Dbfetch

ID   AP012040; SV 1; circular; genomic DNA; STD; PRO; 14328 BP.
XX
AC   AP012040;
XX
PR   Project:PRJDA60101;
XX
DT   02-MAR-2011 (Rel. 108, Created)
DT   28-SEP-2016 (Rel. 130, Last updated, Version 3)
XX
DE   Acidiphilium multivorum AIU301 plasmid pACMV5 DNA, complete sequence.
XX
KW   .
XX
OS   Acidiphilium multivorum AIU301
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acidiphilium.
OG   Plasmid pACMV5
XX
RN   [1]
RP   1-14328
RA   Hosoyama A., Yamada R., Ito N., Takarada H., Narita-Yamada S., Nakamura S.,
RA   Katano Y., Ichikawa N., Nakazawa H., Fujita N.;
RT   ;
RL   Submitted (28-DEC-2010) to the INSDC.
RL   Contact:Director-General Department of Biotechnology National Institute of
RL   Technology and Evaluation, NITE Bioresource Information Center (NBIC),
RL   Department of Biotechnology; 2-49-10 Nishihara, Shibuya-ku, Tokyo 151-0066,
RL   Japan URL    :http://www.bio.nite.go.jp/
XX
RN   [2]
RA   Narita-Yamada S., Nakamura S., Ito N., Takarada H., Katano Y., Nakazawa H.,
RA   Hosoyama A., Yamada R., Fujita N.;
RT   "Whole genome sequence of Acidiphilium multivorum AIU301.";
RL   Unpublished.
XX
DR   MD5; 5d8deb0aedee9becfb2671498fc8373b.
DR   BioSample; SAMD00060977.
XX
CC   ##Genome-Assembly-Data-START##
CC   Genome Coverage       :: 8x
CC   Sequencing Technology :: ABI3730
CC   ##Genome-Assembly-Data-END##
CC   Please visit our web site.
CC   URL:http://www.bio.nite.go.jp/
CC   DOGAN ; Database of Genomes Analyzed at NITE
CC   The database contains genome sequence data, physical maps
CC   and the genomic and proteomic data of the microorganisms
CC   analyzed.
CC   URL:http://www.bio.nite.go.jp/dogan/Top
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..14328
FT                   /organism="Acidiphilium multivorum AIU301"
FT                   /plasmid="pACMV5"
FT                   /strain="AIU301"
FT                   /mol_type="genomic DNA"
FT                   /note="strain coidentity: NBRC 100883"
FT                   /db_xref="taxon:926570"
FT   CDS             1..1335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P5_00010"
FT                   /product="replication protein C"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P5_00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83255"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="UniProtKB/TrEMBL:F0J838"
FT                   /protein_id="BAJ83255.1"
FT                   /translation="MQTENAFGASRPSGAKCPSGLRKLSLAMLNTERVGEAFGGLPDKA
FT                   LPGRVLAAFKAAAPALGYSGRVVHAVDWLFSFTQAQDWTEGSRPIVWPSAALQQQALGI
FT                   GSTQAKTLNRHLVELGLVSMKDSPNGKRYGRRDPHGRIVEAYGFDLSPLAVRMAEFQAV
FT                   AEKARAEREEMRRLRRRATIAVRGLAQVLETAAEIGLAGPEWGRLGQEAHALARVLKRI
FT                   ERIDELALGVAGLERRHAEAKKRLADATIPPQEAHCETVQTDPKGPENRPHQYNYKLNP
FT                   NPCQDTVMALSECRSGSGAVTSRQPSVPSERFKKGPNRSARKDSGPVMRLTTDELVCLA
FT                   PRLRPYLRSPSPTWPDIVEAADWLRHDLGVSKPLWGEACLAMGREQAAIALAIVSMKPE
FT                   GHFTSTPGGYFNGMVTRARGGTLNLTRTIWGLKTNQDRARRSKGH"
FT   CDS             1570..2169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="ACMV_P5_00020"
FT                   /product="putative partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P5_00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83256"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J839"
FT                   /protein_id="BAJ83256.1"
FT                   /translation="MFVTVASYKGGVGKTTTAVHLAAYLQTLSSTLLIDGDPNRSATAW
FT                   GRRGGFPFQTVDEKEGAYQARNFQHIVIDTEARPGSADFEALAKGCDLLVIPTVPASLD
FT                   TDALILTLQAARKLAPNKYRVLMTKVPPPPETDGPQLRAVLLREEIPVFTAEIPRLKSF
FT                   ERAAAEGVPVYGVQHDPRAKRAWEAYQAAGKEMTDG"
FT   CDS             2162..2473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P5_00030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P5_00030"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83257"
FT                   /db_xref="UniProtKB/TrEMBL:F0J840"
FT                   /protein_id="BAJ83257.1"
FT                   /translation="MAKATESKFAGIFQNATPAASPAEPAPERAELPVPSVAVRSLGRP
FT                   HGKRSDPAWKQFSVLLRRQTQRDAVMILRAGQGENENCDLSDLLQELLEQWVSQQRRS"
FT   CDS             complement(2773..3204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P5_00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P5_00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83258"
