcatatcatt gaaaaatata gataaaattt catgcgtagc ccctgcgcgg     92460
     ttcaaggagg cgttcgagcc ttcgaatgtt tcagaaccac gatgccaagc ggcgaagaaa     92520
     gcctcgcgcg ccgcttatga tgactggcgt cttgccgtcc gtcaccggct tgcctagcgc     92580
     tgcatcttcc tggatacgcc gccactcggc tggggcattg acgatcacag ggggtccgga     92640
     aacgcgattg agtccggctt gcaggtcgtg tggcacggga cccgccgcct gcaggagcgc     92700
     tttcggcccg ggcgtcatgc gtggatcctg gctgtcgaga acggattgtg gatcgagcaa     92760
     ggcttccgct gcttgagcac tctcggtccg ctgggttggg ggggcacccc agggctgttc     92820
     aacgctgatt tccgagctgg tgtcatcagg caataccgag gaaaacggcc aagctgcggg     92880
     tcactgacat catggtttcg tcatccagat gaccgaacgt ggagccgatc ttgtcccgct     92940
     gggttgtgct ggccttgtcg atcatgatct gagaccgttt ccgcaagcca ttggtctcgg     93000
     agggggccac cggcaacctc agtagggggg gcctccgcga gggcacctgt gatgggtaaa     93060
     atcgtcactg tggcggtttc atcaaagcgg tctgcatgta tgaccagggc tgggcgcggt     93120
     ttgccgaaat cgccttgcag ggcgacggtc acgagatctc cgcgcttcac tcccagccat     93180
     ccagatccgc gatggcggca tcgaggaagg cggcaagctt ggcatcctgc cggtcagctt     93240
     cagcaacaag gcgcgcctgg cggcggcatt cttcgtcaaa tcccctggcg cgggtatccg     93300
     gtacccagat ttgaacgggc cgtaagccag ctcgtcgcag ggcatcgcgg cgcttttgaa     93360
     cacgcacggc aacaggtgtc atgatctgtc tcctttgtgt tacatgtgac atgtaggagc     93420
     caaaaagtcc tgtagaatgg gggcgtcaat tcgggaggcc gctggctttg gccagcgccg     93480
     gaagatatgc aacctttcgg tggcgatatg tgccatgatt agctatggcc aagaacagca     93540
     gggacgggaa tcgattgcgt gctgcccggc gccgggcggc gctcgccgag cgcggtatca     93600
     agcaagttct gcttatggcc ccggagcagg cgcacccgtt gctgaagcag gcggcgactc     93660
     tgatgacccg cgacgatgac cccctggagc cactggcggc gctgcgtcgg gctggtgggg     93720
     cgaatgagcc ggagcccgtc ggggcatcac ccgacctggg tgcggaactg gaagccacca     93780
     aagccaggat cgcggaaatc gagcgtcagg cagaggcgcg actggcgatg gtgattgagg     93840
     cagcggagcg ccggaggcga gcgctggagg ctgagcagga gaaagcgcgg gcgaacgccg     93900
     tggaggcaca gaaggccgcc aagtccgccc aggtagccgc aggacgggcg gaagaggcgc     93960
     tacggcgcgc ggagaaggcg gaggccacgg atccagcagg ccaaggcgat gccgggcctc     94020
     aaaggccggc tggtgcgctt tctggccggc gatgtgctga aatagcagga ggccgctgcg     94080
     ccggacttct gcaatggaaa gccccgtttg cgccctgtga ggcgagtatg gcgcgaaaat     94140
     tcgatagcgt ccgtcaatgt ggtggaaatt ctggtgtagc tgaagcggcc aatggtcacg     94200
     cggcgacggt ggaaattcgt ggtgtatcgg catcgatggc gggtgccatg agttcgacca     94260
     ttccctcgat ctgcatatag cggttctgtg tctgccattc gtcgttggcc tcgagcagca     94320
     cggccccgat caggcggatg atcgaacctt cattgggaaa gatgccgacg acatcggcgc     94380
     ggcgcttgac ctccttgttc aggcgttcga gcgggttcgt cgagtgaatt ttggttcggt     94440
     gctgggcggg aaagtccatg tgcgccagca cgtcggtttc actgtcgtcg atgaacgcgc     94500
     caagttttgg ccatttgccc cggagctggt cggccacatg gcgcagggtc tggctggcac     94560
     tgacgcgatc cggctggata aacgcctgac gcaacgctgc agacaccatg ctctgctgcc     94620
     ccttcggcac ataggacaag gcgttgcgca tccagtgaac gcggcatctt tgccaggatg     94680
     cccccatcac ccggcggatc gccgccttca acccttcatg agcatcggag atcaccagtt     94740
     tcacctcacg caacccacgg cggaccaagc tcttgagaaa ggtcgaccag aaggtctccg     94800
     cctcggacgg gccgatgtgc aggccgacga tctcgcgccg accgtcggtg ttcaccgcca     94860
     ctgcgattat cgctgcaact gagacgatcc gcccaccttc gcgctgcttg agataggtcg     94920
     catccaacca cagatacggc cactcgccgg caagtggccg gtcgaggaag gcgttcaccc     94980
     tctcatcgat gtccttgcac agtttcgaga ccgtgctctt gctgatcccc gtcagcccca     95040
     tggcctgcac cagctcgtct acccgccggg tcgagacgcc gccaatccag gcttcctgga     95100
     tgaccgcggc cagcgccttc tccgaggtcc ggcgagcttc caggaacggc gggaagtagc     95160
     tcccctgccg cagcttcggg atccgaagct gcaagctgcc aagccgcgtg tccaatgcgc     95220
     gttcccggta gccgttgcga taggtcgcgc gctcgccgct gcgctcgtag cggctggcgc     95280
     cgatcagccc atccacatcc gtctccatca gcagttgaac caccgcctcc gcaacgctgc     95340
     gcagaaaatc gccgtccccg gctttggcca gtagctcagc cagtggtaat ctatcttcgg     95400
     tcatcgggtt ctccaggctt caggttgaag tctcgcaact ccaccatagc cgactgatcc     95460
     gatggccacc tcaaactaca ccgttacagg gcccaaaagt ccaccacgac cccggacact     95520
     accggacgaa ctgcgccaaa gtttcggctt cgtgtgcgtc agtcttgttc cgctgcaacg     95580
     ctgtcgccac gcgtgcatgg cgcgcatcga ggcagatcac cggaaaaccg aggtccttga     95640
     gcgaatggta gagccacggc gccaactgtc cggtctcgag cccgacccga acgagttcgg     95700
     gcgcatgccg gcgcagggcc gcggcgagca cctccggctc gctggccctc ttgccccgcc     95760
     agaccagctt cccgttgtcg tccacaacgt gaatggcggt gtctttgtcc gaaatgtcca     95820
     gtcctgcgta gtgcgccatg attgcctccc tcggctccaa caagcggacc acccgctcgc     95880
     ttcgcgcccc cggtttgaca gatcaaaccg ctggatcgcg atcaccgcat ggggaacgca     95940
     tcattgcctg gtcgaaccga tgccgggcct gagcatggat tgggagggcc tcaaccgaac     96000
     caacgccctg gcattcatcc tctgggcctc aattcggctg atgctacgaa ggcactgtaa     96060
     gaatagaata tcatcttgga ccgaatctaa gtgtgacgtc ggatagttgg cgatgtaagt     96120
     atttcccgat cctaccgggc aatgcgatgg tctgatatct tgagtttgtt cttgggcaag     96180
     ctatcatatg cctcccatga acggtaacct tggaccattt ctggagaaat cacatgacaa     96240
     tagcgaatcc cgccgcggtc agccccggca cccaccaatc ggcccccaat catccggcgg     96300
     ccgccgtgca tatcgctgcg gcatcgcatc acgccgtagc agaacaccat cacctcgagg     96360
     ccgcacacca tctcaacatg ggtgagcacg aacccgccag gctgcatgct gccgcggcca     96420
     tggcgcattc cgagaaggcc cattccaaga cggttgaagc ggccaaacca cctgccagat     96480
     aggtcttggt atagcttaag acttttccga gtggccggtc tttcctgaat tacctgatct     96540
     ggcaattctc ggtatcatgt ttttcggagc gggcttgcgg tgctgggaca gtcgatgcgg     96600
     acaataacag gaacgatcgg cacaggaact tgggattgca tagagggtgt ctgtctaaca     96660
     catgcatatc gcatattcac acaggtcgtg aatatgcggc tgcggatgca acgtgacgat     96720
     caactgggta ggcagcctca accggactct tacttaacag tctgtaatag gctacactgg     96780
     cggtagggct gttcaacgct ggtttctgag ttggggtggg tcggatgcgc aacactgtgg     96840
     gggcgaactg actttctggg tgggggcgaa ctgactttct ggggaatatg gggattcccg     96900
     accggcggga tttgggattc ttgggaaggc aaccgatacg gaggttgtca tggccgcgtt     96960
     cagctcgttg ctcgatatcc tggcagaggt tcccgatccg cggcgcgcgg aaggcaagct     97020
     ctacaagctg ccgcatgtcc tgctgttctc gatcctggcg atcatcagcg gcagcaactc     97080
     gtatcgcggc atcgtcacct tcatcgacgt ccatcgccgc cggttgaacc gcagcttcgg     97140
     cctgaaatgg cgccgggcgc cctcgcacac ggcgatccgc tacatcctcc aggggctcga     97200
     tccgggcgcg gtggaggccg cgttccgacg ccacgcggca ctgctgcagg cggccaggac     97260
     caagcccggc acggccagca ttgcgctcga cggcaagacc ctgcgcggca gtttcgacag     97320
     gttccatgac cgcaccgcgg ctcatgtgct cagcgccttc gccaccgaca ccaagctggt     97380
     gctcgctcat gtcgagatcg gcgagaaatc cagcgagatc cccgccgccc aggcgctgct     97440
     cgccgaactg ggcatcgcca aggacacact cgtcaccctg gatgccctgc actgccaaaa     97500
     aaagccttca acgtcgccca ggcgggcaac atcagcctca tcgtccaggt caaggacaat     97560
     caaccgacgc tgaagcaggc gatccaccat atcgccacat cgagcgcccc atacgacgtc     97620
     ttccggaccc gcgaccgcgg ccgcaatcgt gacgaaaccc gcaccgtctc cgccttcaat     97680
     cccgcctgcg cgctcgccgg caccgactgg catccccatg tcaccgccat cattcaggtc     97740
     gagcgcgcaa tcgccacccg caatcccgaa accggcctgc tcaagctgac acacgacacc     97800
     gccttctacg tcgccaacac atccctcacc gccgccatcg ccgccaaggc catccgcgca     97860
     cattggggca tcgaaaattc ctcccactat gtccgagacg tcaccttcgc agaggatcga     97920
     tcccggatcc gaaccaaccc tggcgtcatc gcccgattgc gcagcttcgc cttcaacatc     97980
     ctgatgaaca gcaaacccag cgccagcacc ctcagccagg accgctaccg cgccgcgctt     98040
     gccgacctct accacatcct cgctctcaat cactatccca aagcgttgaa cagccatgac     98100
     actgggggcg aggaagaatg agcgcacgag tgcaggtact cgcttgatgg cggcgagttg     98160
     ggcgtcgatc ttatcacgca gcttctcacc cttgcgcagc ggattcctgg ccacgccggt     98220
     gcgcttcaca tggctccaga ccaacttgtc cgggttcagt tccggcgcgc agcctggaag     98280
     gaaatgcagc gtcagacgcc ccgcggtcga ggccacgtag tccttgacca ggcgcgtctt     98340
     gtgggcagag cctcggagaa cctcctgcct caatgcatct taatctcgtc gcctgacctc     98400
     gtcaggctcc ccaaaccaga gacgccgcca caggcaattt ccacacaatc caagacgcca     98460
     acgttctcgg cgaaggtgac gtcttggaca tagtgggagg aattttcgac tgcgcccacg     98520
     gcgcacgctg agaagggccc actccaagac cgtcgaggtg gacaagactc cggccaaata     98580
     gcccacaatg ccgcgccccg gctttgcaag gctcggtatc gcgcgcgctc ggaagcctcg     98640
     gccacattgg cgagatcgga tttcttccac tgggaactac gtagattccg gtcctgcatg     98700
     atcgtttcgc gggtcgccat gttgagcagt gcgactatct cggcatgcgc gtcaaacacc     98760
     cgcctaccgg ccaacacaga ggtgctgcgg acccgacgcg cgaccatggc gcgtccatca     98820
     ggagctttag catgagatcg tatagactgg cttggttcac cgttgccgcc ggagccgggt     98880
     tgctactcgg cggctgcggc tattcgccgg gaggccgtgc cctgtccggt gctgcgatcg     98940
     gcgcagggac gggcgcggtt gtcggttcgg tgaccggcat cgggccgggt ggtggcgcgc     99000
     tgatcggcgg tggcgtgggt gcagccgtcg gcggtctcac cagtccgagc acgatcaacc     99060
     tctcgccccg ttaaccggaa cccgcccagg tgacgtttaa acaccctgaa agcaggaaag     99120
     aatccatgaa ccgcattcag gttatcacgc cgctcggcgc cggcctcgct ctggcgacgg     99180
     ctggcgcgaa cgcgcagacg acgaccacaa catccaccgc ccatacgcta cagcctaccg     99240
     cgatgacgtg gacgccggtc atgccgtcgc cgagcggcac gctgagcacg accgaaacca     99300
     gccgcagcgt cgatgcggcc gggaatacgt cgcaatcgcg gaagacgacc tatggcagcg     99360
     aagacggtgc ggtcagccag tccaccagca ccaccacgat tacacctgtg ccacacacta     99420
     gcaccacgac cgacacaacg tctccatact cgaccacgaa atgaaccgga ggacatcatg     99480
     cgatcgaaca agaccaccgc ggcacgcatt ctgcttgcca cgtggatgag cggggccgtc     99540
     ctggtcctcg ccggctgcgg tggcggttcg ccggacaccg cgacgacgac gacgacgcaa     99600
     catacgagca cctcgaccac agcgaccgcg gcggcgccgc caatgctggg cgcgcccgtg     99660
     accacgacca cgcagaccac gcgctcgacg acgatggagt agcgcgatgg cgtgcgccgc     99720
     caccgcgctg catgagtaat ttccgaggct gtccggcgag cggtcgggtc tgccagattg     99780
     taggctcgac cgctcgcttc gcgcgtgccg tcaataggtg gggtatggaa catggatgac     99840
     agaacaggcc gtccgcgcaa catagtgtca ttgcaggtcg catctctcga cgcccatatc     99900
     ggcggtcaga tcacggcacg gcgcgcggaa attggactct ctcgccggca actggcgatg     99960
     acactgcgcg tgccagtgag agggatcgcc gcctacgagc gcggcataca gcatgtcgca    100020
     ccagcggacc tgttccggtt agcgcaggcg ctcggcgtgg acctcgccta tttctacacg    100080
     gattcggcgt cctcgccgca ggcgccaaag gccgaaaccg ggtgtccggt cggcggtcgc    100140
     gccgcgggcg gcgtcgggca ggccgccgtg gacatgcgcc aatatgacga tatcgaccag    100200
     atcgccgata gattcagtcg gattcggaat ccggcaattc ggcgatgcgt tacccggatg    100260
     ctggacagcc ttgccgagca tgaggtatcg agtgtcacgg tcggagatgt ccggaccgag    100320
     ccactgatct ccgcgttcga agagctcgcc gagttggcat atgcgccgcc ctcggcatcg    100380
     cgcggatgag cgcgtcgcgc cggcgcgcgt gcgcgtgaag gcatgccgaa ccggacgccc    100440
     gccacgcgcc cttcgcggaa cgctcgggcc gtggcctggc gggcctctcg cgggcgtcgg    100500
     agcgtatatg tgtgccctac attggagccg caggtggcgg ctgagctggt cgccgcgccg    100560
     gggtatgccg cgaccgcatc gtcgaacgct ttgatgaagt gtgataagcc tcctcgagac    100620
     gcccgccctg gcgcggcctc cacggggcga gtacgcagag ccggagatgc gtagtttccg    100680
     agccttctat gggaagtgag gccctgctaa ttattgaggc ctcggcaggc cggatcacac    100740
     gatccagtat agcgatcgac agcgaacgag ccgcaccggg tttcgtgcaa agccttagca    100800
     gagatcgtaa cgggagccgg ctgatggaca aggatcgcgt agctggattg gcgaaagaga    100860
     tcaagggcgc cgtgaaagag gccgtcggta aactcgtcgg cgatgccaag ctgcaagccg    100920
     aaggacgtgc cggcaagacc gagggcaggg tgcagaatac ggtcggcggt ctgaaggatt    100980
     ccgtccggaa atagcattcc gcacgcgcgc tactatgtgg gacggctgcg ttcacatccg    101040
     cagcgcgcgc ttgagtgccc cacccgatgt ctggcgcgac gccaaggcag atccatcggc    101100
     gctcggcggt ggttgatcgc aacctgccca agcgtgccca tgtctgagaa catcacagat    101160
     acattcgctt caagagcaac agccgatcgg attgaagcat atgatcggat gatagtcacg    101220
     ctatcagaca gctcacgcgg tgagacagac agtgcaccaa gccggccgtt ggtgcggaca    101280
     agaaggtgtt gcagacgtga ggtgagtgtc ttgtcgaaaa ggttgactgg aaagacccca    101340
     ttcatgcgca tgtggctggg tggggcgaac gctatcgcac gccactcccg cgccaccaaa    101400
     gtcgcgcggc ggcaggccgc ggcgctggta aaggatgccg cccgcgtctg gaagcgggcg    101460
     ttggtggatc ggccggtgtc ggcggctcgc atgtcggcag gttgcgtgtc ggaagtcgtc    101520
     gggttcggct ccaatcccgg cgcattgagg atgctggttc atgcccgcgc ccggctgccc    101580
     gcgggccggc cgctggtcgt cgtcctgcac ggctgcggcc aggatgccgc agcctttgcc    101640
     aacgcgtccg gctggctcgc gctggcggac gagttggggt tcgcgctgct ggtgcccgaa    101700
     caggttcacg cgaacaaccg tggccgctgc ttcaactggt tccgccctga tgacgtccgc    101760
     cggagcggcg gcgaggcgat gtcgattcgc cagatgctga gagtcgcggt cgcacgctat    101820
     gggtccgacc caagacgaat ctacattgtc ggattttctg ccggcggcgg catggccgct    101880
     gcgatgctcg ccgcataccc tgcggtgttc gctgcggggg gcattgtcgc gggcatgccg    101940
     gtcggctgcg cgcaaaccca ggtcgcagcg atgcttcaca tgcgacgggc aaacatgtcg    102000
     cggtcgcggc aggcgctcgc tggcgacgtc cgtgcagtga cgcaggcccg ttcacgacgg    102060
     tcgtggccac gcgtctcgat ctggcaaggc ggccgagatc gcacggttga tccggcgaac    102120
     gccgaaatac tcgcggcgca atggggcgag ttgcatggcc aggatacggc gccgaggacc    102180
     gacaacgtgg catcggggca tcggcatcgg acctggggcc ggcccgatcg accgcccgcc    102240
     gtcgagatct ggacgctgcc cgcgatcggg catggctttc ccgtcgatgc cagcctgccc    102300
     gggagcggcc gcaccagccc gtatctggcg cgcgcggatc tgtccgccgc gcgccagatc    102360
     gcgacgttct ggcttctgaa caatgaccac gccaaacgcg cggccttgca ccgctgaatg    102420
     ggttcgccga tgctcgtaac accagtacca cggctacgtt gatgatagat ctgtcgccgc    102480
     cacgggcgcg accgggcacg ccagccgcga tcaatgacac ctcggggctg atgacgctga    102540
     tcagcgtggt ggtggcggtc gccacgctgt cgatcgcccg cgacgtgctg atcccgatca    102600
     cgctggcggt gctgctgtcg ttcctgctcg ccccgctggt aaatctgctc cgccgcaccg    102660
     ggctggggcg ggtgccgggg gtagtactcg cagtgctgtt ggcgctcggc gtcatcctcg    102720
     gcaccgccgg cctgatcggc acccaggtcg ccgatcttgc cgacgacatc ccgcgttata    102780
     cggacaccat ccagcagaag gtcgatgccg ttcagagcgc gacgtttggc cgcctctccg    102840
     ctttcgtcgg gagcatgggc agccaaatca atcgcgacag ccacgcgtcg gccggcgcgc    102900
     cggcgagcgc cggcacgacc gtcagtgcag cgtccgccgc ggcacccacc aacgcggccg    102960
     cgaagccgat accggtggag gtccatcagc cggaaccgtc gctgatgaag ctggcgaggc    103020
     gcgtcctcac gccgatccta tcgccgttga tgactacggc catcgtcgtg gttgtggcga    103080
     tcttcattct gctgcggccc gaggatctgc gcgaccgact catccgcatg ctcggcaccg    103140
     gcgatctgca ccggacgatg accgcgatgg atgaggccgg gcaccgcctg agccggtact    103200
     tcctgaccct gctggcattg aacactgcat tcggcagcat gatcggcctc ggtctgttcg    103260
     tcatcggcgt gccgagcgcg gtgctgtggg gcatcatggc gatcctcatg cgcttcattc    103320
     cgtatatcgg cccgtggctc gcggccgcgc taccgcttgc gcttgccgcg gcagtcgatc    103380
     cgggttggtc gatgctgctg tggacgggga ccctgttcgt ggttagcgag ggcgtgatgg    103440
     gccaggtgat cgagccgatg gcatatgggc acagcaccgg attgtcgccg ctgtccgtcg    103500
     tggtcgcggc gatcttctgg agctggctgt gggggccggt cgggctgatc ctgtcgatgc    103560
     cgctcacact ctgtctggtc attctgggcc gccatgtgga tcgattgaag ttcctcgacg    103620
     tgctgctcgg cgaccgttca gcgttgacgc cggtagagag cttctacaac cggatgctgg    103680
     caggccgact ggacgaagtg caagacgacg ccgagcagct gctgaagtcg tgtacgctgt    103740
     cggcatacta cgatgaggtc gcgatccccg gcttgcgact ggccacaatc gacatcgagc    103800
     gcggggtgct gaccgaggcg cagaccattc ggatcatcgc cggggtgcag ggactgctgg    103860
     aggaaatcgg cgaccatgac gacagcgata cgcttctgac tgccgcggga ccggcgaggc    103920
     tgccgtcaga tcggcaggca acgccggaat cgcgcgagcc cgggccgcct gccgggctgg    103980
     gcgagccggt cggcctgtcg ccggactggc aggccccttc cgcggtgctg tgcgtggccg    104040
     gccgcggccc gctcgatgat ctggcgtcgg cgatgctcgc tcagctgctc ggcaagcgcg    104100
     ggatcggcgc cagcgtcgtg acgcatgaag ccgttagcct gcgtgcggcc gacacgctcg    104160
     acatcgtggg cgtgcagatg gtctgcctga cctattccgg cattgccggc acatcctccg    104220
     atctgcgcta caccgtgcgt cggctgcggg cacgcagccc gtcggtttgc attcttgtcg    104280
     gattttggcc ctccaacatg gtgagtgacg acaggctgcg tgctgccgtg gccgccgata    104340
     tctatgcagg ttcgctgcac gacatggtcg tcgcctgcct cgcggaggcg cttggcccgg    104400
     caagcgacag agtgcgtcag ttggcacctg tccccgagcc gtagccggac gacggcgtgc    104460
     gcccgatggc agcagggccc gccaccgtca cattcaccgc gtcatagcaa tcgactgacc    104520
     atccccgagg gtcgatcgac gatcattccg acgcggcttg ccgggcaccg tcttgcctga    104580
     cgcgaggcta atcgtctgct tccgacaacg cgaccagtgc cagccgggcc agggctggcc    104640
     gcgatttcgc gccgtttcac tccatgatct cggtgcgagg gttctcgacg gtgcgctgac    104700
     tgatcttcag ttcgtaggcg atgttcttgt tcggatgccg gtgaccacca gttccatgac    104760
     cacacggtga cgtgcagtga accgcgccgg aaatcccgcg ctccaccttg aagccgccga    104820
     tgccgggtcc ctggccggcc cgcggatcca ccaccacgac cagccgcttg cgcgggtcgg    104880
     caatcatccc cggcggtggc gtgatgcgca gcagcgaata gttcatcggg agcagcagtg    104940
     cgctgtcgct catcaccatt tcatggtcga accgcaacgc cgtcgacatc agccacgcgg    105000
     tgctcgcgat ctcctcgttg acacgctgct gcagcagctc aaggaacaag acgccgcgct    105060
     ggaacgcgtc gatcatgtat tcgggccaag cggaggcaag ctgggccgct gcagagctgg    105120
     cggcgccggc gactgccgcc ggtccgtgcc ctgcccagcg tcggcttgtg tcgcgctccg    105180
     aagtcaatgg tcatcccgat ctcccagggc cgtcgctcgg gcccggatgc gattgccacg    105240
     taaccaccgc atcgcacggc ggccaccagg gcggtttcgt ttcttgcaac catcggcctg    105300
     ctgcacgtcc tggccgggcg gcagcgtcaa ccgaatgcca gaagcggcat ggataccgcg    105360
     ttcagacata tccttcccct acgcggcgac agacagactc ggaaaccatc gatccgtctg    105420
     cgccgtcccg ccggacgccc ggcttccacc agcggacgtc ctcgcttcat ttaatgctgg    105480
     ggccagcctt ccattgcggc cagatggtcc aagctccgca agatcgaggg atcattgcga    105540
     aggctcgcac aggcatccgg tgtcgtccgg gcggcggcaa gtcggatccg ctgcagcgat    105600
     cgcccatctt ctcgaaatga accagggcgg tcagcgacaa gtacttgccc tgcatccccc    105660
     acagagcacc ggcctgggta taagcctcga tcatcgatgc cccttgaatc agcgcgttcc    105720
     accgccgact tcgcaacttg cacgacgcgg cgcgcgaagc gaccgccacg atactgctca    105780
     tcggctgcat ctgcgcctga tacgctgggg ccttctcttc gggctgcgcc gcaccggcaa    105840
     cgatcggtgc cataaccagt gcgatcaccg caacggccct tatcatcaag atcctccgtt    105900
     gccatcaatg cggtaaggtg atcgatcggg tcgccggtcc tgcagcaccg ggcacgtcgg    105960
     tgtgcggaat cgcatggccg ccatcctccg cttcagtcat ggaagtctcg cgcccgtcgg    106020
     tcgggccttt cggcgtggta gtcgacgtgc cgacagccgc cgtggcatca gtaactcccg    106080
     cgtgtccgac ccgattgggc aggagggcca gcacctcggt cgcgatggag gctggctccg    106140
     ctgcaggggc gaccagttcg gcagatcggc gatcatcgcg gcaaggcgcg tctgcacagc    106200
     ttcctgccac ggctcgaaat cgagcctggc cagtgcggag aggacgctgc cgaccaggcc    106260
     tttgctgtcc tcgcccatgg ttgcgaacag gaacgcgtcg aagggcgagc gagcattcag    106320
