Dbfetch

ID   AP012038; SV 1; circular; genomic DNA; STD; PRO; 54248 BP.
XX
AC   AP012038;
XX
PR   Project:PRJDA60101;
XX
DT   02-MAR-2011 (Rel. 108, Created)
DT   28-SEP-2016 (Rel. 130, Last updated, Version 3)
XX
DE   Acidiphilium multivorum AIU301 plasmid pACMV3 DNA, complete sequence.
XX
KW   .
XX
OS   Acidiphilium multivorum AIU301
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acidiphilium.
OG   Plasmid pACMV3
XX
RN   [1]
RP   1-54248
RA   Hosoyama A., Yamada R., Ito N., Takarada H., Narita-Yamada S., Nakamura S.,
RA   Katano Y., Ichikawa N., Nakazawa H., Fujita N.;
RT   ;
RL   Submitted (28-DEC-2010) to the INSDC.
RL   Contact:Director-General Department of Biotechnology National Institute of
RL   Technology and Evaluation, NITE Bioresource Information Center (NBIC),
RL   Department of Biotechnology; 2-49-10 Nishihara, Shibuya-ku, Tokyo 151-0066,
RL   Japan URL    :http://www.bio.nite.go.jp/
XX
RN   [2]
RA   Narita-Yamada S., Nakamura S., Ito N., Takarada H., Katano Y., Nakazawa H.,
RA   Hosoyama A., Yamada R., Fujita N.;
RT   "Whole genome sequence of Acidiphilium multivorum AIU301.";
RL   Unpublished.
XX
DR   MD5; 225ce8e436b096fd7a3dcbdfa7c163e4.
DR   BioSample; SAMD00060977.
XX
CC   ##Genome-Assembly-Data-START##
CC   Genome Coverage       :: 8x
CC   Sequencing Technology :: ABI3730
CC   ##Genome-Assembly-Data-END##
CC   Please visit our web site.
CC   URL:http://www.bio.nite.go.jp/
CC   DOGAN ; Database of Genomes Analyzed at NITE
CC   The database contains genome sequence data, physical maps
CC   and the genomic and proteomic data of the microorganisms
CC   analyzed.
CC   URL:http://www.bio.nite.go.jp/dogan/Top
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..54248
FT                   /organism="Acidiphilium multivorum AIU301"
FT                   /plasmid="pACMV3"
FT                   /strain="AIU301"
FT                   /mol_type="genomic DNA"
FT                   /note="strain coidentity: NBRC 100883"
FT                   /db_xref="taxon:926570"
FT   CDS             1..1362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00010"
FT                   /product="replication protein C"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83150"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7T3"
FT                   /protein_id="BAJ83150.1"
FT                   /translation="METESPGFGQNSRTNQGFGGLRRLSLAMLATDRTAAGFTGLSDGA
FT                   GGPGAVLAAFKAAAPYLGLPPRVVHAVDWLFRFTQRQDWEAGARPVVWPSAAVQQADLD
FT                   LGASQTKALNRHLVELGLVVMRDSPNGKRYGRRDRGGRIIEAYGFDLSPLGVRFDEFRA
FT                   VAEKGRAEREAVRQLRRRVTIARKAIEQIVETAVEVGLEPGVFVREAEEARRLSRRLAK
FT                   AESSAVLAFGVTRLEDRHGDLRQRLESLIAARQGTGSAQKDVETDPKAPENRPHQYRYK
FT                   SDLNPEQDTVSGIEKSSPAPVGSGATAETTGLRNGRSGSETGRGEQKPARRDDGTVLRI
FT                   TPDELVRLAPRLLPYLGRSSPAWPDVVEAADWLRHDLGVSKPLWGEACIAMGREQAAIA
FT                   LAIVSARPAGHFRSTPGGYFHGMVAKARAGELNLGKTIWGMRSKRDTHGWNQPQ"
FT   CDS             1385..1660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83151"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7T4"
FT                   /protein_id="BAJ83151.1"
FT                   /translation="MTLEADYLEALGLLGRVCEQYRRETGSPAYLVGGAAVALWTGGAF
FT                   HSADFDLIVASAISHLQRGYRPLARCLNQPCCGGRVAIHRRDYGPL"
FT   CDS             complement(1822..1980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00030"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00030"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83152"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7T5"
