Dbfetch

ID   AP012039; SV 1; circular; genomic DNA; STD; PRO; 40588 BP.
XX
AC   AP012039;
XX
PR   Project:PRJDA60101;
XX
DT   02-MAR-2011 (Rel. 108, Created)
DT   28-SEP-2016 (Rel. 130, Last updated, Version 3)
XX
DE   Acidiphilium multivorum AIU301 plasmid pACMV4 DNA, complete sequence.
XX
KW   .
XX
OS   Acidiphilium multivorum AIU301
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acidiphilium.
OG   Plasmid pACMV4
XX
RN   [1]
RP   1-40588
RA   Hosoyama A., Yamada R., Ito N., Takarada H., Narita-Yamada S., Nakamura S.,
RA   Katano Y., Ichikawa N., Nakazawa H., Fujita N.;
RT   ;
RL   Submitted (28-DEC-2010) to the INSDC.
RL   Contact:Director-General Department of Biotechnology National Institute of
RL   Technology and Evaluation, NITE Bioresource Information Center (NBIC),
RL   Department of Biotechnology; 2-49-10 Nishihara, Shibuya-ku, Tokyo 151-0066,
RL   Japan URL    :http://www.bio.nite.go.jp/
XX
RN   [2]
RA   Narita-Yamada S., Nakamura S., Ito N., Takarada H., Katano Y., Nakazawa H.,
RA   Hosoyama A., Yamada R., Fujita N.;
RT   "Whole genome sequence of Acidiphilium multivorum AIU301.";
RL   Unpublished.
XX
DR   MD5; bf4415aaae44cb093fa8770b34a0b3ed.
DR   BioSample; SAMD00060977.
XX
CC   ##Genome-Assembly-Data-START##
CC   Genome Coverage       :: 8x
CC   Sequencing Technology :: ABI3730
CC   ##Genome-Assembly-Data-END##
CC   Please visit our web site.
CC   URL:http://www.bio.nite.go.jp/
CC   DOGAN ; Database of Genomes Analyzed at NITE
CC   The database contains genome sequence data, physical maps
CC   and the genomic and proteomic data of the microorganisms
CC   analyzed.
CC   URL:http://www.bio.nite.go.jp/dogan/Top
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..40588
FT                   /organism="Acidiphilium multivorum AIU301"
FT                   /plasmid="pACMV4"
FT                   /strain="AIU301"
FT                   /mol_type="genomic DNA"
FT                   /note="strain coidentity: NBRC 100883"
FT                   /db_xref="taxon:926570"
FT   CDS             1..1404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00010"
FT                   /product="replication protein C"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83211"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Z4"
FT                   /protein_id="BAJ83211.1"
FT                   /translation="METESPGFGRNTNINQRPGGLRRLSLAMIATDRTAEGFTGLSDGA
FT                   GGPGAVLAAFKAAAPYLGLPPRVVHAVDWLFRFTQRQDWEPGARPVVWPSATVQQADLD
FT                   LGVSQTKALNRLLVELGLVVMRDSPNGKRYGRRDRSGRIVEAYGFDLSPLGVRLEEFRA
FT                   VAEKGRAEREAVRQLRRRVTIARKAIEQIVETAVEVGLEPVAFVREAEEARRLCWRLGK
FT                   EERSDVLAFGVTRLEDRHGELRQRLESLIADRRGMAQKDVETDPKGPENRPHQYKYKSN
FT                   PDPEQDTVSGIEKSSPTPVRSVAAVGKPGLRDGSSGPQTGRGAQKPARQDDGTVLRITP
FT                   DELVRLAPRLRPYLGRSSPAWPDIVEAADWLRHDLGVSKPLWGEACLAMGREQAAIALA
FT                   IVSARPAGHFRSTPGGYFHGMVTKARAGELNLGKSIWGLRAQDRSSGPGKAAPRHCGPE
FT                   GLAIPRIST"
FT   CDS             1542..1823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83212"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Z5"
FT                   /protein_id="BAJ83212.1"
FT                   /translation="MFDGRADLMRVAQFQINAGSVVVLPAIEDLIGDRLGQYAGDKPPD
FT                   VSRLIPGTGSFRDGGQDRFRLSAYLKKRVEEEGGDISLLDGLDSESEP"
FT   CDS             1820..2020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00030"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83213"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Z6"
FT                   /protein_id="BAJ83213.1"
FT                   /translation="MRTIKLETHLKRTAAKARELDAAGRNVPTDALRNAGKTRTTAKRV
FT                   LLDRVEKRARAAGKKPVLSHY"
FT   CDS             2247..2438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83214"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Z7"
FT                   /protein_id="BAJ83214.1"
FT                   /translation="MRYTDTIMSRCEALNLFPGRGIACDDIRVGLRINSFRKLHGDCLY
FT                   RWCRPRGDPRNISWRAGL"
FT   CDS             2703..3065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traJ"
FT                   /locus_tag="ACMV_P4_00050"
FT                   /product="putative plasmid conjugal transfer protein TraJ"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83215"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Z8"
FT                   /protein_id="BAJ83215.1"
FT                   /translation="MDTAYPRQIRSARETRTEIVRVRCTPSERKAIEELANVTGQSLSD
FT                   FVRAGALSVDIRGRVEQRAIYALADAVGHMNVLGAQLKQWQTARDGDDASAASAERVLA
FT                   DIEAAVRDVHEKVAAL"
FT   CDS             3098..3196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83216"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Z9"
FT                   /protein_id="BAJ83216.1"
FT                   /translation="MLINRLQGGLDKERVHEVVALIDEVAGRIERL"
FT   CDS             3361..3606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00070"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83217"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:F0J800"
FT                   /protein_id="BAJ83217.1"
FT                   /translation="MRTYNIHEAKTHLSRLIEQALKGEGFLIAKAGKPLVKVTALGKPE
FT                   ASSTRRLGFMAGRMRVPDDFNRIGADEVRKLFEDDA"
FT   CDS             3603..3989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00080"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83218"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:F0J801"
FT                   /protein_id="BAJ83218.1"
FT                   /translation="MKLLLDTHLLLWAAENAPRMPEAARELIADPGNELYFSAASLWEI
FT                   AIKQGLGRPDFEVDARVLRRGLIDNGYLELPILSEHAVAIEGLPAIHKDPFDRLLIVQA
FT                   MVEGITLLTNDAVVARYPGPVRFV"
FT   CDS             complement(4217..4477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00090"
FT                   /product="putative Tn3 family transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00090"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83219"
FT                   /db_xref="GOA:F0J802"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:F0J802"
FT                   /protein_id="BAJ83219.1"
FT                   /translation="MNRSCGDPPLVTAIILWNTRYLAQAIQALRQVEDVPGTLLTHLSP
FT                   IGWEHVNLTGDYIWSANQKSTENHAGLRPLRPIPDTTIKAA"
FT   repeat_region   complement(4454..8241)
FT                   /note="Belongs to Tn3 family"
FT   repeat_region   4454..4493
FT                   /rpt_type=INVERTED
FT                   /note="perfect 40 bp inverted repeat"
FT   CDS             complement(4487..7453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00100"
FT                   /product="putative Tn3 family transposase for insertion
FT                   sequence element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00100"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83220"
FT                   /db_xref="GOA:F0J7K1"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7K1"
FT                   /protein_id="BAJ83220.1"
FT                   /translation="MPLRVLLSAEQRARLFSIPTDMASMSRHYVLDAADLAMVRVRRRA
FT                   SNRLGFAVQLCVLRFPGRTLDPSEYPPAPALAFVAEQIGVDPLLFAEYARRAETRREHL
FT                   VELQKFTGLRSFGLDDWRACLHAGADTAWATDRGEPIIQAMLVHLRESRVLLPSATVLE
FT                   RIGLAARVRARKKTFEVLAAGMADAERSALTELLTVDPELRRSRFAWLRDYSESPAPSN
FT                   IVSLLDRLEYVRAMGIDPARAGRIHAARLVRLTDEGALMTVQHIADLEPARRTAILIAQ
FT                   IASLETRLTDATLAMFEKYVGTLFSRARNRDERRFQATRRDVAKALLLFRRTIAALRQA
FT                   KEAGEDGITAIEREIGMNQLEDVLPIIGAVADVADQDILVTAAERYTVLRRFSPRFLAA
FT                   FDFRSNMPNDPVLAAIELLRALNRGAIRSLPKRPPSTFLPPQWRKLIFAGGTADRRLYE
FT                   TAVLAVLRDKLRGSNIWVAGSRDYQAFETYLLPAGAGAATGIDGEADPDRYVASRAEML
FT                   RERLTFVAARAAQGDLDGVEIEDGKLFIARTPPTVPDAARDLALRLNSMLPRVRITEVL
FT                   SEVDAWTGFTDRFVHLRTGNPVTDKAALLAAVLADGTNLGLARMADASRGLSYHHLVNV
FT                   AQWHISDDNYVAARAAIINAHHAHPMAAIWDDGTSSSSDGQYFRAAGRAGAGGSVNAKY
FT                   GIEPGAVIYTHVSGQYGPFHTRVISATMSEAPYVLDGLLHHVHQTDLRIAEHYTDTAGA
FT                   TDHVFGLCHLLGYRFAPRIKDLRDRKLYTIEKPGTWPLLVPLIGDAVETTAILGQWPEL
FT                   MRLKASINAGTVLPSVILRKLAAAGGGNTLSRALRAVGRIERTLFTLQWLSDPALRQRS
FT                   HAGLNKGEASNALRRAVFFHRQGEIRDRTFENQSFRASGLSLITAAIVHWNTIYLDQAV
FT                   QHLRAQGTAVPDDLLAHVAPLGWEHIALTGDYVWNPANPNASFRPLRDVRAPFIPRAA"
FT   CDS             7627..8208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00110"
FT                   /product="putative resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83221"
FT                   /db_xref="GOA:F0J7K2"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7K2"
FT                   /protein_id="BAJ83221.1"
FT                   /translation="MAHTLIGYARCSTDRQDLAAQRAELEQLGVKPDRIYTDHGLTGTN
FT                   RARPGLAQALAAVRKGDTLVVPKLDRLARSVPDARAIADELITRGVKLALGAAVYDPTD
FT                   PMGKMFFNILATFAEFEADLIRLRTREGMAIARAKGKLRGKRPTLSERQQKELRRMYDT
FT                   GNYSITDLADLFSVSRPTIYRTLARQPANA"
FT   repeat_region   8202..8241
FT                   /rpt_type=INVERTED
FT                   /note="perfect 40 bp inverted repeat"
FT   CDS             complement(8205..10997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00120"
FT                   /product="putative Tn3 family transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00120"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83222"
FT                   /db_xref="GOA:F0J805"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:F0J805"
FT                   /protein_id="BAJ83222.1"
FT                   /translation="MGHRRILTGEQIAQLFDPPTDRRGMIRHYTLSAADLAVIRRGRGD
FT                   HHRLGLALMLCYLRYPGRPLHAGETPDPALVAFVAAQVDVLPEYLGAYLGVDQNRRRHS
FT                   AALQDRLGLRPWGPRVAADLADWLLAHALETDRLVDLAALVLDECRGRGILLPPPARLE
FT                   RLCIEVRYRARREIERRLTEGLSADQRHGLDTLTERRLDTSQSWLAWLRQIPESAKPAS
FT                   MLGLIERLEHIRAIGIDPERGYRINQARLAQLVREAGRTTVQHVAGYERRRRHAVLTAI
FT                   ALDLSARLTDQAINLFERLIGAMFRKAEGRHARAFQAEGRAINEKVRLYARIGAALMAA
FT                   RAGQGDPFAAIDKVIPWERFCSTVVEAETLVRSEDFDPYEVLSDHYAGIRRWAPAFLAA
FT                   FEFQGVPAAASLMRAIAMLRAMNSAGASTLPKSAPTAFVRPRWARHVLTARGIDRRYYE
FT                   LCVLAELRQRLAAGDVWVTGSRQYRAFEERLISRETLQVLQKESGIPVAVETDFERFIA
FT                   TRRTWLDARLAEVDARARGGLLPDVTIEKGVLRITPIEKSTPPEAETLAAKLYATLPRI
FT                   RITDLLTEVAGWTGFPDCFTHLRTGETAADPRVLMAGLLADGLNLGLTRMAEACSIASL
FT                   GQLAWTADWHIRDETYALALRRLVEHQNREPLAALFGSGTASSSDGQFFRAGGSGRDAS
FT                   RINAHYGPEPDLKFYTHLSDRYAPFHTRVIAATASEAVHVLDGLLDHHGEAPPRQHRHH
FT                   TDGGGVSDHVFALCALLGYVFAPRIPDLKDRRLYSFARPAAYPTLAPMIAGRINVDLIR
FT                   AHWPDLLRIATSIRTGTVSASVILRQLAAYPRQNAVAAALRELGRLERTLFTLDWLEDP
FT                   GLRRESSHELNKGEARNSLARAVFIHRLGEIRDRTFENQKHRASGLNLGSPHDLFKIVR
FT                   "
FT   CDS             complement(10948..11595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00130"
FT                   /product="putative resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00130"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83223"
FT                   /db_xref="GOA:F0J806"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:F0J806"
FT                   /protein_id="BAJ83223.1"
FT                   /translation="MLIGYMRVSTDNDRQVLDLQRDALLGAGVDERHLFEDRAGGSRRD