     ttgcgggcgg gtcatttcgg ctcccgactt ttatgatcgc tgcaatgggc ggatcatgat    106380
     cgacccccac gaggctgaac gatcatgcga ccataggaca atttcgaaat tagcgtcagg    106440
     gtcggaaact accggcctct gcgcgccggg gcggcgacct ccgggactac gtgtacaggt    106500
     ccgcgcacgc atcgccccga tctgctcgtt tcggatcaat gatgagcgcg gtatgacttg    106560
     ccgattattc ggatatagaa acacctatac tcgtgaatgg catcggatag ctatagaggt    106620
     aagtacttcc cgattgacat tcagttgcgg ccgcccctca ccaatgagta atttccgagt    106680
     ctgccgcgga agtgcggccg cgcgtagtct gccttgcatt ccaaaatcgg cccggtgcgt    106740
     tccgacgtga ccggccggac ggcgtgccga ccgagcattt ggcagatccc catctaccgc    106800
     gctgaatgtc ttccgctagt gtcctgcccc tgaaattcgt gggtgaattt cagggataag    106860
     gaggtcatta agttactgat tttctaatgt cccgaatata aaatccatca gatttcagat    106920
     tcgggacact aggtcggaaa ggagcagtgc cttgtttctt tatgtcgtcc cggtcctggt    106980
     tctggctgcg cttgttgttc tcgccgccac ggtgaaaatt ctgcgtgagt atgagcgcgc    107040
     cgtggtcttt acccttgggc gctttcaaag ggtgcggggt ccaggccttg tgctgcttct    107100
     ccccttcttc caggaaatgg ttcgggtcga tctgcgcatt cgcgtcatcg agatccccag    107160
     ccaggacgtg atctcgcatg acaacgtgtc gatgaaggtc gacgccgtat tgtatttcaa    107220
     cgtcgtcgat ccagagaagg cgattatcca cgtccaaaac tatctgccag ccaccaacat    107280
     gctcgcacag accacgttac gtgccgtgct cgggcagcat gagctcgatg agatgctgtc    107340
     cgagcgaaag aagctcagcg ccgatgtcca gagcattctc gacgcgcaga ccgaaacctg    107400
     gggcatcaag gtcagcaacg tcgagatcag aacggtagaa ctgactgaca acatggtgcg    107460
     ggccatcgcc aaacaggcgg aagcggaacg cgaccggcgt gccaagatca ttcacgcgga    107520
     agccgagttc caggcatccc aaaccttggt caacgccgcg cagatcctgg gaagcgtccc    107580
     agccgcaatg cagttgcgct atctgcaaac gctgacggag atcggcgccg aacagaattc    107640
     gacggtcgtt ttcccgatgc caatcgacat tatcaaaccg ttcctcgagc tgcttgataa    107700
     ggccggcaaa ccggctggcg caaacggcgc cgatcgcgcg ttgcccctga aaggcgtccc    107760
     gctgagtgtg ccagatgcga atgcgtgacc acactgtcac ctgctctgta gggagaaacg    107820
     gctccgatcc agccgatccg gcccgcgggg tatgggatgt cgtgcggcgc ttgatgtctt    107880
     gggcatgacc atctccgttt atccatctat agacccatat ccatatcggg atttagtcta    107940
     tagatgttag cactactttg gcagaaatct gatttttagg attcccatgg cacggattgc    108000
     gtgattcatg gggagccagc tttgatggag gctggcgatg gacgaggact ggcagggaga    108060
     tctggagcgg tggcttgccc cttatctgaa aggtctgggc aacaagacgc gacgacggat    108120
     gtgcccggct tatatcgccg gcttgatcgg gccgggtgat cgcaaaagca tccagcccat    108180
     ggcggcccgg tcggacgcca tttcctatga ccggctgcat catttcatcg gggctggtct    108240
     gtgggacagc gcgccactgg aagcgacctt gtgggaccaa gcggataaat tggttggtgg    108300
     caatgaagcc tggctgatca tcgacgacac cgccttgccc aagaagggta aggcctcggt    108360
     tggcgtcgcg ccgcaatatg ctacggcgct cggcaagaat gccaactgtc agacgctggt    108420
     gtcggtgacg ctggcttcgg gcgcagttcc gctcatgctg agcttgcggt tatttctgcc    108480
     ggaaagctgg acgagcgata tcgcgcgcat ggacaaggcg ggcgtgcctg cctgtttcca    108540
     ggaataccgc acaaagcccg agatcgcgat cgaggagatc gatcgcgtca tcgctgccgg    108600
     cgtgcgcttc ggctgtgtgc tggccgatgc cggttacggg ctgtcggctc cgttccggca    108660
     ggcgctgagt acacgcggcc tttgctgggc tgtcggcatc ccccggcacc agaaggtcta    108720
     tccggcggat gtgcagctga tcttcccggt cgcaggccgc ggtcgcccac gggtgcgtca    108780
     tgtgcccgac gtcaaatcca tggcggcaca agcgatgctc gaaggcgcga agtggcggca    108840
     gctcggttgg cgcaagggaa caaaggggcg tctgacagcc cgctttgccg ccatgagggt    108900
     acgcattgct gatggcgcgc cccagcgaat cggttctgcc ggtgcccagc acatgccggg    108960
     agaggaagcc tggctggtgg gtgagcatcg ctcgaatggc gaacgaaaat actatctctc    109020
     gaacctgcct gccgacaccc cgatcagagc tctggctggc gccatcaagg cgcgctggat    109080
     ctgcgagcag gcccatcagc aactcaaaga ggaactcggc ttggaccact tcgagggccg    109140
     atcctggact ggcctccacc gccatgccct gatgacgatg atggcctacg ccttcttgca    109200
     atcccgaagg ctcgctcagg cgggacggaa aaaaaagagt ccccggtccg cctccccaac    109260
     ccaccctgcc agcagtgcgc caagccatcc ttgaccgtct ttctcgctca ccgccgcggc    109320
     attgccctca ttgcggatgt agcctcatcg gacatcacaa caaacttctg ccaaagtagt    109380
     gttaggggtg cagggagcga tcaagttctg atcagctttg gatccgctcg aagccgcacg    109440
     ccgacacaac gccctgagca gcgaggcgca cggcgattgt agtgggttac gccatcgata    109500
     gcgcggagga tctggcgcta caccacttct atcgcgtgat ggcctggctg ggcgaggaac    109560
     tcggcgacag gcaagcgggc gccctcgcgc cacgttgcgt caaggacgtg atcgaggagc    109620
     aactcttcga acgccggcgc gacctgttca ccgatctcag cctggtgttc atggatacga    109680
     cctcgctctg cttctacggc gagggcggcg agacgctggg ccggcgtggc cattcgaagg    109740
     actatcgccc cgacctcgcg cagatgatcc tggccctggt gatcgatgcc gaagggcggc    109800
     caatctgcac cgagatggtg ccgggcaaca ccgccgacgt gaagatcctg atgccggtgg    109860
     tcacgcgcct gcgcgagcgc ttcggcatca cccgcgcctg cgtggtcgct gaccgcggca    109920
     tgatcagcgc cgataccatc gcggcactgg aagcgctggg gatggaatac atcctcggcg    109980
     cgcgcgagcg caccagccgg gtgatccgcg acgtcgtgct gaaggacaag gccgcgatgg    110040
     tcccgctcgt gctcgatcgc cagcatggcg agacccagct gtgggtgaag gaggtgcgca    110100
     tgggcaaggg caaggcggcc cagcgctaca tcgtcacggt gaatgaggca gaggcgaaaa    110160
     aggacaggga gaaccgccag gccatcatcg atgggctgca ggcccagctg aagaaaggcg    110220
     acaaggcgct ggtcggcaac tcggcctacc ggcgttatct ccgcagccgc ggcaacgcct    110280
     tcgagatcga tccgggcaag ctggccgagg aggcccgctt cgatggcgtc agcgtgctca    110340
     ggaccaacgc aaggatcacg cccctgcagg ccgtgatccg gtatcgcgac ctgctcgagg    110400
     tcgaggccct gttccgcgcc gccaaggcca gcttcgatac aaggccgatc tttcaccagg    110460
     ctgacgccgc gatccgcggc cacgttttct gttccttcct ggccctgacc ctcgccaagg    110520
     aactgaaacg cctgtgcggc gccaggggct tccagcccga atggcagaag ttgctgaacg    110580
     atctcgacag gctccagcag gcaaccatcg aaaagggcgg caaggtcatc accacgagga    110640
     cccacgtcac cggccaggtc ggcaatgtct tcaaggccgc cggcatcgcg ctgccccaca    110700
     acatcagcga gcaccccgca gactgaagcc gcggccacgc accgccgaca caacgcccca    110760
     aaaatgtagt gatggcaaca cccgcacgcg ggcaaataaa atattgatat cgccagtatt    110820
     tattaaaccc actgcccaag tggggcttga ttccatgcgg agtgatctga atattacgta    110880
     ttatttataa ataacctgat gccgattgcg gcagctcgca tggatttgca gatatagtga    110940
     ttgacgtccg ggcgcgcaca gcccgtagat tccgaccctg acgcggattt cggaactgtc    111000
     ctatggtcac cgcatcgctc agcctagtgg cggtcgacca tgacccgccc attgcagcga    111060
     tcatgaaagg cggtagccga aatggcccgc gcgcaattca atacccgctc accctttgat    111120
     gcgttcctat tcgcacccat cggcgaggac agcaaaggcc tgatcgtcag cgtgctctct    111180
     gcgctggcca ggctcgattt cgacccctgg caggaagcgg ccgtgttcgc gcggctgccg    111240
     aaggaagccg ctcaggcgcg gctgactagg atgatcgccg atctgccgaa tacatcgccc    111300
     ttgcaaatgg agccgggcac catcgcgaca caggtgcttg ccctcctgcc cgatcggccc    111360
     gaacccacag tagttcccga tgccacggcg accgtccgga attcgacgac cgtgctgcgc    111420
     ccggccgggc tgctggtcgc cttgggtccg atcgtgctgc tgattgcatc ggcggtcgtc    111480
     ttcgccctgt ggtcggcctc gatcatcacg atggcgagcc agcgggtccc gacggcgaag    111540
     gcgagtcagg tcgatatacg cggcggcaat cgacccgacg ccgcccgcgt accgctctcg    111600
     gccgcaaccg gcatcgcggc gaccgccggt gccgggcgcg cgaccgacgg ccgagggacg    111660
     tccacgactg aaactggaga tggcggagat gctcatgctc gaaccgacat gccggctgct    111720
     tcgggaccgg cgacccggtc gatcatctcg ccgcattgat ggcaaggagg atcgcgatga    111780
     tgcgggcaat tgcgatgatc gcactggtta tggcgccgat cgtcgccgga gcggcgcaaa    111840
     ccgaagagaa ggccgcggcg tatcaggcgc agatgcagcc gatgagcagg atcgtcgcgg    111900
     tcgccgcgcg cgccgcctcg tgcgaggtgc gaagtcggca gtggaacgcg ctgattcagg    111960
     gcgcatctgt gatccaggcc tatgccctgg ccggcgctct gtgggggatg cagggcaagt    112020
     acctgtcgcc tgccggcctg gttcatttcg agaagatggg cgatgcgctg cagcagatcc    112080
     gacttgccgc agcccggaag acaccggatg cctgcgcaag tcttcgcaac gatccctcga    112140
     tcatgcgcag cctggaccat ctggccgcaa tggagggctg gccagagcat tgaatgaagc    112200
     gcggccggcc gctggtggca gccgggcgtc cggcggaatg gcgcagacgg atcgatcgtt    112260
     gccgaacctg tctgtcgccg cgtcgggtaa cgccatgact caacgcagga tcagcgccat    112320
     ttcgggcatc cggatggcgc tgccgccggg ctgggacgtg cagccgcgcc gtgcagcggg    112380
     ccgatggccg caagcaacca aaccaccttg gcggccgccg cgcgttgcgg cggtggcgtg    112440
     gcaatcgcat ccgggcccga gcgacggccc tgggagatcg agatgaccat tgatttcgca    112500
     gcgcgacaca agccggcgcc gggcagggcc gggcgcggac cggcgatagc cgccggcaac    112560
     gccggccctg cggcggtcca gcttgccacc gcctggccca actacatgat cgacgcgttc    112620
     cagcgcagcg ttctgttcct cgagctgttg cggcagcgtg gcaacgacga gatcgcgatc    112680
     accgcacggc cggtagcgac ggtgttgcgg ttcgaccatg acctggtgat gagcggccaa    112740
     gcgctgccgc ggccgatgaa ctactcgctg ctgcgcatca cgccaccgcc aggggtgatc    112800
     accgacctac gcaagcggcc ggtcgtggtg gtggacccgc gggccggcca gggtcccggc    112860
     atcggcggct tcaaggcgga gagcgagatc ggcgacgccc tggacgccgg gcatccggtc    112920
     tacttcatca gcttcgcggc gacgcccgaa cccggccagc agttcctcga cgtcgtcgaa    112980
     ggtcaggtgg cgttcttcga gcgcgtcgtc gcgctgcatc ccggcgcacc gcgtccgttc    113040
     gcgatcggca actgccaggc gggctaccag accctgatgg tggcgatgct gcggccggac    113100
     ctgttcgggc cgtgcctcgt cgccggctcg ccgatgtcgt actggcaagg cgtgcacggc    113160
     aagtatccga tgcgctatgc cggcggtctg ctcggcggca gctggctgac cgcgatgagc    113220
     agcgatctcg gccgcggcag gttcgacggc accgcgctgg tgatgaactt cgacagcctg    113280
     aacccggcga actggctgtg gggcaagcag tacgacgtct atacccatat cgacaccgga    113340
     ggcgcgcgct acctcgcatt cgagaagtgg tggggcgact tcatccagct caacggcgat    113400
     gaattgcagt tcctcgtcga caatttgttc atcggcgata aattgacgcg cggtcagttg    113460
     gcgtcgagcg atggcaggat cttcgatctt cgcaacatca gatcgccgat catcgctttc    113520
     gcctcgaccg ccgacaacat cagcccgccg ccgcagtcgc ttggctggat tctcgatctg    113580
     tatcgcaacg tcgatgagat ccgtgccgcc gatcagacga tcgtctattg tctggaccac    113640
     aagatcgggc atctcgccat cttcgtctcc accaaggtgg gcgccgagca ggacgaggag    113700
     ttcgtacaga tgatagatgt catcgactgt ctgccgccgg gtctgcatga aatgatcatt    113760
     tcgccgcggc cagccgaaac gccgcgtggc ggcttcgtaa ccggcgattg gatcgcccgc    113820
     ttcgagaccc gctcactcga cgacatccgt gcgcttggcc gcaacagccc cgaggacgat    113880
     cgcgccttcg ccgccgtcgc gcgcctgtcg gccctcaacc tcgcggccta tcgcaggatc    113940
     ctccagccgc tggtgcgcgc gctcgcgaac cagccgatgg ccgacctcac ccgcgccctg    114000
     aatccgctgc ggctgagcta cacgatcttt gccgaccgca atccatggat gcaggttgtg    114060
     cggacgatgg ccgccggcgt ggacgcggcg cgccgaccgg tggcggccga caatccgttc    114120
     ctcgcgctgc agacgcaggt ttccgaccag atcatcgccg gactggatgc ctaccgcgcc    114180
     gcgcgggacg tgatggccga gcaggtcttc ttcggtgtct atggctcgcc gttcgtgcaa    114240
     gcgctgctcg gcatcacaga caggaccgaa gcaaggccaa cgcccggccc gtcccccgaa    114300
     caacgggcgc tgcaggaggt ccatgcaaag gtatacgccg ccaagctcaa gtccggcggc    114360
     ttcgacgaag cgctgaccag ggcggtgctc tacgtactcg cggccgacca cgtgctcgac    114420
     cagcgctgcg cgctcgcgct caacgccgcg cgttggacga tcatgcacct gtcgcttgcc    114480
     gcgttcaagg cggtggtgcg ggatcaggca ttcctgctgc tgctcgagcg cgagcaggcg    114540
     atagcggcgc tcgctgtgct ggtgcctgag gcggacgcgc ggacagcgct gctgagccag    114600
     gtgcgcgcga tcgtcggcgc ggccggcccg ccgagttcgg ccgagagcga ccgcctgctc    114660
     cgactgaaac aagcgctggc gccgccaccg cgccgcccga ccgccaccgc cgcggcctcg    114720
     ggaaagccgc aggcggtgtc gcactgaatc gaacgtgccc gatctcggcg agcgggacgg    114780
     cgcgtgacga tggcaatgcc ctggtgaccc aggcgtgaca tcacccatgc cgcggctcac    114840
     ccgacgcgag gcgcggcgca gacaggacga tgagacatga cgaagaccgc tgtcggtcac    114900
     gccgacgcgc ccgcctccaa gccgaacgcc gaagccgtgg ccacggcggg atcgaaatcc    114960
     gaggcgaagg acgatttgaa gacgctgcct ttggcggcgg tcgagaaaga gctgcgctcc    115020
     tcgcccgacg gtctcagcca ggccgaggcg gaacggcggc tgaagcagta tggtccgaac    115080
     gagatcgagg agaagaagac cagcgagctg ctgaccttcc tcagctattt ctggggtccg    115140
     atcccttgga tgatcgaagt ggcggtgatc ctgtcggcag tcgcgcggca ttggccggac    115200
     ttcgtgatca tcctggtgct actgctggcc aacgcccttg tcggattctg ggaagagcac    115260
     gaggcgggaa gcgcgatcgc cgccctgaag gccacgctgg cggtcaagac aagggtgctg    115320
     cgggacggca agtgggtcgc gccggcggcg cgggagctgg tgccgggcga cgtcatccgc    115380
     gttcgcctgg gcgacatcgt gccggcggat gcgcgcctgc tggacggcga cccggtggag    115440
     gtggaccagt cggcgctgac cggcgagtcg ctgccggcca cccgcaaatc cggcgaggcg    115500
     atcttttccg gctcgatcat tcgtcggggc gagatcggcg cgctggtcta tgccaccggc    115560
     gcgaagacct atttcggcag aacggccgag ctggtgcagg gggcgaagag cgtcagccat    115620
     ttccagcgcg cggtcctgaa gatcggcaat tatctgatca tcctggcggt ggtcatggta    115680
     tcggcgatca tcgccgtcgc agtaatccgc ggcgatccga tcctcaccac gctgcaattc    115740
     gccctggtgc tgacggtggc ggcgattccg gtggcgatgc cgacggttct gtcagtgaca    115800
     atggcggtcg gcgcgcgcat gctggccaga aagaaggcgg tcgtcacacg gctggtggcg    115860
     attgaggagc tggcgggcgt cgatgtgctg tgcgcggaca agaccggcac gctgacgcag    115920
     aacaagctca cgctgggcga tccgttcggc gtcgatggcg tcacgccggc ggaggtggtg    115980
     ttggccggcg ctctggcgtc gcgcgtcgac aatgacgaca ccatcgatct ggcagttctg    116040
     ggcgggctga aagacgatca ggccctcaaa ggctatgagc cgggccattt ccagccattc    116100
     gacccggtgc acaagcgcac cgaggccgcc gtcaccggtc ctgacggcaa gctgttcaag    116160
     gtgacgaagg gcgcgccgca ggtgatcatg gcgctcgccg ccaatgcccc gcaggtgaaa    116220
     tccgccgtcg acaaggcggt cggcgatttc gccgcgcgcg gctttcgggc cttgggcgtg    116280
     gcacgggccg agggcgatgg cgactggcag ttccttggtg ttctgccgct gttcgatccg    116340
     ccacgcgagg acgccagagc cacgatcgcg gcggccgaac gcatgggcgt gaaggtcaag    116400
     atggtgaccg gcgatgcgct ggcgatcgcg caggagaccg ccggcaagct cggcatcggg    116460
     tgcaacatcc tcgatgccgg caccctgggc gacgaagcgc agcagaagac cccggcggcg    116520
     gccaaggcga tcgacgatgc cgagggcttc gcgcaggtgt tccccgagca caaattccac    116580
     atcgtcgcgg cgctgcaaag tcgcggccac atcgtcggta tgaccggcga cggggtgaac    116640
     gacgcgccgg cgctgaaaca ggccgattgc ggcatcgccg tcgcaagcgc cacggatgcg    116700
     gcgcgcgcgg cggcggccat cgtgctgatg acacccggtt tgtcggtgat catcgacgcg    116760
     atccaggaga gccggaaaat cttccagcac atgaacagct acgcgatcta ccgcatcgcg    116820
     gagaccctgc gtgtgttgct gttcatgacg ctcgccatcc tgatcttcaa cttctatccg    116880
     ctgacggcgg tgatgatcgt gttcctggcg ctgctcaacg acggcgccat cctatccatc    116940
     gcctatgaca acgtccgcta caagaacgcg ccggaggtgt ggaacatgcg cctggtgctg    117000
     gggatcgcca cggtgctggg cgcggtcggg ccgatcgccg cgttcgggct gttcttcctc    117060
     ggcaatcgcg tgttccatct cagccatccg cagctccaga ccatgatgta tttgatgctg    117120
     tcggtcgccg gtctaatgac tatctttcag gcccgcaccc atgggccgtg gtggtcgatc    117180
     cgcccggcgc cgatcttcct gggcgcggtg accggcgcgt ggacggtggc cactctgctg    117240
     gtgctgttcg gggtgctcat ggcgccgctt gactggcggt tggtcctgtt cgtctgggcc    117300
     tacgccctgg cgtggttcct cgtgaccgac ccggtgaaac tgcttgcgta tcggctcctc    117360
     gatccggtca aagacgcgag caggcccgaa cccgaaactg gagccaaagc caggcacaag    117420
     ccggactccc gcgccaggcc aacggccacg accgaagtcg gtgccaatgc caccgccacc    117480
     agcgaagccg gacctgacgc cacgacccaa ggcaagtccg cggcagcgcc gaagcccgaa    117540
     cctgagagtc ctctctgatt ggggttattg gtgtcaagct gttcctcttt tcgcaggcca    117600
     ttcccgtagg tcactcgctt ctctccgcgg tcggcgcgtg gccgccgcat gatgggatca    117660
     ggaggatgag gtgtctcaat ctgtttcgcg acctccgcgg catacatcca gtcgcgggga    117720
     tccggactct caacgagatc acctcgtcca tcgtccccac gggaacgaca ctgactccgc    117780
     cctcgtcagg cggaagctgc aactcctttt ctcatgctac ggtggcctgt ttgccccagc    117840
     agaactcgct gccatcgatc cacatgcgat gcaggatcac cgccagcttg cgcgccacag    117900
     cgacgcgggc gcgcgccatg ccccggcgct tggccacgtt catgccccat gcccgcagcg    117960
     ccgaccattt ggtgctgcgg atcagcaacg aatgggctgc ctcgtacagc gccgttcggg    118020
     ccagttcgtc accacatcgg ctgatgcggc cctgcacgtc ggtttcgccg gactggtagc    118080
     gtcgcggcgt caggccaaga tgcgcgccga catcgcgcga ccttcgaaag cggtccggtt    118140
     ggtcgatcgt ggcacggaac gccaacgccg tcagcgggcc gacgcccggc actgtcataa    118200
     gccgcctgca tgttggctcc acgcgcacct cgtcgagcac gcgcctggtc agccgctcca    118260
     cctcccgggt cattgtctcg acagcggcca gcagcgatcc agccaggctc accagcaccg    118320
     ggtcatccgc taccaattca cgcacgcgag ctccaaagtc cttgcggctt ggcgtaccaa    118380
     ccttcaaccc gacctcgcgc agcaacgccc gaatgccgtt ctcgacatca cgacgcttgt    118440
     tcagcagcat ccgccgcgcc gtcagcaacg cgcgccagga gcggcagggc gggcttttca    118500
     catgcaccgc acgataccat ccggtgcgca tgatctgcgc gatgccgcgc gcgtcgttgc    118560
     ggtcggtctt gttcggcatc gcacccatcg cggccttcgc ctgacgcgct tcgatacaga    118620
     tcgccggaat gccagcatcc gaaagccccg cttgcagcca ggccgtcagc gagcacgcct    118680
     ccagaccgac ccgcgccatc tccatcccgg atgccccgaa gaaggcgacc agcgcctccg    118740
     gctcgctggc aacccgcgct tcacgcacaa ttccacccgt cccatcgacc acgcagaccg    118800
     cggtctcttc caacgacaca tccaacccgg caaagtattc cacggctgct cctcctcgat    118860
     gcttgcggcc gatgcacaca caaccacgct ctatcatccc gagaggagca gccacccaga    118920
     tcacccgggt gagaccccaa tcaccccatc tatttcgaat cggatagtca acgagcgagg    118980
     cgcctcagca agaacacgct ggaggcggcg tagaggaagg cctcgacgct ctcgatgctt    119040
     gcctcgaaat cctttgccag ccgcctgttg cgattgatcc aggcgaagaa ccgctcgacg    119100
     acccagcgtc gggagatgac ggcgaagccg acctggttgt cggccttccg cactacctcg    119160
     atgcggatcg ggctggcatt cgcaacccga gcgccggcat agccaccatc tgcgtagccc    119220
     agcgccacga acggccaact cgcacgtgac gcacggagca gcggcccagc cccgtcacga    119280
     tcctgaatgg ccgccgaatg ggcctgcagc ttgagcgccc ggccgtcggt atcgaccatg    119340
     gcgtgccgct tgcgcccctt gatcttcttg cccgcatcgt atccccgggg gccgccactc    119400
     tctgtcgtct tgatgctctg actgtcgatc acggccgccg tcggactggc ctcccgaccc    119460
     gccctctcgc ggtcgcgcat caccagatgg tggttgatcc gctcccaggt gccatcgtca    119520
     cggaaccggg caaaccagcg ataggccgtg ggccatggcg gaaaatcctt cggcagcagg    119580
     ctccaggcaa taccgcctcg caggacgtag aagatcgcgt tgacaatctc gcgcatctcc    119640
     cacttccgat gccggccgca tcggctcggc gcgggcagga acggcgacag cagcagccat    119700
     tccgcgtcgg tcacgtcact tccatagcgt agccccgtgc ggctatgctg cgcacgggtg    119760
     gttggcgtcc acatggtgtc tccggcaagg cttcgaacac ctgcccggaa tcacatccgg    119820
     cccaaccatc caacccctca tcaaaagcgt tcccgttcca tttcgaaatg gcctctgagt    119880
     gaaagcggct ctgttgcaaa ttttgtgaac agggggagtg acgtattctg gatgggagcc    119940
     gagcttatca ggccgcctcg cgttccgttt gtgggccgat gagctggact gcttcggcaa    120000
     gggcgcaggc accgaggccg aaggcgcgtt cgacgatgcg cgcctcaccg caaatatccc    120060
     gcgtgagatt gaacatggcg gcctacccct tacgcagggc ccgcatcacc tcgaagccct    120120
     tgctcgtggc ataggccgtc ttcagtgtct tgaagccgcg caccgggcgg gtcagctgct    120180
     tgagcttgcc atggtccgcc tcgacgacgt tgttcaggta tttgacctgg cgatggaggg    120240