FT                   /protein_id="BAJ83152.1"
FT                   /translation="MPGTLLRHLSPIGWEHVNLTGDYIWSANQKSTENHAGLRPLRPIP
FT                   DTTIKAA"
FT   repeat_region   2541..3913
FT                   /note="Belongs to IS110 family"
FT   repeat_region   2541..2562
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 22 bp inverted repeat"
FT   CDS             2610..3650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00040"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83153"
FT                   /db_xref="GOA:F0J6W4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6W4"
FT                   /protein_id="BAJ83153.1"
FT                   /translation="MDIVIVGIDLGKNSCSVVGMDAAGRVVLRRRLRRGTLESFVGELG
FT                   SCIVAMEACCGAHHLGRIFAARGHEVRLMSPEYVRPYVKAQKNDDLDAEAIAEAATRPT
FT                   MRFVPVKSQDQSDLQALHRARERLVSERTALINHLRALLLERGIVVPQGRRKLEAELET
FT                   LAEDGGFAALSPRIRTLIEDLRAEWRSLDQRITGFDAEFVQLARDDVAVRRLTKIPGMG
FT                   TINATALAAAVGEAQAFKRGRDMAAWLGLVPRQMTTGGKPRLLGISKRGNRYLRKNLIH
FT                   GARAALPYLVERDTPLGRWARGLLDRAHKNVVVVALAAKLARIAWAVLAHGCDYDAQFE
FT                   AAAAAA"
FT   CDS             complement(3797..4330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00050"
FT                   /product="MgtC/SapB family protein"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83154"
FT                   /db_xref="GOA:F0J7T7"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7T7"
FT                   /protein_id="BAJ83154.1"
FT                   /translation="MTDLSQPFPVPFLTTVGDFAVAFVLGTLIGAERQWRQRSAGLRTT
FT                   VLVALGAAAFADLGVRLAGPAGSTRVVAYIVSGIGFLGAGVILKEGANIRGINTAGTLW
FT                   CSAAVGAFCGCGYSAEATLLTVFILAGNTLLRPLVNVWPAPSARGDFHLALISLLQRIR
FT                   SRASNPAKMEIRAA"
FT   repeat_region   3892..3913
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 22 bp inverted repeat"
FT   CDS             complement(4351..4647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83155"
FT                   /db_xref="GOA:F0J7T8"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7T8"
FT                   /protein_id="BAJ83155.1"
FT                   /translation="MNQDNRFPASETRRSKGVSRIPVLRAAWASQRDLDRTAHDNSADI
FT                   AAIARAEGWLTPLMPIERVALRPWQQAVFWGLRLYIGVMLIVMGWGFLHVAGG"
FT   CDS             complement(4675..6048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00070"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00070"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83156"
FT                   /db_xref="GOA:F0J7T9"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7T9"
FT                   /protein_id="BAJ83156.1"
FT                   /translation="MSAETDLLISPETARITFPEGLEARLRDRLRIQRLRIGKQSLGSR
FT                   IALGLALVGPGLLVMLGDNDAGGVITYAQTGATYGFSLFIPLMIPLGFIAYLVQEMTIR
FT                   LGAVTRRGHAEMIWKRYGAFWGAFSLIDLVVANILTLMTEFIGIRVASAIFHIPYLVTI
FT                   PAAFVFIVSILLFLKYYTWERISLFVAAFNMVFVPLALFSHPDWSAIGRTFTGTGWALP
FT                   GGLLSAGFLILISANIGTTIAPWQLFFQQSCVVDKGILPQDIKASRRDLMLGVIGMVVV
FT                   ATSIIVISGQYLHGLANTASLGDHSVLADIGSRLGHGAMVIFALGLFEAGLIASIVITA
FT                   STAWAIGEALDVPRSVNISPRRSLYFYAPAILGTAIAASVPMLPHVPVGFLNLTVQVIA
FT                   TVFMPTAMLFLLMLLNDRELLGDHVNSPIRNILSVGVMVMLIACNGLYGIATVFPHAL"
FT   CDS             6577..6852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00080"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83157"
FT                   /db_xref="GOA:F0J7U0"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7U0"
FT                   /protein_id="BAJ83157.1"
