Dbfetch

ID   AP012041; SV 1; circular; genomic DNA; STD; PRO; 12125 BP.
XX
AC   AP012041;
XX
PR   Project:PRJDA60101;
XX
DT   02-MAR-2011 (Rel. 108, Created)
DT   28-SEP-2016 (Rel. 130, Last updated, Version 3)
XX
DE   Acidiphilium multivorum AIU301 plasmid pACMV6 DNA, complete sequence.
XX
KW   .
XX
OS   Acidiphilium multivorum AIU301
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acidiphilium.
OG   Plasmid pACMV6
XX
RN   [1]
RP   1-12125
RA   Hosoyama A., Yamada R., Ito N., Takarada H., Narita-Yamada S., Nakamura S.,
RA   Katano Y., Ichikawa N., Nakazawa H., Fujita N.;
RT   ;
RL   Submitted (28-DEC-2010) to the INSDC.
RL   Contact:Director-General Department of Biotechnology National Institute of
RL   Technology and Evaluation, NITE Bioresource Information Center (NBIC),
RL   Department of Biotechnology; 2-49-10 Nishihara, Shibuya-ku, Tokyo 151-0066,
RL   Japan URL    :http://www.bio.nite.go.jp/
XX
RN   [2]
RA   Narita-Yamada S., Nakamura S., Ito N., Takarada H., Katano Y., Nakazawa H.,
RA   Hosoyama A., Yamada R., Fujita N.;
RT   "Whole genome sequence of Acidiphilium multivorum AIU301.";
RL   Unpublished.
XX
DR   MD5; 43a897f0e5b6f31f0c2fd0fe0f036727.
DR   BioSample; SAMD00060977.
XX
CC   ##Genome-Assembly-Data-START##
CC   Genome Coverage       :: 8x
CC   Sequencing Technology :: ABI3730
CC   ##Genome-Assembly-Data-END##
CC   Please visit our web site.
CC   URL:http://www.bio.nite.go.jp/
CC   DOGAN ; Database of Genomes Analyzed at NITE
CC   The database contains genome sequence data, physical maps
CC   and the genomic and proteomic data of the microorganisms
CC   analyzed.
CC   URL:http://www.bio.nite.go.jp/dogan/Top
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..12125
FT                   /organism="Acidiphilium multivorum AIU301"
FT                   /plasmid="pACMV6"
FT                   /strain="AIU301"
FT                   /mol_type="genomic DNA"
FT                   /note="strain coidentity: NBRC 100883"
FT                   /db_xref="taxon:926570"
FT   CDS             1..630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="ACMV_P6_00010"
FT                   /product="putative partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P6_00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83274"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J857"
FT                   /protein_id="BAJ83274.1"
FT                   /translation="MILGVLNQKGGVGKTTLSVNLAASLARAGRRVLLIDADPQGSALD
FT                   WAAARQEGPLFSVVGFPRPTIHREIAQIGNGYDHIVIDGPPRVTDLARSAIMASDLVLI
FT                   PVQPSPYDVWAAEEVVKLIEEARVYKESIKCSFVVNRKIANTAIGRDVGEALSAYPVSV
FT                   LSASITQRVVFAEAAGQGMAVHEVEPGGPAAAEIEAVTAELMELAR"
FT   CDS             627..860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P6_00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P6_00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83275"
FT                   /db_xref="GOA:F0J858"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:F0J858"
FT                   /protein_id="BAJ83275.1"
FT                   /translation="MNKKVSFGVRPSVTRTSELDAEAWVADRATDEREPMKRLTIDIPA
FT                   HLHRAIKTQCASRGTKIADELRELLLQKYGKS"
FT   CDS             complement(1004..1489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P6_00030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P6_00030"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83276"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:F0J859"
FT                   /protein_id="BAJ83276.1"
FT                   /translation="MTPLTDQFTLNIAGINGPSDTEGGRYGVQSFAFNQPSNFASALAP
FT                   SGFTESIGGLAANGCNGTGNFYCFMADTAPTGPVLPANTSINYVFNVTLLSGTFSGYSP