     taacctcggg acatttgcct tcggctttca gttccgcaat ggcgatggcg taggtcggcg    120300
     ccttgtcggt attgatgacc tccggtttct cccagtcctt caacccgttc agggccttgc    120360
     ccagaaagcg ctttgccgct ttcgcgttcc gcgtcggcga aagatagata tcgatcgtgt    120420
     tcccatgctt gtcgactgca cgatataaat acgcccattc gccacggacc ttgatatagg    120480
     tctcatcgac ccgccagctc gtcgaggccg gccgccgcca ttgccagcgc agcagcttct    120540
     caatctccgg ggcatatcgc tgaacccagc ggtaaatcgt cgaatgatca acgttcacgc    120600
     cgcgctcacc cctcatctgc tcaagatccc ggtagctgat cccataccgg caataccagc    120660
     gtaccgccca aagcacgatc tcatcgtcga aatgccgccc tctgaacgcc gacaacaccg    120720
     ctcctccacc agcctgcatc caatcccatc agaggaaacc ggactttgca acagagccct    120780
     gtcgaccgcc ctctctacgc gctccgcaat cgcatcgagc gctgcttcaa caaactcaag    120840
     aacagccgcc ggatcgccac aagatacgat caaaccgcca gcagcttcct aggtttcact    120900
     ctcctcgcct caatccgcct atagttcagg tttgcccacg cggcctagta ggatagtcac    120960
     ccgtgaaaaa tcgaactttg ctgatctggg ggcgatgttt tggtggctgg caatattggg    121020
     atttgcaggg tctgggcgag ctgaggggaa aaaccttgca aaaccgttgg agcgttgcgc    121080
     ggtggtcgcg atcgtgattc tctccctttg atgtcgaaca tcatgcgttt ggcgtggagg    121140
     aaagaatgcc gccgaagctg aatgcctcgc aggatgatct cgaactgttc cgctcgcggc    121200
     tggagaacat catcgaccag cggcatcccc tggtgcggct ggcccggctg atcgactggc    121260
     gggttttcga ggaacgcttc ggctcactct acgccgaggc ggcgggacgt ccggcactgc    121320
     cgacccgcct gatggtggcg ctgcatcttc tcaagcacat ggatgggctg tccgacgaag    121380
     cgatctgcgc gcgctatctc gacagtccgt atgtccaggc attctgcggc gagacgcatt    121440
     tccagcacac gctgccgctt gaccgatcct cgatgacgcg ctggcgcaaa cggatcgggc    121500
     ccgagcggat ggaggccctg ctcgccgaga cgctggcggc cgccgagcgg ggtggggccg    121560
     tggcggagaa gcactacaag cgggtcacca tcgataccac ggtccagcca aaggccgtga    121620
     cgcatccgac cgacagcaag ctcctgcaca gcggcatcga gacactggcg cggatggcac    121680
     gcaagcacgg tatcacgcta cgccagtcgt atcgccgggt cgcgcgctac gccaggcagg    121740
     aggcggcgcg cctgcaccat ggtggcaaac gccgcgaggc cgaggctcgc gtgcgcaagc    121800
     tgcgaacctg gctgggccgg ctggctcgtg acatcacccg caagatcgca ggcaacgctg    121860
     aagcgaaggc cactttcgcc gaaacgctgg gcctgatcaa tcgcctgggc agtgtcagga    121920
     attccgtgta tgggcggcgg ttgaacatca ggccgccatg gcccttacga agcgatcgcc    121980
     gaagatgacg gcgaactgag cctttgccat agcccattct cgaggtggca tcacccactc    122040
     tttctccgag cggttcagga tcagatagag cagcttggcc gcggcctcgt cgctggggaa    122100
     atggccgcgc gcgcggatgg cccggcgcag cttggaattc aaagcttcta tggcgttcgt    122160
     tgtataaatg atccgacgaa cgtcgcccgg aaagccgaag aaagggatga cttcctgcca    122220
     tacccggcgc cagctctggc cgatggcggg gtatttctgg ccccatggac cggcctcgaa    122280
     agcggcgaga gcggccccgg cggccctggc atccacggcc cggtagatgt ccttgagggc    122340
     ggtggcgacc gccttgcggt ccttgtagga cacgaaatcc atcgaattcc ggagcagatg    122400
     gacgatgcag gtctgcacga tcgtctcggg aaagacggcc gtgatcgcct ccgggaaccc    122460
     cttgaggcca tcgaccaccg ccagcaggat gtcctcgacg ccgcggttct tcagctcgtt    122520
     catcacgcgc agccagaatt tggcgccctc gttctgctcg atccacatcc cgagtacgac    122580
     cttcgtcccg tcggccataa cccccagcgc gatatggatc gccttgttgc ggaccacgcc    122640
     ctcgtcgcgg atcttcaccc ggatggcatc gaagaatacc agcggataga ccgggtccag    122700
     cggacgctgc tgccaggatg tcacctcgtc cagcaccgca tcggtgatcg tgctgatcag    122760
     ctccgccgag gcatccatgc cgtagatctc gcgcagatgt tccgcgatct cccgggtgct    122820
     catcccccgc gcatacatcg agatgatctt gtcatcgaag cctggaaacc ggcgctggta    122880
     tttggcgatc agctgcggat caaagctgcc cgcacggtct cgcgggatcg caatctcgat    122940
     ctttcccgtg ccggtcgaca ccgacttgcg gccatagccg ttccggctgt tctccgcctc    123000
     cgcttcgtca ctcagatggt aatccatctc cgcgctcagg gcccgctccg ccagagcctt    123060
     cttcagtgcg ttcaccagat ccccggaatt cagcgctgcc gccgcgtctc ccccagccag    123120
     aagctggtcc agcaattcgt ccgggatcgc cggcgctctc cgtcgtgcca tatgggtctt    123180
     cctttctacc cactatgcca ctcacacacg aaattcagga cactgccatc gcctgcttcg    123240
     ccagaagcgc tccgaccgcg gtgccgacaa gctctattcc ctgcacgcgc ctgaggtgga    123300
     gtgcatcggc aagggcaagg ccaggacgcg attcgaattc ggcgtgaagg tctccatcgc    123360
     caccaccaac gccgccgcac ccggcggtca gttcgttctc ggcatgcaga gccagccggg    123420
     aaatccctat gacggccaca ccctggccgg ccagatcgag caggtcgagc ggatcaccgg    123480
     cgttgccgtc gcccgcgcct atgtcgaccg cggctatcgc ggccacggcg tcgaagccga    123540
     gggcagaagg atcttcatct cccgccagaa acgcggcatc acccccacca tccgccgcga    123600
     gttgcgccga cgcacagcca tcgaacccgt catcggccac atgaagaccg atggccatct    123660
     ggggcgaaac ttcctgctcg gcttcgacgg tgatgccatc aacgccatcc ttgccggcgc    123720
     cggccacaac ctccggctgc tccgcagatg gctgatcagg cttctttgcg ccatcttcac    123780
     atggctctcg gccgcaagac cctctccaga ccttcgccta ccgaactacc acatcgctta    123840
     attcacagac gactaggata gaatccaccg gagacatggc acatgcttgc ggagtcaatg    123900
     atggtgattg tggcgcggtc gctgactgtg atcatgcgat ggtcacgaag ccaccgaagg    123960
     acccttgata tggtttcgct ccttattccg agataatcgg caatatcaat gcgagacatc    124020
     ggcagatgga tcgacgcgtc gccgtcatcg tcttgctgtt ccttcatcat gaggaggaac    124080
     caggtcactc gttctgttgc agacatacgg ccaagccgca gcatctgttg ttgcgcctgt    124140
     atcaggctac gttcagttgc taaaagcagg tcgcttgcaa acttgggctg atcggtcagc    124200
     aaagcatcaa gatttcgaag cggcaggctg atgatctgca tatcagttag ggcttctgcc    124260
     gtacaggttg catttttgtt aatgccaact acaaatccgg atggcacgaa aaaatcgccg    124320
     gcgaagagga atcctaacac ttgccgtcgt ccgtcttgca agccctttga aagtcgaacg    124380
     ataccagaaa caatttggta catcttgtcc gcaatttgat tttccatgaa gatggtagtg    124440
     ccggcttcaa gcgctcgtgc gtgataacct agctgaccgc aggtcgtccg aattgcagcc    124500
     tgaaactcca gagcttcgac caaaatgcga cccattagcg tgccgtctcc tattttgaga    124560
     tcaggtctat aaatttaatc gggacttcat atctaataat tgtaacagat aaatgttatt    124620
     ttgccgcagt ttgttggcaa ttcccgaagg gtaatggcaa tttgtatcgc aaaattacag    124680
     gctattaatt taggcggatt tgagcgtttt tcgatcgatt tgtatcgatg agggattctc    124740
     tatgcgagtg aatgcgagtg aattctgatt cgggatctgt gctggtaaag gaggccggca    124800
     tggatgggac atcctctttc gatggatttg cgcatgctgt tgatttccac ttaaatttgt    124860
     tgggggagga attcccgggt cagcggaatt caacacacag gatgaccgct gacatggaat    124920
     cggtgtcgtg aagttgcggt ctgcgtacag cggagaactg gaaatggcca gcccctcgcc    124980
     gatcgccatt atgaaaggcc catcacgatg ccagggctct ccgctggcac atccttgacg    125040
     atcctttcca caaccatccc gcaggattta gcaggccgct tttacctaaa cgactgccgc    125100
     ctcgtggcag acgccgatcc gaaagatgct gcggctcaat ggctcagggc cgggtgttga    125160
     ccctccgaaa gtgcgttgta tcagcaagtt gtaatgccga tcggcgttgg gaccccacac    125220
     ggaaccacaa acaaagccaa ctgttcatag gtggcacaaa cggctagaaa caagcacgag    125280
     gccgaaggag aaaacaatgt ccctacaacc agatggtgca gacataatca tactgcaaag    125340
     gatcgaaggg aagatagaca ggcttacaga ggatcttgcg gatttgaagc gccgcacagc    125400
     ctctatggag gagcgtacct cccgcgttca ggcagaatta tcatccatac atggtgattt    125460
     ttcaggccag tccatgagga ttgatcggat cgagaatcga cttgaccgca ttgataaccg    125520
     tctaagtatt cacgagtttt agcgccgtaa caccctcact atcgcccggc caggccggac    125580
     gatagtgagt ttagcggcag tacactcaaa ttcattatat cacgaattca agaaccttca    125640
     cagggatttt gcgggtgtcc agctcaaggg cgtggcgccc aggggacgca tagagcgagg    125700
     acgcgatcgt cccggcgtgc gagtggcata agattattac tatagttttc aaatagtttc    125760
     aaaaattatc agaaataaat attgtttagt accaaatata cttaaatgat gtcatcacaa    125820
     tagcctaatt gcatcaaaaa aatatgtatt ttatgattca tactaatgct accgtatcta    125880
     gttttgattt cattttgaaa gttctgcatg attccatgcg gaattcgaaa acaggagaaa    125940
     atgatgaagc aatcaccagt cactgagcca gttcgtgcga ctcttacaat aacctcagca    126000
     gcagctgtac tagcgcttct tggtattggt tccgcgtggg caatgacgcc tgcggcctcg    126060
     gtatcgggca ctcatggttt gatcgcgtcc agttcgccgg cggtgcacgg gattatcttg    126120
     gcgcagtccg atgaggcagc taagaccgaa ggtatgaaag aagaggaaaa gggcgccgag    126180
     gagacgaaga aaggtatgga ggacgagcaa aagggcgccg aggagatgaa tcaaggtatg    126240
     gaggacgagc aaaagggaat ggaagaagaa gataaaaaag attgatgtgc ggcggcttct    126300
     gaaactctgg agggcatttc gagatggaat ggcctctgaa aaatccgtca tcgcctcagc    126360
     gaacgcagaa gatacccatg atgtgatgat gcgccgccgg ggctgaccgc tttgatcgac    126420
     ttgattgacg tctggagttt tcggcgccgg aggaattttc ctgaaacagg tcctcgggtg    126480
     gactgcgaag gcggcccggg ctggtcccgg gccggcgtcg tcgaagttac atggattttg    126540
     tgtgctcagt ggtcatctcg tgagcctcgg tcgactgcct gagtgccgtc tcggacaggc    126600
     catgcgcctt cttcgaatac tcagcggcca ttttgccgtc acccttgatc tgctgggcgg    126660
     aggctttgtg atgggccttt gctgcatcct cgtgtgattt tgcggcgatg ttatgagtat    126720
     tgttggtcat tattgattcc tttcttaaca atccgcacag tgcgcggtca cttcggtatt    126780
     gattcgctcc gaaatacaac aaacaaaacc tgcatgacgt tagtaaaaaa ccagaataaa    126840
     ttgtctgatt tcttgtaagt ggttaatcat gacaaaaaag caagctgcgt attcataata    126900
     tatatttatt ctaattcgtt cgtatttagc ttttatcgga tattctggcc acctttcttt    126960
     cagtgtccat acacaggtta acctgagagc gctcagagtc tgttccgaat cacattagca    127020
     acgagcgagt ctgtggacgt ggagcatgac gaaggcggcg tagccgaagg tctccgctga    127080
     ggcgattgtt gcctcgaagt ctttggctag ccggcggtca tgcgaactta tgcagtcggc    127140
     gggaaaaatt gggcttgccg ggacgggtaa ccgcctcgac accccgggcg gggtgggttt    127200
     tctcgagata taaggggaga tggccgattt gattacggac cagaacagta agccgcagca    127260
     aggcgaactg ccgaccacac acatcgacgc gctgaccaac tcgttttcgc agttcctgcg    127320
     catcgaagcc acgagtggtg ccgttctcct gttggccacc gtcgttgcat tgacgctttc    127380
     caactcaccc tggtccgatg gcttcagatc tctttgggag acaccaatcg gcattcagat    127440
     cggtgcgttc cagtttctgc gctctttgcg ggatctgatc aacgacggtc taatgacgct    127500
     gttcttcttc atcgtcgcgc tcgagatcaa gcgcgaagtg gtgcttggtg aacttcggaa    127560
     cccgcgcatg gtggctctct cggtcgtagc tgcggcagga ggcatgcttg tgcccatggg    127620
     cttgtatctg gcgctgcagc atggccaacc tgggcagcat ggttggggcg tcgtgatgcc    127680
     gaccgacaca gctttcgtca tcggctgcct ggcgctcctt ggttcgcgtg tgcctccggg    127740
     cctacgcgtc ttcctgctat cgcttgcggt cgtcgacgac cttgccgcca tcctcgtggt    127800
     cgccgtcggt tacagtcgat caatcgactg gactgccctt gcgctcggcg ccgtcggact    127860
     ggtgataatt cgggggatgg cattactcgg cgttcgtaac atccgcgtct actttctggc    127920
     tggggcaata atctggctcg ccgtcaatgc gtccggcatc cacgcgacga ttgttggtgt    127980
     tatcctcggg ctcatgacac cgacggctgg ctgggtgagc gaccagcgtc tgggggaaat    128040
     cttgcgaaag gtgctctcct atcccccggg agatcattgg agtggcgata ccgaggataa    128100
     ccgggcgctg caggttgccg gtatcgcggt gcgcgagacg ttgtcgcccg tcgagaggct    128160
     cgaggccatg ctccatccct gggtcgcctt cggcgttatg ccgcttttcg cgcttgcaaa    128220
     cgcgggggta ccgatcacga tcaagggact tatcaaccca gtctcgctgg cggtgatggc    128280
     gggcttcgtc ctcggcaagc cgatcggcgt cacagcattc gcatggctgg gggtgcgcac    128340
     gggtgtcgcc attcggccgg cggggctcac ctggggggga cttgtcggtg gggctcttct    128400
     taccggtatc ggattcacca tggcgctgtt tatcgccggc caggcatttc aagatgccac    128460
     gctcaacgca gcgaagctgg gtatccttgc tgcctcagtc gtctcttctg ttgctggtct    128520
     cacgctgctg tgcgcgttgc ctcggagtga cggaacgcct atgtttcggg ggcgcagagg    128580
     cggaggagaa cacccatgac ataccccgct ctggcccatc gcggcatgaa aaaaagtctc    128640
     ccaagaagct agttggccct gactccttta cacatcgata accgggtcag ttgcgttatg    128700
     ttcggatgct gcttgaattg gacgcgagcc cgggtcgaca cgccttgagt cgatcgccat    128760
     ctgaacagcg gagagctctg agctgttcca tttgacgatc ggcatggcac cacgaggtga    128820
     tcgatcctcg ccctatttgg tggcgccagt ctaagggaga agctcatgac gagagctgat    128880
     agccgcgcac gcatttggcg gctcggcggt aatttgcatt ccagcaagcg catggcgtcc    128940
     ctccgcgcga tccgccgtcc cctgctgatc gcagccctca tcgttgcggc cgctccatcc    129000
     acatccttat ccgcgtcgat tccgcagggg gtctggctaa tggacggaag gtcgcggtgc    129060
     agatttttga ctgtggaaac aagatgtgtg gccggatcct ctggctgctc gtccctcgga    129120
     agccggaggg ccagctccag cgcgacaaga aaaatccgga tgccgccctg cggagccgac    129180
     cgctctgcgg cctgacgata ctttggaacc ttcggtccac gggccctgcc agctggggcg    129240
     acggctggtt ctacaatccg gacggcggta gaattttgat ttccactgag aagtgttggg    129300
     gtggaacggc ccacggcatc ggatgtgcca agatgaggtc gctcaaatga ccatcatgaa    129360
     agggccgtca ttacgcaatg tcgatgaata gagtgttttg cctgcagcgg atacaaaatg    129420
     cgacgaaaat ccggtagatc gaccccgctt ttggggacta gaactggcgc tcacaggctc    129480
     gtgagggtat catggccacg gctgccgata ctgccatcca gccccataat ctccgcgccg    129540
     cagcgatctg gaacgttgcc ggggatgcct acgatgaaat cagtcggggt atcgcggatt    129600
     caatcgacca tgcggttcgc cgcctcgcgc caggtccggg tgaaagagtg ctcgacgttg    129660
     ccaccggcac cggctggact gcgagatcca tagcaagaag cggcgcgatc gtgtccggtg    129720
     ttgatctcgg ggtggaccta gtcacagccg ctcagaatcg ggcacgggcg gaaggtctca    129780
     atatcgacta tcgcgtcggg gacgccgagg cccttgccta tgacgatgcc acgtttgacg    129840
     cggcaatttc cacctacggc gtgatgttcg ccagccatcc tgaggctgcc gccgccgaac    129900
     tggcccgcgt cacgcggccg ggaggccggc tcgtgctcac gacgtggagg cccgacagct    129960
     cggtcttcgg catgttccgt gtgctgcgcg agttcatgcc gccgccccct gatcctgcgc    130020
     cgccatcacc attcgagtgg ggccgcgaag accgtgtcac cgcgctgttg ggggaggcat    130080
     ttgacctcga attcgagccc ggcatttcag tctaccgcgt ggcggacggc gaaaccgcat    130140
     ggtctacgtt tgtccttgga tatggccctg cgcgcaccct ggccgccagt cttgatgaaa    130200
     gaaggcgcgc cgaccttcag cgtgcattcg tccaatttca cgagaacttc cgcgatggtg    130260
     acgagatctt ggtgcctcgc gaatacctgc tttcctatgg cacaaggcgc ggggactgat    130320
     ccacaaaccg ggcgcgctgc ggtcactcag acagatcagg gcggacctgg tgttcgctac    130380
     ccggaatgca tccggaacag cgcgaaaaag gcgaggccga tcaggctggc gcctcccatc    130440
     agtaaaacgc caatggcctc ggatctgtta tcggatttcg tcttttgcgg ataggcgtga    130500
     tgcatggaat gtctcctgtc caggcgctct accgattgcc ggatataggg gttgatttgt    130560
     gctgatccgg ccagttttgc atgttgaacg cggcgagcca tgcgcaggtc gcacctgaca    130620
     cggtcagaca tgcgtcttca ttgaagccgg tcgtgctgat tggaaggctg ctgctggcga    130680
     ctatcttttt tctttcgcct tagcggatgg tatagcgaat tattcagata tagcaaggct    130740
     tctaaaaata atatgaaaat tgatgcgata caaactataa ttaaaaccaa aataataggg    130800
     tgagttatca gatcataata ccaagacagg aattttatca tttaaatttt tccagataaa    130860
     caaaccgagt tttcacaaat ttatcgaaat aaatatactt tttaattgta aattaatgtg    130920
     cggttatgcc acgcgaacgc gcgctgttca cgcaacgccg caaggaggct tacgaggcgc    130980
     tgcatcctga gacgaaattc aaaagcacac ttcacaaggg attgggtcgc caagttggcg    131040
     acgaggagga gggcgcccca cgcttcaccg ccgacacaga cgcctgcttg cctcccgacc    131100
     gctccggagt catcaatcca gagtgggaca acaacggaac attgtcctac ctttttatgc    131160
     ggtgcggatc cgcgacctga tcgcgccgcg cgctgtgatc gaggtaacca tccggcgaag    131220
     cattcaatta cccataaggc tatatggcgc agcaagtcgg ccctctccct gtccatccgc    131280
     ggctgggcga agtcggtttc gttatcgtct caacggatgg ggtcttcagg cgagcatgat    131340
     gatctgtttg cctcgactgc cgctggtctc gaaggcgcgg tgcgcatcgg cgatgcgcgc    131400
     gagttcgtag acgccgtcca catgtggcct gaccacgcct tcctcgacat agcgggcgag    131460
     cgaggccagc atttcggtat cgggcgccgc attgaagtag cggatccgcc gaccaccatg    131520
     gatgcacgag aggctgacat aggccatcca tagcagcggg tgtctcggat caggcacgat    131580
     cgctgccatg cgtcgctttt gggccagcag gtagtgtccg gggtcgtggt ggacttttgg    131640
     gccctgtaac ggtgtagttt gaggtggcca tcggatcagt cggctatggt ggagttgcga    131700
     gacttcaacc tgaagcctgg agaacccgat gaccgaagat agattaccac tggctgagct    131760
     actggccaaa gccggggacg gcgattttct gcgcagcgtc gcggaggcgg tggttcaact    131820
     gctgatggag acggatgtgg atgggctgat cggcgccagc cgctacgagc gcagcggcga    131880
     gcgcgcgacc tatcgcaacg gctaccggga acgcgcattg gacacgcggc ttggcagctt    131940
     gcagcttcgg atcccgaagc tgcggcaggg gagctacttc ccgccgttcc tggaagctcg    132000
     ccggacctcg gagaaggcgc tggccgcggt catccaggaa gcctggattg gcggcgtctc    132060
     gacccggcgg gtagacgagc tggtgcaggc catggggctg acggggatca gcaagagcac    132120
     ggtctcgaaa ctgtgcaagg acatcgatga gagggtgaac gccttcctcg accggccact    132180
     cgccggcgag tggccgtatc tgtggttgga tgcgacctat ctcaagcagc gcgaaggtgg    132240
     gcggatcgtc tcagttgcag cgataatcgc agtggcggtg aacaccgacg gtcggcgcga    132300
     gatcgtcggc ctgcacatcg gcccgtccga ggcggagacc ttctggtcga cctttctcaa    132360
     gagcttggtc cgccgtgggt tgcgtgaggt gaaactggtg atctccgatg ctcatgaagg    132420
     attgaaggcg gcgatccgcc gggtgatggg ggcatcctgg caaagatgcc gcgttcactg    132480
     gatgcgcaac gccttgtcct atgtgccgaa ggggcagcag agcatggtgt ctgcagcgtt    132540
     gcgtcaggcg tttatccagc cggatcgcgt cagtgccagc cagaccctgc gccatgtggc    132600
     cgaccagctc cggggcaaat ggccaaaact tggcgcgttc atcgacgaca gtgaaaccga    132660
     cgtgctggcg cacatggact ttcccgccca gcaccgaacc aaaattcact cgacgaatcc    132720
     gctcgaacgc ctgaacaagg aggtcaagcg ccgcgccgat gtcgtcggca tctttcccaa    132780
     tgaaggttcg atcatccgcc tgatcggggc cgtgctgctc gaggccaacg acgaatggca    132840
     gacacagaac cgctatatgc agatcgaggg aatggtcgaa ctcatggcac ccgccatcga    132900
     tgccgataca ccacgaattt ccaccgtcgc cgcgtgacca ttggccgctt cagctacacc    132960
     agaatttcca ccacattgac ggacgctatc ggccagcagt cgccgatacg cggcgacgtt    133020
     tgtcccgact gtatcgagga tgacatcaaa cgaccggaga gtggcaggtt cgaggccagc    133080
     atagtcaacc gcctcgtcag cgccgagatc gcggacgaag gtgagattgc ggccacttgc    133140
     caagccggtg acgtgcgcgc ccattgcctt gccgtgtcaa accccacttg gacagttggt    133200
     tttataaagt ctggtgatat caatagttta tttgcccgcg tgcgggtgtt gccactacat    133260
     ttttggggcg ttgggtcggc ggtgcgtggc cgcggcttca gtctgtgtcg cgcgacgatc    133320
     aacgtgagaa tccggcgtca atcaggatga gaagacggct ggggaggcac cggcgaaggg    133380
     cgtagcccgg agccggtgcc tccccagccg ggcggcgtcc ttgccagggc gccgccgtgg    133440
     tcgcggccgg ccgggtcgcg gaggatgcct cctcgcaacg gggagacctt cgtgcccggc    133500
     cgccacatca acgaccacca gaagaggctt ttcatgagat atcgacagac agacggcgtt    133560
     gccctggcgg ccgccagggc cggcttcagc acggccgcgg gctaccggct ggagcagaag    133620
     cggcacctgc catcatcggc gaagccgcca cgcggccggc gccgcccgga tccgctggcg    133680
     gcgatcttcg acgctgaggt ggtgccgctg ctggaagccg cgcccggcct cagggccgtg    133740
     gcgatcttcg aggagatgtg ccggcggcat cccgatctcg ccccgggtgt ccggcggacg    133800
     ctcgagcggc gtatccgcac ctggcgcgcg ctgcacgggc cggagcagga ggtcatcttt    133860
     cgccagaccc atgagccggg cgcgatgggc ctgtccgact tcaccgacat gaacgagctc    133920
     ggcatcatcg tcgccggcgc cccgctcgac caccggctct atcacttccg cctggtctgg    133980
     tccggcttcg agcacgccca tgtcatcctg ggcggcgaga gctacgtcgc cctcgccgag    134040
     gggctgcaga acgccctctg gcttctgggc ggcgccccgc gcgaacatcg cagcgacagc    134100