FT                   /translation="MQYTEKEKRKLVNRLSRIRGQVEAMQAALDADARCTALLQQATAC
FT                   RGALDGFIGTVIEHHIRQHIVDPKQQETDRAQAAEELIGVVHSYLT"
FT   CDS             complement(6880..7506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00090"
FT                   /product="putative resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00090"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83158"
FT                   /db_xref="GOA:F0J7U1"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7U1"
FT                   /protein_id="BAJ83158.1"
FT                   /translation="MSMVGYARVSTREERQIFDRQMDALTVAGCERIFEDRGSGARSDR
FT                   PGIKACLDYLRRGDVLVVLDLDRLGRLAGELIGLVDDLEARGVGFRALNTAFDTTTPAG
FT                   RAFLQIQAAFAEMERNVIRQRVREGIVAARARGRKGGRPRMMTAERLRYAQHLMADSTR
FT                   SIPSICRELGGIPASTLYHYMKADGTLKSPGIKLLGNAAVALEAV"
FT   CDS             8109..9311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00100"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00100"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83159"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7U2"
FT                   /protein_id="BAJ83159.1"
FT                   /translation="MQGVCIQISENFSLKHMDGLSDEAICVRYLDSPYVQAFCGETHFQ
FT                   HALPLDRSSMTRWRKRIGSERMEALLAETLAAAERGGAVAEKHYGRVTIDTTVQPKAVT
FT                   HPTDSKLLHKGIETLARMARKHGITLRQSYRRVARYARQEAARLHHGGKRREAEARVRK
FT                   LRTWLGRLARDITRKIAGNAEAKAAFAETLGLINRLLRQKRSDRGADKLYSLHAPEVEC
FT                   IGKGKARTRFEFGVKVSIATTNAAAPGGQFVLGMQSRPGNPYDGHTLAGQIEQVERITG
FT                   VAVARAYVDRGYRGYGVEAEGRRIFISRQKRGITPTIRRELRRRAAIEPVIGHMKTDGH
FT                   LGRNFLLGVDGDAINAVLAGVGHNLRLLRRWLIRLLCALVAWLSAANRSPSLGFAHRQI
FT                   T"
FT   CDS             complement(9327..10223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00110"
FT                   /product="peptidase S33"
FT                   /EC_number="3.4.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83160"
FT                   /db_xref="GOA:F0J7U3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005945"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7U3"
FT                   /protein_id="BAJ83160.1"
FT                   /translation="MDAGNFAPFDGYRTWYRVSGDLEAGGPPLVVLHGGPGAAHDYVDR
FT                   FRLLATPRRAVIHYDQLGCGRSTHLPDRGAAFWTVDLFLAELDNLLDHLGIRDRYAVLG
FT                   QSWGGMLAAEHAVRRPPGLKALVIANSPASMVTWVAEANRLRAELPAEVQQTLLAHERA
FT                   GTTDHPDYEAAVDVFYHRHLCRLDHWPDEVKRSFAQMAEDPTVYHTMNGPSEFHVIGTL
FT                   RTWDITERLHVIAVPTLVLSGAFDEATPETVRPYVELIEGARWVLFDQSSHMPHVEETA
FT                   RCMDVVGGFLDTMDEAE"
FT   CDS             complement(10262..11251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00120"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00120"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83161"
FT                   /db_xref="GOA:F0J7U4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7U4"
FT                   /protein_id="BAJ83161.1"
FT                   /translation="MTTPDGVVLLEASGVSKRFAVGRRVIGAARRMVHAVDGVSLCVVR
FT                   GETLGIVGESGCGKSTLGRCLMRLHDVSEGSVVFDGINITHRSRNALRPIRRRMQMVFQ
FT                   DPAASLNPRYRVRDLIAEPMRIHATVPEREIGDRVARLLDLVGLRRGHMDRFPHEFSGG
FT                   QRQRIGIARAIALEPDLIVADEPVSALDVSVQAQVVNLFQDLQERLGLTYVFIAHDLSI
FT                   VRQITDRVAVMYLGSIVETGPTDLVFTSPSHPYTMALISAVPMPDPDPARRPRRIILTG
FT                   DVPNPISPPSGCRFHPRCPRAQERCRAERPALRALDDGRDCACHFPET"