FT                   DFKINWDGTKNHYDLISETLTPTSGTPVPEPGSLLLLGTGLVGLGLVGRRKLSKRYL"
FT   repeat_region   1477..1481
FT                   /rpt_type=FLANKING
FT   repeat_region   1482..5269
FT                   /note="Belongs to Tn3 family"
FT   repeat_region   1482..1521
FT                   /rpt_type=INVERTED
FT                   /note="perfect 40 bp inverted repeat"
FT   CDS             complement(1515..2096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P6_00040"
FT                   /product="putative resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P6_00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83277"
FT                   /db_xref="GOA:F0J7K2"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7K2"
FT                   /protein_id="BAJ83277.1"
FT                   /translation="MAHTLIGYARCSTDRQDLAAQRAELEQLGVKPDRIYTDHGLTGTN
FT                   RARPGLAQALAAVRKGDTLVVPKLDRLARSVPDARAIADELITRGVKLALGAAVYDPTD
FT                   PMGKMFFNILATFAEFEADLIRLRTREGMAIARAKGKLRGKRPTLSERQQKELRRMYDT
FT                   GNYSITDLADLFSVSRPTIYRTLARQPANA"
FT   CDS             2270..5236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P6_00050"
FT                   /product="putative Tn3 family transposase for insertion
FT                   sequence element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P6_00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83278"
FT                   /db_xref="GOA:F0J7K1"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7K1"
FT                   /protein_id="BAJ83278.1"
FT                   /translation="MPLRVLLSAEQRARLFSIPTDMASMSRHYVLDAADLAMVRVRRRA
FT                   SNRLGFAVQLCVLRFPGRTLDPSEYPPAPALAFVAEQIGVDPLLFAEYARRAETRREHL
FT                   VELQKFTGLRSFGLDDWRACLHAGADTAWATDRGEPIIQAMLVHLRESRVLLPSATVLE
FT                   RIGLAARVRARKKTFEVLAAGMADAERSALTELLTVDPELRRSRFAWLRDYSESPAPSN
FT                   IVSLLDRLEYVRAMGIDPARAGRIHAARLVRLTDEGALMTVQHIADLEPARRTAILIAQ
FT                   IASLETRLTDATLAMFEKYVGTLFSRARNRDERRFQATRRDVAKALLLFRRTIAALRQA
FT                   KEAGEDGITAIEREIGMNQLEDVLPIIGAVADVADQDILVTAAERYTVLRRFSPRFLAA
FT                   FDFRSNMPNDPVLAAIELLRALNRGAIRSLPKRPPSTFLPPQWRKLIFAGGTADRRLYE
FT                   TAVLAVLRDKLRGSNIWVAGSRDYQAFETYLLPAGAGAATGIDGEADPDRYVASRAEML
FT                   RERLTFVAARAAQGDLDGVEIEDGKLFIARTPPTVPDAARDLALRLNSMLPRVRITEVL
FT                   SEVDAWTGFTDRFVHLRTGNPVTDKAALLAAVLADGTNLGLARMADASRGLSYHHLVNV
FT                   AQWHISDDNYVAARAAIINAHHAHPMAAIWDDGTSSSSDGQYFRAAGRAGAGGSVNAKY
FT                   GIEPGAVIYTHVSGQYGPFHTRVISATMSEAPYVLDGLLHHVHQTDLRIAEHYTDTAGA
FT                   TDHVFGLCHLLGYRFAPRIKDLRDRKLYTIEKPGTWPLLVPLIGDAVETTAILGQWPEL
FT                   MRLKASINAGTVLPSVILRKLAAAGGGNTLSRALRAVGRIERTLFTLQWLSDPALRQRS
FT                   HAGLNKGEASNALRRAVFFHRQGEIRDRTFENQSFRASGLSLITAAIVHWNTIYLDQAV
FT                   QHLRAQGTAVPDDLLAHVAPLGWEHIALTGDYVWNPANPNASFRPLRDVRAPFIPRAA"
FT   repeat_region   5230..5269
FT                   /rpt_type=INVERTED
FT                   /note="perfect 40 bp inverted repeat"
FT   repeat_region   5270..5274
FT                   /rpt_type=FLANKING
FT   repeat_region   5287..5294
FT                   /rpt_type=FLANKING
FT   mobile_element  complement(5295..6374)
FT                   /mobile_element_type="insertion sequence:ISAcr1"
FT   repeat_region   5295..5336
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   CDS             complement(5311..6327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P6_00060"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P6_00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83279"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:F0IZR7"
FT                   /protein_id="BAJ83279.1"