FT                   /db_xref="UniProtKB/TrEMBL:F0J841"
FT                   /protein_id="BAJ83258.1"
FT                   /translation="MSGNQIKMRGVARMAFRAVRNDVAAEIEAGSTVKLSWLKHFGDQP
FT                   TPTVSYTHFAGLVAREITGKVGSRGGRATAKLSSPHEASVLDQPAAVPLPNPQPALSPE
FT                   KRQQPNDSQSQVRQQPKRIVTRVPDIERILYGSKGKLKE"
FT   CDS             complement(3368..3520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P5_00050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P5_00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83259"
FT                   /db_xref="UniProtKB/TrEMBL:F0J842"
FT                   /protein_id="BAJ83259.1"
FT                   /translation="MASPLRPKTRRAHPAPASSHRRVSTAPPLQAALYPSAFALQMHIL
FT                   PKKDK"
FT   CDS             3610..3960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P5_00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P5_00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83260"
FT                   /db_xref="UniProtKB/TrEMBL:F0J843"
FT                   /protein_id="BAJ83260.1"
FT                   /translation="MRRARATRESRSVQLAVRYTPGEWEQIEARAAAAGLGVTDYVRVA
FT                   AVHAAINSKVDKAAIVALERQGAVLRGLLERLEAIRSQLLRGSGPSPQTVERVVAEIRQ
FT                   GLVGLSEAVKRL"
FT   CDS             3957..6080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P5_00070"
FT                   /product="relaxase/mobilization nuclease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P5_00070"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83261"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:F0J844"
FT                   /protein_id="BAJ83261.1"
FT                   /translation="MIVRRVPPKVTRAGGFRQLARYVTAAMVPGQGEAGRAGDGVAAGS
FT                   GGRRGPQGARGLGAYLGDQVRHGDRVVWVRITNCALADDLEAAIKVMDATQAMNTRVKA
FT                   DANYHLVVAFPPGEQPERQQIEAIEDRLVGGLGLSAHQRISALHGDKEHLHLHVAINLI
FT                   HPETFKAAHFFRDHERLAVMAAELEVEHGLTRTNHGLPEPGRARELDAAATMRAHTGEE
FT                   PFIDWVKRVAGPDLLEAGREDRGGWPALHVAAARHGLEVRPRGAGLVIGKRGEPALMMR
FT                   ASDLDRSMSFGRLTDRLGVYQPAGAAVAAIVPESIYERTVRPEHRGEPGLWDRYVVERD
FT                   GARAGRREAVEAQIAAERAYRAKIAAHYAAKFGEIKRLKVTIGIDPRIRYDALKREQRA
FT                   LLDRHRRESLAVRERIRAEHPPTPGWPDWLRREAEGGDRVALAALRQTAEQQGRREQVV
FT                   ALMIRVPERLVEPKPTLGVQARVGRHGDRTWRMWDGGVVLDTKEGVALVTLSPEAARLA
FT                   LDLAHRRADGAPLEIGADDRLRSSLLEAAVTNRMEIRFADPVLEAERDQRIRALDEAEG
FT                   WTAPDRRAGTIMMFASHRNAWPEPGDQCFYRGLEPEDRGAVQFVGTMRLRGADIALWQQ
FT                   GSLIMVQDISEHRMPLVRTLAPGQEIDLAAVHRAAAREADMTSEIDRSDGAGSETERGH
FT                   EAEPERDLGFEMD"
FT   CDS             complement(6208..6546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P5_00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P5_00080"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83262"
FT                   /db_xref="UniProtKB/TrEMBL:F0J845"
FT                   /protein_id="BAJ83262.1"
FT                   /translation="MIRIPISWLEWGARHNLWSRPHFLCREVSEAPLDEEMMPNLVYDE
FT                   VRGGHRKWAHMLCPRCSEHIQLQTAAGSNWKITCDWLHRPTVQPSIWETEGCGAHFFVR
FT                   KGRLIWCP"
FT   CDS             complement(6543..7946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P5_00090"
FT                   /product="ThiF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P5_00090"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83263"
FT                   /db_xref="GOA:F0J846"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="UniProtKB/TrEMBL:F0J846"
FT                   /protein_id="BAJ83263.1"
FT                   /translation="MTQFALRLLAEQRDRIADLLFKDDSERAVLALCGRSRVKDPWSGE
FT                   VDERFLVREIIEVPEDAYEARSPDGFTWSTTPFFNALKLAEAKDFAVAVFHAHPAGQLK
FT                   FSGADDIAEHDLFQIAFNRLDSDRPHLSVIMDRTKDLAARVYGPDLKPQAASRIMVIGK
FT                   RWQSWLSGPAAIAPVELDRQARAFGTASSAQIAGLKIGLVGCGGTGSAIAMLLARIGVR
FT                   KLALLDDDIVEDTNLNRLHFATRIDASLRRKKVDVVGEGAAAIGLPISIIRVPDFADRP
FT                   AGLAILKACDVVFGCTDDDLGREVLNRLAHFYFIPVIDVGLLIEPNANGGYDIFDGRVT
FT                   VVQPGYPCQSCRGLISNDQVYQDSLRRDPELQEARRRAGYVPNDPDPSPVVVTFTTEVA
FT                   AMAVNELFHRLNGFRGEEQTCSERVRQFQYLKNSDTLPSGHSKQGCKICGVRRYDGRGD