FT                   RPGLAAALAYLKSDDCLVVWKLDRLGRSLPHLLETVNSLRTRGVGFRSLTEQMDTTTPQ
FT                   GEFLFHVFGALAQFERSLIQERVQAGLAAARRRGRRGGRPVAIDAEKLAAVITALDTGA
FT                   TKSSACRTFGISRSTLVDSLARIGWSPGLNKQEGGTSGSSTDIDRGTDRAAV"
FT   CDS             complement(11845..12183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00140"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83224"
FT                   /db_xref="UniProtKB/TrEMBL:F0J807"
FT                   /protein_id="BAJ83224.1"
FT                   /translation="MVMGGTPAVRGNQIEYKRYYNNLSFVNATLLFWLWRGVKEPPGGR
FT                   SGAQPVGEHRTGEDGRRSRSLTPWSGPEPIGWGAQPSGLRPCPPAPLPFGENGVQGQRL
FT                   CVGQIGLK"
FT   CDS             12176..12430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00150"
FT                   /product="prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00150"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83225"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:F0J808"
FT                   /protein_id="BAJ83225.1"
FT                   /translation="MTITTLSSREFNQDTSRAKKAASEGPVFITDRGKPAHVLLSIEEY
FT                   HRITGKRRSIADALAMPGLTDIEFDPPRVSIGLRPADFS"
FT   CDS             12430..12855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00160"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83226"
FT                   /db_xref="GOA:F0J809"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:F0J809"
FT                   /protein_id="BAJ83226.1"
FT                   /translation="MFILDTNVVSELRKVRLGKAHPQVAIWADSVDAETLYISAITILE
FT                   IEIGILQIERKDPDQGDLLRAWLEKQVLPEFEGRIFPVDTAVARRCATLHVPDPHAERD
FT                   ALIAATALAHGMTIVTRNVADFHTTGVPLLNPWEPEH"
FT   CDS             complement(12928..13236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00170"
FT                   /product="putative mobilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00170"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83227"
FT                   /db_xref="UniProtKB/TrEMBL:F0J810"
FT                   /protein_id="BAJ83227.1"
FT                   /translation="MARKPIEQQIAQLEARAKTLKARLAKQDRARDTRRKILIGALVLD
FT                   RLEHNADAEFSERLANWLRRELPGFLTREDDKALFADLLNGKADAPATIPEPRKAEA"
FT   CDS             13654..16497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traA"
FT                   /locus_tag="ACMV_P4_00180"
FT                   /product="putative conjugal transfer protein TraA"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00180"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83228"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="InterPro:IPR014136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:F0J811"
FT                   /protein_id="BAJ83228.1"
FT                   /translation="MAIYHLSMKPVARGSGRSAVAAAAYRAADRLENARDGMVHDFSRR
FT                   HGVEHAEIILPNDTVAADGTVVHGVGPEWARDRSALWNAAELAERRKDARVAREIEVAL
FT                   PHELSAEQRLALTRDFAQALARQYGVAVDFAIHAPHGHTDVRNHHAHILLTTRRMMIGR
FT                   GEAGRWIGAMPAGFLGEKSELELENKKLQALGLPTSHEQLRDIRSGWEQRTNEHLVRAG
FT                   LDVRIDHRSHQERGLEIEPTQHMGVNATQMERRGKVVSRVRIDEDAAKRNAALIRERPD
FT                   QVLTLITGEKSVFDRHDVARALHRYIGDADAFQAAFATVMASPALVELRAEQRDERGRV
FT                   IEQARYSTREMVGIERDMAISADRMAQGRGFGVAGRRVEAAIETRPFLADEQRAAIEHV
FT                   CGPERISAVVGLAGAGKSTMLAAAREAWVAQGYRVHGAALAGKAAEGLEESAGIASRTL
FT                   ASWERGWERGFDRLGPRDVLVIDEAGMVGSKQLSRFITEADRAGAKIVLVGDPEQLQPI
FT                   GPGAAFRAVAERVGFVDLAEIRRQREVWQRAASVAFGRHQTEEGLRAYAERDAVRFEAT
FT                   AADARAAIVRDVLADMEARPDGSRLVLAHRNADVRDLNEAIRTVRRERGALTDERVYRT
FT                   TEGERAFAPGDRLLFRENNRELGVKNGMLGTVELAEDDRLLVWLDSPSGPGRGRSVSVS
FT                   MADYAAVDHGYATTIHKAQGATVDRAYVLASGTMDRHLTYVAMTRHRDGVTLYADREEF
FT                   STVAALSARLSRSQAKETTLDYDRADYAHRRGLDVRPREAVVAHEIAAGRAGFRERYEA
FT                   HRQQQAAEAARNKGAHGLVREWARRSEAYNKALPGLAADPTLVGGARAELLGFEQLLDR
FT                   HSEAAQWLRARGHDFGVKDGSALAQVLASPDAGRAIGRLIEGAEERMRGQLAREAERVA
FT                   ARKQQERSVSRDRGMSM"
FT   CDS             16494..17099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00190"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83229"
FT                   /db_xref="GOA:F0J812"
FT                   /db_xref="UniProtKB/TrEMBL:F0J812"
FT                   /protein_id="BAJ83229.1"
FT                   /translation="MSSAEEHLYGLMEIAEQQQAAVQRALNGLAEERAALAQERQKLAE
FT                   EASSLEERVREAVSAAVTTALEQVGKEGVATVRAATKPMLEDLAGLAGGMAVAEEALRR
FT                   IVAWASWRLLGWIVALTVGLMLFGWLSSTAVVWWDRTTVSQLRGEIAMLQANHAAWVKA
FT                   GMLDKITRCGANSRPCVAINQSAGAYGNSGEYRVLKGY"
FT   CDS             17273..18154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00200"
FT                   /product="O-antigen ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00200"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83230"
FT                   /db_xref="GOA:F0J813"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:F0J813"
FT                   /protein_id="BAJ83230.1"
FT                   /translation="MTELSEPGSTIREFRQPVHFSLSADRGWGQRFQLIATDMKDGVRL
FT                   WRLIWTLGLSDIKLRYRGSALGPFWLTISMGVQIGAMAFLYADLFHTDIHTYLPYLSIS
FT                   IVLWGYLNSLISDGCVCFSSADTLIKGTRMPFTVHAARSVVRNTIVLGHNLVVVVVVFA
FT                   IMGVDQSLYSLLAIPAFLLWLIDAFAISLLFGAFCARFRDVPQIIMALMQIAFFVTPIM
FT                   WYAKILETHPRAVLLVKLNPFFYILEILRAPLLGSPMSVDMVLKALIISAGIIIISIIG
FT                   FARTRGRIAYWV"
FT   CDS             18159..18986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00210"
FT                   /product="O-antigen ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00210"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83231"
FT                   /db_xref="GOA:F0J814"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J814"
FT                   /protein_id="BAJ83231.1"
FT                   /translation="MAHLTAFNISVDFPLYHSDSRSLKKTIMGRAASRFGQDQKHRPVV
FT                   QALRNISFSLRSGDRLGLIGSNGSGKTTLLRALSGIYQPTVGSLSMEGRLTSLLDPGQG
FT                   MNTDLTGRENIQLRGQFLGLPRAEIDRLEADVEDFSELAQFLDLPVRSYSSGMVVRLAF
FT                   AMATAFPPELLLMDEWILAGDAAFMEKAKNRIEGMVRHADILILASHSPVILAEWCNRL
FT                   VLLDNGQIKADGEPMDILEEYLPSTAIEEVRLTVSQKRMRKQRVVEEESKDLP"
FT   CDS             18983..20041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /gene_synonym="rmlB"
FT                   /locus_tag="ACMV_P4_00220"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00220"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83232"
FT                   /db_xref="GOA:F0J815"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:F0J815"
FT                   /protein_id="BAJ83232.1"
FT                   /translation="MTKFLITGGCGFIGSAVVRRLLASAAHEVVTVDKMTYAASEDALG
FT                   AALGHPRHRLIRADIADAAAMRAVFEAHRPDIVMHLAAESHVDRSIDGPRDFIDTNITG
FT                   TFVLLEAARAWFATLDEPARRRFRFHHISTDEVFGALEPGDPPFTETTPYDPRSPYAAS
FT                   KAASDHLVRAWQHTYGLPTIVSNTTNNYGPWQFPEKLIPLVLINALEGRPLPVYGDGSN
FT                   LRDWLFVEDHAEALVTIALTGTPGETYAIGARQPRSNLDVVRAICRLLDDRRPDPAGPR
FT                   ERLITFVADRPGHDFRYEIDPARSEAALGWRAAHDFEAGLARTVDWYLANETWWRAIRA
FT                   RRYAGQRLGTAA"
FT   CDS             20038..20919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /gene_synonym="rmlA"
FT                   /locus_tag="ACMV_P4_00230"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00230"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83233"
FT                   /db_xref="GOA:F0J816"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F0J816"
FT                   /protein_id="BAJ83233.1"
FT                   /translation="MIRKGIILAGGSGTRLHPSTLAASKQLLPVYDKPMVYYPLSTLLL
FT                   AGIRDLLLISTPQDLPQFRRLLGDGGQYGIHIDYAAQPSPDGLAQAFLIGEDWLAGEAC
FT                   ALALGDNLIHADHLSLALRQAAGREAGATVFAYQVRDPERYGVVTFDDAGRPIDIVEKP
FT                   TAPASSWAVTGLYFYDRRVSEFAHRIRPSARGELEITDLNRLYLDDGSLTVERLGRGTA
FT                   WLDAGTPDSLLQAATFVQTIQARQGQLVGCPEEVAFRMGFIDAETLRRHATRLGKTDLG
FT                   RLLHELADGDTP"
FT   CDS             20916..21470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbC"
FT                   /gene_synonym="rmlC"
FT                   /locus_tag="ACMV_P4_00240"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00240"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83234"
FT                   /db_xref="GOA:F0J817"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:F0J817"
FT                   /protein_id="BAJ83234.1"
FT                   /translation="MIETLVLPDVKLITPPRFADSRGWFSETWNQAKLAALGFTETFVQ
FT                   DNHSCSTRPGTIRGLHCQIAPFAQGKLVRCIRGAIWDVAVDIRHGSPGFGRFAAAELSA
FT                   ANGAQLWIPPGFLHGFCTLEPDTEVVYKVTAPYDKASERGVIWNDPDLALPWPVPGDGA
FT                   LLSDKDNLLPRLAEAEPWFTL"
FT   CDS             21472..22377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /gene_synonym="rmlD"
FT                   /locus_tag="ACMV_P4_00250"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00250"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83235"
FT                   /db_xref="GOA:F0J818"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="UniProtKB/TrEMBL:F0J818"
FT                   /protein_id="BAJ83235.1"
FT                   /translation="MPARPILITGASGQLGHALAARAPAAGLPARAVGRPGFDFDAPET
FT                   IAATLAATDPALVVNAAAWTAVDAAEANADAAYRANRDGPATLATLCRARGNPLIHVST
FT                   DYVFDGTKGAPYTEADPIAPLGVYGESKAAGEEAVLASGADAIILRTAWVFSATGKNFA
FT                   RTMIAAAHRLPTLRVVADQRGAPTAAEDLAEAILAIAARILAEGWQPGFAGIFHATSAG
FT                   DTSWHGFATEILALAARHGTPLPDIVPIATADWPTPARRPADSRLDTTKLKDSFGLALP
FT                   HWRDATARIVPAILAQDETS"
FT   CDS             22374..22586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00260"
FT                   /product="putative glycosyltransferase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00260"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83236"
FT                   /db_xref="GOA:F0J819"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F0J819"
FT                   /protein_id="BAJ83236.1"
FT                   /translation="MTTILLSTFNGTRFLPEQLASFAAQTDQDWRLLWRNDGSSDSTHE
FT                   ITSRLVAGIFHATHTGDITWDGYAT"
FT   repeat_region   22817..22824
FT                   /rpt_type=FLANKING
FT   mobile_element  complement(22825..23904)
FT                   /mobile_element_type="insertion sequence:ISAcr1"
FT   repeat_region   22825..22866
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   CDS             complement(22841..23857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00270"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00270"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83237"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:F0IZR7"
FT                   /protein_id="BAJ83237.1"
FT                   /translation="MDVLAREDLPFPQSLPEFQRIFPNDAACAAYLESARWNGGFACPR
FT                   CGVVGEPFRFEARPGVLRCRACRKDVSLMAGTVMERSHTPLSTWFWAAYLIASQTPGMS
FT                   AVQFQRQLGLSRYETAFGILHKLRAGMVRPERDKIGDTPQEHVEVDETWVGGRTRGDGR
FT                   GVHHKVLVACAVEVRHRKPGTKLDNRKDGRYAGRVRLAVVPDRSANSLCGFVENAVAPG
FT                   SLIVTDDWSGYAGLGRRGFDHHAIAECGDPEVAEEFLPIVHLVFTNLKTWINGIHHGVS
FT                   AKHLQAYLNEFTFRFNRRLYPFNAFRSLLGIAGRAAAPTFDELYSGEWTHPTFSGCG"
FT   repeat_region   23863..23904