FT                   /translation="MDVLAREDLPFPQSLPEFQRIFPNDAACAAYLESARWNGGFACPR
FT                   CGVVGEPFRFEARPGVLRCRACRKDVSLMAGTVMERSHTPLSTWFWAAYLIASQTPGMS
FT                   AVQFQRQLGLSRYETAFGILHKLRAGMVRPERDKIGDTPQEHVEVDETWVGGRTRGDGR
FT                   GVHHKVLVACAVEVRHRKPGTKLDNRKDGRYAGRVRLAVVPDRSANSLCGFVENAVAPG
FT                   SLIVTDDWSGYAGLGRRGFDHHAIAECGDPEVAEEFLPIVHLVFTNLKTWINGIHHGVS
FT                   AKHLQAYLNEFTFRFNRRLYPFNAFRSLLGIAGRAAAPTFDELYSGEWTHPTFSGCG"
FT   repeat_region   6333..6374
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   repeat_region   6375..6382
FT                   /rpt_type=FLANKING
FT   CDS             complement(6851..7507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P6_00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P6_00070"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83280"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:F0J863"
FT                   /protein_id="BAJ83280.1"
FT                   /translation="MKRFLLASLLGLGALTACSGVALAGPEYSLALSESGYSTASVVPS
FT                   TSSAQYSGTYGTFSVNLVSTTGVPSIGNAYNTSSINTSSNSAGVLTVEATVTGLTSPLG
FT                   TYDMLSGLTSNLLTGGALSVAETTYLDPANVAFGMTDKLASNTFTSIGNDNVLATTPAL
FT                   TGPYSLTEMFVVTATGTGSANSTISMTDVPEPGSLILLGTGLLGLGLIVRRQKRG"
FT   CDS             complement(7918..8115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P6_00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P6_00080"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83281"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:F0J864"
FT                   /protein_id="BAJ83281.1"
FT                   /translation="MITTSYDPEADALYVRFAPKGAAIAETRELEPGILLDVDETGHLV
FT                   GIEVLSVRSRATLPAIPHAA"
FT   CDS             complement(8132..8410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P6_00090"
FT                   /product="plasmid stabilisation system family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P6_00090"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83282"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="UniProtKB/TrEMBL:F0J865"
FT                   /protein_id="BAJ83282.1"
FT                   /translation="MPVIFTAEALDDLAHIRQHIGRENPHAATRVAVQLVAACDRLEYL
FT                   PERGRPGLVSGTRELTVIWPYVIVYRISASSVEILRVWHGAQDRDGC"
FT   CDS             complement(8401..8577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P6_00100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P6_00100"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83283"
FT                   /db_xref="UniProtKB/TrEMBL:F0J866"
FT                   /protein_id="BAJ83283.1"
FT                   /translation="MIPNPTPMPDDPDTEAFVAAVKDGIASADAGRTVPYEDVRKWLLS
FT                   WGTENELPKPECR"
FT   CDS             complement(8574..9299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P6_00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P6_00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83284"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J867"
FT                   /protein_id="BAJ83284.1"
FT                   /translation="MAVSVLELRRRGYSEDDIALARVTQDAHRRAGAPYRSLTEILAGQ
FT                   PARPRPSAPVEDLTVRQLRRRGSYGQAALIADQAALAEKDPDRAAQARYHAQGLKTLAQ
FT                   MPHQLEFDFFGGGNVSLGHQFIDTVQSRLLQSDATSAEQDAAMATLLLIVRHLGWQSYT
FT                   CEKTATDLAEMRGKKKQAMAETLALLEKVGAISRVKRGRTKVITVTPEGAFRGDVNRHA
FT                   EAVDRYRAEVVQLRPEPAE"
FT   CDS             complement(9757..10041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P6_00120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P6_00120"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83285"