FT                   MNPMLDLTL"
FT   CDS             complement(7943..8368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P5_00100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P5_00100"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83264"
FT                   /db_xref="InterPro:IPR025701"
FT                   /db_xref="UniProtKB/TrEMBL:F0J847"
FT                   /protein_id="BAJ83264.1"
FT                   /translation="MSEPSFLPEDDQDFLRRKAIKHRLVSEMVGMEVRRGVIFPEFEVP
FT                   GNLCSRQNGQLVAGGTAALLVLIPKGYAKTRLDSWYVQPGLFLPGGGLVDRAGSETDLF
FT                   NGRWQFWSRHLADSEWRPDIDGLETYIQYIREGLRNP"
FT   CDS             complement(8365..8772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P5_00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P5_00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83265"
FT                   /db_xref="InterPro:IPR027802"
FT                   /db_xref="UniProtKB/TrEMBL:F0J848"
FT                   /protein_id="BAJ83265.1"
FT                   /translation="MGELDQGKDPLLEQAVEHLKHAEADLARAREAETRTEHEIKEAAE
FT                   EITRAERHNRPHELIVNRKPYTWPKDKIDGREIKALAGSPADWVVNQIVDGPGEDPEVA
FT                   NDQFVELALDAEPKGVKRFITRKPKTSPGVR"
FT   CDS             8922..9266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P5_00120"
FT                   /product="Xre family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P5_00120"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83266"
FT                   /db_xref="GOA:F0J849"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:F0J849"
FT                   /protein_id="BAJ83266.1"
FT                   /translation="MLLPIKELGRLIAVKRGGRGVRATAADVGISAATLSRVENGHMPD
FT                   LETFAKICRWLDRDAREFLGLGDQAEQSPQAVVHFRKQKTVAPETAVALGELILAAQRA
FT                   IQARNQLIDP"
FT   CDS             9268..9831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P5_00130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P5_00130"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83267"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:F0J850"
FT                   /protein_id="BAJ83267.1"
FT                   /translation="MRHGFKAQAERLSAEARLELGLDPAAPLDPSRYARHIGVVVLDFD
FT                   DLEISAECKRRLLQTDSESWSGMTLKEGGVTAIIINPSHSRGRRSSTLMHELAHIILKH
FT                   VPARVDVSTNGMLLLSDYSEDAEAEADWLAAAMLLPRDVLMRSRRRGETITNIAMAFGT
FT                   SDQLCEWRIRMTGVDVQLKRAARR"
FT   CDS             complement(9945..10949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P5_00140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P5_00140"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83268"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:F0J851"
FT                   /protein_id="BAJ83268.1"
FT                   /translation="MRCIFCSLDRSPSEEHVFPLAIGGTVTTDRVCEPCNSTLGSRVDA
FT                   ALSDFFPVRVRRAMLNLAGNSGTVPARHEMFLGKVKLVGQTADQAHVTFNKETGQLDTR
FT                   QLKHVAETVTPDGQKMLQITLDERDKDQLPKIIARERKRRGLPPLSEEQLASQTNNFTT
FT                   TTVDHPLIQINQSISFAFLRHAMMKIAYELAFLWLGELYLDDPVAAELRTAICSPELTS
FT                   TDKIAGYVGVAEDCDAFKCWTPHEEHHLAYANVVAGNVMISVRVFDIYAACIVVSREAG
FT                   RYFQSHAHDEKLRFLAIDAVSGKTVETSFGQETQRIATAMTAFQRLPPFWDPL"
FT   CDS             11109..11666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P5_00150"
FT                   /product="putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P5_00150"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83269"
FT                   /db_xref="GOA:F0J852"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:F0J852"
FT                   /protein_id="BAJ83269.1"
FT                   /translation="MIFGYARVSTAAQDLTAQRAQLAAVRCEKVFCEKITGTHADRPQL
FT                   RKLLAALQPGDVVVTTAVDRISRDTTDLLVIARQIKDSGAGLRSLAEPFLDTTSDFAEI
FT                   VLAILGVAAKLERRRILERTAHGREAARAQGVKFGRKPKLTLHQQREAAARVAAGEPQR
FT                   VVARSYNVSQATISRLDAAVKS"
FT   CDS             11717..12691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P5_00160"
FT                   /product="putative DNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P5_00160"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83270"
FT                   /db_xref="GOA:F0J853"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F0J853"