     ctctccgccg ccttccgcaa cctggccgcc gagaacgtcg ccgacctgac ccgccgatat    134160
     gacgcgctct gcgcccatta cggcatgacc ccgtcgcgca acaatcgcgg tgtcgctcat    134220
     gagaacggcg ccatcgaaag cccccacggc catctcaagc gcgtggtccg cgacgccctt    134280
     ctcctgcgtg gcagcacagt cttcgtcgat ctcgaagcct atcgccgctt catcgccgag    134340
     atcgtcggcc gccagaaccg gcgccacgcc gagcgcatcg acgccgagcg cgccgccctg    134400
     cagaaactcc ccgagcagcg caccgccgat tacgaggaga ccgtcgtcac catcacctcc    134460
     tccggcggct tcaccctcag gaaggtcttc tacaccgtcc cctcccgcct gatcggccag    134520
     cggctccgcg tccgcctcta tgacaaccgg ctcgagctgt tcctcgccgc caccccgctg    134580
     atgacactcc cccgcggccg gccacaaccg gatggcagac acggccacgt cgtcgactac    134640
     cgccacgtca tccacagcct gcgccgcaaa ccgatggcgc tgctcaatct cgtctatcgc    134700
     caccagctct tcccgcgcga tgcctatcgc cagaccttcg agcacctgct cgagcagaca    134760
     ccgcccaggg acgcgtgcag gatcatggtc gaactcctcg ccatcgccca tgagcgtgcc    134820
     tgcgaggctg aactcgccag cgtcctcgcc gccgatagca acgccggccg acagcccgac    134880
     ctcaatgcca tccgccagcg cttcgcaccc gatcccgcca gcctgcccgc actcaccatc    134940
     ccgaccatgc cgctcgccag ctatgacatc ctgctccagg gagcagccgc atgagcgaga    135000
     ccgcacgcac cgtcgacgcc cagcgcctta ccctgctgct caacgagctc aggctccccg    135060
     ccatcaagca ggtctggccc gacttcgccg cccgcgccga caaggaagca tggcccgccg    135120
     cacgcctcct cgccacgctc gccgagcacg aggtcgccga gcgcgaccgc aggcgcatcg    135180
     agcgccacct cctcgaagcc aggctgccgc ccggaaagac catcgccact ttcgccttcg    135240
     aggccgtgcc gatgatctcc aaggcccagg tcctcgccct ctgctccggc gacggatggc    135300
     tcgataccgg cgccaatctc ctcgccttcg gcccacccgg cggaggaaag tcccatctcg    135360
     ccgcagccat cggcctcgcc ctcgtcgaga atggctggcg cgtgctgttc acccgcacct    135420
     ccgacctcgt ccagaagctc cagatcgcac gtcgcgaact cgccctcgag gccaccatcg    135480
     ccaagctcga caaattccac ctgctgatcc tcgacgacct cgcttacgtc accaaggatc    135540
     aggccgaaac ctcagtcctc ttcgaactca tcagcacacg ctacgagcgc cggtccctga    135600
     tgatcaccgc caaccagccc ttcggcgagt ggggaaaggt gttccccgat cccgccatga    135660
     cactcgccgc cgttgaccgc ctcgtccacc acgccaccat cttcgagatg aacgtcgaaa    135720
     gctatcgccg caaaaccgcc atccaacgac gaaccggacc aggacgccca cccacacgag    135780
     cgacaatcac cgaaaacggc agattgtcgc gccacgacaa tcaagtcgcc gaaacccgct    135840
     tgccagcatc aaaccaatcc gattaacgtt ccgaggtcgc gatcactttc tcatcctgat    135900
     cgtcgcgctt ctcatcctga ttgtcgcgct acaagtctgc ggggtgctcg ctgatgttgt    135960
     ggggcagcgc gatgccggcg gccttgaaga cattgccgac ctggccggtg acgtgggtcc    136020
     tcgtggtgat gaccttgccg cccttttcga tggttgcctg ctggagcctg tcgagatcgt    136080
     tcagcaactt ctgccattcg ggctggaagc ccctggcgcc gcacaggcgg ttcagttcct    136140
     tggcaagtgt cagggccagg aaggaacaga aaacgtggcc gcggatcgcg gcgtcagcct    136200
     ggtgaaagat cggccttgta tcgaagctgg ccttggcggc gcggaacagg gcctcgacct    136260
     cgagcaggtc gcgataccgg atcacggcct gcaggggcgt gacccttgcg ttggtcctga    136320
     gcacgctgag gccatcgaag cgggcctcct cggccagctt gcccggatcg atctcgaagg    136380
     cgttgccgcg gctgcggaga taacgtcggt aggccgagtt gccgaccagc gccttgtcgc    136440
     ccttcttcag ctgggcctgc agcccgtcga tgatggcctg gcggtcctcc ctgtcctttc    136500
     tcgcctcggc ctcattgacc gtgacgatgt agcgctgggc cgccttgccc ttgccaatcc    136560
     ggacctcctt cacccacagc tgggtctcgc catgctggcg atcgagcacg agcgggacca    136620
     tcgcggcctt gtccttcagc acgacgtcgc ggatcacccg gctggtgcgc tcgcgcgcgc    136680
     cgaggatgta ttccaccccc agcgcttcca gtgccgcgat ggtatcggcg ctgatcatgc    136740
     cgcggtcggc gaccacgcag gcgcgggtga tgccgaagcg ctcgcgcagg cgcgtgacca    136800
     ccggcatcag gatcttcacg tcggcggtgt tgcccggcac catctcggtg cagatcggcc    136860
     gcccttcggc atcgatcacc agggccagga tcatctgcgc gaggtcgggg cgataatcct    136920
     tcgaatggcc acgccggccc agcgtctcgc cgccctcgcc gtagaaggag agcgaggtcg    136980
     tatccatgaa caccaggctg agatcggtga acaggtcgcg ccggcgttcg aagagttgct    137040
     cctcgatcac gtccttgacg caacgtggcg cgagggcgcc cgcttgcctg tcgccgagtt    137100
     cctcgcccag ccaggccatc gcgcgataga agtggtgcag cgccagatcc tccgcgccat    137160
     cgatggcgta gctctgcatc cagtcgacac aggagcggtc ggagcccgag acgaacagcc    137220
     ggtgcagtgt ggcgacgaag acggcgcgct cgacggcaaa gccgaactgg cggccctcga    137280
     ggaggttgtt gagcacctcg ccgatgccga gccggtccca gaggcggccg aacagcaggg    137340
     ggccaccgat cctgtgggcg gcgatccggc cggcatcgat atcggagagg atgatggaac    137400
     gttcggcgtg ccgtgcgatg gaggcgacga gcctgtcgag ttcgccggat gcggcgagga    137460
     catccttgcg accgaggggt ttgatggtgc gctggcggac ggatttgccc acgcgcacgc    137520
     tttcgacgag gtagagatag ctgtggccgc gggcgactct ctcgacgacg aacatgctga    137580
     tgttgtgacg gcaatgccat gccgaattca acaaaaaact gccattcagc caaaactgtt    137640
     gttactacac atttttcgcg cccaaatgtc acccattata tatcaatgac ttatatccat    137700
     tcgttcccca tccgttctca ccccactgtc caactcgggc ctggtatgag tggcaggtga    137760
     cgccaaaggg caagcaaccc tttgccttcg cccggccgga tcgtgaaacg atggcctttg    137820
     cgggcatttg ggaaagctgg gtgacgcctg gcacggcgaa agtgcttcgc accttcgcca    137880
     tcatcaccac ggcagccaac gccacggcgg cgcccgtgca tgaccgcatg ccggtcatca    137940
     ttcgccagga ggattggccg atctggctgg gcgaagcggc gggcgagtct gctggccttc    138000
     ttcatccacc gccagatgag ttgattgagg cgtggccggt ggggcaggcg gtcaattcgc    138060
     cccggaacaa cgggccggac ctgctggcga cggctgcgga atagccccca cgcgaagtta    138120
     aggggggggg cgatcgctcg tggttaagtt actgaaaaat catgattatt tcttgttgtt    138180
     ggttgttgcc ggggcaggag cttttccgcc ttgcgttagg acggcaggag ctggcgggcg    138240
     ctgcgtgatt gtagaggaaa gattccgtcc gcccttggca atatagccct ctgtcaaagg    138300
     cttaatcttg ccaaagccat ccatttccat tccgtgaccc gctttagact cctttgacat    138360
     cgaaaactcc ttcatccacc tgcttcatgc ggaaactcaa tattgatctt ctccggggca    138420
     cgagcaaggt aaagcctcgg ggtttcatat aactgctcac catccaaatt atagacgatc    138480
     acccgcagca aaaccaattc tcgaagctta tcagtctcgg aaaaagtatc cacccagccc    138540
     gcatagagaa agccgtggtc caaatcccgg acgtgagcgt attcaaccgc cgcttcgccc    138600
     gagtttagca tgaagtccca aacatcctca tccccatatt ttttcgtggc ttttatcagt    138660
     tgtaaaaagc gcgtcagaag tttgtaggtt gaggcataaa gccagaggag ggccattatg    138720
     aggctgattc ccaccgcgcc tagaacctca tgggctatag gggcggtcag aacctcatgt    138780
     gaatcagcag cagcaagatc aactattgga aatggccaat gcaaccactc aaaaaccata    138840
     tattcaacaa catagacagt cagcccaaaa acgaaggctc tcactacaaa ttcgatttcg    138900
     gagggcttca cttttgccgc ataggttgcg tctagcttcg cccagataat tcccggtagg    138960
     aagataacag ctacttgcac aagaaacaga ttcacgctca catcgtccat tgcaggccca    139020
     tagatttccg aatcagccta tagcatcctt cctcagcttc cccgcaaaac cgcataaatc    139080
     gtcatacaat cgcccctatc gcccgcgtcc gcgcttgcgg ctttcctgct caagcggccg    139140
     ttcctcggct tggcgctgcg cctggcgccg atgcccctct agcgctttct gtagccgcgc    139200
     ccgggcactc cggtgcgcgg cctcgatcaa cggccgcgcc cgctcccagc cggccgccac    139260
     ggctgctctt acggccgggg gcgcccgctc gatgcgggcc agcgtctgcc ccttctcctc    139320
     accggcccgc gccatggtgt cggccaagcc gccttgcgcg cccgcacgga cctggctgcg    139380
     cgcaaaacgc tgggacaggt cagcgggcaa gccagcggcc gcgcgcttct cgtcagccgc    139440
     cagccctttg aggaaggcgc gggcggcatt gcggcgggcc tcctcgccga tcttcaccag    139500
     atcgagcgca ttggtctttt caggctggcg cgcgatgttc cgcgtccagt tcgcccagat    139560
     gtcgtgctcg cggatcgggc gcggatctcc aagcggccgg cggcccccga tctcctgacg    139620
     ctcagccccc tccgaggtca gccagtaatc ccgctcccgg tgcctcgacc cggagacata    139680
     ggtcttgaag ccgtccgtgg tctgcgaacc gcctggcgtt acaaagatat gctcggtcgt    139740
     ggtgatgccc tgggcggtgt tggtggtcat ggcatagcca taagccagcc gcatccggcc    139800
     ggtttccttg tcggcgagcg tgtcccattt cacaaagcct tcgcggccat ggtcgttccg    139860
     cagcaccaga ccctcctcgc ggatgctggt gatttcgagg atcgagccgt tatcgccgat    139920
     cgcgcccttg ccgccatcca gcatcgcggc gttggtccgg gcgaatagcc ggattttttc    139980
     gcccgtcgcg atcggcatcg cgtagtgctc gccggtgttc ttgtcgatcg ccgccagcgt    140040
     catgcggctc tgccccagct cgccagaggc cagcagccgt tgccggattg cctcgccgat    140100
     cgcccgcgca tcctgattgg tcggtgtgct gatcgacagc gtaaagcgtg gccggtcagc    140160
     attcgctttc cggcgctcat cccagagcgc agcggctcgc gcgatcacct cattatgccc    140220
     gcccgcgacg atctcggccg tgccatcctg ccgcttcatg tccagcgcct tgccaacagc    140280
     ctcagcacca cctttgcgca gcaagcccgt aatctcgcgc gcccgctcat tggtttggcg    140340
     cacactgctt tcgattgacg gcacctcacc cagacctttt tcgagaaggc cgatcacctg    140400
     gcctgcctcg atcgactggc attgcttcgg atcaccgatc gccaccatgc ggaacccgtg    140460
     ctgctcctga agccgcaaca aatcgagcat ctggcgcgtg ccgatcgtgc ccagctcatc    140520
     gatcaccacg acactgcggt tggacaggtc cagccggccg ctctccaccc ggttgatgaa    140580
     caccgataca gccgcaatcg tatcacgccc gcctgtctcg gcctcggtat tcagcccggc    140640
     ctcgcgcagc tcgcgcgcct ggcgccagcc aaggctgatg ccgtgaatgt ccgcaccctg    140700
     gtcacgccac gcggccacaa gcggcttcaa cagcgtggtc ttgccggccc cggctgcccc    140760
     gatccccacc gcgaaccggc cgcccatgcc gagatgatcg atcatccggc gctgcgccgc    140820
     gccatgtgcg ccggtgaagc tcagcccgct cgcctcgatc ccgcgcttga tctgtaccgg    140880
     gttgagcgtg ccgcgccgat cgcggccagc ctgtcccgac agctcgacca gcgcgctctc    140940
     ctgctcgaca tgggcgcgcg tggtcaacct ggttgtagtg atcgtcacat ccgggttgtc    141000
     cgggtcatcc cgctcggtct cgaccgcgat gatctgcgtg cgcgcagact caccgttgcc    141060
     gccagcaccg cccgtctcga caaccccgcg cgcccgcaac cgcgcgatca cctgatcaac    141120
     atcgccgcca tccttgatgc cggccgccac caggccacgc gctgcggcaa cgcgctcatc    141180
     ctcggccttg atgaccgccc gccgggcaaa ctgctcgccc agcacccgcg aagccgcctc    141240
     ataggccaga tcaagccggg ccgcttcggt catcttctcc gccggcgcag catcctgcag    141300
     aacgctcttg tgctgatagc cacgtgcctc cgcctggcgc cgccagctcg caaagtcgct    141360
     cagatcgtcg gccttggcac tgcggctcgc aaaggcgccg cctttcagca gcttgatgcg    141420
     ttcgtcgccc gtcatgcggt cccaatccgc ccccagcgag gcggcatagg ctttcgcgtc    141480
     ggagagggca tcgcgggtcc gcttactgaa cgccgcccgg atctcctccg gcacggcgct    141540
     gagccgcgcc gcgccggtgg ctcggtccaa ttctatactg gctcccgccc gccggagatt    141600
     ctgcgcaaga tgggcctgat agattgctcc ccattcatgg atgcggccgt gcatctgcaa    141660
     cgtgttcagg gacacaaccc ggccgctctc agtgacgatg acattcggca ccgcgacatg    141720
     cgtatgaagt tgcggatcgc cggccacttt caccgacacg atctcggttt ccgtgcggcc    141780
     atccgctgtc tcgcgggcaa tttcgagggt gggccgggct gtgtagtgat caaaggtgat    141840
     ccacccgatg cggccctgct cggtgccttc cttgccgcct ttgcccttcc gtgcctggcc    141900
     aatgacctgt tcgatctcgg ccatggtcgc ggccaccgca tccttgtgcg cctgggccag    141960
     ttggttgcgc tccgcctcgg tcggcgcgaa ggcccatgcc agcgaaatcg tcttgtccgc    142020
     cgagaaggta aaatcaacgt agccgatcgg agttttcgag cggttcaccg cgttccgcca    142080
     atcggccgca tccaacgcct tgccgtccgc ccgcttgcca tcaaggatgt tggcccgctc    142140
     ggtctcggaa aggacgcgtc cgtctttggc gccgagtgcc ttgtagagcc gcacaagctc    142200
     gggatgaggc gcgggcgggc tttgttcagc ctcttgggcg ggcgggccgt ccggcgccgc    142260
     gctgggagag gcgggcgcca gcttcgcctc gatccgcgcc cggtcggcag cacccgacgc    142320
     ctcagccgcc gccagcgcct gccgcaaacc ggcagcgcca ccttcacgca aggcatcagc    142380
     ccaatcggcg cccttcgctc cgcccgcgac atcagccggc ggttcaagat agaccgcctc    142440
     gccgccattg gcctcaatca aggccgcggc cttggcggcc gccttctgcc cggcctcgcc    142500
     aacatcacgg ccattatgga ggcgggcatt gtcgcgatca gccagcagcg caaccggcgt    142560
     cgagccggtg aactgcccgg cccaagccac caggccgcca gcattatagc cgacaacacc    142620
     agcctgccgc gtttcctgca cgacactcgc gacggtctcg aacccttcac cggccacccg    142680
     cgcctggtca tggccgccaa tcggcaccgc cgcgccagcc ggcggatgca acagccaggc    142740
     gcccgaggcc cccaacatcc ggcggccgat cttctcgccg ccttcggtca gataggtgcg    142800
     ctgcacgccc gtcagccgca cccggccatc ctcatcctgg ccgaacatcg gcgtcagcat    142860
     caccaccgcc gccccggccg acacttccgc cgaatcataa ttcggatgcg gccggaccag    142920
     ccgcacatgg ctcatcagcc aatcggcatc gaggccgcgc ccgctgagat aggcacgggc    142980
     tgacgcccgc agggcctcgg cctcgtccac acgcgccgca tgcgccgcgc gctgctgcaa    143040
     tttctgcccc accgccccgt gcaaacgcgg cgcgcgcagc tcgcccgtgc ccggaatcgc    143100
     ctcatcccag agtttcccgg cgatgctctt gcggaaagca ctgcgccgca cctcggccgc    143160
     gcgcgccgcc ttcgccgcct cggggtccag ctcgaccgcc tcggctttga cgcccagccg    143220
     gcgcaccagg ctctcgaacc gcccgccttc gctggcggca aagtcggtcc attggccagt    143280
     ggtggcgttg accgagactg tccagctttc ccctccgcgc caggtcgctt gcagccgcaa    143340
     cctgccgccg ctggtccggt agggcacacc agcggcatca agcgccgccg caacatcgat    143400
     cgcccgtggc tccgctggcc gctcctcggc cgccgggcca cgcggcggca ccgccggttc    143460
     accgccccgc gcaatatcgg cctgccagtc agccgccagc gccgcatccc gatcatgccc    143520
     gaccacctcc tccatcgggg gcggggcaaa atcatctggc cagggcggcg gaccatcggc    143580
     cgcccttccc agctcgccaa gcgccgccgc ttcggccgca agggcggcgt cgcgatcctc    143640
     cgcctcgttc ggctcaacag cctttggcgc tgcggtctgc ggagtgatcg cgggggccgc    143700
     ctcgactggc gcggccggca gatcaaatcc gtcagcccgt ttgccggcga gcaggttttc    143760
     cagctccgcg cgggtcggca accgcatcgg gtcaaacccg aacacctcgg caagcggcgt    143820
     cactgcgcgc tgatactgtt tgcccgcgat cttctcgcca tccgcccgat tgcccgccag    143880
     cagctcggca atctcgtcac gggtcaatgg gcgcgacgtg tcgatcccca gcgcggcggc    143940
     aacggtgggg tgcatatcgc ggcgaggctc gggaatggtg ccagggcggg ccgcgtccaa    144000
     cgcggtggcc gccgcgttat cttccgccgc tgccgtgccg ggctgccaaa gcccgccatc    144060
     aaccgtcatg ccgcgctgat aatacgccgc catgtcctgc tcgaaccccg gcagtgtcat    144120
     ggtcatcagg tgatccgcca tcttcccggc ggcaccggat gaggtggacg ccgcaccggc    144180
     gcggaacgtc agcacgtctc tccgcccgcc ccggactgtg atccgtcgtc gcccggttcg    144240
     agcgccgtgg ccaggccacg catcaccccg gcctcaacct ctgcccccag cccgtccagc    144300
     gtcgtgccga tttgcagaag cgcggtggtc tggtcgcgca gcgcaccggc gatgcctgcc    144360
     agggcgtcct caagcgggct ttcttccgaa ggggtcgcca gctcgatcaa ccgcgccagc    144420
     atttggctgt gcgtgttctg cgtttcgatc atcagccgca tcgcctggat gacggcatcg    144480
     aggcggtcat ctttcggggg cggcggggcg gtttcgggct cgggcatcgg gcggaactcc    144540
     tgccgtcacc gtagccccat tgtcacttgc gccgcaagct ccataggtgc aatggtctgt    144600
     gacttatctc ctgaactttc cacccgcata gtggcggggg tttggcggac tttatggcgc    144660
     ggatttgctg tgcttatgct gtgaatttgc atcgtatctg ctgcgaaaat ggaggacatt    144720
     atgctgtgaa tatgctgtgg ttgtgctgcg ttctattgac gtgcagaggt tgaaatcggt    144780
     aggattcccc atgcccgtac ctgatctcga tattgaaaag ctcggtgcgg cgatggcttc    144840
     cggccttcgt cggcgctccc cgttgatggt ctggtttatc gagcaccacg acgaatttgc    144900
     cgccctcctc gacaagcatg gagcgcattg gaaggggttg gcggagcact tcgcggcggc    144960
     cgggctggtc tcccgcaccg gccagccgct cacgccgcgc acggtcgaaa actactggct    145020
     gcgggcacgg cgcctggtcg ccaagcgacg ggcggaaggg cgcccggttg cggcggcccc    145080
     ggccggcacg cctgagcccg aaccgagatt caaacccttc accatgagca acgaagggca    145140
     cggtgtttcc gcagcggaac cccaggcccc cggcactcct gcggcaccgg ccgaccaggc    145200
     ggcccagccg acacccaagt ttcaacggtc atggatgaga aatgagggcc gcggcgtttc    145260
     tcctgcggaa cgccgtgccc ttggtgatcc aacagctccg gcagatcccg acgatccgaa    145320
     atggagaggc gacaaatccc gataggagaa tttgatgact gaggccccct catcagaaaa    145380
     gaaacccaac ggcgcccaca aacccacaac ccccgtattc cgccccggca gcgtggccgc    145440
     cggactcaag tcggcggaaa tcaaacctct gctgaccaga gagcaatcca gttctgaacc    145500
     cgtcgcccag ggcctcgatc tcgctgatcg gcccaagatc atcctgacgg ccggccgggg    145560
     caaaaccggc aagaccacct tcctgcgctg gatcgcggag atggcgcagc gggacgggaa    145620
     agcgcctctc ctggctgaca ttgatcccac caacgcaacc ttctcgacct atttcggcgg    145680
     ggtcgctcgg ccggacacct tcaaccaggc cgcggttcgc gactggctcc aggacttcat    145740
     ggagttcgcc atcgccgaaa aacaaaccgc catcgtcgat ctcgggggtg gcgatacgat    145800
     cctccgcacc atagccggag agatgcccgg cttcgatgca atgatcgagg atgcgggcat    145860
     ggccgtggtg atgttctacc tcgccggccc gcatcccgag gatctaaccc ctgcggccac    145920
     gctcggcgcc ttgggcttca agccccgcgc gcgggccttc gtgctcaatg aaggcatggc    145980
     tcaagccgga caatcccgcg accaggcgtt cgggcgcctt acctcctcga acgtctatcg    146040
     cgatgaaacg gcggacggtg cgctcaccct ctggatgccg cgcctgcatg cggccgaggc    146100
     tgtcgaggcg cgcaccgcga gttttatcgc cgctcgggac ggtcagacag aaccgccgct    146160
     cggggtgttc aaccgctcgc gggtgggcca ctggctcaag gcgatggatg agcaattcgc    146220
     cggcgtgaaa tcgtggatgc catgagcgag gccgtcgatc agggcggagc agaagctgcg    146280
     atccgcgccg cgcaagcgga gctggatcgg gccgagcagc tggcccggct cgacaatgac    146340
     cccaccgcgc acacgctcca cgcgctccgg gtctttctgg gctcgacggc cgccattgcc    146400
     gcagatcagc ggcgcgctat ggctgagcac cgcttgcatg tcgatcggga ttttagcgcc    146460
     gtgcgccagg cgcgggatgg cttggcgcaa accatcgatc aagctttcaa ggccgcaaag    146520
     gcgcaggccg aagcggcgca tgcggatctc tcgcgccagt ttgtggcctc cttcgcgaaa    146580
     gaggcagaac agcgcctcaa gtccatgtcg cggtggatat ggtggcgcac gatcgcctcg    146640
     ggcgcggcgc tggccatcgt gatcctctcc cttgggttcg gcctgggcta ctggcgcggc    146700
     aacgcggccg gttacagcga ggccgccggc accattcacg ccaccggggc cgttgagcaa    146760
     tccgtcctcg cctcacaagg cccggctggt ttggcacaat ggcaccagct catgcgcgac    146820
     aacgcgatcc tcgacaccat gaaatccgac tgcaccggga agaacgtggc gcatcaggac    146880
     ggccgcacgg cctgccatct ctggctatgg acaacgccga atgttgcgtc cgcagcgcat    146940
     gggtaggggg atggaggagc gttttacccc caccgcggat gggtcggctc gctcggccgg    147000
     cttcgtctcc cagctcggcc gggttttgct cggcctgctt cggggcacgt tgcgttttct    147060
     gctggtggcc gtgctcgacg tgctgatcct cgcggttcgg ttcatgctct ggttccgccg    147120
     cctcttgttc tggctgggcc tcttctcagc tctgtcctgc attttgaatt atcaggctca    147180
     taagccgctg ctcgccgcgt tcgcgctcgg ggctggtatc ctcatgatga cgctctcacg    147240
     cgccagcctg ctcctcaatg accggctgcg cttctgccag ctgcaactcc atgcctgggc    147300
     tcaaggctgg ccggtagcgc gttatgcgtt caccgccctc ccgccccggc gttgatgagg    147360
     ttggccgatt taatgcctaa ccagcagctg aacggtgaca tgtaagcatg ttgttgtgtt    147420
     ggtagggcac aaatcgatcc tggtcactgg atggcggatt gtctgcctcc gaaaccagcc    147480
     gttcaatgcc gacacgcacc ggcgacttcg cgcccatccc ggtcgcccgg cactccagag    147540
     ggcattctcc gaagccgaca ctagaggtcg cccgcaggtc gtcccgcatg agccaaacgc    147600
     cggatgcggc cacgaggatc gccgggatcc agagcgttgg aaggggtgcc tggacaaatt    147660
     gagcgataag gccgagcaac ggtgcgccaa gcactgagcc agtattgcgc cagtagagag    147720
     gacaacatga aagtgctttt catgtatgct aggcatggac attaagtgaa cggcaatgga    147780
     ttgccgaggt agaagtccaa tctagcgatc aatttgggtc gatcatgcga tttgcgaact    147840
     aattttcggg cgtgatccat ttgcattgat acttgaatga acgattatgg cgttctcctg    147900
     agtttgcggt ttgaagcgca gaaggcgaag tgcgttggcc gtgacgagta ccgtggcccc    147960
     ggtatcggca aggatcgcca tccagagcgg cgtgatgccg gacaggctgg tgaccaggaa    148020