FT                   /db_xref="UniProtKB/TrEMBL:F0J868"
FT                   /protein_id="BAJ83285.1"
FT                   /translation="MASNLDARIEAARKKAEQATARLQALEAKANAEARKLDTRRKVIL
FT                   GALLIDEAEKDERFARALIALLERISRDQDRKAFEGWPPPSPSQTASEP"
FT   CDS             complement(10031..10225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P6_00130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P6_00130"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83286"
FT                   /db_xref="GOA:F0J869"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:F0J869"
FT                   /protein_id="BAJ83286.1"
FT                   /translation="MRILLALLLPWLQFFTIGRPFAGLFCLLLQLTIIGWIPAAIWSVY
FT                   ALSQYKTDSKIRNALKHGK"
FT   CDS             10344..12056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P6_00140"
FT                   /product="MobA/MobL family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P6_00140"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83287"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:F0J870"
FT                   /protein_id="BAJ83287.1"
FT                   /translation="MRAVLAGQTTEGGRWHVASYHLSAKAVSRSTGRSAVGAAAYRSGE
FT                   RLTNERDGVTHDYTRKRGVLSSFIVAPAGAEAWASDRSGLWNRAEAAEARKDAKVAREY
FT                   ELALPAELSALEREALARQFAQVVVERFGVVADVALHAPHREGDQRNWHAHILTTTRAA
FT                   NENGLGAKTRVLDSPKTSAAEIEALREIWAEQINAALERAHVGERVDHRSFARRGLEQA
FT                   PTVHLGPAATALERRGVQTGLGDVNRAVAATEEAREAVRQVEAEVIDLEAERERRADVA
FT                   QQTHWRSLPLRELQWEVNTLWPDREAALATARMANPAYREAAEAAETAEAGVAKARLNL
FT                   LEATETERSLKQKAERYRGNQGVLGRVRFWLQDKGVLEIPEWKRLQDQISETQKLAEKW
FT                   KDDLATAEELNAKAKIAFNEVDSAIAGTVDEILAPELRRYEAARSVLDERIEEDRRRAA
FT                   EAEAERRAEEIRQRVDAEIERELREAAEQRRRAETAELRQVVHDLDTITPNGRGGYRFA
FT                   FVRGLDQQEKERREAILYADKEKTKEVLKEELQERQLQAKREQDRDLGYDMEP"
XX
SQ   Sequence 12125 BP; 2504 A; 3404 C; 3820 G; 2397 T; 0 other;
     atgatccttg gtgttctgaa tcaaaagggt ggcgttggga aaacaaccct atccgtgaac        60
     ttagcggcga gtctggcgag ggccggcagg cgggtgttgt tgatcgatgc cgatccgcag       120
     ggaagtgcgc ttgattgggc tgcggctcgc caggaggggc cgcttttttc ggtcgtagga       180
     tttcccaggc cgacgattca tcgcgagatc gcacagatcg gcaacgggta cgatcatatc       240
     gtgatcgatg ggccgccccg tgtcactgac ctcgcacgtt cagcgatcat ggcaagcgac       300
     ctggttctaa tccccgtcca gccatcacct tacgacgtgt gggctgctga ggaggtcgtg       360
     aaactgatcg aagaagcacg ggtctacaaa gaaagtatca aatgttcttt tgtagttaat       420
     cgtaaaatcg caaatacggc gattgggcgt gacgttggcg aagctctgtc ggcctatccg       480
     gtgtcggtat tgtccgcgag catcacgcag cgtgtggtgt ttgcagaagc tgcggggcaa       540
     gggatggccg tgcatgaagt tgagccaggt gggccggcag cggccgagat cgaggccgtg       600
     acggctgagc tgatggagtt ggcacgatga acaagaaagt ctcttttggt gtcagaccaa       660
     gcgtgacacg cacatccgag cttgatgctg aggcgtgggt ggccgaccgt gcgaccgatg       720
     aacgggaacc tatgaagcgg cttacgatcg atattccggc acacctgcac cgagctatca       780
     aaacgcaatg tgcgagccgt ggtactaaga ttgctgacga attgcgcgag ttacttttac       840
     agaaatacgg aaaatcgtaa attatacgct tgcttcaata acgggaacgc cgctgcaccg       900
     gacttctgca cctgaaattc ctgcttccgg cctatgggtc gggtgtggtg cgaaattcgt       960
     gatttgtgaa ccccacccca agcggcagta agctctacct ctatcagagg tatcgtttgg      1020
     agagtttgcg ccgcccgacc aaaccaagac cgacaaggcc agtgccgagc agaagaaggg      1080
     agccgggttc gggtacgggt gtacccgatg tcggcgtcag ggtttctgaa ataagatcat      1140
     aatgattctt tgtcccatcc cagttaatct taaaatccgg actatatcca gaaaatgtcc      1200
     cagacaacaa tgtaacattg aatacataat taatgcttgt attggccggc aataccgggc      1260