FT                   /protein_id="BAJ83270.1"
FT                   /translation="MNIQAKQIPLSDFTGDYRTVHIGRSQLVHADAFEWLSQLPPESVD
FT                   GMVFDPPYGVKEYELDQIEMMLSGGPGIWRLPPSFDGSQRAPLPRFTALNPEERTTLHR
FT                   FFRDFAVAALPALKPGAHIFMASNSFLSQLVFSAMIDGGFEFRTEIIRLVQTLRGGDRP
FT                   KLGEEEYPDVCSLPRGGYEPWGLFRKPMPPKMTVRECLRIYGTGGLRRRSDGNPFCDVI
FT                   DSERTPKREKEIAPHPSLKPQSLLRQLVRAVLPLGKGVVVDPFMGSGSTVAAAEAVGYK
FT                   CVGVERYDDYFEMATKAVPRLITVKAAAKSSHVVSVEQAAFCV"
FT   CDS             complement(12701..13369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P5_00170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P5_00170"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83271"
FT                   /db_xref="UniProtKB/TrEMBL:F0J854"
FT                   /protein_id="BAJ83271.1"
FT                   /translation="MTRTPSPADLARLERLACHPSSVEVSHFNKKSDLPYGLRVEQIAA
FT                   AMNEFIDFLSFINQQLATRQIERLETMLMPANFSSIVGEFMTSAIPKHCKTLVKNTYHN
FT                   GHPDMLPAGKYPNDKLQHGTEGIEVKGSRYLKSWQGHNAEDAWLMVFCFSGGRPTDKIK
FT                   GVLPAPFKFRLVAGAQLKKEDWKFAGRSETSRRTITASVTKTGYQKMMANWIYKAPDLA
FT                   "
FT   CDS             complement(13366..13587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P5_00180"
FT                   /product="Xre family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P5_00180"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83272"
FT                   /db_xref="GOA:F0J855"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:F0J855"
FT                   /protein_id="BAJ83272.1"
FT                   /translation="MSLTDKQRFGRKVKQLRLAKGWTQEELAEHTGLHPTYIGGVERGE
FT                   RNLGLDNLLKIARALGEPPAALLLDFPK"
FT   CDS             13924..14145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P5_00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P5_00190"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83273"
FT                   /db_xref="UniProtKB/TrEMBL:F0J856"
FT                   /protein_id="BAJ83273.1"
FT                   /translation="MTDAAQIERVRRYRQRLRENGKTQVLLNLPVEIVEALDRLRDSRG
FT                   ASCRGDVVASLVAAVEWNKENGNDLAKP"
XX
SQ   Sequence 14328 BP; 2888 A; 3953 C; 4493 G; 2994 T; 0 other;
     atgcagacag aaaacgcctt cggggcgtca cgaccaagcg gggctaagtg cccgagcgga        60
     ctacgaaaac tatcccttgc catgctgaat accgagcgtg ttggcgaggc gttcggcggc       120
     ctgccggaca aggccttgcc gggccgtgtc ctggcggctt tcaaggcggc agcccctgcc       180
     ctcggctatt ccggccgggt cgtgcatgcc gttgattggt tgttcagctt cacccaggcc       240
     caggattgga ccgaaggcag ccgaccgatt gtctggccct cggccgcttt gcaacagcaa       300
     gcccttggca tcgggtctac acaggccaag acgctcaatc ggcacctggt cgagctcggc       360
     ctggtctcga tgaaggacag cccgaacggc aagcgttacg gccgccgcga tccgcatggc       420
     cggatcgtcg aagcctatgg gttcgatctt tctcccctcg ccgttcgcat ggcggagttt       480
     caggcggtgg ctgagaaggc gcgtgccgag cgggaggaga tgcgacgctt acgccggcgg       540
     gcgacgattg ccgtacgcgg ccttgcccag gtgctcgaga cggccgccga gatcggcctt       600
     gctggcccgg aatgggggcg tctcggccag gaagcccatg ccttggcgcg ggtgctgaaa       660
     cgcatcgaac ggatcgacga attagccctt ggcgttgccg gccttgaacg gaggcacgcg       720
     gaggcgaaga aacgcttggc ggacgcgacg attcccccac aggaggccca ttgcgaaact       780
     gtgcaaaccg accccaaggg gccggaaaac cggccccacc aatacaacta caaactaaac       840
     cctaatcctt gtcaggatac agtaatggca ttgagtgaat gtaggtcagg cagcggagcc       900
     gtgacctctc gccaaccgtc cgttccatca gaaaggttca aaaaaggacc aaatcgatcg       960
     gcacggaagg attctggccc ggtcatgcgg ctcacgaccg acgagctagt gtgtctagct      1020
     ccccgcttgc ggccctatct ccgatctccc tcccccacct ggcccgacat cgtggaagct      1080
     gccgactggc tgcggcatga tcttggcgtc tcgaaaccgc tttggggcga agcctgcctt      1140
     gccatgggcc gggaacaggc cgccattgcg ctggcgatcg tctcgatgaa gccggaagga      1200
     catttcacct cgacaccggg cggatatttc aacgggatgg tgacgcgcgc ccgcggtgga      1260
     accctcaacc taactcggac gatttggggt ttaaagacga accaggatag agcccgccgg      1320
     tcgaaagggc actgaccatg cgcgtaggag cgcgtgccat gatgttcggc tgggacaagg      1380
     cggcaaggac gctgcaccag ggcggacgat ggctttcgca ttacataatt ataaaattat      1440
     gcaattacga tcatgttcgg cggtcttgat cgtaattatg aaattctata aatttgaaat      1500
     ttcataatta caccatcaca taattccaag ttttgtaatt atgaaattct gaaattatgg      1560