     cacgctcttg agcccgagag ccaacgcgat gttctgccag atattgatga tggttgcgcg    148080
     cgatagggtc accatttcgg cgacgccggt gacccggttc ttcaggagtg cggcgtccgc    148140
     cgtttcgagc gcaacatccg tcccgctccc cattgcgaca ccaaccgacg aagctgccag    148200
     ggctggcgcg tcgttgatgc catcaccgac catcgcgatc ggcgcctcgg ccttgtaacc    148260
     cgagatagcg gcaagcttgt catccggcag aagactggca cgaacctcga tccccgcggc    148320
     gtcggcgatc ccttgtgcgc accgaaggtt gtcgccggtg agcatgaccg gtcgaatgcc    148380
     aagcgcacgc agtgtccgca cagcttcgga agcatcggct ctcagttcgt cccgcaatgc    148440
     gatcagaccg atcaggcgct tgccttcgca caccgtgacg acggtttttc cctcatcctc    148500
     gagggctgaa atccgttcct gtgccgtatc atcgagcaat gcctgttcag cggcatgaag    148560
     cggcgaggcg accgtcacga aaccggagct gatccgcccc atgacggact tgcccggcgc    148620
     cgccacggtg ccgccgaaca ctcgcggcat atcaaggccg cgaagttcag cttccttgac    148680
     gatcgccgcg ccgagcgggt ggctggatcc gcgttccacg gccgcggcct tcgccaacac    148740
     gttcgcaaca tcgccctcga cggggacgac gtcagtcacc tgaggctgcc ccatcgtcag    148800
     tgtgccggtc ttgtcgaagg cgaccgttct gatcttgccg agtgtctcca gcgccgcgcc    148860
     gcccttgatc agcaacccgt accgggcacc gctcgcgagt cccgatgcaa tagccgcagg    148920
     tgttgagatc accagcgcgc aggggcaggc gatcagcagg acagccaacc cccgatagat    148980
     ccaggtgaac cagtcggcgc caagggcgag aggcggaccc tgttgatttc cactgagaag    149040
     tgacccggga attccatcga gatttgaccc gccttttggt tatgatttgg gtttcatgat    149100
     ggggtcaagg gctgcttttc tcctttcgtt ttgagatttc tgcactgagc tgttcttgaa    149160
     ccggaagctg tcattgccgg tctccaggat gtggcagtgg tgcgtcaggc ggtcgaggag    149220
     agcggtggtc atcttggcgt cgccgaagac cgcggcccat tcgctgaagc tgaggttggt    149280
     ggtgatggcg acgctggtgc gctcgtaaag cttgctgagc agatggaaca gcaaagcgcc    149340
     gcctgaggcg ctgaagggca gatagccaag ctcatcgagg atgacgaggt cggcatggat    149400
     caggcggccg gcgatttgcc cggcctttcc ctgagccttt tcctgctcca gagcattgac    149460
     cagctcgacg gtggagaaga agcggatgcg ctttttgtga tgctcgacgg cctgcacgcc    149520
     aagcgcggtg gcgatgtggg ttttgcccgt gcccgggccg ccgacgagca cgacattgtc    149580
     ggcgggctcg atgaagtcgc aacgatgcaa ctgcctgacc agggcctcat tgacctcgct    149640
     gctggcgaag tcgaagccgg ccaggtcgcg ataggccggg aagcgggcgg ccttgagctg    149700
     ataggccatg gagcggacct cgcgctcagc ggtctcggcc ttgagcaact gggagagcac    149760
     cgggatggcg gcttcaaagg ccggagcacc ctgctgggcc agttcatcga cggcctgtgc    149820
     catgccgtgc attttgaggc tgcgaagcat gatgacgagc gcacccgcgg cgggatcatg    149880
     acgcatggcg agtctccccg gtttgacgca gggtatcgta gcgctcgaca tcggccctgg    149940
     gctcatgggc caatgtcaac gcctgtggtg cggtgatgac tggcggcggc gcctgtttgc    150000
     cgtcgatcag cctgtggagc cggttgagga tatgcgtctt ggacggcacg ccatcggcca    150060
     aggccagttc cgccgccatc agaaccagtt gctcatcatg gtgcagcacc agggccagga    150120
     tctccaccat atcgcggtca ccgcctggat gctgcaggag atgccgctgc aaatgccgga    150180
     acgcatcggg caattccagg aacggcgcgc cgttgcgcaa ggcgcccggc ttgcgctgga    150240
     tcaccgccag ataatgccgc cagtcataaa tcgtgcggcc gggaccgtgt gtccgctcga    150300
     cgacgcgggg gtgttcgcaa atgatttgcc cttccgccgc caccaccagc ctgttggggt    150360
     aaacccgcag gctgaccggc cggttggcaa aagaagccgg cacactgtag cggttgcgct    150420
     ccaggtggat caggcaggtc gaggagacgc gcttggtgaa ttccacgaac ccatcgaatg    150480
     gccgccccac gggcatgagg ctctcgacct cctgggccca gacatcggca atgctccctg    150540
     gctcgccgcc atgtgcggtc tgctcccaaa gctcccggca gcgctgttcc agccaatcat    150600
     tgagggcgtc gagggtttcg aacggcggca tggattgcca caggcgatgg cgggcatcct    150660
     ggacgttctt ttcaacttgc cccttctccc agcctgcggc gcgattgcag aaatcgggct    150720
     cgaagagata atggctggtc atcgcctgga agcgcaggtt gacgctgcgc tccttgccgc    150780
     gaccgacctt gtccacggca gtgctcatgt tgtcgtaaat gccccgccgc ggcacgccgc    150840
     caagcgcccg gaaggcgtgg ttgtgcgcat cgaacagcat ctcatgcgtc tgcagcagat    150900
     aggcgcggat gatgaacgcg cggctgtagc agagcttggt gtgcgccacc tgcagcttga    150960
     cgcgggcgct gccaatgaca gcgaaatcct cgctccagtc gaactgaaag gcttcgccgg    151020
     gcgcaaaaga cagcggcaca aaggtgccac gcccggcggt ctgctgcaga agtttgcatt    151080
     cttccttcca ggcgcgggca aatgccgcta cccggttgta ggagccgtca tagccaaggc    151140
     tgaccaggtc tccgtgcaat tgcttgaccg tccgccgctg cttgcgcggc cggttcccct    151200
     cacgccggag ccagagggcc aacttctcgg catacgggtc cagcttgctc ggccggtccg    151260
     gaacctgaaa cttcggctca atctgatcag accgcagata tttgcggatt gtgttccgtg    151320
     acacgccaag ccgccgtgaa atctcccgga tcggcacata ctcacgctta tgccaccggc    151380
     ggataatgct caaaaacgcc atgtccaaca ctccgttcgc ccccgcctct tccagacggg    151440
     gaaacagtca aacatgggtc aaatctcagt ggaaaaatcc ggccttcccg ggtcacttct    151500
     cagtggaaat caacaggcgg acccagcatc acgagggctg agaacgccat ggcggcaggc    151560
     gtataccaac ggctgaaccg gtcaatgaac cgtgccgtcg gggctttcgt agcctgagct    151620
     tcctcgacca tgtggatgat gcgagctatc gtgttgtcgg cagaggtgcg ggtgatctcg    151680
     atgcgaagct cgccatgtcc ggcaatgctg ccggcataaa ccggcgcccc ctcggctttg    151740
     acgacgggcg cggattcccc ggtcaccggt gcttcattga cctgggacgt gcccccgacc    151800
     accgttccat cggacggtac ccgatcgccg gcgcgaaccg tcacaacgtc gccgatggcg    151860
     agggtctcga ccggcaccgt ttcaatcgcg tcgccgcgca ctcggcgtgc ggtgcgcggc    151920
     acgaggccga tcagcccctc gataccggcc cgcgcccggc cagcggcgac gccctctagc    151980
     agttcaccca gcgcgaacag gaacacgacg attgcggcgt cagcaccctc gccgatcgca    152040
     agggcgccga tcgatgcaat cgacatcagg gtttccattg tgaagggcgt gccagtccgc    152100
     atgcccgcca gcgcccggcg gacaatcggc agcaggccga ccagcgcggc tgcgacatag    152160
     ggccagggcg accaggccgg ctctgcctgc gtcacgacaa atccaagcgc gaggagcaac    152220
     cccgtgacgc cgaccagtcg gaccttgcgg gtcttccacc agacgtttcc gctggctgat    152280
     tccgtccgga ccttatccgc atccgcctgc ctggtgcctc cgagaggcgt gaagccgagc    152340
     gctctgatcc tcgcctcgat catggttctc gcggtgcggt cttcgtccag catgagcgac    152400
     agggaggcgg tgctgaaact gacagagaca tccgtgacgc caggcaaccg cttcatggca    152460
     ttctcgatct tcacggcgca gccgccgcaa tccatgcctt cgatcttcag cttgacacta    152520
     atcgcggcag ccatggcttt tcctcgacaa tcacgacatg aatccgatat gatccctgta    152580
     gtcactatag ggtcaagcga tgtcaggtgg atttttggca atcggcgaac tcggtcggca    152640
     gaccgcaacc agggtcgaga ccatccgcta ctacgaacgt atagggctat tgccggctcc    152700
     agcgcgaacc gccggcaact atcgggcata cggccctgag catctgaacc gattgagctt    152760
     cattcgcagg tcacgcgatc tgggtttttc actcgatcag gtccgtgctt tgctggatct    152820
     tgccgatgag cgcgcccgct cttgtgaagc tgtcgacgca attgcccgcg atcatctggc    152880
     ggagatcgat cgcaagatcg ccgatctgcg tgctctgcgg cgcgaactcg gcaacatgat    152940
     cagtcagtgc cgccagggga cggttgccga atgccggatt atcgacgcgc tatcccctgg    153000
     agccagccaa aagaagcggc ggaagtgacg agaggtttca ttgagggcgg ggcagatccc    153060
     gcatgagcca gattcctgat ccggccacga ggaccgccgt gatccagagc gtcggaaggg    153120
     ttgcctgcgc aaattgagcg atgaggccga gcgcgacggc gccgagcgcg tagccggtgt    153180
     cgcgccagta gcggtaggtg ccgagggcct tgccgcggat cagcggtgct gcacggtccg    153240
     acatcgcggc gatgagatta ggatagagca gcgccatgcc gaggcccata acgatcgccc    153300
     ccggcagcca gagcgacgca tcgcgcccgg ccgccgtgat cgcgatgccg gcggccagga    153360
     ggaagaaccc gacgatcacc ggggcgcggc ggccgacccg gtcgcccaga tggccggtcc    153420
     agagctgcga gacgccccag accatggcgt aggtgccggt cagccagccg atttcgatca    153480
     gctttgcgcc atgtgatttg aaaaacagcg ggaacatcac ccagaccagc gtgtcggcga    153540
     ttttgttgac gataccgccc tggcagatcg cccgcccgac ccgatcgcgg aaagagatgc    153600
     ggacgaagat ctcgcgtagc gtgagcgtat gatcctgcga cgcgccggca ccggcctcgg    153660
     catgttcggc cttgacccaa gcgagcgtat cgcggacccg ggtgatcgtg gcgaaggcca    153720
     gaacaatcgt ggccatgccg aaaattagca gtgcattacg cgcgccgacc gcctcggcca    153780
     gcagggcggc cacggcgccg gccagaccga cggcaacata tccagtagcc tcgttgatgc    153840
     cgacggcaag cccgcgctgg tgactgccgg cgaggtcaat ctggctggtc accgtcatcg    153900
     tccatgtgaa gccctggctg atcccgagaa acacgttcgc gatcacgatc caccaccagt    153960
     tgggtgccgc ccagatcagc agcgggatgg gaatggctgc gatccagccg gcaatgagga    154020
     caggcttgcg gccgaaccgg tcggcgagcc cgccggcgac aaggttgagc gcgcccttca    154080
     ccaggccgaa ggagagcacg aaactcgcga gaaagagaaa ggcaccgggt gcgacgccga    154140
     actcgtgcgc gagggtcggc aggaccgcgc gctccatgcc gatgacaaga ccgacgaaga    154200
     agacctgtag cgcctgtagc gtaaactggc cgcgattggc cgcgatgccg cggatatgat    154260
     ccgaggcgtt cgccaccgtg gtcacgcggt gaagcccgca ttccaggcac gcagttcggc    154320
     tgcgccctcg ggggcgggcg ggatattctc gagcatgaag gcgacgaagc gctcggcatc    154380
     gtcgatgcgg aaggcggggt tgtaccgccg ctcaaagccg atagtggaca ccggtttgcc    154440
     tgagagacct cggccacaga ccgagccagc cagagccccg ggtagcacct cgatatgatc    154500
     cggcagcgcc ttgagccgga cgaggctggc gaagaggtcg cgcgcgccgc gcgcggcgtc    154560
     ggtggcaagc tcggtccggc cgacatcgcc caccataagc gtgtggccgc cgagtacgct    154620
     ccacggctca tccgcgcggg tgcggtcggt caccgtgagg cagagatgct ccggcgtgtg    154680
     accgggcgtg tgcagaacct cgagcacgac attgccgagt tcgagccgtt cgccgtctgc    154740
     gaggcggcgg cacgcatagc cgaccttggc ggattcgtgg atggcgtatt cggcgccagc    154800
     cgcttcggcc aatgcgcggc cggcggagcg atgatcggca tgcaggtgcg tatcgattac    154860
     ctggcggatc ggcgtcgccg aggctgatgc ggcctgcaaa taaggctcga tcggaaacag    154920
     cgggtcgaca accacgccgg cgcccttgcc gacacagccg agcagatagg aggccgccgt    154980
     gggatcggtg tgcaggaact gtcgcaggat catgagtgtt gctcccggct gaggtggcga    155040
     tcttgtcgcc agcgcgctat cacattatca ttcgcgatat tgatcgaatg agtcgaagat    155100
     gaagtcaagc agcggtccaa agcaacagat tttcagccat ctcgccgaga tcgcagctgc    155160
     acttgcgcat ccgcacagga tcgaaattat cgaactgatc gcccaaggtg agcgcagcgt    155220
     agaggatctt gccgaacgga tcggcctgtc gctctcgaac acgtcccgcc acctgcaggt    155280
     cttgcgccgt gcccgccttg cggcgccgcg gcgagagggc aagaacatgt tctatagcct    155340
     ggtctccgag accgaggtgg tgacgttgct gggcagcctg gggcgagtgg gcgagcggaa    155400
     catcgcggaa atcgatcagg tgctgcaggc gtatttccgg gcgcgggatt ctctcgagcc    155460
     cgtatcgcgc ttgaccttgc ttgaacgcct gcgcgagggc agcgtgacac tcctcgatgt    155520
     ccgaccggcg gatgaattcg cgcggggcca tttgccgggt gcgttgaaca ttcccctcga    155580
     tcagttggat gcggcgctgg gccacttcac tgagaacatc ccggtcgtcg cgtattgccg    155640
     gggaccgtat tgcgttctgt catatgaagc cgtggcgcag ttacgggcgc gaggcgttca    155700
     ggccagccgc ctggaagatg gctatcctga gtggaaggga gcgggtttgc ctatcgagac    155760
     ctgagctgcg ggggcggacc ggctatccga tcttacggcg accgtgaacc gacgcgaacc    155820
     cgatcacacc ggggacgtat ttcgaatcag ctgcttggaa tgccgatcgg cgtccagacc    155880
     ctaggtcgat aacaataagt ccatgagtct actggtcgct gcccgaactt ggttgttcag    155940
     gccgcatttt cctgaaaacg gcgcactggt ggctgctggt gttgtcgtgc aagccaaaga    156000
     tcatagtttg cctgcatccc aagccatgcc tgcgccgtgc tcacgccagc ctgttcaagc    156060
     cggatcgcca aatcagggct aatggcagcc ctggcgttca acacacgcga caacgctgcg    156120
     cgggacatag ccagcctctg ggcggcctcg gtaacggaaa gccccagctc accgatgaca    156180
     tcctctctta gcagttcgcc aggatgtggc ggattattca tcattttacc ttctcctagt    156240
     ggtagtcttg ataattcacc aactcaacgc cagcctcaac gaaccgaaat gtcactctcc    156300
     aattcccgtt gacccacacg gaccagtgcc cggcaaggtc acctttcagt gggtgcagct    156360
     taaacgccgg gatgttcata tcctgcggcg tctgcgccac atccaaaagg ccaagaatgc    156420
     gcttcaactt gccagcctgt gcggcttgaa tcccgcgcat ggagcccgtg cggtaaaaag    156480
     cctccaggcc cttatgtcgg aaactcaaga tcacaaatca gtgtaacgcg tagcgcgtca    156540
     ctatacaact tcaatcaatg tgatcacgtc caaaaccgac cggtttcgga cacctcgccg    156600
     agagcatgcc caaaactatg cttgacggca ttgtgggcat tgtccgatat tacaggcagg    156660
     tttttggacg taattgccct atgtcgcgcg tgtttttgta tgcccgtgtc ccgacggtcg    156720
     agcagaccgc cgagaatcag atcgccgagg cgaaggccgc cggcttcgcc attcgtccga    156780
     accggatcat cacggaaacg atctcgggca gcgtcgcggc tcgtcagcgg ccggagttag    156840
     agaaaacgaa gcgcgcagac cgtctggttc agcgccggcc acgacatgcc gccggcaaca    156900
     aggtggacct gaaaagcacg gacctcctca aggccgagct tctccggcga gcggctgaaa    156960
     aaacggccaa acttggcgac cgcatgcacg tatgatcgtt gggtcgcagg cgatagattg    157020
     cggaccgtca tatcctcaat catgcggcgg cgcagagggc ccatctcggt catcgggggg    157080
     ctcccgtcca gggttggggt gaaaagcacc caaatcctgg cagactaccg ccagaccatg    157140
     ggaaaaccgc cgcctcagac gcaactaccg cgccaacggt ttagttcaat cccaaaaatc    157200
     accagaatcg caactttctg ccaaagtagt gatagagccc accaaaacaa gccaggttcg    157260
     gccggtaagc cgtcacgccc gcacgatgtc aggttgcaca gcacgcctga gaaaaatcag    157320
     aggaaatgcg ctcgcgaatt atcccggtta gtgccgggca aactgcccat aaatgacatg    157380
     ataagaagat atcttggatt atggtgaaat atcaacatga taagggcgtt acagcgcgat    157440
     aaaacggaca acatcgaatg ctgtaaatca ccaaaaatgc accaaaaatt acccaatatt    157500
     tgacatggga atagaggccg ccattcattc tgagccagcc acgctttcgc aatagcgtca    157560
     tacgataaat caccaatatt ggtgaaatat cggcataaaa caggaatcaa tgtgagttca    157620
     aattgtcctg cgggactaac gccagacaaa ccagcactat ctgtcgaaac tagacgcagt    157680
     aacgggggta aggagtggtg aggagtgggt ggcggaagag gtggtgggtt gggtggaaat    157740
     ggggttggtg ttggtagtgg ggaatgaggc ggtgttggag cggggagtag cgggcaagcg    157800
     gcggtgttgg agcggggagt agcgggcaag cggggtggcg ggcaagcggc ggtggtcggg    157860
     cgcggatgac ggatgagatc gccgggtggc gggcaagcgg cggtgtaaca gtcgtctgtg    157920
     ctatgcagaa ctgagcgaga ggaacgaggc ttcagatgat agccacagtc aaagcgtgtg    157980
     tcggccgaga ggtcgacggg acgtcgatat atctagccag gcgcggcggc ggcattgtcc    158040
     tgaatttcgt gtatgggcgg cggttgaaca tcaggccgcc agggccctta cgaagcggtc    158100
     gccgaagatg acggcgaact gagcctttgc catagcccat tctcgaggcg gcatcaccct    158160
     ccttggccgc gagggttgtc cggagcgcct tattttcagc ttccagggtc tggtctggcc    158220
     cctgtgaggc cgaagcccac gggaagcgtt gcatgtgcat gtcgagagaa ggacgatgtg    158280
     gaagccaaat tttggctgta tcccgaggtt tcggtggcat acgatgacgg ctttaatgcc    158340
     aaggccctgg ggtgcctgat tgcgatgatc gagaccaacc ggcagcggat tataggagta    158400
     tgggatgaat tcttcgcctg gagcctgcgg cgtgcggttt gactgcggat tccggagaat    158460
     tcgcccatgg attccgattt taattcgccc acgattccga cgtttattcg cccggggatt    158520
     ccgagattta ttcgcccggg tagcggtctc tgtggctgtt gatttcgttg ctctcctgtt    158580
     cttgttgggt caagcggttt ttggggtttg cttgcgggtc ttgcgcaggc tttcaccggt    158640
     gagttcgatg cggtgggcat tgtggagcag acggtcgaga atggcgtcgg cgtaggtcgg    158700
     atcgccgatc agctcatgcc aatgcgccgg agggatctgg ctggtgatga tggtggcgcg    158760
     acggccgtag cgatcctcga cgatctcgag caggtcgtga cgggcgctgg cgtcaagcgg    158820
     tgcaaggccg aagtcgtcga ggatcagcag attgacggtg ccgagagtgc ggatcatccg    158880
     gccgtgccgc ccttcggcgc gggcgagtgc gagttcggtg aagagtttcg gcgcgcgctg    158940
     atagagcacg ctcctgtcat cacgacatgc cttgtgaccg agggcgcagg ccagccagga    159000
     ttttccgacc cctgtcggcc cgctcaggac gagattgtcg tgcgcgtcga tccactcacc    159060
     ctggatcagc ttctggaaca gagcccgatc gaggccgcgg gcactccggt aatcgacatc    159120
     ctcgattgca gcgtcatggc gcagcttggc atggcgcagc cttgtgctca accgcttgtc    159180
     acgtcggacg gtgatctcgc ggtcgagcag aaggccgagc cattcggcgt gactgaggct    159240
     ggggtttcgg gattggcgtg cagctcggtg aacgcgcggg ccatgcctgc aagaccgagc    159300
     tggtggatct gatcgagggt cggatggttc agcatgaggc ttctccttgt catcagtgga    159360
     aatatccgcc gccccggatg ttggggtggc ggatcggggt gggatcggga ctggcggagc    159420
     cggcggctcg ctccagccgg tgatcgagga tggatttgac cgagctgtag gtcagggtgc    159480
     cgatggtgag cgcgcgctcg gccgcggcgt cgagccggtc ggcgccgacg ctgcgggcca    159540
     ggcgaaggat accgatgcag gcgcggaacc cctgctccgg atgaggccgg cgttcgagga    159600
     tcagggtgca gagtgtcgcg accgagggac caagccgtgt ggcttcctga tggatccgcg    159660
     cgatggtcca gtcgccgtaa cgccggtggc tcgagggcat gtgctcggcg atcgtcgtat    159720
     gtttgccgtt gcccgacggc agtgtcgtga atttcgtgtg tgagtggcat agtgggtaga    159780
     aaggaagacc catatggcac gacggagagc gccggcgatc ccggacgaat tgctggacca    159840
     gcttctggct gggggagacg cggcggcagc gctgaattcc ggggatctgg tgaacgcgct    159900
     gaagaaggct ctggcggagc gggccctgag cgcggagatg gattaccatc tgagtgacga    159960
     agcggaggcg gagaacagcc gcaacggcta tggccgcaag tcggtgtcga ccggcacggg    160020
     gaagatcgag attgcgatcc cgcgagaccg tgcgggtagc tttgatccgc agctgattgc    160080
     caaataccag cgccggtttc caggcttcga tgacaagatc atctcgatgt atgcgcgggg    160140
     gatgagcacc cgggagatcg cggaacatct gcgcgagatc tacggcatgg atgcctcggc    160200
     ggagctgatc agcacgatca ccgatgcggt gctggacgag gtgacatcct ggcagcagcg    160260
     tccgctggac ccggtctatc cgctggtatt cttcgatgcc atccgggtga agatccgcga    160320
     cgagggcgtg gtccgcaaca aggcgatcca tatcgcgctg ggggttatgg ccgacgggac    160380
     gaaggtcgta ctcgggatgt ggatcgagca gaacgaaggc gccaaattct ggctgcgcgt    160440
     gatgaacgag ctgaagaacc gcggcgtcga ggacatcctg ctggcggtgg tcgatggcct    160500
     caaggggttc ccggaggcga tcacggccgt ctttcccgag acgatcgtgc agacctgcat    160560
     cgtccatctg ctccggaatt ccatggattt cgtgtcctac aaggaccgca aggcggtcgc    160620
     ggccgcgctc aaggacatct accgggccgt ggatgccagg gccgccgagg ccgctctcgc    160680
     cgatttcgag gccggtccat ggggccagaa ataccccgcc atcggccaga gctggcgccg    160740
     ggtatggcag gaagtcatcc cgttcttttc cttccccggc gaggtccgtc ggatcgtcta    160800
     caccacgaac gccatagaag ctttgaattc caagctgcgc cgggccatcc gcgtgcgcgg    160860
     ccatttcccc agcgatgagg ccgcggccaa gctgctctat ctgatcctga accgatccga    160920
     aaaagagtgg gtgatgccac ctcgagaatg ggctatggca aaggctcagt tcgccgtcat    160980
     cttcggcgac cgctttgtaa gggccctggc ggcctgatgt tcaaccgccg cccatacacg    161040
     gaattcctga cagtgccggc accagcagcg ccggcacgcc gccaattgct gccagagtgc    161100
     gattatgcgc ctcgatccag tccggcaggg tctgggtcca ggtcgcctca gcataggtga    161160
     agctcgatgc gccgagaacg gcgacgaaga tctgggccgc acgcgtctcg ccggtgagcc    161220
     ggtcgatcac caccggcact gtgtcgcctg cataatcgac gaacagcttc ttgcccgatg    161280
     cgtgggtctg gcgcatcgtc accggcagcc gggcttccca gctccggtag agctcgcaga    161340
     accggctgta gcgatacccg tccgggtgct cggcgatata ctcgtcccac aggatcgaca    161400
     gcgtcacgtg cttgcgctgc aactcgcggc ggatacgccc ccagtccggc tcatccacac    161460
     gtcgatgccc cggccgcttg cccgccgagc cttcgaacaa gcgcctttcc aaggccgcct    161520
     cggacagcgc cagagcccct ggcccatcga gcccggccgc ctccagtcgc cgcagcgtca    161580
     agcgcaccgt cgatgccgca accccgaccc ggatccccac ctggcgggtc gaaagccccg    161640
     ccatcctcaa tctgacaatc tcgcgcacat cgcgcatcgc aatccgctcc actggcattc    161700
     atccactccc tcgatcagac aaagggaggg aacctgaacc agccagcaga gacctcaatc    161760
     cgacccggcc aaccccgccc gcctgggcga ataaaagtcg gaacaggtgg gcgaattaat    161820
     ctcggaatag gtgggcgaat aattcccgga atcccgggcg agttaatatc ggaatcccgg    161880
     gcgaattgag cccggaatca gcagtttgac aaggactcga tgtggatcac gctggatgac    161940