     cggtcggggc tgtgtcggcc atgaagcagt aaaaatttcc agttccatta cagccgtttg      1320
     cggctagacc tcctattgat tctgtgaatc ctgacggggc cagagcactc gcaaaatttg      1380
     atggctggtt gaaagcaaaa gactgtacgc catagcgccc accttctgta tcggaagggc      1440
     catttatgcc tgcgatatta agggtgaact gatccgttaa gggggtcacc gcacgatctg      1500
     ttcaaaatcg tacgctaagc gttggcgggc tgcctggcga gggtacgata gatggttggg      1560
     cgggagacgg agaataggtc tgcgagatca gtgatggaat aattgccagt gtcgtacatg      1620
     cggcgcagtt ctttttgttg tctttcggat agcgtcggcc ttttgccgcg taattttcct      1680
     ttggcgcgag cgatggccat gccttctctg gtacgtaacc ggatcaggtc ggcctcaaac      1740
     tctgcgaagg tggcgagaat gttgaagaac atcttcccca ttgggtcggt tgggtcatag      1800
     acggccgcgc cgagcgcgag tttgacaccg cgggtaatga gttcatcggc gatcgcacgg      1860
     gcatctggaa cggagcgtgc aaggcggtcg agttttggca cgaccagggt gtcgccttta      1920
     cgcaccgccg ccaaggcttg agcaagcccg gggcgggcac gattggtgcc tgtgaggcca      1980
     tggtccgtat agatgcggtc cggctttacc ccgagctgtt cgagttcggc gcgttgcgcg      2040
     gcgagatctt gccggtcggt tgaacagcgg gcgtaaccga tcagggtgtg ggccatgcgg      2100
     aattgtaacg tatgaccccc cttcattgca aaagatatcg taccagttaa atgatccatc      2160
     cgttgccgag ggaaacagcc accagtgcca ggccgttaca tctgtccgtt gaacgatcct      2220
     cttgcggacg cacggtgggc gctaattttc tcatcaaccg gaacccgata tgccactccg      2280
     cgttctttta tccgctgaac aacgagcccg tttgttttca attccaacgg acatggcctc      2340
     catgagccgg cattacgtac tggatgctgc tgacctcgct atggtcaggg tcagacgccg      2400
     ggcaagcaac cggctcggct ttgccgtgca actctgtgtt ctccgcttcc caggccgcac      2460
     tctggatcca tcggaatatc caccggcgcc ggcgctggct tttgttgctg aacagatcgg      2520
     tgtcgatcct ttgttgtttg cggaatacgc gcgccgtgct gaaacccgtc gggagcattt      2580
     ggtcgagctc caaaagttca ctggtctgcg tagttttggc ctcgatgact ggcgcgcctg      2640
     cctacatgct ggtgcggata cggcttgggc cacagatcgc ggcgaaccca tcatccaggc      2700
     tatgctcgtt catctgagag aaagccgggt attgcttccc tcggcgacag tgttggagcg      2760
     aattggactg gccgcccgtg tccgagcacg caagaaaaca ttcgaggtgc tggcagccgg      2820
     gatggccgat gcggagcgca gtgctctgac cgagctgctg acggtcgatc ccgagttgcg      2880
     tcgctcccgt tttgcctggc tgcgggatta ttcggaatca ccagctccct ccaacatcgt      2940
     ctccctgctc gatcgcctcg aatatgtccg cgccatgggc attgatcccg cacgggctgg      3000
     tcgtatccat gctgcccgcc tggtccggct gaccgacgag ggggcgctca tgaccgtgca      3060
     gcacatcgcc gatctggagc cggcgcggcg cacagccatt ctcattgccc agatcgcaag      3120
     cctggaaacc cgtctgacgg acgcgacgct tgccatgttc gagaaatatg tcggcacttt      3180
     gttcagccgg gcgcgcaacc gcgatgagcg tcggtttcag gccacgcggc gcgatgtcgc      3240
     caaggcgcta ctgctgttcc gccggacgat cgccgccctt cgccaggcga aggaggccgg      3300
     agaagatggg atcaccgcca tcgagcgcga gatcggcatg aaccagctcg aagatgtgct      3360
     gccgatcatc ggcgccgtcg ccgatgtggc ggatcaggat attttggtca cggcggccga      3420
     gcgatatacg gtgctccgcc ggttcagccc ccgcttcctg gccgccttcg atttccggtc      3480
     gaatatgccg aacgatcccg ttctggccgc gatcgaactt ctccgcgccc tgaaccgtgg      3540
     cgcgatccgc agcttgccca agcggccgcc ctccacgttc ctgccgccgc agtggcggaa      3600
     attgattttt gccggcggca cagccgaccg gcggctctat gaaacagcgg tgctggccgt      3660
     gctgcgcgac aagctgcggg gcagtaatat ctgggtcgct ggcagccgcg attaccaggc      3720
     gttcgagacc tatctgcttc cggccggggc gggtgcggcc accggcatcg atggtgaggc      3780
     cgatcccgat cgttacgtcg caagccgggc agagatgctg cgcgagcgtc tgaccttcgt      3840
     ggccgcccgg gccgcgcagg gcgacctcga cggggtggag attgaggacg gcaaactttt      3900
     tatcgcccgc acgccgccca ccgtgcccga cgcggctcgc gatctggcgc tgcggctgaa      3960
