Dbfetch

ID   AP012042; SV 1; circular; genomic DNA; STD; PRO; 5178 BP.
XX
AC   AP012042;
XX
PR   Project:PRJDA60101;
XX
DT   02-MAR-2011 (Rel. 108, Created)
DT   28-SEP-2016 (Rel. 130, Last updated, Version 3)
XX
DE   Acidiphilium multivorum AIU301 plasmid pACMV7 DNA, complete sequence.
XX
KW   .
XX
OS   Acidiphilium multivorum AIU301
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acidiphilium.
OG   Plasmid pACMV7
XX
RN   [1]
RP   1-5178
RA   Hosoyama A., Yamada R., Ito N., Takarada H., Narita-Yamada S., Nakamura S.,
RA   Katano Y., Ichikawa N., Nakazawa H., Fujita N.;
RT   ;
RL   Submitted (28-DEC-2010) to the INSDC.
RL   Contact:Director-General Department of Biotechnology National Institute of
RL   Technology and Evaluation, NITE Bioresource Information Center (NBIC),
RL   Department of Biotechnology; 2-49-10 Nishihara, Shibuya-ku, Tokyo 151-0066,
RL   Japan URL    :http://www.bio.nite.go.jp/
XX
RN   [2]
RA   Narita-Yamada S., Nakamura S., Ito N., Takarada H., Katano Y., Nakazawa H.,
RA   Hosoyama A., Yamada R., Fujita N.;
RT   "Whole genome sequence of Acidiphilium multivorum AIU301.";
RL   Unpublished.
XX
DR   MD5; 51fbe9f8e359050d6921c324db728589.
DR   BioSample; SAMD00060977.
XX
CC   ##Genome-Assembly-Data-START##
CC   Genome Coverage       :: 8x
CC   Sequencing Technology :: ABI3730
CC   ##Genome-Assembly-Data-END##
CC   Please visit our web site.
CC   URL:http://www.bio.nite.go.jp/
CC   DOGAN ; Database of Genomes Analyzed at NITE
CC   The database contains genome sequence data, physical maps
CC   and the genomic and proteomic data of the microorganisms
CC   analyzed.
CC   URL:http://www.bio.nite.go.jp/dogan/Top
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5178
FT                   /organism="Acidiphilium multivorum AIU301"
FT                   /plasmid="pACMV7"
FT                   /strain="AIU301"
FT                   /mol_type="genomic DNA"
FT                   /note="strain coidentity: NBRC 100883"
FT                   /db_xref="taxon:926570"
FT   CDS             1..525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P7_00010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P7_00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83288"
FT                   /db_xref="GOA:F0J871"
FT                   /db_xref="InterPro:IPR008813"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J871"
FT                   /protein_id="BAJ83288.1"
FT                   /translation="MKQKQLGLTTEPGGTWVQVERAAMERWSKLAVSNSRAAAVMMLIT
FT                   SQMGRHNALVVSQATLAKMAGCGLNTLKRALGVLRDGNWIEVRQIGPTGTACAYIVNDR
FT                   VAWSGNRDGIRYSLFSAAVLVSDAEQPDHSELGAQPSLESYPDHASRRAPATHWSRSRP
FT                   AHPAATDGIGA"
FT   CDS             581..976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P7_00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P7_00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83289"
FT                   /db_xref="GOA:F0J872"
FT                   /db_xref="InterPro:IPR007889"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J872"
FT                   /protein_id="BAJ83289.1"
FT                   /translation="MLSQRRAAQAWGISRATLQRAVSSGKLSALPDGTIDPAEMLRVFG
FT                   EAKGGPSGHHNEPLGPPLGRGDEMAFQAEIRMLKAQIEAKEALLSAKDRHIEDLSQALR
FT                   LLAGPPAPAPQPSLLAKLFSRQRSPRS"
FT   CDS             990..1424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P7_00030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P7_00030"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83290"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:F0J873"