     aggttggaaa tgtttgtaac cgtggcgagc tacaagggag gagttggcaa aaccacaacc      1620
     gctgttcacc ttgccgccta tttacaaacc ctctcttcaa ccttgttgat cgacggcgac      1680
     cctaatcgta gtgcaaccgc atgggggcgg cgcggcggtt ttccattcca aaccgtggac      1740
     gagaaagagg gggcttatca ggcgagaaac ttccagcata tcgtgatcga taccgaggct      1800
     cgccctggca gtgcagattt cgaggcattg gcgaagggat gcgatctact cgtaatcccg      1860
     acagtgccag cttcgctgga cacggacgcg cttattctga cccttcaggc ggctcgtaag      1920
     ttagctccga acaaatacag ggtgctgatg accaaggtgc caccaccacc cgagacggac      1980
     ggcccccaac tccgcgcggt gttgctgcgt gaggaaatcc ccgttttcac tgcggagatt      2040
     cctcggctca aatcttttga acgagccgcg gccgaaggtg tccctgtcta tggcgtgcag      2100
     catgaccctc gcgccaagcg cgcctgggaa gcctatcagg cggcgggaaa ggagatgact      2160
     gatggctaaa gctaccgaaa gcaagttcgc gggaattttt cagaacgcaa cgccagcagc      2220
     atcacctgca gagcctgccc cggagcgtgc cgaattaccc gttccgtcgg ttgctgtccg      2280
     atctttggga cggccccacg gaaagcgtag cgatccagca tggaagcagt tttccgtgtt      2340
     gctcaggagg cagacgcagc gcgatgctgt catgatattg cgggcggggc agggtgagaa      2400
     cgaaaattgc gacttgtccg acctgttgca ggaattgctt gagcagtggg tatcgcaaca      2460
     acgccgatct taaccatgaa caataacagc aggtcatgcg ctaatggaaa cactggcaac      2520
     cttggtgatg ataccggagt atccagtcta ccagccagcg catcagatat tcccggacgc      2580
     caggcaggtg atcacaacgg tcgcgtcatg aaatccgaga tcaagcaaat cgacctgtca      2640
     ttgcggcaag ccatcagtga agcaaaatcc gacatgctta agtggaggat ggtcgcattc      2700
     tgttttcagg ccgtggccat catcggtatc tcctgggggc ttcttcacgg gctccacccg      2760
     taattcaggt cctcactctt ttagtttgcc cttgcttccg tagagaattc tctcgatgtc      2820
     ggggactctg gtgacaatac gttttggttg ctggcggact tggctttggc tgtcattcgg      2880
     ttgctgacgc ttttcgggtg aaagcgctgg ctgcgggttg ggcagaggca cggccgccgg      2940
     ttgatccaaa acggatgctt cgtgcggtga cgacagcttg gcggtggccc ggccaccccg      3000
     tgaaccaact ttgccggtga tctcccgggc gacgaggcca gcgaagtggg tatagctcac      3060
     tgttggcgtg ggctggtcgc cgaaatgctt tagccaactc agtttgacag tggaccctgc      3120
     ctcgatctcg gcagcgacat cattacggac tgccctgaac gccattcggg ccactccgcg      3180
     cattttaatt tggttaccag acatactttc atcgtagcca gtggggtgtc gaacaaaaat      3240
     cggattttgc aggattcagc gagatattag cagaatttag cggtttaaag cagattttgt      3300
     cagattctac tggatttatg tcttcatacg cttaaatctg gctttctctg ccatattctc      3360
     ccttattcta tttatctttt ttaggcaaga tgtgcatttg caatgcaaat gcggaggggt      3420
     agagtgccgc ctgaaggggc ggtgcggtgc ttactcgcct gtggctcgac gcaggcgccg      3480
     ggtgtgcccg gcgcgttttg ggacggagag gagacgccaa tggatgccgg caacgagtcc      3540
     gagagcgaag gctccgccgc agcggatgag ggaaggccgg cgggttccat gggagggcgt      3600
     cctcgcggcg tgaggcgtgc gcgggcgacg cgcgagagcc gaagcgtgca gctggcggtg      3660
     cgttacacgc cgggcgaatg ggagcagatc gaggcgcggg ctgcggcggc cggtcttggt      3720
     gtcacggatt acgtccgtgt ggcggcggtg catgccgcga tcaattcgaa ggtggacaag      3780
     gcggcgatcg tggcactgga gcgccagggc gcggtgctgc gggggttgct ggagcggctg      3840
     gaggcaatcc gttcccagct attgcggggc tccgggccgt cgccgcagac ggtggaacgg      3900
     gttgttgcgg aaatccggca ggggcttgtc gggctgagcg aggcggtgaa gcggctatga      3960
     ttgtccgccg ggtaccgccg aaggtgacgc gggcgggcgg gttccggcag ctggcccggt      4020
     atgtgacggc ggcgatggta ccggggcagg gggaggctgg gcgagcgggc gatggcgtcg      4080
     cagctggttc cggtggccgc cgcggtccgc aaggggcgcg cgggcttggc gcgtatctgg      4140
     gtgaccaggt ccggcatggc gatcgggttg tgtgggtccg gatcacgaat tgtgcactgg      4200
     cggatgatct ggaggcggcg atcaaggtga tggacgccac ccaggcgatg aacacgcggg      4260
     tgaaggcgga cgcgaattat catctggtgg tggcgtttcc gccgggggag cagccggagc      4320
     ggcaacagat cgaggcgatc gaggaccggc ttgtgggtgg gcttgggctg tcggcgcatc      4380
     agcggatatc ggcgctgcat ggggacaagg agcatctgca cctgcatgtg gcgatcaatc      4440
     tgattcatcc ggagacgttc aaggcggcgc atttcttccg ggatcatgag cgtctggctg      4500
     tgatggcggc ggagctggag gttgagcatg ggctgacccg gacgaatcac ggcttgccgg      4560
     agccaggccg ggcgcgggag ctggatgcgg cggccacgat gcgggcacat acgggcgaag      4620
     agccgtttat cgactgggtg aagcgggttg cgggtcccga ccttctggaa gccgggcgcg      4680
     aggatcgggg tggctggccg gcattgcatg tggcggcagc gcggcatggt ctggaagtcc      4740