     cagtatgctg ccgcgggtgc ggatcaccga ggttttgagc gaggtcgatg cctggaccgg      4020
     gttcacggac aggttcgtgc atctgcgcac cggtaacccc gtcaccgaca aagcggccct      4080
     gctggcagcg gtgctcgctg acggcaccaa tcttggcctt gcccgcatgg cggacgcctc      4140
     gcgcggtctc agctatcacc acctggtcaa tgtggcccaa tggcacatca gcgatgacaa      4200
     ttatgtcgcc gcccgcgccg ccatcatcaa tgcgcaccat gcacacccca tggcggcaat      4260
     ctgggatgat gggacaagct cgtcttcgga cgggcaatat ttccgggccg caggccgcgc      4320
     cggagccggc ggctcggtaa acgccaaata cggcatcgag ccgggcgcgg tgatctacac      4380
     ccatgtttcc ggtcaatacg gaccgttcca cacgcgcgtc atctccgcga cgatgagcga      4440
     ggcgccttat gtgctcgacg ggctgctgca tcatgtccac cagaccgatc tgcgcatcgc      4500
     cgagcattat accgataccg ccggcgcgac cgatcatgtc ttcggtctct gccatctgct      4560
     gggttacagg tttgccccca ggatcaagga tctccgggac cgcaagctct acacgataga      4620
     aaagccaggc acctggccgc tgctggtgcc gctcatcggc gacgccgtcg aaaccaccgc      4680
     catcctcggg caatggccgg agttgatgcg gttaaaggca tccatcaatg ccggcactgt      4740
     tctgccttcc gtcatcttgc ggaagctggc cgccgccggt ggaggaaaca ctctgtccag      4800
     ggcgttacgg gctgtggggc ggatcgagcg caccctgttc accctgcaat ggctgtccga      4860
     tcccgctctg cgccagcgca gtcatgccgg gctcaataag ggcgaggcca gcaatgccct      4920
     gcgccgcgcc gtattcttcc atcgccaggg tgaaatccgc gaccgcacct tcgaaaatca      4980
     gagcttccgg gcctccgggc tcagtctcat caccgccgcc atcgtccact ggaataccat      5040
     ctatctcgac caggccgtcc agcacctgcg ggcccagggt acggcagtgc ccgatgatct      5100
     cctggcgcat gtcgcgccgc tcggatggga acacatcgct ctgaccggcg attatgtctg      5160
     gaatcccgcc aatcccaatg ccagcttcag gccgctacgc gatgttcgcg ctccgttcat      5220
     accccgcgcc gcttagcgta cgattttgaa cagatcgtgc ggtgacccct taagggattg      5280
     gctgtcgctg attccttgcc tatccggttg ttacccacac ccactaaatg tagggtgtgt      5340
     ccattccccg gaataaagct cgtcaaaggt tggtgcggct gccctacccg cgattccgag      5400
     cagcgagcgg aacgcgttga agggatagag gcgccggttg aaccgaaacg tgaattcatt      5460
     gaggtaggct tgtagatgtt tggcgctgac cccgtgatgg atgccgttga tccaggtctt      5520
     caggttggta aagaccaagt ggacgatcgg caggaattct tctgccacct ccgggtcgcc      5580
     gcattcggcg attgcatggt ggtcgaaccc gcgccttccg agaccggcat agccgctcca      5640
     gtcgtcggta acgatcagcg atccgggagc aacggcgttt tcgacgaatc cgcagagcga      5700
     attggcgcta cggtcgggga caacagcgag acgaacgcgt cccgcgtagc gaccgtcttt      5760
     ccgattgtcg agcttggttc ccggtttccg gtggcgcacc tccacggcac aggcgacgag      5820
     aaccttgtga tggacacccc gtccatcgcc tcgggttcgt cctccaaccc acgtttcatc      5880
     cacttcgacg tgttcttgcg gcgtgtcgcc aatcttgtcg cgctcggggc gcaccatccc      5940
     ggcgcgcagc ttatgaagga tgccgaaggc ggtctcgtag cgcgacaggc cgagttgccg      6000
     ctgaaattgg acggccgaca ttccgggcgt ctggctggcg atcaagtaag ccgcccagaa      6060
     ccaagtcgac agcggcgtgt gactgcgttc cataacggtc ccagccatca ggcttacgtc      6120
     tttgcgacag gcccggcagc gcagaacgcc cgggcgcgcc tcgaaacgga acggctcgcc      6180
     aacgacgccg caccttgggc aggcgaaccc tccattccag cgggcgcttt cgagataggc      6240
     ggcacaggcc gcgtcgttcg ggaaaatacg ctggaattcc ggcagagact gcgggaacgg      6300
     caggtcttca cgggccagga catccatgcc caacactaga tctagtaggt atgggagtca      6360
     accggatagg caaggctgat tcggtcagcg tataggtgag gccatcggcg atcaggctgg      6420
     cgcgagcgcc tgcggttgta agtcccagga tgacgacagc gctggcaaca tggcgaaatt      6480
     tcaacatgaa cgtccctttc gaaaggctgg cgttgactga cgcggtcggt tcatttcggt      6540
     tcggctgctt tacgcagggg aggcgccgat tttggccgca aaatagaaca agcaattccc      6600
     atgccgagct aaataagctc gtaaaatcaa tgactaaaat attttagaca agcgagatgt      6660
     aaaatatact gacactactt ttggtcgagt cataaataaa aaatatcttt ggttgtataa      6720
