Dbfetch

ID   AP012043; SV 1; circular; genomic DNA; STD; PRO; 1729 BP.
XX
AC   AP012043;
XX
PR   Project:PRJDA60101;
XX
DT   02-MAR-2011 (Rel. 108, Created)
DT   28-SEP-2016 (Rel. 130, Last updated, Version 3)
XX
DE   Acidiphilium multivorum AIU301 plasmid pACMV8 DNA, complete sequence.
XX
KW   .
XX
OS   Acidiphilium multivorum AIU301
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acidiphilium.
OG   Plasmid pACMV8
XX
RN   [1]
RP   1-1729
RA   Hosoyama A., Yamada R., Ito N., Takarada H., Narita-Yamada S., Nakamura S.,
RA   Katano Y., Ichikawa N., Nakazawa H., Fujita N.;
RT   ;
RL   Submitted (28-DEC-2010) to the INSDC.
RL   Contact:Director-General Department of Biotechnology National Institute of
RL   Technology and Evaluation, NITE Bioresource Information Center (NBIC),
RL   Department of Biotechnology; 2-49-10 Nishihara, Shibuya-ku, Tokyo 151-0066,
RL   Japan URL    :http://www.bio.nite.go.jp/
XX
RN   [2]
RA   Narita-Yamada S., Nakamura S., Ito N., Takarada H., Katano Y., Nakazawa H.,
RA   Hosoyama A., Yamada R., Fujita N.;
RT   "Whole genome sequence of Acidiphilium multivorum AIU301.";
RL   Unpublished.
XX
DR   MD5; fb66313cf1cb6b2c823e37a3106b5d01.
DR   BioSample; SAMD00060977.
XX
CC   ##Genome-Assembly-Data-START##
CC   Genome Coverage       :: 8x
CC   Sequencing Technology :: ABI3730
CC   ##Genome-Assembly-Data-END##
CC   Please visit our web site.
CC   URL:http://www.bio.nite.go.jp/
CC   DOGAN ; Database of Genomes Analyzed at NITE
CC   The database contains genome sequence data, physical maps
CC   and the genomic and proteomic data of the microorganisms
CC   analyzed.
CC   URL:http://www.bio.nite.go.jp/dogan/Top
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1729
FT                   /organism="Acidiphilium multivorum AIU301"
FT                   /plasmid="pACMV8"
FT                   /strain="AIU301"
FT                   /mol_type="genomic DNA"
FT                   /note="strain coidentity: NBRC 100883"
FT                   /db_xref="taxon:926570"
FT   CDS             1..720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P8_00010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P8_00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83296"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J879"
FT                   /protein_id="BAJ83296.1"
FT                   /translation="MATSLAELRRRGHSDDDIHLAQMTQEAQRRAGAPHRTLAEILAGK
FT                   PARSRSEAAVVDLTARQLRRRGSYGQAALLADQAALGETDPERAERARFHAAGLAALGK
FT                   AKQLEFDFFGGGNVSLGHQYIDAVQDRLMKTEATPAERNAALATLLLITRHLEWQSYTC
FT                   TKIAADLAEMQGVKRQDMKDTLALLERVGAISRIKRGRTKVIAVTPEGAFRGDISKHGE
FT                   AIARYSAEVVKLRPETI"
XX
SQ   Sequence 1729 BP; 380 A; 524 C; 529 G; 296 T; 0 other;
     atggccacat cgctcgctga actgcgccgc cggggacact ccgacgacga tatccacctc        60
     gcgcagatga cgcaggaggc gcagagacgg gcgggagctc ctcaccggac actggcagag       120
     atactggccg gaaaaccggc cagaagccgc tcagaggccg ctgtggtgga tctgacggca       180
     cggcagctac ggaggcgcgg aagctacgga caagccgctc tgctggccga tcaggccgcg       240
     ctgggcgaga cagacccgga gcgcgcagag cgcgccagat tccatgccgc ggggctggcc       300
     gccctgggta aagcaaagca gctagagttc gattttttcg gaggcggtaa cgtgagcctt       360
     ggtcatcaat acatcgacgc cgtgcaggac cgcctgatga aaaccgaagc gacgccggca       420
     gagcggaatg ccgcgctggc gacgctgctg ctgatcacgc ggcatctcga atggcagtcc       480
     tacacctgca ccaagatcgc cgccgatctg gccgagatgc agggggtgaa acgacaggac       540
     atgaaggata ccctcgcgct gcttgagcgc gttggggcga tcagcaggat caagcggggc       600
     cgcaccaagg tcatcgcggt gacgccggag ggcgcgttca gaggggacat ttcaaagcac       660
     ggggaagcga tcgcacgcta ctcggctgag gtcgtgaagc tgcgcccgga gacgatatga       720
     gcgacgaacc tgaaaacatc accgccgttc ttctccggga aatccgtgat gaactgcgcg       780
     ggctgcgccg cgaggtggtg gacgtgcgaa cactgaccct aggcacgttc gaccggatga       840
     agcggctgga gcgtcgcctc gaggaaaccc gcgacgatct ggagaccacc atcaaggccg       900
     agatcatggg caccggcctg aactggcgtc gggacttgga agaccgtctc gacgccttgg       960
     aagaaactag gaagccgcct cacggctaga gggggtgcac gggggggcaa gccccccctg      1020
     ccaagcgcgc ggtattaccg cgcattgctt gcaatcaaac ctatcggaat atagcgcggc      1080
     ctgccgatta cctcgctgtg ctcagatcgg tgcgcaatca cgcggtttgt gctgcgaaat      1140
     tggcgacaat ggctccgaca aacacggcac tgaatgtacg catgtcgatg acactatgac      1200
     gcgccaatag cttcaaactt agatcaacat cgtcctcact ttgcgcattc atctcgaaca      1260
     aattgagcgg acgatacgct cgcattttct cgctttttcc gggatcgcta agggtgaaaa      1320
     cccttggccg caccgcaaac tgaaaagttt gcataagtgc gcccttcggg aactagtgct      1380
     gttttgcctc tgctggtctc tgagccgccc tagacggcag ggagagcccc agacctgccc      1440
     acatcgtccc caatgccgct atgcggtgtt tgagccgccc tgaacggcag gatgaggctc      1500
     tgcccccccc ccccggccac cacggcccgt cagggccgcc agaaatgggc aagccgcgca      1560
     agcggctttc cgctgctctt cctgaatctt cttctaggta tggataccgc cggaaggtct      1620
     ggacaaaaaa tctaggattt ccgccaattc caagccgaaa tcgcttgacc gattgtaagc      1680
     caccagctta catttgtaag ccaccagctt acaatcggga gtcgcgttc                  1729
//