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   repeat_region   23905..23912
FT                   /rpt_type=FLANKING
FT   CDS             24365..26617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00280"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00280"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83238"
FT                   /db_xref="GOA:F0J821"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F0J821"
FT                   /protein_id="BAJ83238.1"
FT                   /translation="MKYPNFEFMHEHGLGVLAFGSEVPEVVLKLCNLSSPSDIAVIRNR
FT                   FAFSGRSCILEAMHVQAQRDISAAELRVTRTESERRHLEERFAAAELRVTRTEAERRHL
FT                   EERLAAAELRVTRTESERRHLEERLAAFESHMTRMETERRDLAEKLGSVLSSESWRMTA
FT                   PLRFLVRLIRRLTGRNLRRGRIILRALKPANIEHRREVIQVLRRRVVLASRFVPGLNNA
FT                   VIHASRITLPSISDDSNLKSLKYIPPHHAAVVSYPIWSLRFDTPSATDLLHLEETEIKM
FT                   PEILVIARFSSETFHLIQQTANALKATVGVRWRSVFITKNPDDTTFAVTCMQAFRGDVR
FT                   FLTRSFPEELNGKIIVLLEAGAIPRSHGLRLLVEAMVHNPDLALTYSDEDRLSSKGLPE
FT                   FPWFKPKYSPLLAAQGMLFGRMFAIRPCGQLASDSLFDPIQSVLQLALKATHGLASERI
FT                   RHIAHVLFHDILPSAPFQPVSLPSLEILPFVSIFIPTRDHWHLLRQCLDSLRRTDWPID
FT                   RIEIIVIDNGSTETETLEGMAIEEASGRIRIIRDSRKFNYAALNNVAARAARGDVFVLL
FT                   NNDTEIIDPTWLRKLCAYAIQPDVGAVGAKLLYEDRTIQHGGVILGIQGTAGHAHLLLR
FT                   ESEGGYQQLANITREVAAVTGACIAVSRTAFEEVGGLREEFEVAFNDVVFCLDLLAAGR
FT                   RNIYVHDCVLIHHESKTRGFDTTPQKIAVARSEAIRAWLHHPRLLVVCELSDVVVR"
FT   repeat_region   26576..26581
FT                   /rpt_type=FLANKING
FT   repeat_region   complement(26582..28151)
FT                   /note="Belongs to IS5 family"
FT   repeat_region   26582..26593
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 12 bp inverted repeat"
FT   CDS             complement(26594..27961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00290"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83239"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:F0IZU1"
FT                   /protein_id="BAJ83239.1"
FT                   /translation="MPPKLNASQDDLELFRSRLENIIDQRHPLVRLARLIDWRVFEERF
FT                   GSLYAEAAGRPALPTRLMVALHLLKHMDGLSDEAICARYLDSPYVQAFCGETHFQHTLP
FT                   LDRSSMTRWRKRIGPERMEALLAETLAAAERGGAVAEKHYKRVTIDTTVQPKAVTHPTD
FT                   SKLLHSGIETLARMARKHGITLRQSYRRVARYARQEAARLHHGGKRREAEARVRKLRTW
FT                   LGRLARDITRKIAGNAEAKATFAETLGLINRLLRQKRSDRGADKLYSLHAPEVECIGKG
FT                   KARTRFEFGVKVSIATTNAAAPGGQFVLGMQSQPGNPYDGHTLAGQIEQVERITGVAVA
FT                   RAYVDRGYRGHGVEAEGRRIFISRQKRGITPTIRRELRRRTAIEPVIGHMKTDGHLGRN
FT                   FLLGFDGDAINAILAGAGHNLRLLRRWLIRLLCAIFTWLSAARPSPDLRLPNYHIA"
FT   repeat_region   28140..28151
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 12 bp inverted repeat"
FT   CDS             28152..29351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00300"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83240"
FT                   /db_xref="UniProtKB/TrEMBL:F0J823"
FT                   /protein_id="BAJ83240.1"
FT                   /translation="MLRDDPYYSPNLSLESPYKLAFAPRRRELWRKTVGTTLKILMLSS
FT                   TYARGHGVAVVIDLMVTTLRKRGHVVFLAGTKSDRDFSYGGTEVIDVQDPRSAATMATD
FT                   LQIDVIIAHTPPFFGVARWTGAYPPVIAYDYGEPPPNFFPDEEARRESLADKNASLRMC
FT                   TKVFAISQAIADESLIPPDKVIPLGNSHLGVWTSELLERREAIRRKHGWTSHYVILNVC
FT                   RFHVGERKYKGVDQYADMLAALKSVDPDFAARCIFVLCGKAHDEDIAAVRAQGITAIAN
FT                   ISDEEMLDLYVAADLYVNFSRWEGYNLGIGQALAMGLKVIASDIPAHRAFGVRVVGNAI
FT                   DAAFALLDLTRESTERVPLLWSWDEPLHLFAEEIESLAFTSTNPQIGWSHDKSEDQGVA
FT                   "
FT   repeat_region   28152..28157
FT                   /rpt_type=FLANKING
FT   CDS             29466..30044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00310"
FT                   /product="putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00310"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83241"
FT                   /db_xref="GOA:F0J824"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:F0J824"
FT                   /protein_id="BAJ83241.1"
FT                   /translation="MNESATGPLIGYARVSTQGQDLAQQRATLREAGCTRIFEEKVSGA
FT                   KRDRPELARLLDHLRAGDVVTVTRLDRLARSTRDLLDIAERIKEAGAGLRSLAEPWADT
FT                   TTPAGRMVLTVFAGMADFERSLIVERTSTGRIAAKARGVRFGPRPALAAEQIAHARQLI
FT                   EVDGKPVAEVARLLGVHRATLYRTLEKHQ"
FT   CDS             30339..30662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00320"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83242"
FT                   /db_xref="UniProtKB/TrEMBL:F0J825"
FT                   /protein_id="BAJ83242.1"
FT                   /translation="MQLAWEICYMPSEKGKLLVMLDLPIPNDATKLWLRSSWSRFNRTD
FT                   GCEITLNWTKVGFRWRAMVPNFHYNKRSGWIILKDENGIVDFKKYSHAMRLVELYISEN
FT                   EKK"
FT   repeat_region   30820..30827
FT                   /rpt_type=FLANKING
FT   mobile_element  30828..31907
FT                   /mobile_element_type="insertion sequence:ISAcr1"
FT                   /note="imperfect 42 bp inverted repeat"
FT   repeat_region   30828..30869
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   CDS             30875..31891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00330"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00330"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83243"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:F0IZR7"
FT                   /protein_id="BAJ83243.1"
FT                   /translation="MDVLAREDLPFPQSLPEFQRIFPNDAACAAYLESARWNGGFACPR
FT                   CGVVGEPFRFEARPGVLRCRACRKDVSLMAGTVMERSHTPLSTWFWAAYLIASQTPGMS
FT                   AVQFQRQLGLSRYETAFGILHKLRAGMVRPERDKIGDTPQEHVEVDETWVGGRTRGDGR
FT                   GVHHKVLVACAVEVRHRKPGTKLDNRKDGRYAGRVRLAVVPDRSANSLCGFVENAVAPG
FT                   SLIVTDDWSGYAGLGRRGFDHHAIAECGDPEVAEEFLPIVHLVFTNLKTWINGIHHGVS
FT                   AKHLQAYLNEFTFRFNRRLYPFNAFRSLLGIAGRAAAPTFDELYSGEWTHPTFSGCG"
FT   repeat_region   31866..31907
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   repeat_region   31908..31915
FT                   /rpt_type=FLANKING
FT   CDS             complement(32630..33175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00340"
FT                   /product="putative cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00340"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83244"
FT                   /db_xref="GOA:F0J827"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:F0J827"
FT                   /protein_id="BAJ83244.1"
FT                   /translation="MAEAWRPAQRRLHWWTAGLVATGFAIAWIMVAVPLRDLLVKFLLF
FT                   QLHKTIGLTVFALVVWRLGLRNRHGRPADADGLSIAERRAAAAGQALLYGLLLEVPILG
FT                   YLTACSAPSGFPTLFLGVIPIPSVIGPDPHLFDLLAPIHRWSAIILIALAVGHALQAIR
FT                   HHRRGRLLLRQMWRASPH"
FT   CDS             complement(33168..33860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00350"
FT                   /product="YceI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00350"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83245"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="UniProtKB/TrEMBL:F0J828"
FT                   /protein_id="BAJ83245.1"
FT                   /translation="MTDGFARASRHASLQAPYPAHLRGVFVDGSPRRMHRAPSLTAVTL
FT                   LALSAFTPARAAELYHLNQSNSTIRFSVGTLGFFRARGHFAQFNATLLIDPAHPTSTRV
FT                   SVTIPTASVVTPWAQESAMIRSPDFFDVARYGKIRFTSGNVTATAPGHYAVHGQLTLRD
FT                   VTRPVILAAHLVKTATDPTTGDTIDDFTITGTVRRKAFGIVADPVFIDNRVDIVIHARI
FT                   LVLASGDG"
FT   CDS             34116..34541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00360"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83246"
FT                   /db_xref="UniProtKB/TrEMBL:F0J829"
FT                   /protein_id="BAJ83246.1"
FT                   /translation="MSIFLNNLGIFSMEQIEEWLLTTSIVYVVNENFLSKSRIFEVVNY
FT                   FYRIGIPEIIIIDGFGDNPELFTKNKYFRYFSKDSSISVDDIIKDPEKYCDMNNIVIIA
FT                   NDRIYYHSGYINKEYLEKIIYNMNNIFQSDDKYVGVN"
FT   CDS             complement(34546..34992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00370"
FT                   /product="putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00370"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83247"
FT                   /db_xref="GOA:F0J830"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:F0J830"
FT                   /protein_id="BAJ83247.1"
FT                   /translation="MCHDRAQQLLREGHRPAERGRLDRPAESRRLLEVSSRRGPRRSTD
FT                   RIQLRKTIDRLEADDILLITRFNRPARSTCDLLNTLATIAEKGAEFRSLGDGGANATAP
FT                   HGRLMLTVLGGMVEFDRERILVLDVRMGPKPKLSLFQRHEALRR"
FT   CDS             35154..35777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00380"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83248"
FT                   /db_xref="GOA:F0J831"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:F0J831"
FT                   /protein_id="BAJ83248.1"
FT                   /translation="MAAFSSLLDILAEVPDPRRAEGKLYKLPHVLLFSILAIISGCNSY
FT                   RGIVTFIDVHRRRLNRSFGLKWRRAPSHTAIRYILQGLDPGAVEAAFRRHAALLQAART
FT                   KPGTASIALDGKTLRGSFDRFHDRTAAHVLSAFTTDTKLVLAHVEIGEKSSEIPAAQAL
FT                   LAELGIAKDTIVTLDALHCQKKPSTSPRRATSTSSSRSRTINRR"
FT   CDS             complement(35591..36259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00390"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83249"
FT                   /db_xref="UniProtKB/TrEMBL:F0J832"
FT                   /protein_id="BAJ83249.1"
FT                   /translation="MFESGESCAVAVLAEGAGGGFAVHEDVEGEAAQSGDDARVGSDPG
FT                   SILGEGDVSDIVGGIFDAPMCADGLGGDGGGERCVGDVEGNVVCQLEQAGFGIAGGDCA
FT                   LDLNDGGDKGMPFGAGERAGGIEDGDGAGFVTIAAAVAGPEDVVWGARCGDMVDRLLQR
FT                   RLIVLDLDDEVDVARLGDVEGFFWQCRASRVTIVSLAMPSSASSAWAAGISLDFSPIST
FT                   "
FT   repeat_region   36673..36680
FT                   /rpt_type=FLANKING
FT   mobile_element  complement(36681..37759)
FT                   /mobile_element_type="insertion sequence:ISAcr1"
FT   repeat_region   36681..36722
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   CDS             complement(36697..37713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00400"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00400"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83250"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:F0IZR7"
FT                   /protein_id="BAJ83250.1"
FT                   /translation="MDVLAREDLPFPQSLPEFQRIFPNDAACAAYLESARWNGGFACPR
FT                   CGVVGEPFRFEARPGVLRCRACRKDVSLMAGTVMERSHTPLSTWFWAAYLIASQTPGMS
FT                   AVQFQRQLGLSRYETAFGILHKLRAGMVRPERDKIGDTPQEHVEVDETWVGGRTRGDGR
FT                   GVHHKVLVACAVEVRHRKPGTKLDNRKDGRYAGRVRLAVVPDRSANSLCGFVENAVAPG
FT                   SLIVTDDWSGYAGLGRRGFDHHAIAECGDPEVAEEFLPIVHLVFTNLKTWINGIHHGVS
FT                   AKHLQAYLNEFTFRFNRRLYPFNAFRSLLGIAGRAAAPTFDELYSGEWTHPTFSGCG"
FT   repeat_region   37718..37759
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   CDS             37737..38465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00410"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83251"
FT                   /db_xref="GOA:F0J834"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:F0J834"
FT                   /protein_id="BAJ83251.1"