     gtccgcgcgg ggcggggctg gtgatcggca agcgaggcga gccggcgctg atgatgcggg      4800
     cgagcgatct cgaccgatcg atgagtttcg ggaggctgac cgaccggctt ggcgtgtatc      4860
     agccggccgg cgcggcggtg gctgcgatcg tgccggagag catctacgag cggacggtgc      4920
     ggccggagca tcgaggtgag cctggcctgt gggatcgtta tgttgttgag cgggatggcg      4980
     cgcgggcggg ccggcgcgag gcggtggagg cccagattgc ggcagagcgg gcgtatcggg      5040
     cgaaaattgc ggcgcactac gccgcgaaat tcggcgagat caaacggctg aaggttacca      5100
     tcgggatcga tccacggatc cgatacgatg cgctgaaacg tgagcaacgt gcgttgctgg      5160
     accggcatcg gcgggagagt ctggccgtgc gggagcggat ccgggccgag catccgccga      5220
     cgccagggtg gccggactgg ctgcgtcgcg aagctgaggg tggggatcgc gtggcgctcg      5280
     cggccttgcg gcaaacagcg gagcagcagg ggcgccggga gcaggttgtg gccttgatga      5340
     tccgggtgcc tgagcgtctg gtcgagccga aaccaaccct tggtgtgcaa gccagggtgg      5400
     ggcggcacgg ggatcggacc tggcgcatgt gggatggcgg tgtggttctg gatacgaagg      5460
     agggggttgc gctggtcacg ctctcccccg aggcggcgcg tctggcgctt gatctggcgc      5520
     atcgtcgggc cgatggtgca ccgcttgaga tcggcgctga cgaccggctc cggtcgagtc      5580
     tgctggaggc ggcggtcacg aaccggatgg agatcaggtt tgccgatcca gtgctggagg      5640
     cggagcggga tcagcggatc cgggcgctcg atgaggccga ggggtggacg gcgccggaca      5700
     ggcgggccgg cacgatcatg atgttcgcgt ctcaccggaa cgcctggccg gaaccgggtg      5760
     accagtgttt ttatcgaggg ctggagcctg aggaccgggg cgcagtgcag ttcgttggca      5820
     ccatgcggct gcgtggagcg gatatcgccc tctggcagca gggtagcctg atcatggtcc      5880
     aggacatcag cgaacacagg atgccattgg tccgcacttt ggcgccgggg caggagattg      5940
     atctggccgc agtgcatcgg gcagcggcac gagaggcgga catgacctcc gagatcgatc      6000
     gctcggatgg tgcagggtca gaaacggaga gggggcatga ggccgagccg gagcgcgatc      6060
     tcgggttcga gatggactga gggcgccgag tcagacgggt gtgccgggaa gaacggcctg      6120
     caatggagaa gaggcgtaga cgctgtgctg ggcgctgcta tcgtacattt aggcgaaagc      6180
     cgcattgttc taacgattag tttgggatca agggcaccaa atcaatctgc cctttcggac      6240
     aaaaaaatgg gcgccgcagc cttccgtttc ccatatcgac ggctgtacgg tcggccgatg      6300
     tagccaatcg caagtgatct tccaattcga gcccgctgcc gtttggagtt ggatatgttc      6360
     actgcaacgc ggacatagca tgtgcgccca tttgcgatga ccaccgcgta cctcgtcata      6420
     gactaggttt ggcatcatct cctcgtcgag tggcgcctcg cttacctcgc ggcaaaggaa      6480
     gtgcggccgg ctccaaagat tgtggcgagc gccccattca agccaactga tcgggatacg      6540
     aatcatagtg tgaggtcgag catagggttc atgtcgcctc gtccatcata tcgccggaca      6600
     ccacagatct tgcatccttg ctttgagtgc ccgcttggca gggtatccga attcttcaga      6660
     tattgaaatt ggcgaacacg ctctgagcag gtctgctcct caccccgaaa tccgttcagt      6720
     ctatggaaaa gctcgtttac agccatcgcg gcaacttcgg ttgtgaaggt gacgaccacc      6780
     ggactcggat cgggatcatt tggcacatag ccagctcgac gacgggcttc ttgcagttcc      6840
     ggatcgcgcc ggaggctatc ttgatagact tgatcattgc taatcagacc ccggcagctt      6900
     tggcaggggt aaccgggctg caccactgtc acccgtccgt caaagatgtc atagccgcca      6960
     ttggcgttag gctcaatcag cagaccaaca tcgatcaccg gaatgaaata gaagtgcgct      7020
     aggcgattca ggacttcacg gccaaggtcg tcatccgtgc agccaaacac gacatcacag      7080
     gccttcagga tcgcaaggcc tgcagggcga tccgcgaagt ccggaacgcg gatgatcgat      7140
     attggaagac cgatcgccgc cgcaccttct ccgactacat cgaccttctt acgccttagg      7200
     ctggcatcga tccgtgtcgc gaaatgtagc cggttcaggt tggtatcctc gacgatatcg      7260
     tcatcgagga gggcgagctt gcggaccccg atgcgtgcca ggagcatcgc tatggccgag      7320
     cccgttccgc cgcagccgac gagtcctatc tttagtcctg cgatctgtgc ggaggaggcc      7380
     gtgccgaagg cgcgggcctg tcggtcaagt tccaccggcg caatcgccgc aggtccgctt      7440
     agccagctct gccagcgctt gccgatgacc atgatgcggc tcgccgcttg cggcttcaga      7500
     tctgggccgt agacccgcgc tgcgagatcc ttggtccgat ccatgattac cgacaggtgt      7560
     ggccggtcgc tatccaagcg gttgaatgcg atctgaaata ggtcatgctc agcgatgtca      7620
     tcggcgccgg aaaacttaag ttgaccagcg ggatgagcgt gaaagacggc cacagcgaaa      7680
     tctttggcct cggctagctt cagcgcattg aagaagggcg ttgtcgacca agtgaatccg      7740
     tctggcgaac gcgcttcgta ggcatcttca ggcacctcaa taatctcacg gactaagaac      7800
     cgctcgtcca cctcgccgga ccacggatcc ttgacacgtg accggccgca gagtgccagt      7860
     accgcccgct cgctatcgtc tttgaacaga aggtcggcga tacggtcgcg ttgttcggcc      7920