     ggccgagttc tcggcgttcc gctggcatgg ttcccccgcc tgttttatgc gacgccggaa    162000
     cagcgtgttg catgccggat cagttcgcgc ggtcttcatt gggaggggct ggacgaggat    162060
     atttccatcg ccggcctgct cgctggccgc ggtaatcaga cccatcggcc tcgctcgatc    162120
     ccctcggcgg catgaaccgg accgttcccc agatcgatct tgaactcgag gccgagcggc    162180
     ggctcctcga ggccgccgtc gccgaagccc gggccgatct ccgctcgccc gtgccgcatg    162240
     agcaggtgcg agccgatctc ctgcgcgaga tcaagcggct gaacctggcg atcgccggtc    162300
     actgagcatg caggtcgaat ggcatcagct tgccctggaa gatcgtgatg tcattgttgc    162360
     ttatctcgaa ctgctcaacc cgaacgcagc ctcaagcgtt ctgcgtggac tggttctcgc    162420
     cggcgacagc ctggcgctgt ttcccacccg gggccgcgtg ggcttggccg ccggcacccg    162480
     ggaactggtg gcggtgtggc cgtatctgat cgtgtatgag gtcgatacgt catccgatac    162540
     ggtgcggatt ctccgtatct ggcacgaagc ccaggaacga ccgtgatgaa tgccaaaaag    162600
     aaaatggcgg cctttaaggc cgccaagttt taagattggg agggaacgtc agcggagatc    162660
     gctttccgct tcatggcccg atatggcccg gtttggcggg gttacaatat gcgtgttttg    162720
     agatgtgatc tggggcggtg gccagtctgc cgccatgaca cgagagcgta atatcgcctt    162780
     gaaatcaggg ctggaaaacg cacttcaaac tccggacaag gctttttggg tagcctttcc    162840
     agtcgtctca gcatttagcg accggtcact cggcgaccct ggaccatggg gtcgccattt    162900
     tcttgtccac cccatcccag acgcaacgca tcctcacggc ggagggcgat ttagataacc    162960
     ataaatcaag tatttcgtgc gataaggatc gaatgctggg catcattcct catacgatcg    163020
     atcagtacct caagacccgc gttccgcctg aggccagggc gggaattctc gggcgagcgg    163080
     gatttccgga cgggcagacc ttccggctcg atacggaata tgacgacgag tcctgttgcg    163140
     cgctggtcga tgcgatcgcc gcggaaaccg gcacgacaac cgaggccgta ttcgatgaga    163200
     tctcggcgtt cttcctcgac tgggcggaac gcaccttctc gggatttttc aaggttgcgc    163260
     cggatacgcg cggctttctc ctgctgcaac cggagatcca tagcagcctc gcctgtgggc    163320
     tgcgggccag cgggcagcga aaggtggccg acaagttcag ggtcgaggcg ctgccggatg    163380
     gggtgcgaat tcattaccgc tcgtcgaacc ggctcggcta tttctactgc gcgctcgccc    163440
     actgcctcgc cgcgcgcagg ggcgaggtgg ccgagatcag ctttctcgac ggcgatgtcg    163500
     gctcggccgc cgcgatcatc gaggtgaggc tgaaaccggc gctggcggcc tgacgcgcat    163560
     ggatcaggcc gaaacgctcg atcgcgccgc ggtcgaggcc ctgtgcgagg cgatgtgtgg    163620
     cgttgtctcc ggcgacctgt cggtgcggct gcggacggcg agcgcggacc tgacggtcca    163680
     gaagctgtcg ctgctcgcga atttcatgct ggagaccgcc cagcgcgcgg tggagcgcag    163740
     cctggcctat gccggggcac tcgacaacgt gcagcgcatc gcacggcttt cggcctggca    163800
     actggtgttg cctgaccaag aggtcgtgcc ggtcggcacc gcggcgggcc tgccggatgc    163860
     ggcggccgcg ccgctgcagg ggaccgcttg gttcctcgac cgcgtgggcc cgggctgtcg    163920
     tgccgcgatg gccgccctgt tccagggcga tggcgggacg ctcgaatggc tggcggcgga    163980
     tggcgaggcc tggttccgca ccgaggtcgc cgccttgcgc gacgagggca ggctcgcggg    164040
     gtatctcgtg atcacccagg acatctccga gcgccggcgg gcgaccgagc gcatccgcta    164100
     tctcgccgag cacgacccgc tgaccgggct cgccaaccgg agacggctgc acgagcaact    164160
     cgaaggggaa ctcgaggccg gccgccggca gggtacgaaa ttcgcggtcc atgtcatcga    164220
     tgtcgaccga ttcaagacgg tgaacgacct gttcggccat gccgcgggcg accggctgct    164280
     ggtcgatctc gccacctgcc tgcggcagga agcgcgggaa agcgacatga tcgcccgcat    164340
     cggcggcgac gaattcgtcg tcctgcaagt cgggatcggc gacgcgcggg acgccggggc    164400
     gctggccggg cggctggtcg gggcggtgag cgcgcggctc gccgagcccg gcgcgcgcgc    164460
     gctggcggcg acggtctcga tcggcatcgc gctggcgcca gatgacggca cgaccgccga    164520
     ggccctgctc tcgcatgccg acatggcgct ctaccaggtg aagtcgaccg gacggaacgg    164580
     cttcgccttc ttcaacaccg agatcaacga ggcccagctc gcccgtcggc ggatggaggc    164640
     ggaactgcgc ggcgcctgcg agcgaggcga aatggcggtg cactaccagc cactgttcga    164700
     gatcgcgtcc gaccgggtcg tcgggttcga ggcgctggta cgctggcggc gggacggcga    164760
     ggacgtctcg ccggccgtgt tcatcccgat cgccgaggag tcgggcagca tcatcgagat    164820
     cggccgcttc gtgctgcgcg aggcgtgccg cgaggcagcg ggctggccgg taaagttgcg    164880
     cgtcgccgtc aatatctcgg cgctgcagat ccaggacggc gggctgcccg atcttgtcgc    164940
     caccgtgctg gaggagaccg gtctggaggc cgggcggctc gaactcgagg tgaccgagtc    165000
     gctgctgctc gccaatgccg aggcggcgac cgaggtgctc gcgcggatca gggcgctggg    165060
     ggtgacgatc tcgctcgacg atttcggcac cggctattcc tcgctggcga cgctgcggat    165120
     gttccccttc gacaagatca agctcgaccg ctccttcgtc aatgatctcg ggcggctcgg    165180
     cgaggcggag gcgatcgtga tggcggtgct cgggctcggc cgcgcgctcg acgtctcggt    165240
     ggtcgcggag ggggtggaaa ctgaggaaca ggccgccatg ctgcgcgcgg caggatgctc    165300
     gctgctgcag ggctacctga tcggccgacc ggcaccgatc gcccggttca gcgcggaggt    165360
     cggccgcgac gttacgagca ggatgacgaa aacaccgata cctgcggatt cgcctggtta    165420
     ggcaacccgg gccagctagg ctgatagctc attagcttga cataggcttc gaactgatcg    165480
     tcgttgcgcg aatcggtcat gcacaagctg gcgaccaaag ggggtagtcc tgcggtggac    165540
     gtggcaggta ggtcttcatc gagcaacgcc gcacaatcgg tcgagcctga ctggcgctct    165600
     gctcacatgt cctgaacccc cagacatcgt cgctgacaaa aatgccactg gcggcatttt    165660
     ccttcatatt gtgatatcat atttagccat cttcatttcc catagggtta taaatgtggc    165720
     tcttcgacgt ctcaagtgga atggaagacg tcgagcatgg cgttgatggg cgcgccgagc    165780
     aggtagatga tgcacgcgaa ggtagcggtg ttgcgatagc ctcgggcgcg agcgcgggct    165840
     gcctggaaca gcccattgag cgcttcgagg cgggcattgg aatggcctga cttccagcgt    165900
     cgaatgatcc gcttggcatt gcgccgtacg gtatcgacgg cctgtcgaac aggatcgagc    165960
     aggtggtcgg gatcgtccag ccgggcggtg acgtggttga ggaagttggt cagccgccag    166020
     cgcgcggcct gtggcgttgc ggccaggcga acccagcgca gcatctcctt ggcgcgatag    166080
     gcttcggctg tggcgaagcc gctgttctcc aactggtcga gcgcctgccg ctgggccatg    166140
     gtcaggtttt ccggtcgctt caacgtggcc cagcgtaccc ccttgggcag gttgtgctga    166200
     tgcgcctcgg cgcgccgcac ctgctcgacc gcggtggtga agatctgcac gacgtggaac    166260
     cagtccacgg tgaccgaggc ctgcgggaag ctctccgccg cagcagcaag gaaggccgcc    166320
     gacatgtcac acaccacctc ggcgatgcgg cgggcctcgc cgccgtgctc cgccaggaag    166380
     gcccggaagg cggtcatgca ttccttaccc tttccggggg tgacgaacag caccgggcgc    166440
     tcggccgcat cgaggtcaat gaacacggtg acgtagctgt ggcctcgctt ggccgcggtt    166500
     tcgtcgagtg cgatcgcctc gaccccgctg agatcgagcc gctcgatcgc ccggccgaca    166560
     tagtaccgca gaatgcgcca cagccgctgg tcggtgacgc cgatgatgcg cgcggcagcg    166620
     gcaaccggca tctcgcgcat cagagccagc gcggcctgct cgaacaacag cgtgaagccg    166680
     ctgtcgggac gtgcccaagg cacagcaatg cggagtacgc cgtgctccgg acagtcggtg    166740
     cgtggcacac gggcctcgat gatgcaggcg tgctgaaaga agttgaggtg ccgccagctc    166800
     agttccttcc agtcgtgcgg tttgcacagc cggccgcagg ttgggcaggg gaagcgggcg    166860
     cctgggtcgg cggcgacggc cagatgcaac tcatgcggct ggtagtcggt ttccaaccgc    166920
     tggtcgacca cgcgccaggg tggggtcagt ccgaggccga gggtgaagat gtcgctgctt    166980
     gccatggcgg tgctccgcgc aatcagagtg tcccgtgcgg gctggcaccg catgccgcgc    167040
     caatgcgcga tcggactgcg ggatgcggct gctcggcccg tctgcctcaa gactggcgcc    167100
     gtgctcgccg ccgtcaagaa cgctgcgcgt cgctacgcga tggcctgcgg ccattcttga    167160
     ccgcggctgt gcacgacgcc ccgcgcacga tcaggccggg acgaagaaac ggcactccag    167220
     ccgaaccaag aaactggccc cagcgtggca gggctgctac ctgcggtggt ggtcacgcca    167280
     ctttcaggaa ccgccgaagt tccactcgcg gcgtcgagga ggcataaatg tctgctgcct    167340
     tcaccgttta tcgaaacaat aaaaataact atccgtattc gttgtgcgta atatcatacg    167400
     aaaaagacgt tgtgaaagcc ctccgttcaa aaaatattat tcttgagtcc attgttacgg    167460
     ctgacgatga agctatattc tattcaatat tcgattatga acaaaaggat tcgaattatg    167520
     atttgtgtat attatattcc gagaattatt catctcacgt aattacaatg ctttctgagc    167580
     taaagctaat aatagaaatt ccaattatcg ttatatctgc ggtatatgat gaggcatatg    167640
     ctgtaaatat tctgagactc ggcgcagatg attatatcgt taataatgta ggaaggcgcg    167700
     atttaaacgt acgaattgaa agaataatca aaaataaaaa aaattctcgt ataattaacg    167760
     ataatgatat aaatacgaaa aaacaaaact cagaatttga tgacaatata ctgatattta    167820
     acaactttta caagtatttt actcctaatg aaatcaaagt tttaaataaa ttggtagaaa    167880
     acgtgggcga aatcgtttat aggcaagatc tttcgattta tacgcgcgga tattatcata    167940
     agcagcctga cagaagtgta gataatctta tatcacgaat cagaaagaaa cttcgattga    168000
     ttggaatttc tgattatcaa ataaagtcat caagctctct tggatatgta ttggttggtg    168060
     acgggagtag attttttaat gaattatcaa aaaatataga attatatgaa aaaagtatcg    168120
     acacaaaatt atagcacatt gtgtctatct catccaacga tgatgcttgg aaaggagctg    168180
     tcctaccttc gtttaaatta caccatcatg ccgcgggaca gccaaccagc agagatgcat    168240
     gcggcagaaa gatatccctc ctgaaacgcg gtcccgggtg agcgggaccg catcagtcag    168300
     gatcgaccag cgggtctcag agggttttct gccgcctccg aacaacgaga ccgagaacga    168360
     gcaagcctgt tccaaggagc agaacactgc ccggttccgg tacgtccact ttgagaactg    168420
     ccggcgctcc gttcgcctca acgtagtcga cagcgaaact tgtcatcgat cccacaggta    168480
     acgtgccggt atcgctgacg gcttgagttt cgccaggcga gtaagtcacc ttgttgccgt    168540
     ttgcatagct gctggcgcca tcgtcgtggg tgatcgtgac gtaggtgcct gcagctatat    168600
     tcgcagcggg gccttggagc gagaactcca gatatgaata attcgagctt cctggagaac    168660
     tcatcgtggt tccaaggaac gcagcctcac cacccgtacc gctgaaattt gagatgttgg    168720
     cggtattcgt aaagaagtcg gcgtacgtat tcgactgtcc ctggttattg gtgttgtcga    168780
     aattcaactg ccctgagtat gtgaaggaag ccagtgcatc tacggccgat ggcgcaggct    168840
     ggcttgcagc gtttatgaag ttggtgccgc caatcttacc ggtcgttgtg gtccaggccg    168900
     ttactagcca ggtcggatta taaatatccg cccgcgctat tcccgtgagg ccgaggagca    168960
     ccacggctcc atgtaacaga tatttgcgga cgctagacat gttcaatctc caaacgtttg    169020
     agaaatcatg ccatgaatga ccacggacac ttcatacatt gaagtgcgtt caataatcag    169080
     gcaaaaattg tgccgtattt gcaatatgaa tagaatcaga tgtttatcga gcatcggccc    169140
     gtcgagtgta aagtttcctg acagaatatt atttcaatat atacgctaga tagttatttt    169200
     ataaaaaatt cactccaggt tgtaagcatt gggatgcctt tcgtctgctt gtctcgcatc    169260
     cacgtattca gaatatctcg atgcccacct tattcttaag tagtacttag ccatttgtat    169320
     actcatcttg gctattctgt gcgagcttgt cgctgatttg ccaacgaaga ggtgagcaag    169380
     ggcgcatccc gcagcaaccg agattactgt acttgaccaa tgtccgaccc tgtcccgcta    169440
     cccggcctga tggtcagttt ttcgttccct ctggtccgac gaatttgtca gcaacgcgac    169500
     cgggaacttg ccgcattccc taatttagga ccttcggaaa tcgaacgccc ttccccggcc    169560
     gccctattgg tgtttttcca aggctcggta gagtgtggcc cggtggacac ccagcaaacg    169620
     ggcaacctcg gccacgggtt tgccgtccgt ctcgatgagc tgacgggcat gagcgatctg    169680
     ctcggccgcg agagcaggcc gcggcccaaa gcgcacaccg cgcgccttgg ctgcgatcct    169740
     gccggtgctg gtgcgttcga caataaggga ccgctcgaaa tcggccatgc cggcgaacac    169800
     agtcagcacc atgcggccgg ccggcgtcgt ggtatcggcc caccgctcgg ccagtgaaaa    169860
     gcgacgcagc tgagaaactt ctagattttg acaggaaagc ctgccgcctt ccactcggga    169920
     taaccctcct ccagtcgcat cgcttcgatg ccacgtgtgc gaagacgcgc caccgcctcg    169980
     aaggagagaa cgcagtatgg cccacggcaa taggcaacga tcggcgagcg cgatgcaaga    170040
     ctgtccagca tcgcgtcaag gtgatcaagg gtgacattga gcgccccagg cagatgccct    170100
     tgagcaaatt cttccggcgg ccggacatcg agcagcgtca cgctgccctc gcgcaggcgt    170160
     tcaagcaggg tcaagcgcga tacgggctcg agagaatccc gcgcccggaa atacgcctgc    170220
     atcacctggt cgattgccgc gatgttccgt tcgcccactc gccccaggct gcccagcaac    170280
     gtcaccacct cggtctcgga gaccaggcta tagaacatgt tcttgccctc tcgccgcggc    170340
     gccgcaaggc gggcacggcg caagatctgc aggtggcggg acgtgttcga gaccgacagg    170400
     ccaatccgtt cggcaagatc ctccacgctg cgctcacctt gggcgatcag ttcgataatt    170460
     tcgatcctgt gcggatgcgc aagcgcagcg gcgatctcgg cgagatggct gaaaatctgt    170520
     tgctttggac cgctgcttga cttcatcttc gactcattca atcaatatcg cgaatgataa    170580
     tgtgatggcg cgctggcgac aagatcgcca cgtcagccgg gagcaacact catgatcctg    170640
     cgacagctcc tgcacaccga tcccacggcg gcctcctatc tgctcggctg tgtcggcaag    170700
     ggcgccggcg tggtcgtcga cacgctgttt ccgatcgaac cttatctgca cgccgcctcg    170760
     gcctccggct cgccgatcca cctcgtgatc gacacgcatc tgcatgccga tcaccgctcc    170820
     gccggccgcg cgctggccga agcggccggc gccgaatacg ccatccacga atccgccgag    170880
     gtctcatatg cgtgccgccg cctcgcagac ggcgaacggc tcgaactcgg caatgtcgtg    170940
     ctcgaggtgc tgcacacgcc gggtcacacg ccggagcatc tctgcctcac ggtgaccgac    171000
     cgcacccgcg cggatgagcc atggagcgta ctcggcggcc acacgctcat ggtgggcgat    171060
     gtcggccgga ccgaacttgc gaccgacgcc gcgcgcggcg cgcgcgacct gttcacgagc    171120
     ctcgcccggc tcaaggcgct gcccgaccat atcgaggtgc tccccggtgc tctggccggc    171180
     tcggtctgcg gccgaggtct ctccggcaaa ccggtttcga cgatcggctt cgaacggcgc    171240
     cataatcccg ctttccggat cgacgatcgg gagcaatttg tcgcattcat gctcgagaat    171300
     attccacccc cgcccgaagg cgcggccgaa ctgcgtgcgt ggaattcggg cttcaccgcg    171360
     tgaccacagt gacaaacgcc tcggctcata tccgcggcat cgcggccaat cgctgccagt    171420
     ttaccctaca ggcgctacag gtcttcttcg tcggtcttgt catcggcatg gagcgcgcgg    171480
     tcctgccgac cctcgcgcac gagttcggcg tcgctccagg tgcctttctc tttctcgcga    171540
     gtttcgtgct ctccttcggc ctggtgaagg gcgcgctcaa ccttgtcgcc ggcgggctcg    171600
     ccgaccggtt cggccgcaag cctgtcctca ttgccggctg gatcgcagcc attcccatcc    171660
     cgctactgat ctgggcggca cccaactggt ggtggatcgt gatcgcgaac gtgtttctcg    171720
     ggatcagcca gggcttcacc tggacaatga cggtgaccag ccagattgac ctcgccggca    171780
     gtcaccagcg cgggcttgcc gtcggcatca acgaggctac tggatatgtg gccgtcggca    171840
     tcgccggtgc ttgtgctgcc ttgctggccg aggcggtcgg cgcgcgcgat gccctgatga    171900
     ttttcggcat ggccacgatt ggtctggcct tcgccacgat cacccgtgtg cgcgacacgc    171960
     ttgcctgggt aaaggccgaa catgccgagg ccgatgctgg cgcatcgcag gatcatacgc    172020
     tcacgctccg cgcgatcttc gtccggatct cctttcgcga tcgggttggg cgggcgatct    172080
     gccagggcgg ggtcgtcaac aagatcgccg acacgctggt ctgggtgatg ttcccgctgt    172140
     gcttcaaggc acatggcgcc aagctgatcg aaatcggctg gctgaccggc acctacgcca    172200
     cggtctgggg cgtctcacag ctctggactg gccacttggg tgaccgggtc ggcaggcgga    172260
     cgccggtgat cgccgggttt ttcctccttg ccgccggcat cgcaatcacg gcggccgggc    172320
     gcgatgtttc gctctggttg ccgggagcga tcgtcatggg catcggaatg gcgctgctct    172380
     acccgaactt gatcgcagca atgtccgacc aagcggcgcc actgatccgc ggcaaggctc    172440
     tcgggaccta ccgttactgg cgcgacaccg gctacgcact cagcgccctg ttactcgggc    172500
     ttatcgccca attcgcccag gcaaccctcc cgacgctctg gattacggcg atcctcgtgg    172560
     ccgcatccgg cggctggctc atgcgggatc tctctcggaa ataaagccac acggcaaagc    172620
     ccaacatatc agttctgtgt gtattcacgt gtgccgcacg taaaatgcac ttccgtgcca    172680
     ccacccctac ctctattcag aggtagcgtt tggagatttt gcgccgcccg accaaaccaa    172740
     gaccgacaag gccagtgccg agcagaagaa gggagtcggg ttcgggtact ggtgtaccgg    172800
     atgtcggcgt cagggtttcc gatataagat cataattatt ctttgtccca tcccagttaa    172860
     tcttaaaatc cggattatat ccggaaaatg taccagacga caacgtaaca ttgaatacat    172920
     aattaatgct tgcattggct ggcaatgccg ggccggtcgg ggctgtttcg gccatgaagc    172980
     agtagaaatt tccagttcca ttacagccgt ttgcgtttag acctcctatt gattctgtga    173040
     atcctgacgg ggccagagca ctcgcaaaat ttgatggctg gttgaaagca aacgactgta    173100
     cgccatagcg cccaccttct gtatcggaag ggccatttat gcctgcgata ttaagggtga    173160
     actgatccgt taagggattg gctgttgctg attcggtcag cgtataggtg aggccatcgg    173220
     cgatcaggct ggcgcgagcg cctgccgttg taagccccag gatgacgaca gcgctggcaa    173280
     catggctaaa cttcaacatg aacgtccctt tcgaaaggct ggcgttgact gacgcggtcg    173340
     gttcatttcg gttcggctgc tttacgcagg ggaggcgccg attttggccg caaaatagaa    173400
     caagcaattc ccatgccgag ctaaataagc tcgtaaaatc aatgaataaa atattttaga    173460
     caagcgagat gtaaaatata ctgacactac ttttggtcga gtcattcatg aaaaacatct    173520
     ttggttgtat aaatttggcg aatagccgta atgccagaac ccgtatcatg gaagttcgtc    173580
     gaaagtcccc tggaattgat gcgcatggaa ctggatcgct cagcaagatc caggtagagc    173640
     cgcccaggca gcctgatcaa cggacccagg ggatgctgaa acaccgcccc cccaaccacg    173700
     ccgaggtctt cgccgtatgg atacaattga tgcaaattga tgtcggagtt atttcgcgtc    173760
     tgagtgccgc ggcaagatac atacgccacg aggatgccga acggctcgcc tggccgaagg    173820
     cggcgctgtt gatttttctt gtctcgatcg cggcctgggc cgttattctg gcgttgttca    173880
     tctggttttg aattcgccgg cgcgattggc acgaggaagc taagctacag ctagtcaacc    173940
     atcattcgcg ccgcatcaaa ccgcctctcg gcccgacgcc ccttgcccta caaacgtgtg    174000
     tatcacaacc agcctgatga attcgagcgt ggcccgcatc atcggcgctg ggattctacc    174060
     tattcctcgc tactgggcac ggtgatggcc gtgaagatag aaggctatgt ccatgacagc    174120
     gatgacactg atcatcacaa cagcaaaaga cgcgatcgga cgatcataga gaatgacgct    174180
     tttcgcgctg atgcaatcca cgacatgaat gaagcgttgc cgcagcgaca ccatcccaaa    174240
     gaccctttct tgtcgaacat attaccgctt tttcattttc gatcttatcg atgtcaaggc    174300
     tcgcggaata gttgaaattc cgcatagctc atttttgtga attttcgtct gcgcaatctt    174360
     aagcagccag gatcctcgca tcggcgatcc ccagcccccg gacggagatt ccatcagccg    174420
     tgcggccctc atagctatgg tgatgacgcc catgcaccac gaacttagtc cgcatcgcat    174480
     gcgcgagttc atcgatcccg gcgaagtcat gctcatgaga agtcggccac tcatgggtaa    174540
     ccagcacatc gccccgtcga gtgtaaaact tcctgacaga ataatattcc actctatacg    174600
     ccagatgccg taatgggccg agtgcctggc gctaggcgga gaggtggctg tccttgagcc    174660
     gaccgaacat gttctcggtg cggtggcgct gccggtagag cgccttgtcg tgcggtagcg    174720
     gctctttcct gctccggatt gatagaatgc aggggagtga taccgcgttc gaggagggcg    174780
     gcgcggaacg cgtcgctgtc gtagccgcga tcggcgagca gttcgcgggc caacggcagg    174840
     gtgggcagca tcatcgtcgc ccccttgtga tcgctcatct ggccttcggt cagaagcatc    174900
     atgatcggac ggccctgccc atcgcagacg gcgtgaagct tggagttcag gccccccttg    174960
     gtccgcccga tacagcaggg aaaagtccct cttgaagcag gcaggccgtg gtgcgatgcg    175020
     ccttcaggtg ggtcgcatcg aacatcagcc gttccggcgt gtcggcctcg gccgccaggg    175080
     ccgcgaagat acggctgaac acgccaaccc ggctccagcg gatgaaacgg ttgtagagcg    175140
     tcttctcgtc tacaccgcgc agtccagata ccttagttgg cagatcctca tcatttaccg    175200
     ccctgccgtt gtacgccgtg cctgccgctc ctgctcgggc tgttcggttc gttccgcccg    175260
     ccggatttca gcaccactct cagcggcccg ctgccagtaa ccacgcgcct gttcgcctgc    175320
     ctggctgtca ccccggccaa cggcttgccc ggccttctgc tcggcccgca gcgccatcag    175380
     atacccggaa atcttctcgg catcggcagc cgcccggaag atctctcgcg cgtcttgctg    175440
     caaggctttg atccagctcc cgacataggc cgcatgctgg cccggatcat ggccgatccc    175500
     cagcttgtcc gcgatcatca gcgaggcgat ctccgccctt agctcctccc gcgcgtaggc    175560
     ttccgatcca aacggggtgc caagatccgg ccggttcagc cgcgaggggt gccctgtggc    175620
     gtgcccctta tgccgacatc ggcataacgg ccataatgcc gagatccgga ttatgccgca    175680
     tctgctcggc agggcgcggt tggcggtatg atcgcaccaa tcccattcgg cataatcttc    175740
     atcgctccaa caacatggag cacgacgatc atgcctcaat atttgcagac ctgcatcgag    175800
     ccgtatctgg actcgttcgc cgagagcttt gcggcggaga attacaccgc cggcacggtc    175860