     attgggcgaa tagccgtaat gccagaattc cggaattttg aaacaccttt ggccagcggt      6780
     cgaaatgaac cgctggccat ggtccatgag gtggattatt cggtgcgagg ctttcgcaag      6840
     atcttcacgg tcagccgcgc ttctgccgcc gaacgatcag gccaaggccg agaaggccgg      6900
     tgccgagcag aatcagggag cccggttccg gaacgtcggt catgctaatc gtcgagttgg      6960
     cagaacccgt tcccgtcgca gtcacaacga acatttcggt caacgagtag ggaccggtca      7020
     gcgcgggtgt cgtggcaagc acattgtcgt tgccgattga cgtgaaggta ttggaggcga      7080
     gtttatcggt catcccgaat gcaacgttgg ctggatcgag gtaggtcgtt tcagccacag      7140
     aaagagcgcc gccggtcagc aggttgctcg tcagcccgct caacatgtca taggtaccga      7200
     gcggagaggt cagacccgtc actgtggcct cgaccgtcaa aaccccagca ctgttcgagg      7260
     acgtgttgat cgaggacgtg ttgtaagcgt ttccgatgga cggaaccccc gttgtggaca      7320
     ccaaattgac cgaaaaggtt ccgtaagtac ccgaatactg tgcgctcgag gtggatggga      7380
     cgaccgaggc tgtcgagtag ccgctttcgg acagcgccag tgagtattcg gggcctgcca      7440
     aggcgactcc cgaacaggcg gtaagcgcac caagcccaag cagtgaagcc aaaagaaaac      7500
     gtttcattag aaaaacctcc aaaagtaggc cttaaaacta ataagcaaat tttatgccaa      7560
     tataatttat gtattagaat caacgatgaa aaaatgcgtc ttggcggaag tgtaaagaat      7620
     cctgacaggt gattgcgagt tttggggata ttggtgcgac atgtgcgaca gcgcggacac      7680
     caaccggccg cagcaggtag gaagcgtgac tgtctgtcgg tgagccagaa ttccgcatta      7740
     tggaacttcc cggcaaatca ccgggaagtc gtcagatagt cgccgcccgg cacggcaccc      7800
     gaagccagag taaccccgga acagggactg tcaaagcacc ccgccacagg cgcgccagga      7860
     cgccgcgaat acttggattg aagcactggc agcgatcaca aaaccgcttc cgaaacgtca      7920
     ggccgcgtgg ggaattgccg ggagcgttgc ccgtgaccgc acactcagaa cctcgatccc      7980
     gaccaggtgg ccggtctcgt ccacatccag caggatgcca ggctccagct ccctggtctc      8040
     ggcaatcgct gctcccttag gggcgaaccg gacatagagc gcatccgcct cggggtcata      8100
     gctggtcgtg atcatggtct ggctcagcat ctcagcaccc atcccggtcc tgcgccccat      8160
     gccagacacg gaggatttca acgctcgagg cggaaatccg atagacgatc acgtagggcc      8220
     agatcaccgt cagctcccgc gtcccggaaa ccaagccagg ccggccgcgc tcgggcagat      8280
     attcgagccg gtcacaagcc gcgacgagct gcaccgcgac gcgcgtggct gcgtgagggt      8340
     tctcgcggcc gatgtgctgg cgaatatggg cgaggtcatc gagtgcctcg gccgtgaaga      8400
     ttaccggcat tcaggcttgg gcaactcgtt ctcggttccc caggagagta gccatttccg      8460
     cacatcttcg tagggcactg tgcggccggc gtcggcagac gcaatcccgt ccttgaccgc      8520
     ggcaacgaag gcttcggtat ccgggtcatc cggcatgggg gtgggatttg ggatcattcg      8580
     gcgggctccg ggcgtagctg gacgacttcg gcgcggtagc gatcgaccgc ctcggcgtgg      8640
     cggttcacat cgccacggaa cgcaccttct ggcgtcaccg tgatgacttt ggtccgtcct      8700
     cgtttcacgc ggctgatcgc acctaccttc tcaagcaggg caagggtttc agccattgct      8760
     tgtttctttt tcccgcgcat ctcggcgaga tcggtggccg tcttctcgca ggtgtaggac      8820
     tgccagccga gatggcggac gatcagcaac aacgtcgcca tcgcggcatc ctgttcggcc      8880
     gatgtggcgt cgctctgcag gagcctcgat tggaccgtat cgatgaattg atggcctagg      8940
     ctcacgttgc cgcctccgaa gaagtcgaac tctagctgat gtggcatttg cgccagggtt      9000
     ttcagcccct gggcatgata gcgcgcttgg gcggccctgt cggggtcttt ttcggcaaga      9060
     gcggcctgat cagcgatcag tgccgcctgg ccgtagctgc cgcgccggcg caattggcgg      9120
     acagtcaggt cctcgaccgg ggctgaaggg cgagggcggg ccggttggcc ggcaaggatc      9180
     tcggtgaggc tgcgataggg cgcgccggcc cggcgatggg cgtcctgggt aacacgggcg      9240
     agggcgatat cgtcctccga gtagccgcgt cgccgcagtt caagaaccga aacagccatg      9300
     aacgtcaccc ccaacagtca actggtgctt gactacagtc aactggtgct tgacgattgt      9360
     caagctgatt catgggaatg gcgggagaaa aaatggcgga aaacctaggt aaatcgccaa      9420