FT                   /translation="MGVNRIGKVWRLNMSSVRKYLLHGAVVLLGLTGIARADIYNPTWL
FT                   VTAWTTTNGKIGGTNFIGAASQPVPPAADALASFTYSGQLNFDNTNKQGQSNTYGDFFT
FT                   NTGNISNFSSLSNQTESAFLKTTMSAPGSSNYSYLEFSLQGPATNIAAGTYITITHDDG
FT                   ASSYANGKSVTLSPGETQAVSDTGTLPVGSMTSFAVDYVEANGAPAVLKVDVPEPGSVL
FT                   LLGTGLLVLGLVVRRRQKAL"
FT   repeat_region   37760..37767
FT                   /rpt_type=FLANKING
FT   CDS             complement(38702..39061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00420"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83252"
FT                   /db_xref="UniProtKB/TrEMBL:F0J835"
FT                   /protein_id="BAJ83252.1"
FT                   /translation="MRQRSSIFDDPRSPLDVSDFKPAVGKQRRPAPAAIDEVSSKGRFQ
FT                   SREPEPVAPTQATDDQSSTKRRPMVYRTGRNKVFSVKTDPATADAFYAIAQENGWKAAE
FT                   TFEKAIAALKRELAK"
FT   CDS             complement(39058..39741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="ACMV_P4_00430"
FT                   /product="putative partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00430"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83253"
FT                   /db_xref="InterPro:IPR009744"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J836"
FT                   /protein_id="BAJ83253.1"
FT                   /translation="MPTIVFASPKGGAGKSTSAVILATELAAAGAEITIIDADPNKPVA
FT                   RWSRLPGKPQSLRVIDDVTEKTIIRVIDSEAERAAFVVVDLEGTASRMVPYAMSRADLV
FT                   LIPTRGSVLDAVEAVAAIREVKQQEEAFRLHIPAAVIFTNTSAAIRPRTLSAIEAEFAE
FT                   NGVHVLKTRLHEREAYRALFSFGGTLEALDPANVRNIPAAIENAQAFAREVVGLLRRNR
FT                   GEVNA"
FT   CDS             40192..40404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P4_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P4_00440"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83254"
FT                   /db_xref="GOA:F0J837"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:F0J837"
FT                   /protein_id="BAJ83254.1"
FT                   /translation="MNHADTKTDDRNARHRQRIRASGAREVLFQLPEETLALIDDIKKR
FT                   QRLPSRSQALLQLIERGKEAIQKSA"
XX
SQ   Sequence 40588 BP; 8122 A; 11958 C; 12414 G; 8094 T; 0 other;
     atggagacgg aaagtcccgg tttcgggcga aataccaata taaatcagag gcctggcgga        60
     cttcgccggt tgagcctggc gatgattgcg acggaccgga ccgcggaagg tttcaccgga       120
     ctgtcagacg gggcaggggg gccgggcgcg gttctggcgg ccttcaaggc ggcggcgccc       180
     tatctcggcc tgccgccgcg ggtggtgcat gcggtggact ggctgttccg ctttacccag       240
     cggcaggact gggagccggg ggcgcgtccg gtggtctggc cgtccgctac ggtccagcag       300
     gcggatcttg atctgggggt atcgcagacc aaggcgctga accggcttct ggtcgagctg       360
     ggcctggtgg tgatgcggga cagtccgaat ggcaagcgtt acgggcggcg tgatcgtagt       420
     gggcggattg tcgaggcgta tgggttcgac ctgtcaccgc ttggggtgcg gctcgaggaa       480
     ttccgggctg tggcggagaa ggggcgggcg gagcgtgagg cggttcgcca gttgcgccgg       540
     cgggtgacga ttgcccgcaa ggcgatcgag cagatcgtgg aaacggcggt cgaggtcggg       600
     ctggagccgg tggcttttgt gcgggaggcg gaggaggcgc gtcggctgtg ctggcgtctg       660
     ggcaaggagg agagatccga tgtcctcgcc tttggcgtaa cccggctcga ggaccgtcat       720
     ggcgagctgc gccagcggct tgagagcctg atcgccgata ggcggggaat ggcacagaaa       780
     gatgtggaaa ccgaccccaa ggggccggaa aaccggcccc accaatacaa atacaaatca       840
     aaccctgatc ctgaacagga tacggtatct ggcattgaga aaagtagtcc gaccccggtg       900
     aggtcggtgg ccgcggtcgg caagccggga ctgcgggacg gatcgtcggg accacagacg       960
     gggagggggg cgcaaaaacc cgcccggcag gacgatggaa cggtgctgcg gatcacaccg      1020
     gacgagctag tgcggctggc accgcggctg cggccgtatc tcgggcggtc atcgccggcc      1080
     tggccggata ttgtggaggc ggcggactgg ctgcggcatg atctcggagt gtcgaagccg      1140
     ctctggggtg aggcatgcct tgccatgggc cgggagcagg cggcgattgc gctggctatt      1200
     gtctcggcac gcccggcggg gcatttccgg agcacgcccg gggggtattt ccacggcatg      1260
     gtcaccaagg cccgggccgg cgagctcaac ctcggcaagt ccatctgggg cctgcgcgcc      1320
     caggacagaa gttcagggcc gggaaaagcc gcaccgcgac actgtggacc ggaggggctt      1380
     gccattccgc ggatttcgac ctgattgttg cagcagagga gtggtttcac gagatcctgc      1440
     tgcagcgcgg gttttgtccc gaggatcggg cagggaagct caaggtcagg tattatcacc      1500
     ctgactatcc gcagttcggc tggcaactgg tcacaggtcc catgtttgac ggtcgcgcgg      1560
     atctgatgcg tgttgcgcag ttccagatta atgcggggag tgttgttgtc ttgccggcga      1620
     tcgaagacct tattggtgac cgtctggggc agtatgcggg ggacaagccg ccggatgtat      1680
     cacgcctgat accaggcacg ggttcttttc gagatggcgg acaagatcga ttccgcctat      1740
     ccgcctattt gaagaagcgg gtagaagagg aaggcgggga tatctcgctc ctggacggcc      1800
     tggattcgga atcggagcca tgaggacgat caagctcgag acacacctga aaaggactgc      1860
     cgcgaaagcg cgtgaactcg acgctgccgg ccggaacgtg ccgactgacg ctctgcggaa      1920
     cgctggaaag acgcggacca ctgcgaaaag ggtcctattg gatcgggttg aaaagcgggc      1980
     acgtgccgca ggaaaaaagc ctgtcctcag ccactattga ttgttccgaa gcttcgcgag      2040
     ccacgattca atccggaatc ttccgagtgc tcggacccgt cccgtgcagt cgccatggac      2100
     ggggtgcatg ctaccctggc atccgaacat gcgaaagcca ccggttcgcg gtgaagcgct      2160
     atccggttgt tttcacgccg gaggcgcgtg actagctggt tgcgctgtat cgacggatcg      2220
     cgaccgcggc ttcgccggac atcgcgttgc gctacaccga cacgatcatg tcccgctgtg      2280
     aggccttgaa cttgtttccc ggacgcggga tcgcctgcga cgatatccgg gtgggtctga      2340
     ggattaacag tttccgaaaa ctgcacggtg attgccttta ccgttggtgc cgaccgcgtg      2400
     gcgatcctcg gaatatttca tggcgggcag gattatgagg ccgcgctcga ggccagagac      2460
     atggactgaa ggcgcgcggg gccggtcatt ccgcaccctg ccttctccag gcccgtcctc      2520
     ttctccgcat gccaatccgg tttgctccgc tttgaactgc cggcgggcag aactctgtcc      2580
     agcggcaaga atgacacttg tagccacaag tgcggtgggg tagggcctgc tcgcctgcgg      2640
     ctcgacgcgc gtatgagggc cggcggcgat ccggccagaa gcggagaaga agaaacacga      2700
     cgatggacac agcctacccc cgacagatcc gctctgcgcg cgagacccgg acagagatag      2760
     tccgggtgcg ctgcacgcct tccgagcgca aggcgatcga ggagctagcc aacgttaccg      2820
     ggcagtcgct gagcgacttt gtacgggcgg gtgcgctgtc agtggacatc cgggggcggg      2880
     tggagcagcg ggcgatctac gcgttggccg atgcggtggg ccacatgaac gtgctgggcg      2940
     cgcaactgaa acagtggcag acggcacggg acggggatga cgcctcggcg gcctcggccg      3000
     agcgggtact ggcggatatc gaggcggctg tccgagatgt tcacgagaag gtggcggcgc      3060
     tgtgatcgtg cgccggatct aggcgcagaa gaccagcgtg ctgatcaacc ggctgcaggg      3120
     tgggctcgac aaggagcgcg tccatgaggt cgtggcgttg attgacgagg ttgcaggcag      3180
     gatcgaacgg ctctgaccgg tagaaccggc ttgaacggaa tgtcgcgggc acggaacctg      3240
     cccgcgacag ggaaaaccac ctgaggaata tggagcggag aaaatagcag aggcaaagtc      3300
     ttgtgtccgg gcctggatga tataaactaa gtcctgtaaa ctaaactagt gtgtgccgta      3360
     atgcggacct ataacattca cgaggcaaag acccatctgt cccggctgat cgagcaggct      3420
     ctgaaggggg aggggttcct gatcgccaag gcgggcaagc cgctggtgaa agtcactgcc      3480
     ctgggcaaac cggaagcatc cagcacccgg cggctcgggt tcatggccgg gcggatgagg      3540
     gtgccggacg atttcaacag gatcggggct gacgaggtcc ggaagctgtt cgaggacgat      3600
     gcgtgaagct gctgctggat acgcatctgc tgctttgggc cgcagagaat gcgccgcgga      3660
     tgccggaagc cgcccgggaa ctgatcgccg atccggggaa cgaactgtat ttcagcgcgg      3720
     ccagcctgtg ggagattgcg atcaagcaag ggcttggccg gccggatttc gaagttgacg      3780
     cacgggtatt gcggcgcgga ctgatcgaca atggttatct ggaacttccg atcctgagcg      3840
     aacatgcggt ggcgatcgag ggtttgcccg cgatccacaa ggatccgttc gaccggcttc      3900
     tgattgtcca ggcgatggtc gagggaatca cgcttttgac caatgatgcg gtcgttgcac      3960
     ggtatcccgg cccggtccga tttgtttagg tttcctccgc ccggtgccgg tcgcaaacat      4020
     gaagaggatg ctgttgtttg cctgcctcga ccggtacggg aacagtgtgg gcacagaaac      4080
     cgttccgcta gagggtgcag acacgaaagt gaattttacg tacgcctaac gtgaacgagt      4140
     ggtgaacgca ggcgactaga aggcctgaag taacgaaacg gcctgcgctg tagcataagc      4200
     ggacaaagca ggaacatcag gcggccttta tggtcgtgtc ggggattggc ctgagaggtc      4260
     gcaatccggc atggttttcc gtcgatttct gattggcgct ccagatgtag tcgccggtca      4320
     ggttcacatg ctcccagccg atcggcgaga gatgcgtgag gagggttccg ggcacatcct      4380
     cgacctggcg tagggcctgt atggcttgcg cgagatagcg tgtgttccag aggatgatgg      4440
     cggtgaccag gggggggtca ccgcacgatc tgttcaaaat cgtacgctaa gcggcgcggg      4500
     gtatgaacgg agcgcgaaca tcgcgtagcg gcctgaagct ggcattggga ttggcgggat      4560
     tccagacata atcgccggtc agagcgatgt gttcccatcc gagcggcgcg acatgcgcca      4620
     ggagatcatc gggcactgcc gtaccctggg cccgcaggtg ctggacggcc tggtcgagat      4680
     agatggtatt ccagtggacg atggcggcgg tgatgagact gagcccggag gcccggaagc      4740
     tctgattttc gaaggtgcgg tcgcggattt caccctggcg atggaagaat acggcgcggc      4800
     gcagggcatt gctggcctcg cccttattga gcccggcatg actgcgctgg cgcagagcgg      4860
     gatcggacag ccattgcagg gtgaacaggg tgcgctcgat ccgccccaca gcccgtaacg      4920
     ccctggacag agtgtttcct ccaccggcgg cggccagctt ccgcaagatg acggaaggca      4980
     gaacagtgcc ggcattgatg gatgccttta accgcatcaa ctccggccat tgcccgagga      5040
     tggcggtggt ttcgacggcg tcgccgatga gcggcaccag cagcggccag gtgcctggct      5100
     tttctatcgt gtagagcttg cggtcccgga gatccttgat cctgggggca aacctgtaac      5160
     ccagcagatg gcagagaccg aagacatgat cggtcgcgcc ggcggtatcg gtataatgct      5220
     cggcgatgcg cagatcggtc tggtggacat gatgcagcag cccgtcgagc acataaggcg      5280
     cctcgctcat cgtcgcggag atgacgcgcg tgtggaacgg tccgtattga ccggaaacat      5340
     gggtgtagat caccgcgccc ggctcgatgc cgtatttggc gtttaccgag ccgccggctc      5400
     cggcgcggcc tgcggcccgg aaatattgcc cgtccgaaga cgagcttgtc ccatcatccc      5460
     agattgccgc catggggtgt gcatggtgcg cattgatgat ggcggcgcgg gcggcgacat      5520
     aattgtcatc gctgatgtgc cattgggcca cattgaccag gtggtgatag ctgagaccgc      5580
     gcgaggcgtc cgccatgcgg gcaaggccaa gattggtgcc gtcagcgagc accgctgcca      5640
     gcagggccgc tttgtcggtg acggggttac cggtgcgcag atgcacgaac ctgtccgtga      5700
     acccggtcca ggcatcgacc tcgctcaaaa cctcggtgat ccgcacccgc ggcagcatac      5760
     tgttcagccg cagcgccaga tcgcgagccg cgtcgggcac ggtgggcggc gtgcgggcga      5820
     taaaaagttt gccgtcctca atctccaccc cgtcgaggtc gccctgcgcg gcccgggcgg      5880
     ccacgaaggt cagacgctcg cgcagcatct ctgcccggct tgcgacgtaa cgatcgggat      5940
     cggcctcacc atcgatgccg gtggccgcac ccgccccggc cggaagcaga taggtctcga      6000
     acgcctggta atcgcggctg ccagcgaccc agatattact gccccgcagc ttgtcgcgca      6060
     gcacggccag caccgctgtt tcatagagcc gccggtcggc tgtgccgccg gcaaaaatca      6120
     atttccgcca ctgcggcggc aggaacgtgg agggcggccg cttgggcaag ctgcggatcg      6180
     cgccacggtt cagggcgcgg agaagttcga tcgcggccag aacgggatcg ttcggcatat      6240
     tcgaccggaa atcgaaggcg gccaggaagc gggggctgaa ccggcggagc accgtatatc      6300
     gctcggccgc cgtgaccaaa atatcctgat ccgccacatc ggcgacggcg ccgatgatcg      6360
     gcagcacatc ttcgagctgg ttcatgccga tctcgcgctc gatggcggtg atcccatctt      6420
     ctccggcctc cttcgcctgg cgaagggcgg cgatcgtccg gcggaacagc agtagcgcct      6480
     tggcgacatc gcgccgcgtg gcctgaaacc gacgctcatc gcggttgcgc gcccggctga      6540
     acaaagtgcc gacatatttc tcgaacatgg caagcgtcgc gtccgtcaga cgggtttcca      6600
     ggcttgcgat ctgggcaatg agaatggctg tgcgccgcgc cggctccaga tcggcgatgt      6660
     gctgcacggt catgagcgcc ccctcgtcgg tcagccggac caggcgggca gcatggatac      6720
     gaccagcccg tgcgggatca atgcccatgg cgcggacata ttcgaggcga tcgagcaggg      6780