FT   CDS             complement(11248..12237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00130"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00130"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83162"
FT                   /db_xref="GOA:F0J7U5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7U5"
FT                   /protein_id="BAJ83162.1"
FT                   /translation="MTIEAPLLEVSDLRVSFRTRRGVMRAVDGVSFVLGRREILGVVGE
FT                   SGSGKSVSLMAVMGLIDDPNAIVEGSIRFEGRELVGLADREMRRLRGGQIAMIFQDPMT
FT                   ALTPVYSVGRQIVEQLRLHTDLAGCALKARALELLEAVGIPGPRDVIERFPHQLSGGMR
FT                   QRVVIAMALSCNPALVIADEPTTALDVTVQAAILDLIRNLRRDFGSSIILVTHNMGVVA
FT                   EIADRVAVMYAGRIVEQADRRAIFQRPRHPYTVGLLGSIPPMTGVRPRRLPSISGAPPA
FT                   LDQLPPGCSFAPRCPHRSRACVVRPEMRGDGHRYACVLAALPTAGVLS"
FT   CDS             complement(12605..13597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00140"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00140"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83163"
FT                   /db_xref="GOA:F0J7U6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7U6"
FT                   /protein_id="BAJ83163.1"
FT                   /translation="MRDSSLSLGFTILRRLGHMLFVMFGISVLVFLIFFATPGSDPAAR
FT                   IAGRNASPQTVALIRKEFGLDRPLPVQYIRMMDSLVVKRNLTSFVNLGEKVVPAVFHAA
FT                   PVTLSLVAGAATIWIVFAILVGLLAAAYKDRVIDRILMIASLIGISIPVFWLGEVVNLI
FT                   AQGGLHKTWLFSWVPPLGYVPLRRNPALWFKSLLLPWCTLAVAFIGIYGRVLRANIIEA
FT                   MQEDYIRLARAKGLSSRAVLIRHALRCSLIAIFTLFGLDFGALVGGGALLVEVVFGLPG
FT                   VGYLTYQALTNLDLPMIMATVIYASFFVVAANALVDILYSVFDPRVRDD"
FT   CDS             complement(13598..14641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00150"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00150"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83164"
FT                   /db_xref="GOA:F0J7U7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7U7"
FT                   /protein_id="BAJ83164.1"
FT                   /translation="MVSDADYEEALRAWNAPDLPEAASRGYWAAALARLTRNRTAIVAT
FT                   TVLAVVLLACLAAPLYAHFVAHTDPFKSNLGGTVTIAGKQVSVMQPASDGFGVTPIGPT
FT                   WRWGPYMLGADGQGRNVAARLLYGGRVSLLVGAASTAICLLLASLLGVAAGFYGGMTDR
FT                   VISVMLDILWAFPIYLLAISLSVILINAGFHLGPVIITSNDLIMPIGIIAIVYVPYVAR
FT                   PIRARVMMLRRSDFVAASISLGASDGRILRRDILPNVASTLIVFAPIMMALDIITEASL
FT                   SFLGIGIQPPSASWGTIIRNGEQLLYTRPIVSLAPGLAIVMTVVALNVLGDALRDALDP
FT                   RARLTLK"
FT   CDS             complement(14662..16338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00160"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00160"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83165"
FT                   /db_xref="GOA:F0J7U8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7U8"
FT                   /protein_id="BAJ83165.1"
FT                   /translation="MRKQGSWMRRLAGQVALGACLAATAATVPARAAGGHYGGTLKLVA
FT                   SSAAGTLDPQVNYTLRYWQIFPMLYDGLVSFERAGGTAAFHIVPDLATAMPKISDGGKT
FT                   YVFTLRKGVKFSNGAPVTLTDVRASFIRLFKVLNPNAGTWYDVIVGGRHCASAPTTCTL
FT                   PGVVIDQAKDTVTFHLRHPDAEFLDQLAVPFGAILPASTPDKDMGTIPIPGTGAYMISK
FT                   YDPSSKLVMVRNPYFHQWSRLAQPKGYPDRIVYRFGLTPNAQVTAVANDQYDWMYNPIP
FT                   LDRLGEVATKYKSRLYLHSLLALWYATMNTRMKPFDNKDARLAVNYAIDRADLVKLFGG
FT                   PAVATATCEILPPGMPGYKPFCPFTEHPGTTWTAPDMKKAMAYMKKSGMAGQKVTIITQ
FT                   NSDPSRAIGIYLQSVLDRLGFKAKVKGISSNIQFTYIQNSNNHVQMAVTTWYQDYPAPS
FT                   DFLNVLLSCKSFHPGSDNSINISEFCDKSIDTEMAVAETMSIAHPKKADVMWTKIDREM