FT                   /protein_id="BAJ83290.1"
FT                   /translation="MSTSTLYDRDFYAWANEQAGLLRAGKLTQADIEHIAEEIESMGKS
FT                   EKRELVSRLTILLLHLLKWQFQAPKRSKSWQNSVEVQRISLDSHLRDNPSLKSVLDSAI
FT                   SEAYRVARLEAENETGIDKNIFPVTCPWSFDQMMAEDFWP"
FT   CDS             1441..1734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P7_00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P7_00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83291"
FT                   /db_xref="UniProtKB/TrEMBL:F0J874"
FT                   /protein_id="BAJ83291.1"
FT                   /translation="MTQNLNNELRLKILEKLYSIESTLNPGDSVLVQPYIDGQETTNPL
FT                   KIHGYDWNQIDSTLREMCRTGLLSSGSVQYDAPAIGIYFSALTPRGRTLLGK"
FT   CDS             1811..2326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P7_00050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P7_00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83292"
FT                   /db_xref="UniProtKB/TrEMBL:F0J875"
FT                   /protein_id="BAJ83292.1"
FT                   /translation="MPPQEAALLNTLSKYNEAYDQAPNEIQQDRVSTEFARRFCAEIPQ
FT                   GTVHDWIGTLETILPTHHPSGVQITIELPSRDLYSGSLGIGLSVGNFYGYGVTRDGMIP
FT                   SGPLLIRANTPLYHTVSKIPDNDYDRVSFSGRFVPFISPTACEKAIHYATYFDAIRFYK
FT                   VRDLGPDK"
FT   CDS             complement(2398..3519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P7_00060"
FT                   /product="MobA/MobL family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P7_00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83293"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:F0J876"
FT                   /protein_id="BAJ83293.1"
FT                   /translation="MAIYHASVKVVGRGGGRSSVAASAYRSGECLTNERDGNTHDYTKK
FT                   QGVVHREIMTPENAPAWMSDRSKLWNGVEAAEKRKDAQLFRDVEIALPRELSREEQINL
FT                   VRDFVKERCVDHGMVADIAVHEPRASDGEKQPHAHIMLTMRHIEGESFGNKAREWNPDF
FT                   ATKDGKGFVKDKSPLLGLREGWAEHINRALERAHIAERVDHRSLTVQREVALEMSQDQT
FT                   RPEPERLLAERCAQDLDREPQPKLGAAAAMERRGVQTDRGDQMRAVQGRNRERQGVWQQ
FT                   VREWGAQALDKARDWAVELRERLAGVDLSGLRTANLSAALAGADLSVLRQANQAAERAK
FT                   QPTMARRPTKEAVISRQPSRTPSKGRDGPEMDL"
FT   CDS             3664..3951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P7_00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P7_00070"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83294"
FT                   /db_xref="UniProtKB/TrEMBL:F0J877"
FT                   /protein_id="BAJ83294.1"
FT                   /translation="MAKTIDQQIADAEARLARLREKSRKKETRHKIIVGALVLTEAAKD
FT                   AKIAGWLLKQIDTKVTRDVDKTDIAPVVDDLRKVAASQNHQAASVEAAHE"
FT   CDS             4295..4609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P7_00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P7_00080"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83295"
FT                   /db_xref="UniProtKB/TrEMBL:F0J878"
FT                   /protein_id="BAJ83295.1"
FT                   /translation="MVLAVAVLLVGGGSFLSLAWQRHESASLRTEETALRAQIQTDRAN
FT                   LAALKAKGGNIHLSECGPKEDRLCVQVAPDQLGPNMAHAVTWHDVHKARGPQYVIVAGY
FT                   "
XX
SQ   Sequence 5178 BP; 1145 A; 1580 C; 1402 G; 1051 T; 0 other;
     atgaagcaaa agcaactcgg attgaccacc gagcccggcg gaacttgggt gcaagtcgaa        60