     agacgatgtt ggagggagct ggtgattccg aataatcccg cagccaggca aaacgggagc      6840
     gacgcaactc gggatcgacc gtcagcagct cggtcagagc actgcgctcc gcatcggcca      6900
     tcccggctgc cagcacctcg aatgttttct tgcgtgctcg gacacgggcg gccagtccaa      6960
     ttcgctccaa cactgtcgcc gagggaagca atacccggct ttctctcaga tgaacgagca      7020
     tagcctggat gatgggttcg ccgcgatctg tggcccaagc cgtatccgca ccagcatgta      7080
     ggcaggcgcg ccagtcatcg aggccaaaac tacgcagacc agtgaacttt tggagctcga      7140
     ccaaatgctc ccgacgggtt tcagcacggc gcgcgtattc cgcaaacaac aaaggatcga      7200
     caccgatctg ttcagcaaca aaagccagcg ccggcgccgg tggatattcc gatggatcca      7260
     gagtgcggcc tgggaagcgg agaacacaga gttgcacggc aaagccgagc cggttgcttg      7320
     cccggcgtct gaccctgacc atagcgaggt cagcagcatc cagtacgtaa tgccggctca      7380
     tggaggccat gtccgttgga attgaaaaca aacgggctcg ttgttcagcg gataaaagaa      7440
     cgcggagtgg catatcgggt tccggttgat gagaaaatta gcgcccaccg tgcgtccgca      7500
     agaggatcgt tcaacggaca gatgtaacgg cctggcactg gtggctgttt ccctcggcaa      7560
     cggatggatc atttaactgg tacgatatct tttgcaatga aggggggtca tacgttacaa      7620
     ttccgcatgg cccacaccct gatcggttac gcccgctgtt caaccgaccg gcaagatctc      7680
     gccgcgcaac gcgccgaact cgaacagctc ggggtaaagc cggaccgcat ctatacggac      7740
     catggcctca caggcaccaa tcgtgcccgc cccgggcttg ctcaagcctt ggcggcggtg      7800
     cgtaaaggcg acaccctggt cgtgccaaaa ctcgaccgcc ttgcacgctc cgttccagat      7860
     gcccgtgcga tcgccgatga actcattacc cgcggtgtca aactcgcgct cggcgcggcc      7920
     gtctatgacc caaccgaccc aatggggaag atgttcttca acattctcgc caccttcgca      7980
     gagtttgagg ccgacctgat ccggttacgt accagagaag gcatggccat cgctcgcgcc      8040
     aaaggaaaat tacgcggcaa aaggccgacg ctatccgaaa gacaacaaaa agaactgcgc      8100
     cgcatgtacg acactggcaa ttattccatc actgatctcg cagacctatt ctccgtctcc      8160
     cgcccaacca tctatcgtac cctcgccagg cagcccgcca acgcttagcg tacgattttg      8220
     aacagatcgt gcggtgaccc caggttcagg ccggaggctc gatgtttctg gttttcaaag      8280
     gtccggtcgc ggatttcgcc gagccggtga atgaagacgg cgcgggccag gctattgcgg      8340
     gcctcgccct tgttgagttc gtgactgctt tcacggcgca gtcccggatc ttccagccag      8400
     tcgagggtga acagtgtgcg ctcgagacgt ccgagctcgc gcagcgccgc ggcaacggcg      8460
     ttctgccgtg gataggcggc gagttgccgc aggatcaccg acgcagacac tgtgccggtg      8520
     cggattgagg tggcaattct caggagatcg ggccaatggg cgcggatcag gtcgacgttg      8580
     atgcggccgg cgatcatcgg cgcaagcgtc ggataggctg ccggccgggc aaaactgtag      8640
     aggcgccggt ccttgagatc gggaattctc ggcgcgaaca cgtatccgag cagggcgcac      8700
     agggcaaaga catgatccga caccccgccg ccatcggtat ggtgccggtg ctgacgtggc      8760
     ggcgcttcgc cgtgatgatc gagcaggcca tcgaggacat gcacggcctc gctcgcggtc      8820
     gcggcgatca ccctggtgtg gaacggtgca tagcgatcgg agagatgggt gtagaatttc      8880
     aggtccggtt cagggccgta gtgcgcattg atccggctcg catcacggcc ggagccgccg      8940
     gcgcggaaga actgcccgtc cgaggatgag gcggttccag acccgaagag ggcggcgagc      9000
     ggctcgcggt tctgatgctc gaccaggcgg cgcagcgcca gggcgtaggt ctcgtcgcgg      9060
     atgtgccagt cagcggtcca ggcgagctgg cccagactgg cgatgctgca ggcttccgcc      9120
     atccgggtca ggccgagatt gaggccatcg gccagcagcc ccgccatcag cacccgggga      9180
     tcagcagcgg tttcgccggt gcgcagatgg gtgaagcagt ccgggaagcc ggtccagccg      9240
     gccacttccg tcagcaggtc ggtgatccgg atgcggggca gcgtggcata gagcttcgct      9300
     gccagcgttt cggcctcggg cggagtcgat ttttcgatcg gcgtgattct cagcacgccc      9360
     ttctcgatcg tcacatcggg aagcagcccg ccccgggcac gggcgtcgac ctcggccagc      9420
     cgcgcatcca gccaggtgcg cctggtcgcg atgaagcgct cgaagtcggt ctcgacggcg      9480
     accggaatgc cggactcttt ctgcaggacc tgcaatgtct ctctggagat cagccgctcc      9540
     tcgaaggccc gatattgccg actgccggta acccagacat cgcccgcagc aaggcgctga      9600
     cgcaattccg ccaggacgca gagttcgtag taacgccggt cgatgccacg tgccgtgagg      9660
     acatgacgcg cccagcgcgg ccggacaaag gcggtcggcg ctgacttggg cagcgtcgac      9720
     gctcccgcgc tgttcatggc gcgcagcatg gcgatcgcgc gcatcaacga cgccgcggcg      9780
     ggaacaccct gaaactcgaa agcggccaga aacgccggcg cccagcgccg aatgccagca      9840
     taatggtcgc tcagcacctc gtaaggatcg aaatcctcag aacgaaccag agtttcggct      9900
     tcaacaacgg tcgagcagaa ccgctcccag ggtatcacct tgtcgatcgc cgcgaaggga      9960
     tcgccctggc cggcgcgcgc ggccatcagg gcggcgccaa tcctcgcata aagccggacc     10020
     ttctcgttga tcgcccggcc ttcggcctgg aacgcccggg catgtcggcc ttccgccttg     10080
     cggaacatcg cgccgatcag ccgctcgaac agattgatcg cctgatccgt caggcgggcc     10140
     gacaggtcga gagcgatcgc ggtgagcacg gcatgccggc gccggcgctc gtagccggca     10200
     acatgctgca ctgtggttcg gccggcctcg cgaacgagct gggcgagccg ggcctgattg     10260
     atccggtaac cgcgctctgg atcgatgccg attgcccgga tatgctccaa cctctcgatc     10320
     aacccgagca tggatgccgg ttttgccgat tccggaatct ggcggagcca tgccagccag     10380
     ctctggctgg tgtccagacg ccgttccgtc agcgtatcca gcccatgccg ctgatcggcg     10440
     gacagaccct cggtcagccg gcgctcgatt tcccggcgcg cgcggtatcg aacctcgatg     10500
     cagagccgct cgagccgcgc cgggggaggt agaaggatcc cgcgaccgcg gcactcgtcc     10560
     aggaccaaag ccgcaagatc gaccagccgg tcggtttcca gcgcatgcgc cagcagccag     10620
     tcggcaaggt ccgccgccac ccgcggcccc catggccgca acccaagacg atcctgcaaa     10680
     gccgccgaat gccggcgccg gttttgatcc acccccagat aagcaccgag atactccggc     10740
     aagacgtcga cctgtgcggc gacgaacgcg accagggcag gatcgggtgt ctcgccggca     10800
     tggagcggcc ggccgggata tcgtaggtaa cagagcatca gagccagacc gagacggtga     10860
     tgatcgccgc ggccgcgccg gatcaccgca agatcagcag cggacagcgt gtaatggcgg     10920
     atcatcccgc ggcgatcagt cggcgggtca aacagctgcg cgatctgttc cccggtcaat     10980
     atccgtcgat gacccactgg tccctccctc ctgtttgttc aggccgggag accagccgat     11040
     ccgggccaga gagtcgacca gcgtgctccg cgaaatgccg aaagtacggc aggccgacga     11100
     tttcgtggcg ccggtgtcga gcgcggtgat cactgccgcc agcttctcgg cgtcgatcgc     11160
     caccggccgg ccgccccgcc gaccccggcg acgggcggcc gccagacctg cctgcacccg     11220
     ctcctggatc agcgaacgct cgaactgtgc cagagcgcca aagacatgaa acaggaattc     11280
     cccctgcggc gtcgtagtgt ccatctgctc ggtcagggac cggaagccga cgccacgagt     11340
     cctgaggctg ttcaccgtct ccagaagatg cggcagcgac cggccgagcc ggtccagctt     11400
     ccagaccacg aggcaatcgt ccgatttcag ataggccagt gccgcggcga gacccggccg     11460
     atcgcgccgg ctgccgccgg cacggtcctc gaacagatgc cgctcatcga ccccggctcc     11520
     gagcagggca tcgcgctgca ggtcgagcac ctgtcggtca ttgtcggtcg agacgcgcat     11580
     gtaaccgatc agcatgtacg gaaatcccct tcgagacggt ttccgtacat catgccattc     11640
     cgacggtgtt ttccgtagat gattcggcgc aaaattcggg attttgcggc aggtctcgga     11700
     ccaccgacgg aaaacaggtg ttttccgtca tcgcgcgatc ccggcctcaa aaccgcgctc     11760
     tccgctcaaa cccgcagaaa acctccatcc caaccagtca acgttcccac tttgtccgct     11820
     tatgctacag cgcagggcgt ttcgttactt caggcctatc tgcccaacgc agaggcgctg     11880
     cccctgcacc ccgttctcgc cgaagggcag gggtgcagga ggacaagggc gaagcccgct     11940
     gggctgtgcc ccccatccga taggctcagg gccgctccag ggcgtcaagg accggctccg     12000
     cctgccgtcc tctcccgttc ggtgctcgcc tacaggctgc gctccgctgc ggcctccggg     12060
     cggctccttg acgcctctcc acagccagaa aagcaaagtg gcattgacaa aagaaagatt     12120
     gttgtagtaa cgtttatact caatctgatt gcccctgaca gcaggagtgc cacccatgac     12180
     catcaccacc ctatccagca gggagttcaa tcaggacacc agccgggcca agaaagccgc     12240
     ttcagaaggt ccggttttca tcactgaccg gggcaaaccc gcacacgtcc tactcagcat     12300
     cgaggaatac caccgcatca cgggaaagcg ccgcagcatt gctgacgcac tggccatgcc     12360
     tggccttacc gatatcgaat ttgacccgcc tcgcgtcagc attggccttc gccccgccga     12420
     tttctcctga tgttcatcct cgataccaat gtcgtctctg aactccgcaa ggtgcgcctg     12480
     ggtaaggcgc accctcaggt ggccatctgg gccgacagcg tagacgccga aaccctctac     12540
     atctcggcga tcactatcct cgaaatcgag atcggcatcc tgcaaatcga gcggaaagac     12600
     cccgatcaag gggatttgct gcgcgcctgg ctggaaaagc aggtgttgcc cgagttcgaa     12660
     gggcgcattt tcccagtgga tacagccgtc gcccggcgct gcgcgacttt gcatgttcct     12720
     gatcctcacg ccgaacggga tgcactcatc gccgcaacag cgttggccca tggcatgacc     12780
     atcgtgaccc gcaacgtcgc ggactttcac acaaccggcg taccgctcct caatccatgg     12840
     gagccggagc actgaaatcc aaacccacat cccccgcatg agggggacaa aatgtcggaa     12900
     gcaagaacag atcaccgttg agtgacatta cgcttcggct ttcctcggtt ctggaattgt     12960
     tgccggagcg tcggctttac cgttcagcag atcagcgaag agagccttgt cgtcttcgcg     13020
     ggtgaggaag cctgggagct cgcgtcggag ccagttggcg agacgttcgg agaattcggc     13080
     atcggcgttg tgttcgagac gatcaagcac cagtgcgccg atgaggattt tacggcgggt     13140
     gtctctggca cgatcctgct ttgccagccg tgccttgaga gtcttggcac gggcttcaag     13200
     ctgggcgatc tgctgttcaa tgggtttgcg agccatgggt ttcctcggtt ctgtcgtgat     13260
     cgacggcagc gacggttcga cgtgccttgt cctgcatctc ccacaggcaa ttcgggcaga     13320
     ggcaatgtgc tgcgtcatct gcgggcatcg gtgtgacggt cggcagtttt gcgcaccagc     13380
     aaccgccttc aggctggcag atcatcggcg ctcggcaacg tggacaaatc gattgcattg     13440
     atcggaatat caccggttct tgctcaaact tccagtatcc tgtctgatcg gccattcata     13500
     tcgaactgta aagtgctgaa atcctcgaca tatcaggcac ggaacatccc gccagcatga     13560
     cgccatcgat cacgaagagc gaaacgtagt atagctctaa gtgcgcactt acgagttgct     13620
     gcgcaactca gtgcggggta aggtgggtgt ggaatggcga tctaccatct gagcatgaag     13680
     cctgtggccc gtggctccgg tcgcagtgca gtcgcggcgg cagcgtatcg cgcggccgat     13740
     cgtcttgaga atgcacgcga tgggatggtg catgacttca gtcggcgtca tggggtggag     13800
     catgcagaga ttattctccc caatgacacc gtagcggcag acggtaccgt tgttcatggc     13860
     gtaggtcctg aatgggcgcg tgaccgatca gcgttgtgga atgctgcgga attggcggag     13920
     agacgcaagg atgcgcgggt cgctcgcgaa atcgaggttg cgctcccgca cgagctgtcg     13980
     gcggagcagc ggctggcact gacgcgggat tttgctcagg ctctggccag gcagtacggg     14040
     gttgcggtgg attttgcgat ccatgcgccc cacggtcata ccgatgtccg caaccaccat     14100
     gcccatatcc tgctgaccac gcgacggatg atgatcgggc gtggcgaggc ggggcgctgg     14160
     atcggggcca tgccggccgg tttcctgggc gagaaatccg aactcgagct tgagaacaag     14220
     aagctgcagg cgcttggtct gccgacctcg catgagcagc ttcgggatat tcgctccggc     14280
     tgggagcagc ggacgaacga acatctggtg cgtgcagggc tggatgtgcg gatcgatcac     14340
     cgttcgcatc aggagcgcgg gctggagatc gagccgacgc agcacatggg cgtgaatgcg     14400
     acgcagatgg agcggcgtgg caaggtcgta tcgcgggttc ggatcgatga ggacgccgcg     14460
     aagcgtaacg ccgcgctgat ccgggagcgg ccggatcagg tgctgacgct catcacaggc     14520
     gagaagagcg tattcgatcg tcacgatgtg gcgcgggcgc tgcaccgcta tatcggcgat     14580
     gccgatgcgt tccaggcggc gtttgcaaca gtgatggcgt cgcctgccct ggtggaattg     14640
     cgggccgagc agcgcgacga gcgcgggcgg gtgatcgagc aagcccggta ttcaaccagg     14700
     gaaatggttg gcatcgaacg cgatatggcg attagcgccg atcgcatggc ccaaggtcgc     14760
     gggttcggtg tcgctggccg gcgtgtggaa gcggcgattg agacgcggcc attcctggcc     14820
     gacgagcagc gggccgccat cgagcatgtg tgcgggccag agcgtatctc tgcggtggtg     14880
     gggttggccg gggcggggaa gagcacgatg ctggcggcgg cccgcgaggc gtgggttgcg     14940
     caaggctacc gggtgcatgg ggcggcgctg gcgggcaagg cggccgaagg gctggaggag     15000
     tcggctggca ttgcctcgcg cacgctggcc tcatgggagc ggggctggga acgagggttc     15060
     gaccggctcg ggccgcgcga tgtgctggtg atcgacgagg ccggcatggt cggctcgaag     15120
     cagctttccc ggtttatcac cgaggcggac cgggctggtg cgaaaatcgt gctggtgggc     15180
     gatcccgagc agctgcagcc gatcgggccg ggggcggcgt tccgtgcggt ggctgagcgg     15240