     aggaggcgaa gggcgaattg tgtcatggat tgcgtagccc ctccctgatg tactggatat      7980
     atgtctcgag cccatcaatg tcgggccgcc actcgctatc ggccagatgc cgggaccaga      8040
     actgccacct gccattgaaa aggtctgttt ctgaacccgc ccggtcaacc agaccaccgc      8100
     ccggcagaaa cagacccggt tgaacatacc agctgtctaa ccgcgtcttg gcataacctt      8160
     tggggatcaa gacgaggagg gctgctgttc ccccggccac cagctgcccg ttctggcggc      8220
     tgcaaagatt gccagggact tcgaactctg gaaaaatcac gccccgcctc acttccattc      8280
     cgaccatctc gctgacaagg cgatgcttga tcgccttgcg tcgtaagaaa tcctgatcgt      8340
     cttcgggaag gaagctgggc tcgctcatcg gacgcccggc gaagtcttcg gtttgcgggt      8400
     gataaaccgc ttcacgccct tgggttcggc atcgagggcg agctcaacaa actgatcatt      8460
     ggcgacttcc ggatcttcgc ccgggccgtc cacgatctgg ttcacaaccc agtcggcggg      8520
     gctacctgca agcgctttga tctcacgacc gtcgatcttg tccttgggcc aagtatacgg      8580
     cttgcgattg acgatcagtt catgaggacg gttatggcgc tcggcccgcg tgatttcctc      8640
     ggccgcttct ttgatctcgt gctcggtccg cgtttctgct tcccgcgcac gtgccaggtc      8700
     cgcttccgcg tgcttcaggt gctcaaccgc ctgttcgagc agcggatctt tgccttggtc      8760
     taattcaccc atgctagcct ccacttgacg cccttgatgc gccgtgattc tctgtcttat      8820
     caacgaaacg tcttatatgt atgacaaatc gtcttacacg taagacatat ttaggtcgct      8880
     cctgcgctcc gcgcaagggc gtaatcacgc catgaggttt aatgttgcta ccgatcaagg      8940
     aattgggccg tcttatcgcc gttaagcgcg gcgggcgcgg tgttcgggca accgcagccg      9000
     acgttggcat cagcgccgcc acgctgtcgc gtgtcgagaa cgggcacatg cccgacttgg      9060
     agacatttgc caaaatctgc cgctggctgg accgtgacgc ccgcgaattc ctcgggctgg      9120
     gcgaccaggc tgaacaatcg ccgcaagctg tcgttcactt ccggaagcag aaaactgtgg      9180
     cgccagaaac ggcggtggcg ctaggcgaac tgatcctggc cgctcaacgt gcaattcaag      9240
     cccgaaatca gctgatcgac ccctagtatg cgccacggtt ttaaagccca ggcggagcgc      9300
     ctaagcgcgg aagccaggct agagcttggt ttggatccag cggcaccgct agatccatcg      9360
     cgttatgccc ggcacatcgg ggtcgttgtc ctggacttcg acgacctcga gatttcggct      9420
     gaatgcaaaa ggcgcttact gcaaaccgac agcgagagct ggtcaggcat gacgctcaaa      9480
     gaaggcgggg tgaccgccat catcatcaac ccgagccata gtcgtggacg caggtctagc      9540
     acgctgatgc acgaactggc ccatatcatt ctcaaacatg tgcccgcacg agtcgacgtt      9600
     tccacgaacg ggatgctact gctgagcgat tactcagaag acgcagaggc agaggcagat      9660
     tggttggcgg ccgcaatgct gctgccgcgt gatgttctga tgcgtagccg ccgccgtggt      9720
     gagacgatca cgaacatcgc gatggcgttc ggtacaagcg atcagctatg cgagtggcgc      9780
     atccgcatga ccggcgtgga tgtgcagctg aagcgggcag cgcgccgttg agcacgtgat      9840
     ctgggccagc gtgcggattc cggtgctccg gaaagtatga tcgaagcccg cccgctgtcc      9900
     cgaaaagcaa gatttatgcg ataagtcgtt gcggtctggt cgcctcaaag cgggtcccaa      9960
     aagggcggga ggcgttgaaa tgcggtcatc gccgtcgcta tgcgctgcgt ttcttgacca     10020
     aaggacgttt cgacggtttt gccgctgacg gcatcaatgg ctagaaaacg tagcttttcg     10080
     tcatgggcat gtgattggaa atatcgacca gcttcgcggc ttacgactat gcaagcggca     10140
     tatatatcga agacgcggac agagatcatg acattacctg cgacaacgtt cgcatatgct     10200
     aggtgatgct cttcatgtgg cgtccagcat ttgaaagcgt cgcagtcttc agccacacca     10260
     acatagcctg caattttgtc cgtcgatgta agctccggag agcaaatggc cgtacgcagc     10320
     tccgcagcta caggatcatc aagatagagt tcgccgagcc ataggaatgc aagctcatag     10380
     gcgatcttca tcattgcatg ccgcagaaac gcaaaactga tgctctgatt gatttgaata     10440
     agtggatggt caacggtagt agttgtgaaa ttatttgtct ggctagcgag ctgttcctcc     10500
     gacaatggag gaaggccgcg tcgctttcgt tcacgggcaa taattttagg aagttgatcc     10560
     ttgtcgcgct cgtcgagggt tatttgaagc atcttttgtc cgtcaggcgt gacggtttct     10620
     gcgacatgct tgagctgccg cgtatccagc tggcccgttt ccttattaaa cgtgacgtgg     10680
     gcctgatcgg ccgtttgacc gaccagcttt accttgccga gaaacatctc gtgcctggcg     10740
     gggacagtgc cgctgttccc tgccaaatta agcattgcgc gtcgcactcg gacggggaag     10800
     aaatcactta gcgcggcatc gacacggctg cccaacgtcg aattgcaagg ctcacacacc     10860
     cggtcagttg tgactgtgcc accaatagct agcggaaaga catgttcttc gcttggtgac     10920
     ctgtctagag aacagaagat acaccgcata agtgaagcct tagatcttgt cccaactgaa     10980
     tatcacggga ttagggccga ttcgtagagt taagaggaat gtttcataaa tcaagagttt     11040
     tgcatcaaac ctagagatct gaatctttga gacttttctg atgcaaaaat ctgatgcaaa     11100
     atcaaagtat gattttcggc tacgcccgag tctcgaccgc cgcccaagac cttaccgcac     11160