     cgcgccgcga tggagcgttg gtccaagctc gccgtttcaa actctcgggc agccgccgtg       120
     atgatgctca tcacctccca gatggggagg cacaacgctc tggtggtttc tcaagccaca       180
     ttggcgaaga tggcaggctg tggattgaac accctgaaga gagctttagg ggttttgagg       240
     gatggcaact ggatcgaagt tcgccagatc ggcccgacag gcaccgcctg cgcctacatc       300
     gtcaacgatc gcgtagcttg gtccggtaac cgcgatggca tccgctatag cctgttctcg       360
     gcggcagtgc tggtctcgga tgccgaacaa ccagaccatt ctgagcttgg cgcacaacca       420
     tccctagagt cgtatcccga ccatgcatcc cggcgagcgc cagctaccca ctggtcccgg       480
     tctcgacccg cccacccagc cgccactgat gggattggag cctgacctac cagcccgcgt       540
     gaaggagcca tatgggccac gtgattgagc cacttgggcc atgctgagcc agaggcgagc       600
     cgcccaagcc tgggggatat ctagagccac cctacagcgg gccgtatcta gcggaaaact       660
     tagtgctttg ccggatggaa cgattgatcc ggcagagatg cttcgtgtct ttggcgaagc       720
     caagggtggc ccatcgggcc accacaatga gccacttggg ccacccctgg gccgggggga       780
     tgagatggct tttcaggccg aaatccggat gctcaaagcg cagatcgagg ccaaggaggc       840
     tctgctctcc gccaaggatc ggcacatcga ggatttgagc caggcgctcc ggctgctcgc       900
     tggcccgcca gcaccggcac cacagccgtc tctgctggcc aagctatttt cccgccagag       960
     gtcgccccgt tcgtgatagg atcaacacca tgagcacatc gaccctctat gaccgcgatt      1020
     tctacgcctg ggcgaatgaa caggccggac ttctgcgcgc tgggaagctg acgcaggccg      1080
     acattgaaca catcgccgag gagatcgaga gcatgggcaa atccgagaag cgcgaattag      1140
     tcagccgact gactatcttg cttctccatc tgctcaagtg gcaattccaa gctccaaagc      1200
     gcagcaaaag ctggcaaaac agcgtcgaag tccagcgaat cagcctagat tcgcatttac      1260
     gcgacaatcc cagcctcaaa tccgtcttgg atagcgcaat ttctgaagcc taccgcgtgg      1320
     cgcgcctgga ggctgaaaac gaaaccggca tcgacaagaa tatttttccg gtgacctgcc      1380
     catggtcctt tgaccaaatg atggcagaag acttctggcc atagtttggg agccaccaca      1440
     atgacacaaa atctgaataa tgaattacgc ctcaaaattc tcgaaaagct atattctata      1500
     gaatctacgc ttaaccctgg agatagcgtt ctggtgcagc cgtatatcga cggacaggaa      1560
     accactaatc cgttgaaaat acatggctat gattggaacc aaattgattc cacgcttcgt      1620
     gaaatgtgta gaacgggcct cttaagctcg ggctcagtcc agtatgacgc gcccgccatt      1680
     ggtatatact ttagcgcatt aacaccacgc ggccgtaccc tgcttggaaa atagaaccct      1740
     agaaatgaga tcggctgtca aagtagtggt tgtcgcctta tgtttggtga gccttccggc      1800
     tttcgcagcg atgccgccac aagaggccgc gctgctcaat accctttcaa aatataacga      1860
     agcgtatgat caggcaccaa atgagatcca acaagatagg gtctcaactg aattcgctcg      1920
     caggttttgc gccgaaattc cgcaggggac ggtacatgac tggatcggca cactggaaac      1980
     gatcctgcca acccatcatc cgtccggcgt tcagatcaca atcgaactgc ctagccgcga      2040
     tctctactcg ggatcgcttg gaatcgggct gtctgtcggc aatttctacg gatacggcgt      2100
     cacgcgagat ggcatgattc cctcgggacc gctgctgatt cgtgccaaca cgccgctcta      2160
     tcatactgtc tcaaaaatcc ccgataatga ctatgaccgg gtgagcttta gcggaagatt      2220
     tgtgccgttc atcagcccca ccgcttgcga aaaggcgatc cattacgcca cttactttga      2280
     tgcgattcgc ttctataagg tcagagacct cgggccggat aagtagaggc gccaacagtc      2340
     ctctgcctgt acaccatggc taaataaatt tgtcgttccc cttactcggc ctctggccta      2400
     aaggtccatc tctggcccgt ctcggccctt gctaggtgta cggctaggct gccgggagat      2460
     aacagcctcc tttgtaggac gccgcgccat tgtgggttgc ttggcgcgtt ctgcagcttg      2520
     gttggcctgc cgcaacacag acagatctgc accagccagg gccgcgctga ggttggcggt      2580
     tctcaaccca gacagatcaa cgccggccag cctctcccga agctcaacag cccaatcacg      2640