     gtcggttttg ttgacctggc ggaaatccgc cggcagcgcg aggtctggca gcgggcggcg     15300
     tcggtggcgt tcgggcggca ccagacagag gagggtttgc gcgcctatgc cgagcgcgat     15360
     gctgtccggt ttgaggcaac cgcggcggat gcgcgggcgg cgattgtgcg ggatgtgctg     15420
     gccgatatgg aggcgcggcc agatggctct cgcctggtgc tggcgcaccg caacgcggac     15480
     gtgcgggacc tcaacgaggc gatccggacg gttcggcgcg agcggggcgc gctgacggac     15540
     gagcgggttt atcgcacgac cgagggcgag cgggcctttg cgccggggga tcggctgctg     15600
     ttccgggaga acaaccgcga gctgggcgtg aagaacggga tgctgggcac ggtggagttg     15660
     gccgaggacg accgccttct ggtgtggctg gattctccct ccgggcctgg gcggggtcgg     15720
     tcggtgtcgg tctcgatggc ggattatgct gccgtggatc acggctatgc caccaccatt     15780
     cacaaggcgc agggggcgac ggtggaccgg gcctatgtgc tggcctcggg cacgatggac     15840
     cggcatctga cctatgtggc gatgacgcgg caccgggacg gggtgacgct ctacgccgat     15900
     cgggaggaat tcagcaccgt ggctgccctg tcggcgcggc tgtcccgatc ccaggccaag     15960
     gaaaccacgc tggactatga tcgggcggac tatgcccatc ggcgggggct cgatgtccgg     16020
     ccacgggagg cggtggtagc gcacgagatc gcggcgggac gcgctgggtt ccgggagcgg     16080
     tacgaggcgc atcggcagca gcaggcggcc gaggcggcgc gcaacaaggg agcgcatggg     16140
     ctggtgcggg agtgggcgcg gcgatcggag gcatacaaca aggcgctgcc ggggctggcg     16200
     gctgatccga ctctggtcgg tggggcgcgg gcggagctgc tggggtttga gcagttgctg     16260
     gatcgtcatt ccgaagcggc acagtggctg cgggcgcgtg gccatgactt cggggtgaag     16320
     gatggatctg cactggcgca ggtgctggca tcgccggatg ccgggcgggc catcggccgg     16380
     ctgattgaag gcgcggaaga gcggatgcgt ggccagctgg cgcgtgaagc cgagcgggtg     16440
     gccgctcgaa agcagcagga aagatccgtg tcgcgggatc gggggatgtc gatgtgagta     16500
     gtgctgagga acatctctac gggctgatgg agatcgccga gcagcagcag gcggctgtgc     16560
     agcgggcgct gaacggcctt gctgaggagc gggcggcgct agcgcaggag cggcagaaac     16620
     tggcggagga agcctcgagc ctcgaagagc gggtgcgtga ggcggtcagc gccgcggtga     16680
     caacggcgct ggagcaggtg ggcaaggaag gtgtggcgac ggtccgagcg gcaaccaaac     16740
     cgatgctgga ggatctggcc gggctggcag ggggcatggc ggttgccgag gaggcgttgc     16800
     gccggatcgt ggcctgggcg agctggcggc tgctggggtg gatcgtggcc ctgaccgtcg     16860
     ggttgatgct gttcggctgg ctgagcagca cggccgttgt ctggtgggat cgcaccacgg     16920
     tcagtcagct acggggcgaa atcgccatgt tgcaggccaa tcacgccgcc tgggtgaagg     16980
     cgggaatgct cgacaagatc acccgatgcg gggcaaacag ccgcccctgc gtcgccatca     17040
     accaaagcgc cggggcatac gggaacagcg gcgagtatcg cgtcctcaag ggatattagg     17100
     tcatcatgtc cgctgaggtg gttattcttg acgttaagtc gcgattgcgt gtgcagacgg     17160
     ggtgtaacca gtggtagaaa tgccacgatt tcaccttatt tggcaggtgt tttaaggagg     17220
     ggcgcacgcg ggctatgact gccgaagatc ttgtttagag caaaggtggg acatgacaga     17280
     actatctgaa ccgggctcga cgattcgaga gttccggcag ccggtgcatt tctcgctgtc     17340
     ggcagaccgt ggctgggggc agcggtttca gctaattgca acagatatga aagatggcgt     17400
     ccgactctgg cggttgattt ggacgctcgg cctgtcggat atcaagctcc gttatcgtgg     17460
     atcggctcta gggccgttct ggctgacgat ttccatgggc gttcagattg gggcgatggc     17520
     gtttctctat gccgatctgt ttcatactga tattcacacc tatctgccgt atctgtcgat     17580
     ctcgattgtc ctctggggtt atctcaattc cctcatttcg gatgggtgtg tctgcttttc     17640
     gagcgcggat actcttatta agggcactcg catgcctttt accgttcatg cggcgcgcag     17700
     tgtcgttcgt aatacaatcg tgctcgggca taacctcgtc gtagttgtgg tcgttttcgc     17760
     gattatgggt gttgatcaga gtctatattc cctgctggcg ataccggcct tcttgctctg     17820
     gctcattgat gcgttcgcga tctctctact ttttggagcg ttttgtgccc ggttcagaga     17880
     cgtgccgcag atcatcatgg cgttgatgca gattgcgttc ttcgtgacac caatcatgtg     17940
     gtacgccaag attcttgaaa ctcatccgag agccgttctt ttggtcaagc tcaatccgtt     18000
     tttctatatt ttggaaattc tacgcgcgcc gttacttggt tcaccaatga gcgtcgacat     18060
     ggtgctgaaa gcactaatca tctccgctgg gatcattatc atcagtatca ttggctttgc     18120
     ccggacgcgt gggcgcattg cgtactgggt ttgacagcat ggcacatctt actgccttca     18180
     atatttcagt cgatttccca ctttatcata gtgatagtcg gtcgctgaaa aagacgatca     18240
     tgggcagggc ggcgagccgc ttcggacagg atcaaaagca tcgtccggtt gttcaggccc     18300
     tgcggaatat ctcgttttcg ctccgctcgg gtgatcggct tggattgatt ggttcgaacg     18360
     gttcgggaaa gacaacgctt ctgcgggcgc tctcggggat ctaccagccg acggtaggtt     18420
     cactttcgat ggaaggtcgg ctgacctcct tgctcgatcc cggacagggg atgaacacgg     18480
     atctcactgg ccgggaaaat atccagctcc ggggccaatt ccttggctta cctcgtgctg     18540
     agattgatcg gcttgaggcc gacgtcgagg atttctccga acttgcacag ttcctcgatt     18600
     tgccagtgag gagctattcg tcgggcatgg ttgtgcgact tgcttttgca atggctacag     18660
     cttttccacc tgagctactt ttaatggatg aatggattct ggccggtgat gctgccttta     18720
     tggaaaaagc caagaataga atagaaggta tggtacggca cgcagatatt cttatactag     18780
     caagtcattc tcctgttatt ttagcagaat ggtgtaatcg tctggttttg ttagataatg     18840
     gccagataaa agcggatgga gaacccatgg atattcttga agaatatctc ccatctaccg     18900
     caattgaaga agtaaggctt acggtttctc aaaagcgaat gagaaagcaa agggttgttg     18960
     aggaagaatc gaaggatctc ccgtgacgaa atttctgatc accgggggct gcggcttcat     19020
     tggttctgcc gttgtccggc ggctgctggc gagcgcggcg catgaggtcg tcactgtcga     19080
     caagatgacc tatgccgcct cggaggacgc gctgggcgct gcgctggggc atccgcgcca     19140
     tcgtctgatc cgcgccgaca tcgccgatgc cgcggcgatg cgcgccgtct tcgaggccca     19200
     ccggcccgac atcgtcatgc atctcgccgc cgaatcccat gtcgaccgct cgatcgacgg     19260
     gccgcgcgat ttcatcgaca ccaacatcac cggcaccttc gtcctgctcg aggccgcccg     19320
     cgcctggttc gccaccctgg acgagcccgc ccgccgccgc ttccgcttcc accacatctc     19380
     caccgacgag gtgttcggcg cgctcgaacc cggcgatccc cccttcaccg aaaccacccc     19440
     ctacgacccg cgcagcccct atgccgccag caaggccgcg tcggaccatc tcgtccgcgc     19500
     ctggcagcac acctacggcc tgcccaccat cgtctccaac accaccaaca attacggccc     19560
     ctggcagttc cccgagaagc tcatcccgct ggtgctgatc aacgcgctcg aggggcggcc     19620
     cctgcccgtc tatggcgacg gctccaacct gcgcgactgg ctgttcgtcg aggatcacgc     19680
     cgaggcgctc gtcaccatcg ccctcaccgg cacgccgggc gagacctacg ccatcggcgc     19740
     ccgccagccc cgctccaatc tcgacgtcgt ccgcgccatc tgccgcctgc tcgatgaccg     19800
     ccgtcccgat cccgccggcc cgcgcgagcg gctgatcacc ttcgtcgccg accgccccgg     19860
     ccacgatttc cgctacgaga tcgaccccgc ccgcagcgag gccgccctcg gctggcgcgc     19920
     cgcccacgat ttcgaggccg gcctcgcccg caccgtcgac tggtatctcg ccaacgagac     19980
     ctggtggcgc gccatccgcg cccgccgcta tgccggccag cggctcggta ccgccgcatg     20040
     atccgcaagg gaatcatcct cgccggcggc tccggcaccc gcctgcaccc ctccaccctc     20100
     gccgcctcga agcagctcct ccccgtctac gacaagccga tggtctacta tccgctgtcg     20160
     accctgctgc tcgccggcat ccgcgacctg ctgctgatct ccaccccgca ggacctgccc     20220
     cagttccgcc gcctgctcgg cgacggcggc caatacggca tccatatcga ctatgccgcc     20280
     cagccctcgc ccgacggtct cgcccaggcc ttcctgatcg gcgaggactg gctcgccggc     20340
     gaggcctgcg ccctcgccct cggcgacaac ctcatccacg ccgatcatct ctcgctcgcg     20400
     ctgcgccagg ccgccggccg ggaggccggc gccaccgtct tcgcctacca ggtgcgcgat     20460
     cccgagcgct acggcgtcgt caccttcgac gatgccggcc gccccatcga catcgtcgag     20520
     aaacccaccg cccccgcctc cagctgggcg gtcaccggcc tctatttcta cgatcgccgg     20580
     gtcagcgaat tcgcccaccg catccgcccc tccgcacgcg gcgagctcga gatcaccgat     20640
     ctcaaccgcc tctatctcga cgacggctcc ctcaccgtcg agcgcctcgg ccgcggcacc     20700
     gcctggctcg acgccggaac ccccgactcc ctgctccagg ccgccacctt cgtgcagacc     20760
     atccaggctc gccagggaca gctcgtcggc tgccccgagg aagtcgcctt ccgcatgggc     20820
     ttcatcgacg ccgaaaccct ccgccgccac gccacacgcc tcggcaagac cgatctcggc     20880
     cgcctcctgc acgaactcgc cgacggtgac actccatgat cgaaacactc gtactgcccg     20940
     acgtgaaact cataaccccg ccgcgcttcg ccgattcgcg cggctggttc agcgaaacct     21000
     ggaaccaggc gaagctcgcc gccctcggct tcaccgaaac cttcgtgcag gacaaccact     21060
     cctgctccac ccggcccggc accatccgcg gcctgcactg ccagatcgcc cccttcgccc     21120
     agggcaagct cgtccgctgc atccgcggcg cgatctggga cgtcgccgtc gatatccgcc     21180
     acggctcgcc cggcttcggc cgcttcgccg ccgccgaact ctccgccgcc aacggcgccc     21240
     agctctggat tccgcccggc ttcctgcacg gcttctgcac gctcgaaccc gataccgagg     21300
     tcgtctacaa ggtcaccgcc ccttacgaca aagcctccga gcgcggcgtc atctggaacg     21360
     atcccgatct cgccctgccc tggcccgttc ccggcgatgg cgccctgctc tcggacaagg     21420
     acaatctcct gccccgcctc gccgaggccg aaccctggtt cacgctctga catgccggcg     21480
     cgcccgatcc tgatcaccgg ggcgagcggc cagctcggcc acgccctcgc cgcccgcgcg     21540
     cccgccgccg gccttcccgc ccgcgccgtc ggccgtcccg gcttcgactt cgacgccccg     21600
     gagacgatcg ccgccaccct cgccgccacc gatcccgccc tcgtcgtcaa cgccgccgcc     21660
     tggaccgccg tcgacgccgc cgaggccaac gccgacgccg cataccgcgc caatcgcgac     21720
     ggccccgcaa ccctcgccac cctttgccgc gcccgcggaa accccctcat ccacgtctcg     21780
     accgactatg tgttcgacgg caccaagggc gcgccctaca ccgaagccga cccgatcgcc     21840
     ccgctcggcg tctatggcga aagcaaggcc gccggcgagg aagccgtgct cgcctcgggc     21900
     gcggatgcca tcatcctgcg caccgcctgg gtgttctccg ccaccggcaa gaatttcgcc     21960
     cgcaccatga tcgccgccgc gcaccgcctg ccgacgctgc gcgtggttgc cgaccagcgc     22020
     ggcgccccca ccgccgccga ggacctcgcc gaggccatcc tcgccatcgc cgctcgcatc     22080
     ctcgccgaag gctggcagcc cggcttcgcc ggcatcttcc acgccaccag cgccggcgac     22140
     acctcatggc acggcttcgc caccgaaatc ctcgccctcg ccgctcgcca cggcacgccc     22200
     ctccccgaca tcgtccccat cgccaccgcg gactggccca ccccagcccg ccgccccgcc     22260
     gactcccgcc tcgataccac gaaactcaag gacagcttcg gcctcgcgct gccccactgg     22320
     cgggacgcca ccgcccgcat cgtccctgca atcctggcgc aggacgaaac atcgtgacca     22380
     ccatcctcct ctccaccttc aacggaactc gcttcctccc cgaacagctt gcaagcttcg     22440
     cagcgcagac cgatcaggac tggcgcctcc tctggcgcaa tgacggctcg tccgactcca     22500
     cccacgaaat cacttccagg ctcgtcgctg gcatctttca cgctacccac acaggtgaca     22560
     tcacatggga cggctacgct acctaaattc ccgccagagc tgggaggcat ggcatattca     22620
     atcccgaaac tattccgaac gcgattggcg ccttcccaag gccaatatgc atactggaaa     22680
     aataaagtta aatttccatg aaggatagaa taatggataa ttattatgaa aaatataatg     22740
     tgttaaatat gataaaagat gaaagtaatg attttatttt taaatcagct ccgctcagcg     22800
     gggtattaag tgcttggtat ggtccttgcc tatccggttg ttacccacac ccactaaatg     22860
     tagggtgtgt ccattccccg gaataaagct cgtcaaaggt tggtgcggct gccctacccg     22920
     cgattccgag cagcgagcgg aacgcgttga agggatagag gcgccggttg aaccgaaacg     22980
     tgaattcatt gaggtaggct tgtagatgtt tggcgctgac cccgtgatgg atgccgttga     23040
     tccaggtctt caggttggta aagaccaagt ggacgatcgg caggaattct tctgccacct     23100
     ccgggtcgcc gcattcggcg attgcatggt ggtcgaaccc gcgccttccg agaccggcat     23160
     agccgctcca gtcgtcggta acgatcagcg atccgggagc aacggcgttt tcgacgaatc     23220
     cgcagagcga attggcgcta cggtcgggga caacagcgag acgaacgcgt cccgcgtagc     23280
     gaccgtcttt ccgattgtcg agcttggttc ccggtttccg gtggcgcacc tccacggcac     23340
     aggcgacgag aaccttgtga tggacacccc gtccatcgcc tcgggttcgt cctccaaccc     23400
     acgtttcatc cacttcgacg tgttcttgcg gcgtgtcgcc aatcttgtcg cgctcggggc     23460
     gcaccatccc ggcgcgcagc ttatgaagga tgccgaaggc ggtctcgtag cgcgacaggc     23520
     cgagttgccg ctgaaattgg acggccgaca ttccgggcgt ctggctggcg atcaagtaag     23580
     ccgcccagaa ccaagtcgac agcggcgtgt gactgcgttc cataacggtc ccagccatca     23640
     ggcttacgtc tttgcgacag gcccggcagc gcagaacgcc cgggcgcgcc tcgaaacgga     23700