     agcgcgccca actggccgct gtccggtgcg agaaggtgtt ctgcgagaag atcaccggca     11220
     cccatgccga ccggccgcag cttcgcaagc tacttgcggc gctccagccc ggcgacgtgg     11280
     ttgttaccac ggccgttgat cgcatttcgc gtgacacgac cgacctgctg gtgatcgcgc     11340
     gccagattaa ggattctggt gccgggctgc gctcactggc tgaaccgttc cttgatacca     11400
     catccgactt tgccgaaatc gtgcttgcga tcctcggcgt ggccgcgaag cttgagcgtc     11460
     gccgcattct cgaacgcacc gcgcacggcc gcgaagccgc gagagcgcaa ggcgtgaagt     11520
     tcggccgtaa accgaagctt acgctgcatc agcagcgtga agcggccgcg cgcgttgcgg     11580
     ccggagagcc gcagcgcgtc gtggcgcgca gttacaacgt cagtcaggcg acgatttcgc     11640
     gactcgatgc agccgtgaaa agctagtttg gcggacaaaa tcagaacgcg cgcgcgttac     11700
     gcaaaaggat tctcgtatga acatacaagc caagcagatc cctttgtccg acttcacggg     11760
     cgactatcga accgtgcata tcggccgctc acagctggtt catgctgatg cgtttgaatg     11820
     gctgtcgcag cttccgcccg agagcgttga cggcatggtt tttgatccgc cctatggagt     11880
     caaagaatac gagcttgacc agatcgagat gatgttgagc ggcgggccgg gtatctggcg     11940
     gcttccgccg agcttcgacg gctcgcagcg cgcgccgttg ccacggttta cagccttaaa     12000
     cccggaagaa cgcacgacgc tgcaccgctt ctttcgtgat tttgccgtcg ccgccctgcc     12060
     tgccttgaag ccaggcgcgc atatcttcat ggcgtccaat tccttcctgt cgcagcttgt     12120
     tttttccgcg atgatcgacg gtggctttga gttccgcacg gagatcattc gcttggttca     12180
     aacgctgcgc ggcggcgatc ggcccaagct tggcgaggaa gaatatcccg acgtctgctc     12240
     gttgccgcgt ggtggttatg agccgtgggg cctgttccga aagcccatgc ctccgaaaat     12300
     gaccgtcagg gagtgtttgc gtatctatgg caccggcggg ctgcgtcgcc gttcagacgg     12360
     caatccgttc tgtgacgtga tcgacagcga acgcacaccg aagcgggaaa aggaaattgc     12420
     cccgcatccg agcctgaaac cgcaatcgtt gctccggcaa ctggtgcggg ccgttctccc     12480
     cctgggtaaa ggcgtggttg ttgatccatt catgggatca ggttcgacgg tcgccgctgc     12540
     cgaggctgtt ggttacaagt gcgtcggcgt tgaacggtat gacgactatt ttgagatggc     12600
     gacgaaggcg gtgcccaggc tgatcaccgt taaggccgct gccaagtcaa gccacgtggt     12660
     ttcagtcgaa caggccgctt tctgcgtcta ggttggagaa tcatgccagg tcaggcgctt     12720
     tgtatatcca gttcgccatc atcttttggt agccggtttt ggttactgac gcggtgatgg     12780
     tgcgccgact tgtttctgag cggccggcga atttccaatc ttctttcttc aactgcgcac     12840
     cggcgacgag ccggaatttg aaaggagccg gcaaaacacc cttgatctta tcagtcggcc     12900
     gcccgcccga gaaacagaac accatcaacc acgcatcttc ggcgttgtgc ccctgccagc     12960
     ttttcagata gcgggatcct ttgacctcaa ttccttcggt tccgtgctgc aacttgtcgt     13020
     tggggtattt ccccgccggc agcatatccg ggtgcccgtt gtggtaggtg ttcttgacga     13080
     gcgttttgca atgcttcggt attgccgaag tcatgaactc accgacgatg ctgctgaaat     13140
     tcgcaggcat gagcatcgtt tcaaggcgtt caatttgccg ggttgcaagc tgttggttga     13200
     taaaactcag aaaatctatg aactcattca tagcggcggc aatttgttca acccgtaggc     13260
     cataagggag atcggacttt ttgttgaaat gtgaaacctc aacagatgac ggatggcagg     13320
     cgagccgttc cagtcttgcc aggtccgcag gtgatggcgt gcgcgtcatt tcgggaaatc     13380
     caaaagcagt gccgctggag gctctccgag cgcacgcgcg atttttagta gattgtcgag     13440
     gccgaggttt ctctcgccac gttcgacgcc gccgatgtaa gttggatgca agcctgtatg     13500
     ttcagccagt tcttcttgcg tccatccttt cgcaagccgc aactgtttga cctttcttcc     13560
     gaatcgctgc ttgtccgtca aagacatacc caacatgcac ccggaagaca gactatgagt     13620
     ccagcgacta taagtattgt tgaggcgaat tcgaaacgaa tcgtgctgcc atagtgcttt     13680
     gcggtgggtg tcggcctcgc tcgctatggc gctatctgga agcgcgcttc gcttggccgc     13740
     gattcgggct gattcgaccc gattcggccg cttttacggc gtggacggac ctgttttggg     13800
     ggccctgccg ggccttgccg cagatggatt ccgtgaggaa aaccaagcta ttccgggccg     13860
     gtgtgacagc atcgtgaaag gaagcagtgg acaagcaagg ctgtcttgct aggatgtcta     13920
     gttatgacgg atgccgcaca gatcgaaaga gtccgccggt atcggcaaag gctcagggag     13980
     aatggcaaga cgcaagtctt gctgaacctg cccgttgaga tcgtggaagc cttggaccgc     14040
     ttgcgcgatt cccgaggggc ttcctgccga ggcgacgtgg tggcttcact ggtggcggcc     14100
     gtcgaatgga acaaggagaa cggcaacgat ctagccaaac cctagaaacg caaaagcccg     14160
     ccttgccggg cggacttttg agattatcgc tacgggcctt acggctaaga ttggaactct     14220
     atacatcccc aatctagccg taggacgccg tttcttcaag tcggaaattg ccgtttccga     14280
     cgaagggaga ggcttgcccg tcgcgatcca accggaagga ggatcacg                  14328
//