     aagacctacc aatcgatcct gcggaaggtg gggcacgcga tggatgtcga gggcatcagt    175920
     ccttcggcgt tgacgctcga catggccgag catctgggac gcaaggtgcc gcgcaagaag    175980
     acgggctcgg tatggccgta taggttggcc cgccggttcg cgcagcatct gctcgatatc    176040
     ggcgtcacgc agccggtgcc gttgaccgag gcgcagcagg cgcgcgcgac cctgctggcg    176100
     aacttcgaga cctatctggt caagcatcgc ggcctgagtc cgcggacgat ctatcacacg    176160
     ctgcggttcg ccaaccggtt cctcgatcat cgctttggtg atgcgatagt tgatccgggg    176220
     cggttgcggc ctgccgacgt gatcagcttc atcgagcatg tgttggcagg cgcgcgtcgc    176280
     gacaaaacgg tggcaacgca tgttcgtatc ttcctgcaat atctgttcgg cagcggcgcg    176340
     acagcgacca atctggcgct gagcgtgcct agggcggcga agcgctgggg cgcacgactg    176400
     ccgcgccatc tgtcgcccga gggcgtcgag gcggtgctcg cctgcgtgcg cgacagcccc    176460
     cggcacggcg ctcgggacta tgcgatgctg ctcatcatgg cccggctcgg cttgcgcgct    176520
     gccgaggtca tcgcgatcca gctggacgac atcgactggc gcgcgggcga actcttggtg    176580
     cgtggcaagg ggaagctcca cgatcgcgtg ccgatcagcg cggaggttgg cgaggccctc    176640
     tgccgctatc tgcgcgagga acgcggaccc gcgtcctgtc gcacgatgtt cgtcacccat    176700
     cgcgcgccgt accgtccgtt caaggacagc cagatcgtca acgccgttct caaggatgcg    176760
     ctgaaggcga ctggccagaa gccggtaacg ccctatgtgg gatcgcacct gctgcgtcat    176820
     agccttgcca cccagttagt gaactcgggt gcatcgctcg acgaggtggg cgatgtgctg    176880
     cggcaccgct cacgcacatc aacgatgata tatgcccgtc tcgacatcga tgggctgcgg    176940
     tcagtggcaa tgccttggcc cgtggcggga ggcgcgcaat gagcctcacc ttccaactcg    177000
     accgctatct ggctgtgcgg cgccgcctcg gctacgacct gagcaccagc gagcgcatcc    177060
     ttcgccgctt cacgcggttc gccgacagcg agcgtgtgac gcatatcgac acggcgctgt    177120
     tcctgcgttg gcacgctacg ctcggcgagg ccaacggcat gacgcgagcg gcgcggctta    177180
     ccgccgtgcg cctcttcgcg cagtggctga gcagcttcga tccggcgcat gaacccccac    177240
     cacggggcct gttgccggac actgtcatgc gctcgcgtcc gcatatctac agcaatgccg    177300
     aggtcgcttc gattatcgcg gccgcaaagg cgctgccgtc gatctgcggg ttgcgcgggc    177360
     tgacttgctc gacactgttc gcgctcatcg cggtcacggg cttgcgcatc agcgaggcgc    177420
     tcgcgctcga tgggaacgac ctcgacgccg ataatggtgt gctgcgcgtc cgacagggca    177480
     agaacggcaa ggagcggttg ctgccgctcg accccagcac cgtcgagcga ctgctcaact    177540
     atcgcatcga acgcgatcgg ctgatcggtc atccggcggt gccgctgttc gtaaccgaca    177600
     aggcgacccg gctcaccgac tgcacggccc gctacaactt cgcgcaggcg tgccagcaga    177660
     tcggcttgcg atccgagcag cagtaccatc ggcatggccg agggccacgc atccacgatc    177720
     tgcgccacac cttcgccgtg cgcacgatga tcgactggta ccggaccggc aaggatccgg    177780
     cgcgcgagat gatccggctg acgacctatc tgggtcatag cagcccttcc cgaacatact    177840
     ggtatctgga ggcggtcccg gaactgctcg atctggcgat agcccgtgcc accgcgagcg    177900
     gcggggagat ggcacaatga acgccgtcac cttgcccgcg ctgatccagc gcttcttcac    177960
     cgaccggctt tgcacgcaac tggaggcgag ccgacatacg gtcgccggct atcgcgatac    178020
     gttccggctg ctgctcagat atgcgagcgc ccgccgcaaa aagccgccgg tcaacctgac    178080
     ggtcgaagac atcgacgccg atctggtcgc ggacttcctc gcccacaccg agaccgcgcg    178140
     gggtaatagc gctcgcagcc gtaatacccg gctcgccgcg atccgatcgt tcttccgctt    178200
     cgtcgcgatg accgatccga cttggctgct gcactgccag cgcatcctcg ccatgcccaa    178260
     taagcgctat gtgaagcgtg cggtcacgtt cctcgatgcc gaggaaatgg cggcgctgtt    178320
     ggcggctccg gatcgtacaa catgggcggg gcggcgcgat cacgctctgc tcctgcttgc    178380
     ggtccagaca ggcctgcggg cttccgaact ggtcggcctc acgcggggcg atgtcgtgct    178440
     ggggaccggc gcgcacatcc gttgcatggg caagggccgg aaggagcgcg ccaccccgct    178500
     tcgccgcgag acagccaagc tgctggcgac gtggatcggc aacgacaaag atgagggcaa    178560
     gccgctgttc ccgtcgatcc ggggcgaacg gctgagccgt gacgctcttg agcatctggt    178620
     ccgcaagcac tgcctcacgg cgtcgcgcgc gtgcccgagc atcggcacga aacaggtcac    178680
     gccacatacg ctgcgccaca gcacggcgat ggacctgctc caccacggcg ttgatcctgc    178740
     ggtgatcgcg ctctggcttg gtcacgagaa cgtcgagacc acccaaatct acatccatgc    178800
     cgacatgcgg atgaaggaaa aggcgctcgc tcgcgtcgcc gctccagcca cgccgtcggg    178860
     ccggttccgg cccgacgatc aactcctcgc gttcctggaa gggctctgat tatgccgaac    178920
     agccgcatgg ccaatgccgg gctatccggc ctccagcgga ggccatgcgg cataatccgg    178980
     atcgcggcat tatgccccag ctcatgcagc gccgtgctgt aaaaccgatc cgccgtcttg    179040
     aattgctcgc gctccggcat cgtgacccgg tcttgcgcca gggtgtaaaa ggcccggtcg    179100
     ccgggccggt agatgatcgg caccccggaa ttgctcatga tctgctcggc tgcggcgtgg    179160
     cgttcccatt ccgccagggc gggccgggcc tcgatcttcg gcatgccggc gatctgctcg    179220
     gcattgaaca ccacggccga aaacacccgc ggccgttcca gctcgacgct gcggtaaacc    179280
     tgattacctt cggcatcctt caccggccgg ccctgctcgt ccttcaccgg cacccggtca    179340
     aacttcttga aatactggat cagcgtgccc ttttcgccct tcatcacctg ggcatcgagg    179400
     ctctgcgcct gcttgtaggt ggtccagcgc ggatcgctgt agcccttcat ctcggccact    179460
     gccatcagcc agattgcgtt gccgccctga taatccttgc cggtgatcgc gttgtaagga    179520
     atgaaccgga ggccgctggg ctcccacggc ttcacccagg gtgcggtgcc atcctccaac    179580
     tgcttgacga tcgaggcggc aaccgtctgg gcataatcac cggccatggg tggcctcgtt    179640
     ggtattctcc acgtccgcat tggactccca ggcatccgcc tcatcgagtg ccgtttcctc    179700
     aaccagtccc agctgctcga cctcagccgg gtcgatctcc accatgacgc ccggccgcat    179760
     cagatcggct aggtcgcgcg agatgattgg ttgcttcggg tccatggctc tcctccttct    179820
     caacgtgttc tgtagcgtct ggtgcgatcg gccggcccta ccgcggcccc ctacccttcc    179880
     ccggcacgcg cgggagggct gcgcaagcca accttgttgc acaggccatc ggtcggatcg    179940
     gactcatagg atatgttcgg agcagtgttg cggtgcggct cggcatcttc cgccatgccc    180000
     gcaaaccgaa ccgggggcat tagcgcctgg cccggatcgc ggcgatcatc aggcgatcca    180060
     gccccgccat gtcgatctca ccccgaatgc accgctcatt cacagcctca agctccgggt    180120
     gatgaacata accctggcgg ttattcgctg cacgggcctg ctcgatcgcg cgccagcgcc    180180
     gcatcatctc ggattccgaa attttgccga ccagccggtc catccagcgg cgcctcatta    180240
     ctaccggaag tagaggttaa gcagaagcgc agcgaagttc aaggaacctc aaaggttcat    180300
     ttcggctcgg cgaatgtctg tcttggaaaa atcatcacct ttgaacagca gcgccgcccg    180360
     ataagatttg gcagcgccat aggcaaagca atcgcccata ttcaaggcgg ccggatgccg    180420
     ccccttcccg aaatcggcat aagcctggat tgccagatca tactcacgct cgccaagaga    180480
     aatgacctcg atcccgagcg cgctcataaa gctcttcacc ttttgccggg caccgtccat    180540
     cgaaaggccg aagctgcggc agagcccggc cgtcgcctcc cacatggcaa ccggcgagac    180600
     gagacgggtg cgttcctggg ccagaagatc cgccagcatg tcggcatcct cctcgccggc    180660
     gatcatcgcg atcagggccg aggcatcgat gaagatcatt ccccctcccc cgacagatca    180720
     tcgaaaaatg ccttgtctgc cttcaaccct gtgggcggcg gcagcggatt ggcttcgcgc    180780
     cactcacgca ggcgctcgcg caagggcttg gcttcgcggg ttcggtcaag ctcggcctgc    180840
     accgcaagcc gcacggcatc ctgtttggtt aaaccccgct ctttcgccag tttggcgaca    180900
     agctcggcgg tcgcatcatc gcggatataa aggggcatgg gcgcctcaag atattcaaat    180960
     atctgtttag agatatctcg atattcagcc tggagcaagg atatccacca gaacatcgcc    181020
     tggtcgacat atgcctacgc cacggaatgg atttcctggc tcctcccatt gccagtgcta    181080
     ccttcaccgc cgaacggctt ccatgtgacc gaatgccagg aacttggctt ttagttccca    181140
     cccctcacac cgagtgacgc cgcgatatcg ccgatcgagc ggagcaggac caacggatcg    181200
     tccctggatt gctcaaagcc gcgccgccgc cagaattcgg cggcttccct gtcgaccgca    181260
     ttcaccatca aggcccgacc gccaataagc gaagccgcct gaacgcagcg ctgaagggcg    181320
     tgctttacaa ggccggtgcc gatgcccaac cccgcccacc tggtgtcgat cgccagttga    181380
     ccgagtagca tgcatggaac gggattgggt ggctgccctg tccggatcga gcggggcaga    181440
     actgtcggca cgatagcggt gggagcaagg ccgtaatatc caacaacacg acctgcctca    181500
     tgcacaacga cgacggcggt aaagcccttc tgctggttgg aaagcgcccg cgatttgagc    181560
     caatgatcga gcggcgattt cccgcaggag aactccgata catcgtgatc agcggtaagt    181620
     ggttcaggct ccgacagcgg caaatagctc accgcttggc aacgtaaccc ggctcccacg    181680
     gcgcgggtcg cttcaggact tccaccatct ccggcaccgg agcggcggga cgcgccaaca    181740
     catccatgaa ttcggcgaag ccttccgcgc tcatccggat caagccctgc tccatcacaa    181800
     cctcttcggc cgcacgcaca gcggcgtcac gtacgaaatc cgtgcgcgaa cgcccgcgca    181860
     agctcgcagc gcgatcgatc attgcaacat ccgcctcggg caagcgcatc gagatcgggt    181920
     attccttgcg ttcagctact gtggccatgg ctaatctcct tgcctgccat atagcgcacc    181980
     gtatcgcaaa atccaataca taaagctcga caccatcacc aacgatctca tgaggagagg    182040
     cgcaggatga cgatgcgagc gcaaggttct taaaaaacct ggctcattag ggcaccagcc    182100
     gcctcggctt actcgctccc cctatcaatc atcccgacat cacgcttcct tcttgagcct    182160
     acggatatgg gtggcacggg catagcctct ttgttagact ttgccggcga tgaactcctc    182220
     tcagcaaaat atcgaggcac ccagatccag tcagatatat cgacacgcct cgctgcaacc    182280
     tggtcatctg caatattccg catctgacgc gtgtcgtgcg acagaaaggg atttcaaatc    182340
     gatgcagttg gctctgttcc cagagcaaat cagactcatc cgggtccgac ccgaacacaa    182400
     cgaaaagcgc tactaccaga tcgagatcgt tacagacctg ttcggtgccg tcggcctcgc    182460
     acgaacctgg gggcggatcg gacgttccac acactcccgg tttgaccccc tccccgatct    182520
     cggcaccgcc atcgatgccc tccgccgtct ggctcgcgcc aaacgtcgcc gcggctatca    182580
     ggactatcca tctacagggt ggttctgaca aaaatacaat tctgctaaag ccaagctcag    182640
     gcccattcga agagccaagt tccgatcgat caggcctttg tagccgagcg cgatgccaac    182700
     cacccggcgg cctcgtgtcg tcgcgactta tatcgtgatc tccgccagcg tgctttccat    182760
     ccgaatgcga cattcgatca gtagcggcat cgccaggcgt ctaaaacatc agtggggtcc    182820
     gaggccctgg aggtgacgag ggctgcggac ttgacgccgc gccaccgccg aagtgccata    182880
     cgctaatggc gagccgcccc gcagacactg cccctgccca agcaccggat cgcgaggtcc    182940
     tcgccggcct ggttgagcgg gtgacgttcc acaatgccga gaacggtttc tgcgtgttgc    183000
     gggtgaaagc ccgggggcac cgtgatctcg ttacagtcat cgggcatgcc gcgacgatca    183060
     gcgccggaga gtggctgacc gcgagcggtg aatgggtaaa cgaccgggtt catggccagc    183120
     aattccggtc gaagttcctg cggacatcgg cgccgaccac ggccgagggg atcgagcgct    183180
     atctggcctc tggcatgatc cgcggcattg ggccggtgta tgcgaagaaa ctgatccggg    183240
     ccttcggtga cacggtgttc gacgtgatcg aggccaagcc cgaacgcctg cgcgaggtgc    183300
     cgggtatcgg tgcggtgcgg gccgggcgga tcgtcaacgc ctgggccgag cagaaggttg    183360
     tgcgggagat catggtgttc ctgcatagcc atggggtgag cacggcccgc gccgtgtgga    183420
     tcttcaagac ctacggcgct gacgccgtgc aggtgatgag cgagaacccg tatcgtctgg    183480
     cgcgggatat cagggggatc ggtttccgga cagcggatgc gatcgcggag aagctcggca    183540
     tcgccaggga cgcgatgatc cgggtgcgtg ccggcatcgg acatgctctg gcgacggcaa    183600
     tggatgatgg ccattgtggc ttgccggccg gcgaactggt ctcgctcgcc gaaacgctgc    183660
     tcgaggtgcc ggcgccgctg atcgggacgg cactcgacct cgaactggca gagggcacgg    183720
     tgatcgccga tcaggtggcg gggactgact gtgtgttcct ggccggcttg tatcgggcgg    183780
     aacagggtat cgccgagcgg ctgcgaatta ttgcctccgg tgcaacatcc tggccatcga    183840
     tcgatgccga caaggcgatc ggctgggtgg aaagccatct cggcatgaat ctggcggcga    183900
     gccagagtga ggcggtgcgg ctggcgctga ccgcaaagct gctggtgatc accggcggac    183960
     cgggtgtcgg caagaccacg atcgtccggg cgatcctgcg gatcctcgct gcaaaatccg    184020
     tccgcattct gctcgccgcg ccgaccggcc gggcagccaa gcgtcttgcc gagacgacgg    184080
     ggttcgaggc gaagacgatc caccgcctgc tcgaggtaga tcctgcgagc ggcggcttcc    184140
     gccgcggcgt cgaccattcg ctggaatgcg acctgctggt gatcgacgag acctcgatgg    184200
     tggacgtgcc gttgatgcat gcgctgacca gggcgatccc cgacgaggca gcgctgctgg    184260
     tggtgggaga tgtcgaccag cttccctcgg tgggaccggg gcaggtgctc gcggacctga    184320
     tcgggtctgg cgcggtaccg gtggtgcggc tgacggagat cttccgccag gcagcggcaa    184380
     gccggatcat aactgtggcg catagcgtca atcgcgggga gatccccgat ctcggccgcg    184440
     ccgatcccga gagcgatttc catttcgtgg cggccgacga gccggagacg gcggtcgagc    184500
     gcatcgtgga gttggtgaag acgcggattc cgcgccggtt tagactggat ccgatccgcg    184560
     atatccaggt gctctgtcct atggcccggg gtggggtcgg cgcgcggtca ctcaacatca    184620
     ccctgcaggc ggcgctgaac ggcgcggcgg aaccgcgggt cgagcgattc ggctggacct    184680
     acgcccccgg cgacaaagtc atgcagatcg agaacgacta cgaccgggag gtctacaacg    184740
     gcgatatcgg ctttattgct cgggtcgatg cggaggctgg tgagatcgct gtcggcttcg    184800
     atggacggga ggtggtctac ggtctcggcg agctggacgc gcttgtgccg gcctatgcgg    184860
     cgacgatcca caagtcccag ggctctgaat acccagccgt cgtcattccg gtgctgaccc    184920
     agcactacgt gatgctgcag cggaacctgc tctacaccgg catcacgcgc ggccggcggc    184980
     tagtcgttct ggtcggcagt cggcgtgctg tcgccatcgc cgtgcggaat atctcggggc    185040
     ggcgccgatg gtcgaagctt agggaatggc tggggcagta ggcaggatct gctcccgaag    185100
     ttacgaggcc gcccgaaatg tctcgcatgg tcgtgatcga tcacaacctt gtagctgcac    185160
     gcgatgccga tcacacgtac gatcttggat ctggtgatgg aggcaagtgg tcgcggtcgc    185220
     atttcgggtg acgctcgccg gcgccgcgca tgccccagat cgtccgagca agatgcagtt    185280
     cgccgatttt ggccttcgag atcaggccgt ggaagtaacc acccggagtg ctgcggaaat    185340
     ggtccagtgg ctttgccgag acgacggcta cggcgatggc ggcttgctcc cggcccatga    185400
     ccagacaggc gtcgccccag atgaatttgg agatccccat ttcatcgcga agccagtctg    185460
     cagcgtccac aatctcgggc caggtcggcg tctgattgtt aaggtatgtt ttcagccgtg    185520
     gtgcgagctt aatcagctcc attggtgtga ttttgaggag ggaaccggta tccattcgaa    185580
     ctttgcccgg tcgctgttgt tcgtgcgccg tcttgcttga gtttagatga tttccgagcc    185640
     ccttagacgg ccggtcctta ccaggtaaaa ccggagaatg actacttttt ttcgatgcaa    185700
     atactgtatc tttcagattt tgaaggtggt ttgtagttgt aatgtggggg caattttcta    185760
     accccttggg gccaagattc acaagttcgg ttgattcttg tgcttccttt gttctcctcg    185820
     cgtcaagaac gaattccagg taacgacgca tatcgctcag ggcctgctca agccccgcaa    185880
     ccgccatttc catttcgatt gatcgattcc tgccggcaat gccacgggac gccacagccg    185940
     acgcgacgcg atgcgtttcc cactcctctc ccgagatccc ttgctcgacg gcagtgtcca    186000
     ggagctgtcg gataccgttt ctggcaatcg tcgctcggcg cttcagggcc tgcaaacggg    186060
     cgcgctcctc cctcccctcc tcggccacag cccggaactc ggtgaagcgg ctggcaagcg    186120
     gcgatagatc gaagccgtaa gcctcgatga tgcgcccctt ggagtcccgc cgaccatatc    186180
     gcttgccgtt ggggctgtcc ttcatcacga ccagaccgag ttcgaccaaa tggcgattga    186240
     gattcttaac ctggcttgga ccgagaccca gctcttgttg ctgcatgatt gcggaaggcc    186300
     acacgatcgg ccgggaggaa ggctgccaat cgacggcatt cgtgaaccga aagagccagt    186360
     cgatggcgtg tacgacgctt ggccgcagcc caagatgcgg cgcagctgct ttgaatgcag    186420
     ccaatacctg cccggggagc atttccgagg tgaacctatg ggtctcggcg acctcaatcg    186480
     tttccaacat cttgggggtg agttttcgga ggcctggcgc atggcccaag ccaaccctct    186540
     caccccgttg aacggtgtcc atcgtgatcc ttctcctagt tgggatcgcg gcagacgcac    186600
     gtcacctctc caaacaaaaa cggcaatttt tgcttggcaa acgtggacga tcgaactatc    186660
     ttaaatatgc aagacgatag ctacgcgctc gccgcgaagt tggatgggaa acccgcccgg    186720
     caaggcgggt tttctattga ctgactaggt catgtttttg ctccaaagct ggtgcatacg    186780
     tgcctcaccc gtgacatgag gtcttccacc atgtcttttg gcaggctcgt ttcatcgaag    186840
     cggatgcgga ttacacctgg cttcttgtct actgtgaagc tatgccgccc tcctccctga    186900
     tcatccgctt gcgcgggtga tttgcaccgc gatagtgctt tcagcacgag atcgaatctc    186960
     tgatcgctgt ccgctgcacc acctgatttg caaacttgga ggaggcgttc catttcggtc    187020
     ggccatctga tttccttgac agtcttggct aggatcatcc atttccgacg tccggtcttt    187080
     tgtgccggcc cgatcgcctc gaccaactcg gcgggcagag cggtagcgat gctgatcatt    187140
     ctcgacactt cggtcttgtc gatgctaagc gcgaggcaga tcacgtcgcg ctggaactgc    187200
     cgagcctcga gccgcgcagc gaataatgct cgctcgatgt aggatagatc gagacggtct    187260
     tggttctcct ggccttgagc aacaactagt tcttcgtcgg tgagatgctt caccatcgcc    187320
     ctgaccgggc gcccgagcct ttttagggcg cggtagcggc ggtgcccaaa cgcaatttga    187380
     tagcgccctc ggctctccgg atgcggtctg agaagaatcg gagtgcgctg gccttggtcc    187440
     cgaatggtcg cgacgaacgc gtccatttca tcgtcttcac caatgcgatc ggtgatgaat    187500
     gaagggtcga tgagatcggt atcaatctct acgattacat ctccggtttc gagcttttcc    187560
     ttggcatctc gtagatcggc caccatcgtc tcgaccgatt cactcattgc gccgaccaaa    187620
     ccaacccccc gtggcattgg cttccgtatg gcttgcggag cactggccga ggtctcgggt    187680
     ggagaaatca agtgttcaag aaggtgtttg cgccccattc tcagttgctc caagcctttt    187740
     cgaccagggc ctctatttcc gcgttcacct gattcattga ttcgagtgcg cgatcgtatg    187800
     ttgaccgagt gaattgctcg cgtggaactt cgtatagcgt ttgctttgta atcgaggcgt    187860
     cagagatggc cgtgctttta accattgcat tcgtcagcac acgctcgccg aagagcgatc    187920
     gcatgaaggc caccatctgc gtctgcggcc cgtcggtcgg ctcgtatcgt gtaacaagat    187980
     agcgcatcca atcgtattgc atgtcgccac ctgccttagc gacgacacca agtagttcgg    188040
     atgtcatcaa gaggaactgg cacatcgaca tgatgtccag catctccgga tgaactgtca    188100
     ccagtagcgc cgttgaggca cacagcgccg agagcgtcag aaatccgagt tgcggcggac    188160
     aatcaagaat aacgacgtcg tatcggtccg caacctctgc aagggcttgc gagacacgtg    188220
     agaagaacat cgtcgcccct gctctctttt cggccattgc gatggggctt tcgtgttcga    188280
     actccataag ctcaatgttg cccggtatga gatcgaggcc cgggaagtat gtctctctaa    188340
     caacctcggc tgtccgccgg cgcccttcgc catatttgat cgcgccatac aatgtctcgt    188400
     ctggccccaa atcaaattcg ggttgaagac cgtgtagtgc ggtcaaactt gcctgcgggt    188460
     cgagatccac ggccaagacg cgatagcccc tgagggcaag gtactgagcc agatttgccg    188520
     atgtggtcgt tttcgcagac ccacctttga agtttgcgac gcagatgatc tgaaggtgct    188580
     gatcgggtct tcggtgagga agatagcgtc ggtcaccctt cccggattcg tcgaggaatt    188640
     cccggagtgc tcgaatatcc gcaaaggagt acgagcgccg tccatgtgca gtcgtctggg    188700
     gggtcggccc cttgtgctca atcgagagtt gccggaggta actatccgcg acacctacga    188760
     tcttggcggt ttcggtggag gtgaatcggc ggagcgtctt ttgtgctttc ggtggaaaga    188820
     gttttagcct gtgctcctgt agtttttcgg atagtcctgt ggcatcaccg gcgatcaggt    188880
     catgcaacat cgtgcgaccg accgttgtat cggttgaact cgtgtccacg gctctctgct    188940
     ttggtgacgg catatcgcga ctttcacggg catttccgtc tctatggccc gattcgtgtt    189000
     tacaatgcaa gagaaaacaa ccgaccgatt cgcaacattc gtggcagaag gtcaggcatt    189060
     ttctgctaca tagtgtgcgt tctttccaca gtaccgcaac gcggtgccaa tagcagttgc    189120
     gatttcccct ccgcttgcaa gctcagcgta gcaacggcgc ctttgcgact cggatctccg    189180
     tcgaacgttg ctagtgacca atagcgaatc gcggctactg cttctcattg attctacccc    189240
     gcggcagccc atgccatcgt cgggaggttc tgccgacggt ggagatagaa aaagtgcgcg    189300
     ttttatctct gtcgcaaacc gagcagtctt gtcgccagcc ttccacgtcc ggaggcgcga    189360
     agcagcatgc cccggggtgc gatggaacaa ccctttttta gccgtgaaat atgaccggcg    189420
     aagctcggtg agttggcgac aaccttatat ctctatcact acggctattt gcacaacata    189480
     tcggctgccg cgacacccct gcctgatact gcgggtgatc gttgaggcga tcctttccaa    189540
     ttggtccctc atccggcctc acgatgatgc tccagggcta cgtccatcat gacgccgtcg    189600
     ccactcctga tactcagaca gcggcagcat tttcatagtg agcatcgctt tgattgttct    189660
     gcatgcaaac cggccggtat ccaattaacc cgcggggcac ctaattcact tggggtcttt    189720