     acggctcgcc aacgacgccg caccttgggc aggcgaaccc tccattccag cgggcgcttt     23760
     cgagataggc ggcacaggcc gcgtcgttcg ggaaaatacg ctggaattcc ggcagagact     23820
     gcgggaacgg caggtcttca cgggccagga catccatgcc caacactaga tctagtaggt     23880
     atgggagtca accggatagg caaggtatgg tcatgttcca tttgcttatt ggattgtatc     23940
     agcactaagg cctcgtcgct ttgtggagtt gggaacacac aatggtgtgt cctatgctgc     24000
     attctgcgac gcagtattac gtgcagatct tgatacgcaa tgctttgcaa tagacacatg     24060
     gcagggggac gctcatgctg gttattatgg agaagacgtc tataacgatc ttcggacctt     24120
     tcatgacccc cgatatgcgg ctttctcaga actgataagg tcgacatttg atcaggcgtt     24180
     agattatttt caagatggtt ctattgatct tcttcacata gatggttgtc actcttatga     24240
     ggctgtttgt catgatttta ataattggcg cgcaaaactt tctacgagag cagttgtatt     24300
     atttcatgac actaatgtgc gtgagcggaa ttttggtgtt tggaaattat ggtcagaatt     24360
     aaagatgaaa tatccaaatt tcgaatttat gcatgaacat ggacttggtg ttcttgcctt     24420
     cggcagtgaa gtacctgagg tagtgcttaa actctgcaat ctatctagcc ccagcgatat     24480
     cgccgtaatc cgcaatcggt tcgcgttcag tggacggtca tgtatccttg aggcaatgca     24540
     tgtacaggct caacgggata tctccgcggc tgaattgcgc gtgactagga cggaatcaga     24600
     gcgccgacat ctcgaagagc ggtttgctgc ggctgaattg cgcgtgacta ggacggaagc     24660
     agagcgtcga catctcgaag agcggcttgc tgcggctgaa ttgcgcgtga ctaggacgga     24720
     atcagagcgt cggcatctcg aagagcggct tgctgcgttt gaatcacaca tgactaggat     24780
     ggaaacagag cgcagagatc tcgcagaaaa gctaggtagt gttctttcct ccgagtcttg     24840
     gaggatgacg gcaccactcc ggttcttagt gcggctcatt cgccggctta ctggacgtaa     24900
     ccttcggcga gggaggatca tactccgcgc gcttaagccg gcgaatatcg agcatcgccg     24960
     agaagtgatt caggtgctgc gtcgccgtgt cgtcttagcc agccgttttg tcccggggct     25020
     aaacaatgct gtcattcacg cttcgcgtat aacgctcccg agcatttctg atgactctaa     25080
     tctaaaatct ttgaagtata ttccgccgca tcatgctgcg gtcgtatcct atccaatatg     25140
     gtcgcttcgc tttgacacgc cgtcggcgac tgacctattg caccttgagg agactgaaat     25200
     caaaatgcca gagatcctcg tcatagcgag gttctctagc gaaacttttc atctcatcca     25260
     gcaaactgcc aatgctctca aggccacagt gggagtgcga tggcgttccg ttttcatcac     25320
     taagaacccc gacgatacga ccttcgctgt cacttgtatg caagccttcc ggggtgacgt     25380
     gcgttttcta acgcgatcgt ttcccgagga actcaatggt aagattatcg ttcttctgga     25440
     agcgggagca attcctcgta gccatggcct acgcctctta gtcgaagcta tggtgcataa     25500
     tcctgatttg gctctcacct actccgacga ggaccgatta tcctccaagg gcttgccgga     25560
     attcccgtgg ttcaagccaa aatactctcc cttactcgcg gcacaaggaa tgctattcgg     25620
     ccggatgttt gccatcagac catgtgggca gttagcatct gatagtcttt ttgatccaat     25680
     ccagtcagtg ctgcaactgg cgctcaaagc tacacatggg ttggcgagtg aacgtattag     25740
     acatatcgct cacgttctgt tccatgatat cctaccatcg gcaccctttc agccggtatc     25800
     gcttccatct ctcgaaattc ttccattcgt aagcatcttc atccctacgc gcgatcattg     25860
     gcatctactt cgccaatgtc tcgacagtct acggcgcaca gactggccta tcgatagaat     25920
     tgaaattatc gtcattgata atgggtcaac cgaaacggag acccttgaag gcatggctat     25980
     cgaagaagca agtggtcgga tacgtattat ccgagatagt cggaaattca actacgccgc     26040
     ccttaacaat gttgccgcta gggcagcgcg tggtgacgtc tttgtcctgc ttaacaacga     26100
     caccgaaatt atcgatccga cttggctccg taagctctgt gcctacgcta ttcagccgga     26160
     tgttggcgca gtcggcgcca aacttcttta tgaagatcgt accatccaac acggtggagt     26220
     aattctcggt atccaaggca cagccggaca tgcgcatctc ctcctcaggg aatcggaagg     26280
     tggctaccag cagctcgcca atatcacacg tgaggtcgca gctgttacag gagcttgtat     26340
     tgccgtctcg cgtacggcat ttgaagaggt tggtggctta cgcgaagaat tcgaggttgc     26400
     gttcaacgat gttgtatttt gcctagatct tttggccgct ggtcggcgta atatatatgt     26460
     ccatgactgt gtgttgatcc atcacgagag caagacccgt ggtttcgaca ctacgccgca     26520
     gaagattgct gtcgctcgtt ctgaagcgat ccgcgcctgg ctacatcacc ctaggttgct     26580
     agtcgtctgt gaattaagcg atgtggtagt tcggtaggcg aaggtctgga gagggtcttg     26640
     cggccgagag ccatgtgaag atggcgcaaa gaagcctgat cagccatctg cggagcagcc     26700
     ggaggttgtg gccggcgccg gcaaggatgg cgttgatggc atcaccgtcg aagccgagca     26760
     ggaagtttcg ccccagatgg ccatcggtct tcatgtggcc gatgacgggt tcgatggctg     26820
     tgcgtcggcg caactcgcgg cggatggtgg gggtgatgcc gcgtttctgg cgggagatga     26880
     agatccttct gccctcggct tcgacgccgt ggccgcgata gccgcggtcg acataggcgc     26940
     gggcgacggc aacgccggtg atccgctcga cctgctcgat ctggccggcc agggtgtggc     27000
     cgtcataggg atttcccggc tggctctgca tgccgagaac gaactgaccg ccgggtgcgg     27060
     cggcgttggt ggtggcgatg gagaccttca cgccgaattc gaatcgcgtc ctggccttgc     27120
     ccttgccgat gcactccacc tcaggcgcgt gcagggaata gagcttgtcg gcaccgcggt     27180
     cggagcgctt ctggcgaagc aggcgattga tcaggcccag cgtttcggcg aaagtggcct     27240
     tcgcttcagc gttgcctgcg atcttgcggg tgatgtcacg agccagccgg cccagccagg     27300
     ttcgcagctt gcgcacgcga gcctcggcct cgcggcgttt gccaccatgg tgcaggcgcg     27360
     ccgcctcctg cctggcgtag cgcgcgaccc ggcgatacga ctggcgtagc gtgataccgt     27420
     gcttgcgtgc catccgcgcc agtgtctcga tgccgctgtg caggagcttg ctgtcggtcg     27480
     gatgcgtcac ggcctttggc tggaccgtgg tatcgatggt gacccgcttg tagtgcttct     27540
     ccgccacggc cccaccccgc tcggcggccg ccagcgtctc ggcgagcagg gcctccatcc     27600
     gctcgggccc gatccgtttg cgccagcgcg tcatcgagga tcggtcaagc ggcagcgtgt     27660
     gctggaaatg cgtctcgccg cagaatgcct ggacatacgg actgtcgaga tagcgcgcgc     27720
     agatcgcttc gtcggacagc ccatccatgt gcttgagaag atgcagcgcc accatcaggc     27780
     gggtcggcag tgccggacgt cccgccgcct cggcgtagag tgagccgaag cgttcctcga     27840
     aaacccgcca gtcgatcagc cgggccagcc gcaccagggg atgccgctgg tcgatgatgt     27900
     tctccagccg cgagcggaac agttcgagat catcctgcga ggcattcagc ttcggcggca     27960
     ttctttcctc cacgccaaac gcatgatgtt cgacatcaaa gggagagaat cacgatcgcg     28020
     accaccgcgc aacgctccaa cggttttgca aggtttttcc cctcagctcg cccagaccct     28080
     gcaaatccca atattgccag ccaccaaaac atcgccccca gatcagcaaa gttcgatttt     28140
     tcacgggtga cttgctacgc gacgatccat attattcgcc caatctctcg ctcgagtctc     28200
     catataagct tgctttcgcg ccacggcgcc gcgagctttg gcgcaagacc gtcggtacta     28260
     cgctgaaaat tttaatgctt tcttccacct acgcacgtgg tcatggcgtg gcagtggtta     28320
     tcgatttgat ggtaactacg ctgcgcaagc gcggccatgt agtattcctc gctgggacaa     28380
     agagcgaccg cgatttctct tatggaggga ccgaggtcat cgatgtacaa gacccccgat     28440
     cggctgcaac gatggctaca gatttgcaga ttgatgtgat tatcgcgcat acaccaccat     28500
     tttttggtgt tgcacgctgg accggtgcat acccgccagt gattgcttat gattacggtg     28560
     agccgcctcc aaatttcttc cccgacgagg aggcgcggcg tgagagcctg gctgacaaga     28620
     acgctagcct gcggatgtgt acgaaggttt tcgcgatatc ccaggcgatc gcagatgagt     28680
     cattgatccc tccagacaag gtaatcccac tcggcaatag ccatcttggc gtatggacgt     28740
     ctgaactctt ggagcggcgt gaagcaattc gtcgtaagca cggatggact tcacactacg     28800
     ttattctcaa cgtttgccgt tttcatgtag gcgagcgcaa atacaagggg gtcgatcagt     28860
     acgccgatat gcttgctgcc ttgaagtcgg tcgatccaga tttcgcggcg cgttgtatct     28920
     ttgttctctg tggaaaagcg cacgatgagg atatagccgc ggttcgtgcc caagggatta     28980
     cagctatcgc aaacatttct gatgaagaaa tgttggatct ctacgtggca gcagacctct     29040
     atgtgaactt ttcgcgttgg gaaggataca atctgggtat tggccaagct cttgcgatgg     29100
     gactgaaggt aattgcttca gatatacccg ctcatcgcgc ctttggcgta agggttgtgg     29160
     gcaatgcaat cgatgctgcc tttgcactac tcgatctaac tcgcgaatcg acggagcgtg     29220
     ttcccctgct gtggagttgg gacgaaccgc tccacctatt cgctgaagaa attgagagct     29280
     tagcttttac cagcaccaac ccccaaatag gttggagcca tgacaagtct gaggatcaag     29340
     gagttgcgta acttgtaaaa cctgcgacac ataggcaacc gcccggtctg ccaggctttt     29400
     tcttgtcgca tatcattgtc gcatgttata ttaattgtgc gacataacat gcgacaggaa     29460
     agttcatgaa cgagtctgca accggcccct tgatcggcta cgcccgcgtc tccactcagg     29520
     gccaggatct cgcccagcag cgcgcgacgc tgcgggaggc tggctgcacc cgcattttcg     29580
     aggaaaaggt cagcggggca aagcgtgacc ggccagaatt agcacgcctg ctcgatcacc     29640
     tgcgtgccgg tgacgtggtg acggtcacgc gcctggaccg gcttgcccgc tccacccgcg     29700
     atctgctgga tattgccgag cggatcaaag aggctggcgc cggcttgcgc tcactggccg     29760
     agccgtgggc cgataccacg acgccggccg gccgcatggt gctcaccgtg ttcgccggca     29820
     tggccgattt cgagcggtcc cttattgtcg aacgtaccag cactggcagg atagcagcca     29880
     aggcgcgcgg tgtgcgcttt gggccgcggc ctgctctcgc ggccgagcag atcgctcatg     29940
     cccgtcagct catcgaggtg gacggcaaac ccgtggccga ggttgcccgc ttgctgggcg     30000
     tccaccgcgc caccctctac cggaccttgg agaaacacca atagcgcggt ccgggagggg     30060
     cgttcgattt ccgaaaatct tcaattacgg aacgtcgcgg attgaatgtc gcgcatgata     30120
     aaggacgtta tcatgctcaa gaagcgtggt ttaagggatc atcggacgca tctgctcgat     30180
     accgggtccg tccatgcgac cagtgagttg aattgaaaaa cgaaggtgtc tgcagcatct     30240
     ggattgatgc tcaggcggtg ttctggtggt gcatcgagca gcgggcatcc gagactgcaa     30300
     ccctgtaaga tagagaatgc ttcgtgtgcc ttggcgctgt gcaactcgct tgggaaatat     30360
     gctacatgcc gagcgagaaa ggaaagctgc tcgtaatgct ggacctgccg attccaaacg     30420
     acgcgacaaa gctctggtta cgatccagct ggtcgcggtt taatcgtact gatggctgcg     30480
     agatcactct caattggacc aaagttggct ttcgctggcg ggcgatggtg ccgaatttcc     30540
     attacaataa aagaagtgga tggatcatat taaaggatga aaacggcatt gtagacttca     30600
     aaaaatactc acacgcaatg agacttgtag agttatatat ttcagaaaat gagaaaaaat     30660
     aaatttatat tacgaaatat ataaattagg tggaattata gagatcaaaa gaatcgtgtg     30720
     atcaggtcaa tttttcttac gcaaacgacg cctggctaaa gaaaccggtt ttctggctat     30780
     atttggtcta ttttcgatga tatttgcgag accatcgatt atcaaacctt gcctatccgg     30840
     ttgactccca tacctactag atctagtgtt gggcatggat gtcctggccc gtgaagacct     30900
     gccgttcccg cagtctctgc cggaattcca gcgtattttc ccgaacgacg cggcctgtgc     30960
     cgcctatctc gaaagcgccc gctggaatgg agggttcgcc tgcccaaggt gcggcgtcgt     31020
     tggcgagccg ttccgtttcg aggcgcgccc gggcgttctg cgctgccggg cctgtcgcaa     31080
     agacgtaagc ctgatggctg ggaccgttat ggaacgcagt cacacgccgc tgtcgacttg     31140
     gttctgggcg gcttacttga tcgccagcca gacgcccgga atgtcggccg tccaatttca     31200
     gcggcaactc ggcctgtcgc gctacgagac cgccttcggc atccttcata agctgcgcgc     31260
     cgggatggtg cgccccgagc gcgacaagat tggcgacacg ccgcaagaac acgtcgaagt     31320
     ggatgaaacg tgggttggag gacgaacccg aggcgatgga cggggtgtcc atcacaaggt     31380
     tctcgtcgcc tgtgccgtgg aggtgcgcca ccggaaaccg ggaaccaagc tcgacaatcg     31440
     gaaagacggt cgctacgcgg gacgcgttcg tctcgctgtt gtccccgacc gtagcgccaa     31500
     ttcgctctgc ggattcgtcg aaaacgccgt tgctcccgga tcgctgatcg ttaccgacga     31560
     ctggagcggc tatgccggtc tcggaaggcg cgggttcgac caccatgcaa tcgccgaatg     31620
     cggcgacccg gaggtggcag aagaattcct gccgatcgtc cacttggtct ttaccaacct     31680
     gaagacctgg atcaacggca tccatcacgg ggtcagcgcc aaacatctac aagcctacct     31740
     caatgaattc acgtttcggt tcaaccggcg cctctatccc ttcaacgcgt tccgctcgct     31800
     gctcggaatc gcgggtaggg cagccgcacc aacctttgac gagctttatt ccggggaatg     31860
     gacacaccct acatttagtg ggtgtgggta acaaccggat aggcaagtat caaactatct     31920
     tttgattgat ttatgcttac cagaagcgcc gctgcttgcc tcaaatattc aacagcagca     31980
     agatatatac gcttttcatc gtggccgaac tcggacatcg acttgccttc tgtttgtgaa     32040
     tctgccggat taatcatttt agattatccc tattagaaat gacaaacttc acgcttagcc     32100
     acgatattgc taaatatcta aaatctttca cttacgcaac ccatagtagc aaattcgtag     32160