     agataggaca gttttattgc cacgaccttc cggccatatc caaacctaga aagaagatat      9480
     agcgggaggg ttccgagtcg gggtcaaaaa cctgccaggt tggggtatcg caaggataaa      9540
     agcggcttag gggagctgag gacgaagttc agggcaaagg ccgcatgaca tgggcttggc      9600
     aagcgtcgtg tctgcccgag gtataggctg tgaacagcat gccggacgcg aataggattg      9660
     ctcctgcggt caggcagatc aaggcgaccc aatgaggcgc gacatagcgt gtatgggtta      9720
     atggtgtttc ctcgaagaac ctcattctgt cgtcctctac ggttcagatg cggtctggct      9780
     gggggatgga ggcggccatc cctcgaacgc cttgcggtcc tgatcgcggc tgatccgttc      9840
     caaaagagcg ataagcgccc tcgcgaaccg ctcatccttc tcggcttcat cgatgagcag      9900
     agcacctagg atcaccttgc ggcgggtatc cagcttgcgg gcctcagcat tggccttggc      9960
     ttcgagggcc tgaagacggg ccgtggcttg ttcagccttt ttgcgggcgg cctcgatcct     10020
     ggcgtcgaga ttacttgcca tgcttcagcg cgttcctgat cttcgagtcg gtcttgtact     10080
     ggctgagtgc atagaccgac cagatagcag ccgggatcca tccgatgatg gtgagttgca     10140
     gaagtaagca gaacaatccg gcgaatggtc tgcctatggt gaaaaactga agccaaggca     10200
     gaagcagggc gagtaagatg cgcattctga tctccgtttg gcgtgaagtt atatggcagc     10260
     gtagctgggt tgacgactga tgccaagcgg tgagacactt ccgaataagt gaggaagtgc     10320
     gcactttagc attgcctgcg gcaatgcgtg cggtcctcgc cggacagaca acagaaggcg     10380
     gtcgttggca cgtggcgtca taccatctct cagcgaaggc ggtcagccgt tcgaccgggc     10440
     ggagcgcggt cggtgctgcc gcctatcgga gcggtgaacg cctgaccaac gagcgcgacg     10500
     gtgtgacgca cgactacacg cgcaagcgtg gcgtgctgtc gtcgttcatc gtcgcgcctg     10560
     ccggtgccga agcatgggct tctgaccggt ccggtctgtg gaaccgggcg gaggccgcgg     10620
     aagcccggaa ggacgccaag gtggcgcggg aatacgagct tgccctgccg gcggagcttt     10680
     ccgccctcga gcgggaagcg ctggcccggc agtttgcgca agtcgtggtg gagcggtttg     10740
     gggtggtggc ggacgtggcg ttgcacgcgc ctcaccgtga gggcgaccag cggaactggc     10800
     acgctcacat cctgaccact acgcgggcgg cgaatgagaa cgggctgggg gccaagacgc     10860
     gggttctgga cagccccaag acctctgcgg ccgagatcga ggcgctgcgg gagatatggg     10920
     cggagcagat taatgccgcc ctggagcggg cgcatgtggg ggaacgggtg gatcaccgta     10980
     gcttcgccag gcgcgggctt gaacaggctc ctacagtgca tcttgggcct gccgcgacgg     11040
     cgcttgagcg gcgcggggtt cagacgggcc ttggtgacgt gaaccgggct gtagcggcca     11100
     ctgaggaggc gcgggaggcg gttcggcagg tcgaggcaga ggtgatcgac cttgaggccg     11160
     agcgggaacg gcgggctgat gtcgcacagc agacgcactg gcgaagcctg cctctgagag     11220
     aactccaatg ggaggtgaac acgctatggc ccgaccggga ggcggcgctg gcgacggccc     11280
     ggatggcgaa cccggcgtat cgtgaagcgg cagaagcggc tgagaccgct gaggctgggg     11340
     tagcgaaggc ccggctgaat ctgcttgagg ccaccgagac agagcggagt ctgaagcaaa     11400
     aagccgagag ataccgggga aatcaggggg tgttggggcg agttaggttc tggcttcagg     11460
     acaaaggggt tctggaaatc cctgaatgga agcggcttca ggatcagatc tccgaaacgc     11520
     aaaagttggc cgaaaaatgg aaagacgatc tagccaccgc agaggaactg aacgccaagg     11580
     ccaagatcgc cttcaatgag gtggatagcg cgatagctgg gactgtcgat gaaattctgg     11640
     cgccagaatt gaggcggtat gaggcggctc gatctgtgct cgatgagcgg atcgaggaag     11700
     accgccgacg tgccgccgaa gctgaggcag agcgccgcgc cgaggaaata cggcagagag     11760
     tggatgccga gattgagcgc gagctgcgcg aggctgccga gcagaggcga cgggcggaaa     11820
     ccgcagaact ccgccaagtt gtgcatgatt tggacacgat cacaccgaat ggtcgcgggg     11880
     gatatcgctt cgcctttgtg cgtgggctgg accagcaaga gaaggagcgg cgtgaggcga     11940
     tcctgtacgc tgacaaggaa aagacgaagg aagtcctcaa ggaggagcta caggagcgcc     12000
     agttgcaggc caagcgagaa caggaccgag atcttggcta cgatatggag ccgtaatgct     12060
     agtgaatttg ctatatttgt aaatttctgt aaaatcacaa aacaacaaat catcaaaatg     12120
     gaatc                                                                 12125
//