FT                   TDQAPVAPLFTPKHVDFVSSRLHHFVFSGQTYFIPDLAWIK"
FT   CDS             complement(16586..16858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00170"
FT                   /product="putative toxin"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00170"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83166"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7U9"
FT                   /protein_id="BAJ83166.1"
FT                   /translation="MAWKIELDPAADRELDKIDKQTARRILAFLHDRVAALDNPRSIGE
FT                   ALKGSKLGDFWKYRVGNWRIIASIEDGALRILIVRIGNRREVYKR"
FT   CDS             complement(16842..17066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00180"
FT                   /product="putative antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00180"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83167"
FT                   /db_xref="GOA:F0J7V0"
FT                   /db_xref="InterPro:IPR008876"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7V0"
FT                   /protein_id="BAJ83167.1"
FT                   /translation="MLAVRLPPEIESRLDALAQATGRAKSFYVREAIMEHLDDLEDLYL
FT                   AEQRLIDLRAGKTKTVPLEDVMKRYGLED"
FT   CDS             complement(17335..17649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00190"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83168"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7V1"
FT                   /protein_id="BAJ83168.1"
FT                   /translation="MMVCYVEWHLRDALKPLLFQDHDRTGAEAERSSPVANRKRGRRRN
FT                   DQSLPISSFTDMMAHLATQTLNTAALPKAPNATFTTLAKPTPLQAAVFDLIGIDPTRVQ
FT                   "
FT   CDS             complement(17646..18062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00200"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83169"
FT                   /db_xref="GOA:F0J7V2"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7V2"
FT                   /protein_id="BAJ83169.1"
FT                   /translation="MTPNRRMLDTNTVSHLIRQHPAVTRRVVEMPMATLCISVITEGEL
FT                   LFGLARRPKATALHQVVKELLRRIDVLAWDSSTAGIYGTLRAGLTATGRTMGPLDLLIA
FT                   AHAIATGSVLVTNDQAFRMIDGLAVDDWTMPSPA"
FT   CDS             complement(18059..18319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00210"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83170"
FT                   /db_xref="GOA:F0J7V3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7V3"
FT                   /protein_id="BAJ83170.1"
FT                   /translation="MSQIAKLFNNGRSQAVRLPAAYRFEGAEVFIRRDPDSGDVILSRR
FT                   PADWEGFFAILRNTKVPADFLDRSERNQGVQERDPFAGWPE"
FT   CDS             complement(18410..19327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00220"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83171"
FT                   /db_xref="GOA:F0J7V4"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7V4"
FT                   /protein_id="BAJ83171.1"
FT                   /translation="MATDIETAYREIAGFAPDQEAINRIRSAGRILRLQDQDSGWLLLI
FT                   TLEAHNAAIRNTLDAASTLAAAAGTAAADAGKAATAIAREIGRAGPTLAKSIQNAALEV
FT                   GRDLRGSIDQATGAAKDTIAETIATGTTRMDGAIAETFRQATDLLDQAANNLRAGATET
FT                   RDHFIQHWQSLAADATSKALDKRVQIEAARSRRASLRTFAIAFVIAAITFGASVFIAHR
FT                   QGWQHGYRTGKADLLTHIHDQKLRASWANTPDGMLAYQLYKAGFIRELATCSGQGWKIK
FT                   TRGGKPLCLPYQTKNGSIYGWFLK"
FT   CDS             complement(19426..20133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobD"
FT                   /locus_tag="ACMV_P3_00230"