     ttgggatgca ttttgcgaag atctgcagat cgtaacaaaa cattacgatc ttccatattc     32220
     atcgtattta tctggagagt ttcgattcag atagtgggac ttggatgaag ttacacaacc     32280
     attggctgca gtcgctactc cggctgttcc tgggtttgag cgagaccatc tgcgtagtcg     32340
     cggcagctac gtcagcaacg gcagtagcct tgctcccggt gacacgttcg acagaatcga     32400
     aggcccgtgc ccggtagacg gtcatcgttt tggccagaag acccggcata tgatgaaaca     32460
     ggacgatccg tacctataag ctcggccgcg ccggcgtctc atatgcctcg atgatgatcg     32520
     tcacgggttt gatcgcgccg acgaagctgt cgtgatgaag gctgcaggtc gactgccaac     32580
     cccgatttct cacggggcta ggtgcatcgg ggccaaggat gtcgacgaat tagtggggcg     32640
     acgcgcgcca catctggcgc aggaggaggc ggcctcggcg gtggtggcgg atcgcttgca     32700
     gcgcgtggcc aacagcgaga gcgatcagga tgattgccga ccagcgatgg atgggcgcca     32760
     gaaggtcgaa aagatgcggg tcagggccga tcaccgaggg aatcgggatc acgccgagga     32820
     acagggtcgg gaagcccgat ggcgcggagc aggcggtcag gtagccgagg atcgggacct     32880
     ccagtagcaa gccatagagc agggcctgcc ccgctgcggc ggcgcgacgc tcggcgatgg     32940
     acagcccgtc cgcgtcggct gggcggccgt ggcggttgcg caagcccagg cgccacacaa     33000
     ccagggcgaa gacggtcaag ccgatcgtct tgtgcaactg gaagaggagg aacttcacca     33060
     gcaaatcgcg cagtggtacg gcgaccatga tccacgcaat ggcgaagccg gtggcgacga     33120
     ggccggcggt ccaccagtgc agccggcgct gcgcgggacg ccaggcttca gccatccccg     33180
     gacgccagga cgaggatgcg ggcgtggatg acgatgtcga ccctgttatc gatgaaaacc     33240
     ggatcggcga cgatgccgaa cgccttgcgg cggacggtgc cggtaatcgt gaaatcatcg     33300
     atcgtatcac cggtcgtggg gtccgttgcg gttttgacga ggtgagccgc gaggatcacg     33360
     ggtcgcgtta cgtcccgcag cgtgagctgc ccatggaccg cgtagtggcc cggtgccgtg     33420
     gccgtgacgt ttccgctggt aaaccggatc ttgccgtagc gcgcgacatc gaagaaatcc     33480
     ggagaccgga tcatcgcact ttcctgcgcc caaggtgtca cgacagatgc tgtggggatg     33540
     gtgacgctca ccctcgtgct ggtcgggtgt gcgggatcga ttagcaaggt tgcattgaac     33600
     tgcgcgaaat ggccacgggc acggaagaag ccgagcgtgc cgacgctgaa gcggatggtg     33660
     ctgttgctct ggttgaggtg atagagttcg gcggctctgg ccggtgtgaa ggcgctgaga     33720
     gcgagcagcg tgacggcggt gagtgaaggc gcgcgatgca ttcggcgtgg gcttccgtca     33780
     acaaatacac ctctcaaatg agccggatac ggcgcctgta aagatgcgtg gcgggacgcg     33840
     cgggcaaatc cgtccgtcac gcgacactct gtcggcaggg gggggtatcg aaataattat     33900
     agacaatagc aaaggatatt gacgacaaat gaccgactaa tataataaca gcggcaacaa     33960
     caattgaaat atcataatat gagacattta taagattatg agaacggcgg aaaatgcaat     34020
     aatagcattc tgacagttta tgttgaaatc ttcttgattt atgataaaaa attgggaaat     34080
     ggaattttaa ttatgcaaaa ataataaaat ataaaatgtc aatattttta aataatttag     34140
     gaattttttc gatggaacaa attgaagagt ggctattaac gacgtctatc gtctatgttg     34200
     taaatgaaaa ctttttaagc aaaagtcgta tttttgaagt tgtaaattat ttttaccgaa     34260
     ttggaattcc agaaattatt attattgatg gatttggaga taatcccgaa ttatttacaa     34320
     aaaacaaata ttttagatat ttctctaaag atagttcaat atctgtagat gatataataa     34380
     aagatccaga gaagtattgt gatatgaata atattgttat tattgcgaat gatcgtatat     34440
     attatcattc agggtatata aacaaagaat atttagaaaa aattatatat aatatgaata     34500
     atatttttca aagtgacgat aaatatgtag gtgtgaactg atatctcacc gacgtagagc     34560
     ttcatgccgc tggaaaaggg ataatttcgg cttggggccc atacgtacgt cgaggaccag     34620
     gattcgctcc cggtcgaact caaccatgcc gccaaggacg gtcagcatca gccggccgtg     34680
     cggggcggtg gcgttggccc cgccgtcccc gagggatctg aactcggcgc ccttctcggc     34740
     gatggtcgcg agggtattca gcagatcaca ggttgagcgg gcgggacggt tgaaccgggt     34800
     gatcaacagg atatcgtcgg cctcgagcct gtcgatcgtc ttccgaagct ggatccggtc     34860
     agtgcttcgc cgcgggcctc tcctggaaga cacttccagc agccggcggc tttcagctgg     34920
     gcgatctaag cggccacgct ctgccggtcg gtggccctct cggagcaact gctgcgcccg     34980
     gtcatggcac atgttcactc ccctcgattc ccagggctgt tcaatgctga tttctgagtt     35040
     ggggtgagtc cgatgtgcaa catcggggag agaattgatt tttcggggag cgcggggatt     35100
     cccgaccggc gggatttggg attcttggga aggcaaccga ttcggaggtt gtcatggccg     35160
     cgttcagctc gttgctcgat atactggcag aggtccccga tccgcggcgc gcggaaggca     35220
     agctctacaa gctgccgcat gtcctgctgt tctcgatcct ggcgatcatc agcggctgca     35280
     attcgtatcg cggcatcgtc accttcatcg acgtccatcg ccgccggctg aaccgcagct     35340
     tcggcctgaa atggcgccgg gcgccctcgc acacggcgat ccgctacatc ctccaggggc     35400
     tcgacccggg cgcggtggag gccgcgttcc gacgccacgc ggcactgctg caggcggcca     35460
     ggaccaagcc cggcacggcc agcattgcgc tcgacggcaa gaccctgcgc ggcagtttcg     35520
     acaggttcca tgaccgcacc gcggctcatg tgctcagcgc cttcaccacc gacaccaagc     35580
     tggtgctcgc tcatgtcgag atcggcgaga aatccagcga gatccccgcc gcccaggcgc     35640
     tgctcgccga actgggcatc gccaaggaca caatcgtcac cctggatgcc ctgcactgcc     35700
     aaaaaaagcc ttcaacgtcg cccaggcggg caacatcaac ctcatcgtcc aggtcaagga     35760
     caatcaaccg acgctgaagc aggcgatcca ccatatcgcc acatcgagcg ccccatacga     35820
     cgtcttccgg acccgcgacc gcggccgcaa tcgtgacgaa acccgcaccg tctccgtctt     35880
     cgatcccgcc agcgcgctcg ccggcaccga atggcatccc cttgtcgccg ccatcattca     35940
     ggtcgagcgc gcaatcgcca cccgcaatcc cgaaaccggc ctgctcaagc tgacatacga     36000
     cattgccttc tacgtcgcca acacatcgct caccgccgcc atcgccgcca aggccatccg     36060
     cgcacattgg ggcatcgaaa attcctccca ctatgtccga gacgtcacct tcgccgagga     36120
     tcgatcccgg atccgaacca accctggcgt catcgcccga ttgcgcagct tcgccttcaa     36180
     catcctcatg aacagcaaag ccaccgccag caccctcagc caagaccgct accgcgcagc     36240
     tctcgccgga ctcaaacacc tcctcgcact cattactatc ccaaagcgtt gaacagccct     36300
     gcctcgattc ctgagcttac gttttgcgag cgtgcaatga tttgcgccgg cgcgatagtc     36360
     tgacagggta gactattcaa ctactactta agaatgaggt atgtatcgat gcttttctga     36420
     ctattttgat atcagatgaa cgaacgtcta gcgacgcaac atatacaacc taacatttat     36480
     tatgaaataa attacaatcc cgagtatata gcgaaatatt attttgtcgg aatctcttac     36540
     gtctcatagg gcgagatggg atatccgttt gattctatta atattgcaaa tacggcacga     36600
     cttttgcctg attattgaac gcacttcact ggatgaagtg tccgtggtca ttcatggcat     36660
     gatttctcaa acgtttggag cttgcctatc cggttgttac ccacacccac taaatgtagg     36720
     gtgtgtccat tccccggaat aaagctcgtc aaaggttggt gcggctgccc tacccgcgat     36780
     tccgagcagc gagcggaacg cgttgaaggg atagaggcgc cggttgaacc gaaacgtgaa     36840
     ttcattgagg taggcttgta gatgtttggc gctgaccccg tgatggatgc cgttgatcca     36900
     ggtcttcagg ttggtaaaga ccaagtggac gatcggcagg aattcttctg ccacctccgg     36960
     gtcgccgcat tcggcgattg catggtggtc gaacccgcgc cttccgagac cggcatagcc     37020
     gctccagtcg tcggtaacga tcagcgatcc gggagcaacg gcgttttcga cgaatccgca     37080
     gagcgaattg gcgctacggt cggggacaac agcgagacga acgcgtcccg cgtagcgacc     37140
     gtctttccga ttgtcgagct tggttcccgg tttccggtgg cgcacctcca cggcacaggc     37200
     gacgagaacc ttgtgatgga caccccgtcc atcgcctcgg gttcgtcctc caacccacgt     37260
     ttcatccact tcgacgtgtt cttgcggcgt gtcgccaatc ttgtcgcgct cggggcgcac     37320
     catcccggcg cgcagcttat gaaggatgcc gaaggcggtc tcgtagcgcg acaggccgag     37380
     ttgccgctga aattggacgg ccgacattcc gggcgtctgg ctggcgatca agtaagccgc     37440
     ccagaaccaa gtcgacagcg gcgtgtgact gcgttccata acggtcccag ccatcaggct     37500
     tacgtctttg cgacaggccc ggcagcgcag aacgcccggg cgcgcctcga aacggaacgg     37560
     ctcgccaacg acgccgcacc ttgggcaggc gaaccctcca ttccagcggg cgctttcgag     37620
     ataggcggca caggccgcgt cgttcgggaa aatacgctgg aattccggca gagactgcgg     37680
     gaacggcagg tcttcacggg ccaggacatc catgcccaac actagatcta gtaggtatgg     37740
     gagtcaaccg gataggcaag gtttggagat tgaacatgtc tagcgtccgc aaatatctgt     37800
     tacacggagc cgtagtgctc ctcggcctca cgggaatagc gcgggcggat atttataatc     37860
     cgacctggct agtcacagcc tggaccacaa cgaacggtaa gattggcggc accaacttta     37920
     taggcgctgc aagccagcct gtgccaccag ccgcagatgc actggcttcc ttcacatact     37980
     cagggcagtt gaatttcgac aacaccaata aacaggggca gtcgaatacg tacggcgact     38040
     tctttacgaa taccggcaat atctcaaatt tcagcagtct gagtaaccag accgagtctg     38100
     cgttccttaa aaccacgatg agtgcgccgg gaagctcgaa ttattcatat ctggagttct     38160
     cgctccaagg tcccgctacg aatatagctg ctggcacata catcacgatc acccacgacg     38220
     atggcgccag cagctatgca aacggtaaat cggtaacgct ctcgcctggc gaaactcaag     38280
     ccgtcagcga taccggcaca ttaccggtgg gatcgatgac aagttttgct gttgactacg     38340
     ttgaggcgaa cggcgcgccg gcagttctca aagtggacgt accggaaccg ggcagtgttc     38400
     tgctcctcgg aacgggattg ctcgttctcg gtctcgtcgt tcggaggcgg cagaaagccc     38460
     tctgagaccc gctggtcgat cttaactgat gcggtcccgc tcacccggga ccgcctttca     38520
     attgaaaaaa gctatcagca ggaggttgct tgacctggcc acgtcggacc tccgacggtg     38580
     aatcggcttc aacgtggagc cctggctggc aggtggcgct caatgatcca aacagcgttt     38640
     ccccctcccc tcccccgctg agcggcgtag gtttccgtga tggggctact cgaatgaatt     38700
     cttacttggc cagttcacgc ttgagcgcgg caatggcctt ttcaaacgtt tctgcggcct     38760
     tccaaccgtt ttcctgggcg atggcataaa atgcatcggc cgttgccggg tctgtcttca     38820
     cgctgaaaac cttgtttcgg ccagtacggt ataccatggg tcgacgctta gtagacgatt     38880
     ggtcgtcggt agcctgtgtt ggcgctacag gttccggctc gcgactctga aacctgcctt     38940
     tgctactgac ctcgtcaatg gcggccggag cgggacgcct ttgcttgccg accgccggct     39000
     tgaagtcact cacatccaag ggcgagcgtg ggtcgtcgaa tatgctggat ctctgtctca     39060
     cgcgttaacc tcccctcgat ttcggcgaag aagaccaacg acctctcttg cgaaggcctg     39120
     ggcgttttct atcgctgccg gaatattgcg gacatttgct gggtcaagag cttccagtgt     39180
     tcccccgaaa gaaaacagag cacgataggc ttccctttca tgaagacgtg tcttgagaac     39240
     gtgaacgccg ttctcagcga actcggcttc tatggctgaa agtgtacgcg gcctgattgc     39300
     ggcggaggtg tttgtaaaaa tgactgctgc gggaatgtgt aacctgaaag cttcctcttg     39360
     ctgtttcacc tcccggatcg cggcaacagc ctcaacggca tcaagtacgg atccgcgcgt     39420
     tggaatgagt accaagtctg cgcggctcat tgcatagggc accatccggg atgccgtccc     39480
     ctccagatca accacgacaa aagctgcgcg ctctgcctcg ctgtcgatca cgcggatgat     39540
     agttttttca gtcacatcat cgattacacg caaggattgc ggcttgcccg gcaagcggct     39600
     ccacctggcc acaggcttgt tcggatcagc atctatgatc gtgatttctg cccctgctgc     39660
     ggccagctca gtggcaagga tgacggcgga tgtgctcttt ccggcgccac cttttggtga     39720
     tgcaaagaca atggttggca taaacgaccc cagaaaatct acggaaagta gacggtaagt     39780
     ctacggtata ccttaggtag acggtagact taccgtctat gaccgtcaat ggtagaccga     39840
     aaggtgacat ttagttgacc taaggtagac tttttggcgc tgcagttgtg atcctcatgc     39900
     tgtgctcctt tgattctcga aggaccttga actttgccgt cgtttggatt ccagacgcta     39960
     caactgcgat ttgatcccag cgagccttga tctatgcgcc acctgattct cgcccgtccg     40020
     aatcgccggg gaggggggcg gcaagtctct ggccgacatt tcttcacccg aaagagtcgg     40080
     ctggcggcaa agatttcagc gcctaagacc ggaaatttct cacgaatcgc tggacaagac     40140
     cgctcatcag agcgagagtc cgagtctcta gagactgatt cggattcgcc gatgaatcac     40200
     gctgacacca agaccgacga tcgcaacgcc cgccaccgcc agcgcattcg cgcttccggt     40260
     gcccgcgagg tgttgttcca gttgccggaa gagacacttg cactcatcga cgacatcaag     40320
     aaacgccagc gcctgccaag ccgcagtcag gcgctcctgc aactcattga acgcggaaag     40380
     gaggctatcc agaaatccgc ctagacatgc aaaagcccgc cttgccgggc gggctttgcg     40440
     taaactcgtg acgggcctca tcggcgaccg ttcgtgaagg gctgttcccg aacatagtcg     40500
     ttgagagctt ttttgccaag cggaaattgc cgtttctgct gaggggagag ctttgcctgt     40560
     cgcgatccag ccacaacgga ggatcacg                                        40588
//