     ggccttgtcg agcgcctgag ccccccactc gcgcacctgc tgccaaaccc cctgccgctc      2700
     cctattcctg ccctgcacgg ctcgcatctg gtcgccgcgg tcggtctgga cgccccgtcg      2760
     ctccatcgcg gccgccgccc ccagcttcgg ttgcggctcg cggtccaggt cctgcgcgca      2820
     cctctccgct agcaagcgtt ccggttcagg ccgagtctgg tcctgcgaca tctcaagtgc      2880
     cacttcacgc tggacggtca ggctccgatg gtccacccgc tccgcgatgt gggcgcgctc      2940
     caacgcccgg ttgatgtgct cagcccaacc ctctcgcaga cccaacagcg ggcttttgtc      3000
     cttcacgaac cccttcccgt ctttggtggc aaagtccggg ttccactccc gcgccttgtt      3060
     gccaaagctc tcgccctcga tgtggcgcat ggtcagcatg atgtgggcat gaggttgctt      3120
     ctcaccgtcg ctggcgcggg gctcgtgaac agcgatgtcg gccaccatcc catggtcaac      3180
     gcatcgctct ttcacgaagt cccgtacaag gttgatctgc tcttcccgcg aaagctcacg      3240
     gggaagagca atctcaacat cgcggaatag ctgcgcatcc ttccgctttt ccgccgcctc      3300
     gacgccgttc cataattttg agcgatcaga catccaggca ggcgcattct cgggagtcat      3360
     aatctcccga tgaacaacgc cttgcttttt ggtgtaatca tgcgtgttgc cgtcgcgctc      3420
     gttcgtcagg cattcgcctg aacggtacgc cgatgctgca accgatgaac ggccaccacc      3480
     acgcccgacg actttcacac tggcatgata gatcgccaca gacaacctca cacctactga      3540
     aggggtgcag ggggaacccc tgccgtgcac attgcaaagc aatgtataag cgcgcacttc      3600
     gtgcattgtc cagttcatat tcatccgata aagtgacatc atctctgatt gaggaaccgt      3660
     gagatggcaa agactatcga ccagcagatt gccgatgcag aggcccgtct tgcacggtta      3720
     cgtgaaaaat ctcggaagaa ggaaactcgt cacaagatca ttgtgggtgc gctcgttttg      3780
     accgaagcag cgaaggatgc aaaaattgcc gggtggctgc taaagcagat tgacaccaag      3840
     gtcacgcgcg acgtggacaa aaccgatatc gctccggtcg tcgatgatct gaggaaggtg      3900
     gcagcaagcc agaatcatca agcggcctcg gtagaggccg cgcatgagtg accccgttgt      3960
     agaactggtc gaaaccctca aggcggttcg cctcgaagtt gctgctatcg gtcagaagat      4020
     cgacaccaaa gctgccactc ccgcccaact ggcagagctc tctcgggccg ttaaatcggc      4080
     agatcccgcc gaactcgcct cttgcatcgc aaccgccgct gtgcaggcag gacagaaaat      4140
     cgccagagag gttcggggcg aaaccgagaa attgagcact gccacggcca gtctcactac      4200
     ccatgacacc aatctggaca cagccatcaa aagcattgcc gcaaccgggg aggctatcag      4260
     gaaagcgagt ttctggctta attttcgcgc cattatggtc ctggctgtgg ctgtgctcct      4320
     ggtcggtggc ggaagcttcc tctccctggc atggcaacgg cacgaaagcg ccagccttcg      4380
     caccgaggaa accgccctgc gcgcccaaat ccaaaccgac agggccaatc tcgcggctct      4440
     aaaagccaag ggaggtaaca ttcatctgag cgagtgcggc ccgaaagagg atcgtctctg      4500
     cgtccaggtt gcccctgatc agcttggccc aaacatggct catgcggtca catggcacga      4560
     tgtccacaaa gcgcgcggcc cccagtatgt catcgttgcc ggatattagg gctgcaatca      4620
     gacggcccta gagccgcccc tggcggctgg atagggcaca acctcgcccc aacgcccctc      4680
     aatgccactt tgtgggcctc agagccgccc taggcggctg gataggatac gatccggttc      4740
     gccagtgcgg cccgttaggg ccgccgatca tgggcaagcc gctgacgcgg cttgccgcca      4800
     tcattcatcg gccctgaggg ccgcctgatc agcccgtccg cacaggtggg tccaccggga      4860
     tggctacgcg tcgccagcct ccttacgggg cgctccgcta cgcatccccg tggactacct      4920
     gcacggcagg cagccccctt cgggggtgct ccttaagatc atagaaggag cgagaaaaaa      4980
     agtattatat atcaataata tagaaggggg gggtagccca ccagctatgg gctaccccta      5040
     gcccaccagc tatgggctag gtttggacga aatttgtcca tttaatgttg aatttcatcc      5100
     acacttacgc tattcagcat ggataaaatc cgtccatttt cggatgaata atgcccaatt      5160
     ttgggctagg ggtagccc                                                    5178
//