FT                   /product="putative mobilization protein MobD"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00230"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83172"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7V5"
FT                   /protein_id="BAJ83172.1"
FT                   /translation="MSRIIYVGGNKGGVGKSMVAIALADHLRHTRNLPVFLVETDTANP
FT                   DAAKCLGTEINATLAADTRTEAGWQTMLNAIEQHQDKTCVINAGARDNDAMRRYGDYLH
FT                   RGAEALAIPLAIAWVINDERDSLLALRDFMEGYPGRVDVIGNRFFDEAGSFAVYRDSRI
FT                   RAEIEARGGTLRPFPILPRPLATAIKTDRRSPAAILAQAPLFERIALEKWRTDCAEAFA
FT                   PLLEAQPLTTARA"
FT   CDS             complement(20130..20618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00240"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83173"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7V6"
FT                   /protein_id="BAJ83173.1"
FT                   /translation="MADDTSGKPAAGISRDDIKAIAAQMKALPAARDAALLTKRAAIEA
FT                   LSSEIRAMRDKGYTIDQIAAWLRNNTPLAASAATIRAALASKRSRKPGSSARSAAKIGE
FT                   ATAHGSSQPGKDAAGIARDAADRPSNPAPPAKMPARSPPAVTEKPVGAGTFAIGSDDV"
FT   CDS             20955..23951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trwC"
FT                   /locus_tag="ACMV_P3_00250"
FT                   /product="putative relaxase TrwC"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00250"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83174"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7V7"
FT                   /protein_id="BAJ83174.1"
FT                   /translation="MISYSHLTAQGSGQGAGSGGGSGASIAGVVRYLEAMRQDGPVAEA
FT                   ERGAAAMGYYQGRAAPSMWLGAGAAELGLSGAVDGAALAELLSGCLPDGTDLSGRGNRT
FT                   GSRRLGHDLTISTPKSVSILALAGGDARLLAAHDQAVQVAAGEVERLMVVARRGKAGAV
FT                   VERTGRMVAAAYRHEDSRPVDGVADPQLHTHLVIANMTRRSDGVWSAASLDFGARNEIL
FT                   HMLDVVYKAELGKRVAELGYGIERTRDGFEIAGLTREQIAAFSRRTAEIDRTLAAGGLD
FT                   REVASAAQRVRANVSTRLEKGQPGEVEQRYGWRARAREVGLDLDRARSAALERARSGLD
FT                   RGGAVERDAVGPDHEMEMAREAVAGAARHLGERASVFSEAELVREALLAGLGRVGSAAV
FT                   TRAIGERAGGLVAGTDERRGLVFTTRDALETERLVLDVVRSGRGTAKPVAEPGAIAQVL
FT                   ERQERDQGLVFTAGQSEAVRFALGSADRHVGIVGAAGSGKTRALAAIAEAYREVGYEIV
FT                   GLAPSAAAARELGQAGCDLTQTLEAGLRRPAAEVGGVTPGARLCLYVLDEAGMVSARDM
FT                   DRLMRRAEAEGARTLLVGDPRQLASVEAGSPFQQLLETGALRHVRMDEVQRQRDPALRE
FT                   IVQLFARGDAAGAVRAAQPYMAMVEKDRLALTAATTYLGLTPAERADTLVLAGTNRMRE
FT                   AVNAEIRSGLRQRGELDRDELTVQALDKANLTREQAKRPHAYEPGMVVVFSRELKDGRR
FT                   LVAARGSQWTVAGQAGDHVMLRPLAAPAGGAGAREIAWRPSGEMATAYHVRALALAEGE
FT                   RVVFRENDRARGVSNGMGGVVTRLDRARGEALVRSDAGAELRIGADRAQAIDHGYCRTI
FT                   HSSQGATVDRAIVVGEAGRVATAQTAYVAASRERSVLHIITDDRDKLSAAWSRWAERQT
FT                   ARSLLAREAEREMPLSDISRERARQKTFEQARQRAAELAKAREVAGEKQAEVQKQLERT
FT                   RDRGMAMGR"
FT   CDS             complement(24118..24516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00260"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83175"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7V8"
FT                   /protein_id="BAJ83175.1"
FT                   /translation="MRFTLDTNLLVYAVDRDAGDRHCIALDIARRARGRDCVLTLQSLA
FT                   ELFRALTGPKMKVPAALAADIVQEWQDAVIHHGWSFWEAMIWATAKKHGCRILFTEDGQ
FT                   AGRTLGGVTIVNPFGDGGAEFAKAAFGT"
FT   CDS             complement(24521..24766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00270"
FT                   /product="prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00270"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83176"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7V9"