     gcagtatcgg tcgcaatttg cctttttgtg gcagcgacgg tctgcatcgt gctggttgtc    189780
     ccgtcgtgag atccgcgacg attgccgtca accgggcgct cttgctgtat ccacagcagt    189840
     accgtgcttt gctctgttgc cgacatttgt ccctttggac cttattctaa atcttagttc    189900
     tctatgcgaa cggtgccagc atatcctgtg gcgctgagcc gcgcactcgc ggttagacct    189960
     tgcacagagt tccaccccgt tccgaacgcg cccgacttcg ttgccggctt gtcattgttt    190020
     gacctcgtca cagagcggtg ctccaggatt gtttccacca ttgaattata tgttgtgaag    190080
     tacgcgtcta tctagttgac cgcggtcaac aacgaatatg cagtgatcct gattgccgac    190140
     tcgatcaagt ggcgaccaat aatgaaatca tggcgtacct cgtatctaac tgatctacta    190200
     gctctggcag atccgacgct cgcccttgca gaccagcgcg tgggagttga ccgcggtcaa    190260
     cttggtgcct ctctaagtat tcaaatggcc ttcctgccct gatgccaaat ctcggcggcc    190320
     catccgaaca atggtggcaa tcttgaattt aaagataggt cagtttgttg atgttgaccg    190380
     cggtcaaccg ctagcatcaa ttaaattggc gcgaagcgtt ggagccacgc cgttgcaaag    190440
     cagggttctt ccactgtcgt tcatattctg gccagtctcg ccgccgacgg ttgcggcttt    190500
     gcgccaagaa tcgggctgag ggccggccga aaatttgaac acagggttca gagcatctcc    190560
     cgccaagtga aaagtcaaat gcatcaatgc gaattcatgt atcgcgcgcc gggccgagaa    190620
     agctaaagtt gaccgcggtc aaccccatat aaattgtgcg cctaaacgtc ttgcttcggg    190680
     atcacgcccg atagtttgac gttccgatcg aaggtctacg tctgttgacc gcggtcaact    190740
     accagactct cgggcgcaca atccctactt gtctccccgc caaatcggga cgggtggtcc    190800
     gtcttatatg ctaccttcaa cggagagcct caacttcaag gctcacagaa ccccatccaa    190860
     cgggtgcccg tcgaagatgt cgccgaactc cagatactcc ccgagcacgt catagctctt    190920
     gtggcggccg agccgcttca ggcgggccgg atggacgccg cgctccatcc cggtggtgag    190980
     cgccccgcgc ttgaggctgt gtccgcccag gtcgcgccgg ccgaacccgg ccgccatggc    191040
     cctgcgctgg atgatcaggg ccacgctttg cggggtgagt gcctgctcgc caatgaccgg    191100
     gcccggtggc tcggtccgct cgcgcccctt gcggccggat ggtggtgacc agatccggcg    191160
     gaacaacggg ccccgctgga gccccgcggc gacccgccag cgctcaaggg catgcaccgg    191220
     acagagttcg gtatcgccgt agggcagggc gacggtgacc gcctcggtct ggctcccttt    191280
     ggtctgcggc agggtcagcc ggagcccccg ctcagacggt gtcaggtgct cgatcctgat    191340
     gccggcgagt tccgagcgcc gcagcgcgcc ggcgaagccg accaggatca gcgcgcggtc    191400
     gcgcaggtca gtcagctcgg tatcgccgat cggtgccaac agccggcgga tcaccgtcgc    191460
     cgtcgccgcc accttcttgc ggcggatctc gccacgggag gcggcatcgc gctggatgcc    191520
     cgccatggtc tcggcgacgc aggcatcatc ggtgggcacc gggcagccgg cgaggcgatg    191580
     caggtagcgg atcgcggcgc gccggagctt gagcgtttcg gtcgagacgc cgcggccgcg    191640
     ctcatcggcg aggaaggcgg cgacatcagc accggaggcg gggaggggcg tcagcccgtg    191700
     gcggtcgcac cagaggcacc atacgcgcac cgcggcccga tacgcccgcc tggtgttgtc    191760
     cgccttggcc cggcgggcat aggcgctggc ggcgctacgg gcgccggcga gcgtgccatc    191820
     ggccaccggg accggctcgt cctcgatctc gctgaaccag cgccggaccg catgcccgtc    191880
     accggcgagc gggggcgggg agggcaccag gctgccggcc gatggcgcgt cagggatttc    191940
     gcgcggcgca atttcggtgt cgtcaggcac gagcagaatc tcttgagcgc actccggtcg    192000
     gctctgcgcc cggagactta gggtttcgcc gcaggatcag caactttgcc acgatgggct    192060
     gccgattgaa ccggctgcgg cgcatcaaag aaacgatcgc atcggacgga tctgcgacgc    192120
     aagtttgggg agacctttcg ctgtgaggtc gagcacgaat tctgaaggag tgtacggcgg    192180
     attctgatat gagcgtctca actttccgag gatttcggtt gcctctgtgg ggtagagctc    192240
     gaatgttctg gaaagaaact catcggggtg aatcgcttca acagaaaatg gctccagagc    192300
     ctctggcggg aagtcgttga gattttgggt gacgatgtgt tgtgctccgc agcggatcgc    192360
     agccgcgaga acgtgccgat cattctgatc aggcaggtcg aggctgccta tcaagctttc    192420
     gtaaccggta accagcgctt ctggaaactc gaaactcatt ttttgcaact gcgaacgaat    192480
     actgtggtgc aagcctggct tttcagccaa gagattggaa gtccattcct ccaatattga    192540
     tttgctccag cggccccgaa acaagccagc atgatagaag cacagaagaa tgtcccgcat    192600
     cctgaatgga tacaggacat ttgcgtccaa tacgacaaca aagcggtccg caatgtgctt    192660
     catgaggcat cgaattcttg gcccaagcgc gccaattcat ccagtgcagt ttcccgactg    192720
     ctatcacgcc gatttttgta ggcgatcaaa tcttcaaatt taacgcgcct gtgtgagccg    192780
     attggaacaa acgggatctc cccgttcttc agcagaccgc tgaggtatgg cctcgagacg    192840
     ttgagcaaat cggctgcctg ttgcgtcgtc aacatcgacc cgacaggaac aaaggttacc    192900
     atctctcccc gcgcgatatg cccaaggata tccacgagca actcactgat cgcgggagct    192960
     aggcgcagct gctcgctcga tccttcgcca agaatgaggg cgccatcccg cgattttgct    193020
     cgcgcaagtg ctattgcagc gtcattcgcg cttcggactt catcggaagt cggaaggcga    193080
     tgcgtcagat cggtcgcagc cttcgccatc aacccctcct cattttttga tctggctctt    193140
     agctagggca ataacccctc gccaacaagt gaaataaacg aaaaaggtgt aataagtgta    193200
     aatgacatgt cgcttatgtc cgagggggcc ggcgttgtgt gcgtcggcga gcgtgccgtt    193260
     ggctgccggc attttttcag gcgcccaagc tgaaggaagc ggttgccggc gagcgggggc    193320
     ggggagggca ccaggctgcc ggccgatggc gtgtcggggc ggtcttgcgg tgcgaatgcg    193380
     gtgtcatcgg gcacgagggg cctctcctga gcgcgaatcg ggcggttctg cgcccggaat    193440
     cctacgaaat ttatgtagta gcgacaacca tgcttatcag gaaatcagtt aaaaaatccc    193500
     gatcacccca tgaaaaagac ggttatttcg tgctatacgg catatggcgc aaaattacgg    193560
     atcaagatat tgattttccg ttcgaggatt ttcccagctc tccgctcagc ccaggcccga    193620
     ttcctttcct ccatcagggg ccggagcaga atcagcgcgc ccgcggcggt tcggggtttt    193680
     gctccatggc cgctcgtcgg gcggtccggt cgagacgacc ggcacaaggt ggccggcgtg    193740
     ccgcgcctgc caggtcgggg cggtgacggc gaggtcgcgc atggacggca gacggtcgac    193800
     cgtatccacg aaatgcttat gcaccctcac catcagcccg gtcaggacgg cggggccaag    193860
     gcacttcatg gctccccctg aaatgcaggc ccagcagaag ctgatgatcg ccttcgagcg    193920
     ggcggccgga gcgtttgccc ggctcgacca ggccctctcg atgcacccgc tccgcggcgc    193980
     cttcctctac cggttccgtc tcgatgcggt gcgccgccag gcgatggtgg acgggcagct    194040
     gatcgagccg tggcatctcg cggccctgct cgagggggtt cggctccgca tggatccatg    194100
     gctgagcctc gccgagcggg gtgacatctt cgatgcggcc cgccacgcgt tctcgatgca    194160
     ccagtggatc gtcgagcccg attttgatca ggagggtgag atccaggtgg cgatgaaggc    194220
     gatcgagcgc gatgtcgcgc gcgcctcccc gctgctcggc gcggcgcacg cggcccatgc    194280
     ctggctcgcc gggggcggga gacgagctcc actgcggggc gcactcatcc gcttctggca    194340
     gcagagcgga ctgctgcacc ttccggtgcc gatcaccgga ccgcaggccc tcggcggcga    194400
     ccttcccttc gatcgggaga gctggatccc gcttctgctc cacgcactgg cgaacgaggc    194460
     cgcggccgcc caggacctcc tccgcgacct tgagcgggcc tggcaggtcg cgcgcggttc    194520
     gatcggcaag cggcgcaaga acagccgggc cgccacggcg gtcgatatcc tggcggcaac    194580
     cccgatcatc tccgcgaaat cgctcgccga tcggctcggt atgaacgtgg cgaacgccca    194640
     cgccctgctc ggcgagctgc tcgaagccgg gctggtcgtc gagctgaccc accgcagcaa    194700
     gcgacggctc ttcggcctgt cgggcatggg ccggatgcgc gactacgtgg caccgccacg    194760
     ccggccgcag ccggggcggg gaagggggag gccccggatc gagcccgaaa tgccacactc    194820
     tgcgccgccc gccgatcttc cgccggcgcc atccggtggc gtcctgcccc ggcttgcgtt    194880
     cgacttcagc gatctggaag aggccatggc ggcagccgat gaagcgatcc gtgaaaccag    194940
     gatcagcctc gatcggatcc gtcaggccgg accgccggag tagggactac ctcgaccggt    195000
     gcgccttggg gagcaggtga aacctatacg gttcagcgga atgacccggc gttcgtctcg    195060
     aacaacgccg cgcatgagct cgccgcttct ggtttggacg aagctggcct ctccgcgtta    195120
     attgcgacct caccgtcgcg acagcgaagc atctttggtc atgcttgcga caacatcgtc    195180
     ttgcctgcca acatcccggt acgactggaa tgggacgcag ctcggaacat taaaggagag    195240
     gaggcacaga tatggacaag ggtagtggcg gctcggtggg gatgagcgcg ggacggctcg    195300
     agcgtatcgg ggcggcgatg cagggctatg tcgatcgggg aatctatgcc ggcatcaaca    195360
     ccgtcgtcgc gcggcgcggc gtggttgtgc agcaagggca gtatggcttt cgcgataaag    195420
     aggccggctt accaatggct gcggacacga ttttccgcct ttattcgatg acgaagccgg    195480
     tcgtgtgcac ggcgttgatg actctggtcg aggaggggcg gctccggctg ttcgatcccg    195540
     tcgcgcgcta cgttcccgcg ttggccggtt tgaccgtgct gcggccggac ggctcgcgca    195600
     ctgcgccggc ccggccggtc atggtgcgtg atttgatgac gcacacaagc gggctgtcct    195660
     atcatttcct cgaggagacg cctgtcgggc cgatgtatgc ggacagcatt gtcaggttga    195720
     cgtggtgatc gtgtgcccgt agcgatttcg gatgatggct ttgactctgc ctgcacgttt    195780
     gaagggatat cgcttccctc gatcggtgat cgcgtatgcg gtctggagct attaccggtt    195840
     caatctcagc ctgcgggacg ttgaggatct tctggccgct cgcggcgtga tagtatgcta    195900
     cgagacgatc cgcgtctggg tcgatcggtt tggcccgcag atcgccgcgc aaatccgtcg    195960
     cgatcggctg ccggccggcg acaaatggca cctcgatgaa atggtgatca ccattggcgg    196020
     cgagaagcat tggctttggc gggcagttga tcatcgcggt gacgtgctgg aaatcctggt    196080
     ccagaagcgg cgagatgccc gagccgcccg gcgttttctc cgcaagctga tgcgccgatg    196140
     gggtcagccg cgcgtcgtgg tgaccgataa gctacggagc tacgacgttg cccttcgcac    196200
     ggattgccgc agcgccgatc accgatcgca caagcggctg aacaaccgga tcgaagcatc    196260
     ccatcgtcac accaggcgac gagaaaagat aatgggtcgg ttcatatccc caggtcatgc    196320
     ccagagattt ctcgccaccc acgaccagat caccaccctg ttccgcccaa aacgccatcg    196380
     cctctccgcc agatcctacc gccacgcaag agccgatgca tttttgctct ggaccgacta    196440
     cgccgccaat ctcgccgcct gatcgatcgc gtctcggtca aatcacacct cgttcgatca    196500
     acctgacaat cccgtccgga cagttcctga ccgaggatta ctacgtggcc aacaagctga    196560
     tgaaggggtt catcggcagt gccaatattg acaccaattc ccggctttgt atggcgtccg    196620
     cggtggccgc ccaccgccgg tgcttcggcg aggacgtcgt cccggggatc tacgaggatt    196680
     tcgacgaggc ggaactgatc atcttcgccg gctcgaacgc cgcctggtgc catccggtcc    196740
     tgttccagcg cgcacttgcc gcccgggcga cgcgcgggac gcggattgtc gtgatcgatc    196800
     cccgccgtag cgcgaccgcc gagttcgccg acctgcacct cgccgtgcgc cccggcggcg    196860
     acctcgccct gttctgcgcg ctgctcgccg cctgcgcgga ccgcggcgcg ctcgatcgcg    196920
     actatatcgc gcggcacacc gccgggttcg acgccgcgct ggccgccgcg cggcaggccg    196980
     agcacgggat cgatcccgcc gcattcgaaa ccctcgccgg ctgggtcgcc tccaccccgc    197040
     gcatggtgac cgccttttcg cagggcgtga accagtccga gacggcgacc gacgcaatcg    197100
     gcgcgatcct gaacctccac ctcgccaccg gacggatcgg ccggcccggc gccggaccgt    197160
     tctcgctgac cggccagccc aacgcgatgg gcggccgcga ggcgggcggc ctcgccaacc    197220
     agctcgccgc gcatctcggc ttcgacgacc ccgacgacca cgcgacgctc tccgaattct    197280
     ggggcgcccc caacctcgtg cgccggcccg ggctgaaggc ggtcgacctg ttccgtgccg    197340
     tcgccgacgg caagatacgc gccctctgga tcgccggcac caaccccgcc gaatccctgc    197400
     cagcgagcct cgacgtgcgc gacgcgctat cccgttgtcc gcacctcgtg gtcgccgatt    197460
     gctggcccac ggcgacgacc gcccatgccc atgtcctgct gccagcggca gggtggtccg    197520
     agaaggacgg caccgtcacc aattcagagc gcatgatctc ccgccagcgg gcgtttcgtc    197580
     ccgctcccgg tgctgctcga cccgactggt ggatgttcgc cgaactcgcc cggcggctcg    197640
     gccatggcgc ggccttcgcc tgggacgggc cggccgcgat cttccgcgaa cacgcggcac    197700
     tctccgcttt ccgcaacttc gggcgacggc ggttcaatat cggcgggctc gctgccatcc    197760
     cggatgacga ttacgacgca atgcgcccgc tgcgctggcc tctggccgga gatcgcctct    197820
     ttgccgaggg aaacttcccg acgccagacg ggcgggcccg cttcgtcgcc atatcaccgc    197880
     tccgccacgc gcgcacggat ttcaccctca ataccggccg gctgcgcgac caatggcaca    197940
     ccatgacgcg caccggtcgc gtcgccgaac tgatggccca ccaagatgcc gcgaccctgg    198000
     aactcgcacc gacggacgcg gcgcgactcg gcgtgctgcc cggtgatctt gtcgccgccg    198060
     ggagcgaagg ggcgcgcatc gtcttcccgg cagcgatctc gccgggacag tgcgaaggtt    198120
     cggtgttcgc tgcgatacac tggaccgcag cgcagggcag cgccggaagc gtcaaccgcc    198180
     tcactgtttc agcgaccgac ccgatctccg gccagccggc cttcaagcat tcgccagtga    198240
     aacttgcggc ggtgccgacg ctctggcggg ccattgctat cggacgtgcc gcttcctgcg    198300
     cgatgacggc tggcaaacaa gccgtctggt cgcaggcact acgcccgggc gggctggcgc    198360
     tgtcgcgctt taccgggttt gccccgctcg ccgcccgcag cgccgtggac gcggcacggt    198420
     ggctgctggt gctgccggag ggtgccgaat tcctcgacta cgccgacccg gcgcgcgggg    198480
     tcttccgcct cgccgtgctc gaccgggccg gcgtccagct ccttctccac gtcgcgccgg    198540
     cggagcttgc gctgccggac cccgaggcgc tggaggcgct gttcgcggcc ccacaagcag    198600
     gagccgatcc gacgctcctg cttggccagc ccgcccgcgc caccgcgacc cgcgggcggc    198660
     aggtctgcgt ctgcaacgcg gttgccgaac ccgcgatccg tgccgcgatc cgcgccggct    198720
     gccggagcgt cgaggcgatc ggcgcggcca ccggcgccgg caccggctgc ggttcatgcc    198780
     actccgaact gaagggattt ctccgccatg acctcgttgc cgccgaatag caaggcgcat    198840
     cccgtcatcc tcgccggcac cgggccgggc gatccggatc ttctcaccct gcgggccgta    198900
     cgggcgatcg gcgccgccga aatcatcctg catgatgcgc tggtcgatgc tcgcatcctg    198960
     gtccttgccg ccccggatgc cgtcctcatc catgtcggca agcggtgtgg ccggcacgcg    199020
     atgagccaga cagagatcaa ccgccgcctt gtcgaatgcg cgcgcaccgg cgctcgggtg    199080
     ctacggctga agggcggaga tccgatgatc ttcggccggg ccggcgagga gatcgcggcc    199140
     ttgcgggccg caggcattgc ggtcgaggtg atcccgggga tcacagcggc ctcggcggcg    199200
     gcggcgtctg cctgcgtctc gctgaccgcg cggggcaggg cgcgcgctgt caccctggtc    199260
     accggccaca ccgccgatgg cgggctaccg cctcaggact gggcggcact ggcccggctc    199320
     gattcgaccc tcgtcttcta catgggctcc cgccacgccc gagcgatcgc cgaccgcctg    199380
     atcgaggccg ggctcgatcc cgccacgccg gcgatgctgc tgaccaatgt cagccgcccg    199440
     ggcgagacgc gccggcttgc ccgcctcatc gacctcgcag acggaatcgc cgccgccgat    199500
     ctcgcggccc cggcgctgat cctgatcggc gccgcgctcg acgcggcggt tccggtggcg    199560
     actattcagg cggacgcccg cgagctgtcg tgagccagcc ccgcgcctcg acatggtcgg    199620
     cgatccggcg agccgtttcg ggcatcgaca tcccttcggc gcgccatcgc tcgcgaagta    199680
     ccgcgatttc agacagccgt gcggcccagt ccgccccgaa ttcgacttcg agatgccgac    199740
     gcagcacaga ggacaggccg gctgcctgac cgccggtcga gaccgtcagc agcagatcgc    199800
     cgcgcctcac ctgcgccacg gaatgaaagt cgcagtcggg caggcggtcc tcgacattca    199860
     ccagcacgcg cgccgcccgc gccgccgcga ccaggcccgc gcgaaccacg tccggaacgt    199920
     cgacgatcca gagcgcatgc agtcgcgcga ggtcatcgcc cgtcggcatt ctgcggcata    199980
     gcgcggcgcc agcttccgcg attgtcgccg catccggatc ctcactgaac agaagggcgg    200040
     catcggcgcc gccttcacac agcgcacgca gcctgcgaag cgacatagga ccgttgccgc    200100
     atacgccgag acggcaatag ctcggatcga gcacgatcgg aatcatgaga tcatcccaac    200160
     aggaaacgga accgcatcaa ggctagcaac cgcaagatcg ctcacaatcg tgcgtcagga    200220
     ggatagcggc gccttgtctg ctttcagaag ttcaaaaatc gctgcgttac gaccgaaacc    200280
     cagacagagg ccgcccatgg cgaggcgcat gcattcaaac gtgggcggga catggcggcg    200340
     tggctggggc tcgttccacg gcaaatgaca acgggtggaa aaccgcgcct gctcggcatc    200400
     agcaaacgcg gcaatcgtta tttgcggaag aacttgatcc atggcgcacg agcggcgctg    200460
     ccttatcttg tcgaacgtga tacgccgttg ggccgctggg cgcggggatt gctcgatcga    200520
     gcgcataaga acgtggtcgt agtcgcgctg gccgcgaagc tggctcggat cgcatgggcc    200580
     gttttggcgc acggttgcga ttacgacgcc caattcgaag cggcggctgc ggccgcatga    200640
     cggaatcgcc cgaacagcgc tcacagttgg gcgcgaaagg gcagtcgatg tctgcgtgag    200700
     gtgaaaggaa gatggcctga cagtcgaacg gcggcttgaa aacctgacgc agtgaacggc    200760
     ctccgaggcc ggtgtgatta tgaggatcag gccgcgcgga tctccatctt ggccgggttc    200820
     gaagcccgag accggatacg ttgaagcaga ctgattagag ccagatgaaa atcacccctt    200880
     gcggacgggg cgggccatac gttctccgcg accggctgct cgcgcagcaa cagagccgga    200940
     tcaaggaact ccgccatgca aagtacgaag acgttctgac cgcaaatccg tccatcaccg    201000
     tgctgcgcgg cgcggttcga ctcagcacag gcgctgaccg tgagcctgac cgatggaaac    201060
     gcgcgaaccg tcgcgttcga ccgctgcctg atcgccaccg gcggcagtcc cgccattccg    201120
     tcgatcccgg gcttgagcga aaccccttac tggacctcga ccgaggcatt ggtcagcgac    201180
     acgattcccg ggcgactagc cgtgatcggc tcctcggttg ttgcggtcga actcgcgcaa    201240
     gccttcgccc ggctgggcag ccaagtaacg atcctggcgc gtcacacgct gcttttccat    201300
     gaggattcac tgatcggcga gaccattgcc gctgccttcc gcgccggggg gatcgaagtc    201360
     ctcgaacata ccgaggccag ccgggttgac taccggaatg acgaatttgt cctcgcgacc    201420
     gggaagggtg aattgtgtgc cgacaggttg ctcgtcgcga ccggtcgtgc gccgaacacg    201480
     cgggatctga atctcagcgc ggctgatgtc accgtgaacg ccaacggtgc aatcgtcacc    201540
     gatcggagca tgctgaccag cacgcaggga atctacgcag ctggagattg caccgaccga    201600
     ccgcaattcg tctatgtggc ggccgcggca ggcacacggg cggcgatcaa catgaccggc    201660
     ggcagcggga cgctcgatct cgcgacgatg ccggctgtgg tattcaccga tccgcaggtc    201720
     gccaccgtgg gcttgagtga acaggaagcg cgccaagccg gcatcgaaac cgacagccgc    201780
     acgcttaccc tcgacaacgt gcctcgcgcg ctcgttaatt tcgacacgcg cggcttcatc    201840
     gagctggtga tcgaggaagg tagccgtcgg ctgatcggcg tacaggcggt ggccccagag    201900
     gctggcgaac tgatccagac ggcggcgcta gcgatccgta cgcggatgac agcgcaggag    201960
     ctggccgacc agctattccc ctacctgacg atggtcgagg gcttgaagct tgccgcgcag    202020
     accttcagca aggacgtgaa gcaactctcc tgctgcgccg gctgaggtga ggcagccgac    202080
     gtgctggata cagatatgct cacgccaact cacaatatcg tctccgcgaa gatgatccgc    202140
     cactatgaga cgatcggctt gatcgcaagg ccggtttggc aggagaacga ctacctcacc    202200
     tatggttctg atgatgtaca ctggctgagg ttcatcaggc gggggcgcgc gctcggcaac    202260
     ctgatcgcga caatctgtca gcttctcgca ctctggggtg acaccaaccg gccgagcgcg    202320
     gatgtcaagc ggattgctct ggctcatccg gaatccatgc gcagcaagat tgccgaactc    202380
     gtttctatgg ccagagcgat cgaacacctt gcagattttt gcatgagcga tcatcagcga    202440
     gattgtccga tcctcgacga tctcaccagc gcatctcttc tacctgacga cggtgatcgc    202500
     gggttatccg atcgacgcaa tcattgctgc cttcggcgcc gtgccccgca tccgcaacga    202560
     gaccgtcgca cttgcccata tttccttgaa ttacacgccg atcctcaaca tcctgctcct    202620
     ggcggtatca tcactcctag cgctgcggtt cctgagcact ggtgcaccgg acatgttgcg    202680
     catgatggtg gcgctatccg aaggccagga tcatcaccat gaccatatct gaaccacccg    202740
     ccgcctcccc ccgcatgcag gaagccttcg atcctgcgcc cagacgccct atgccggaca    202800
     gcgacaacca tagaggatac tgggcgtctc cggcctgaag ccggcgaacg ctacagttat    202860
     ggtgcaaggc aacaaaccca atccggcacg tctgcggatc gttctggcct tcggcgcgct    202920
     cgggctattc gccgtggcgg gtgttgttgc gcttgcggcg ggcctgtcct tccatgggct    202980
     gaccgcctcg ccggacgcaa tcgtccgcat catccgctcc tggggcgcat ggggcgcgct    203040
     cgccgcgatc tccctgatga tcgcgcattc cttcctgccg ctgccagccg aggtgatcgc    203100
     ggttgcaaac ggcatgatct tcgggcccgt ctggggaacc gtgatcacct ggaccggcgc    203160
     gatgctcggg gcctgggccg ccttcggcct cgcgcgcctc ttcggccgcc ccctcgtcga    203220
     gacattcgtc cccgcacgat atcggcacac gctcgatgac tgggcggaaa cgcggggcgc    203280
     gataccactt ctcatcctcc gcctgattcc gatcgtcgcg ttcaacctga tcaactacgc    203340
     ggtcggcctc gcgcgtatct cgtggtggac cttcacctgg acgaccggcc ttggaatcct    203400
     ccccatgacc ctgttgatgg tggtactggg agatcgtctg gccagcgttt ccggcgaagc    203460
     ggggctggtc gtcctcgccg gtgtgctgct ggcctggctc gcggtcaagc tactgcggaa    203520
     gcgtctccca ccgcaccggc cgggccggag atcgccggcc cgcccacgct ctggatcatg    203580
     aagcgtccc                                                            203589
//