FT                   /protein_id="BAJ83176.1"
FT                   /translation="MPRLVSAADANRQFSEILGQAVQGETVIITRRGAPVAQLTPLGRR
FT                   PADEARDQAWDRLLATLEKGLPLGGHRFDRDSLYDR"
FT   repeat_region   complement(25113..27053)
FT                   /note="Belongs to IS1634 family"
FT   repeat_region   complement(25113..25141)
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 29 bp inverted repeat"
FT   CDS             complement(25189..26922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00280"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00280"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83177"
FT                   /db_xref="GOA:F0J7W0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7W0"
FT                   /protein_id="BAJ83177.1"
FT                   /translation="MFIDVVPNGRSAPAVLLRESFREGRKVHKRTIANLSQMPPALIDG
FT                   LRALLAGGAVVGGADQALEIRRSLPHGHVAAALGMMRKLGIPRLLGRRASRERSLALAL
FT                   IAGRVIAPGSKLSTLRGLNPETATSSLGQMLDLGVIEEREIYAALDWLGTQQGRIERQF
FT                   ARRHLRDGTLVLYDVSSSYLEGRHCELAHHGYSRDHRPDRPQIVYGLLCDREGRPIAVE
FT                   VFEGNTADPATVAAQVETLKRRFHLERVVLVGDRGMITTARIRETIKPAGLDWISCLRA
FT                   GQIQDLAEGPLQMSLFDERDIAAITSPDYPGERLIACRNAALATERRRKREALLVATET
FT                   ELARIRDATRRKRAPLHGEAAIGLAVGAVINQRKMAKHFDLTITASRFDFQRNAASIAR
FT                   EAALDGIYVIRTSVSADVMSETEAVSAYKDLSRVERAFRSLKSVDLAIRPVHHWLSPRV
FT                   RAHVFLCMMAYYVEWHLRDALKPLLFQDHDRPGAETERSSPVAPASTSPAADHKRGRRR
FT                   NDQNLPISSFSDLMAHLATQTLNTAALPKAPNATFTTLAKPTPLQAAAFDLIGIDPMRV
FT                   Q"
FT   CDS             26915..27373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83178"
FT                   /db_xref="GOA:F0J7W1"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7W1"
FT                   /protein_id="BAJ83178.1"
FT                   /translation="MNITRANHRSSRTASPIYGHKTLARNQRYARLSATFRSFPSKNFR
FT                   LDFLNAGDTLVVTRIDRLARSAERPPGYSKIGDVGVRTVLYEAANVILTRPVKGSRLKS
FT                   WAMRVAGRAGMRKAKVALARKLAVVLHRMLADGTAFDVTLAAAARASA"
FT   repeat_region   complement(27025..27053)
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 29 bp inverted repeat"
FT   CDS             complement(27885..28262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00300"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00300"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83179"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7W2"
FT                   /protein_id="BAJ83179.1"
FT                   /translation="MAKTLSEDLRGRVVAAVEQGATHREAAARLGVSAASVSRWRSLLS
FT                   AQRNLKPGRHGGDRRSGRIEKQAHVVLDLLEQMRDATIEELRSALATQGHQFGYGTLRR
FT                   FFQRHRITRKKDRARRRAGAP"
FT   CDS             28427..30310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="ACMV_P3_00310"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="protein synonym:class III ribonucleotide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00310"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83180"
FT                   /db_xref="GOA:F0J7W3"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7W3"
FT                   /protein_id="BAJ83180.1"
FT                   /translation="MCDTAVVGRGFAQRVTEGFATQNVVDPIATLEEYLNREDWRVKAN
FT                   ANQSYSLGGLILHGAAKLVANYWLDHIYPPEVGRAHREADLHLHDLDMLAGYCAGWSLR
FT                   TLLVEGFNGVADRVEASPPRHLSSAVGQMVNFLGTMQNEWAGAQAFSSFDTYLAPFVRK
FT                   DGLSYAEVRQNIQEFIYNLNVPSRWGSQTPFTNITFDWVCPKDLRDQIPLIGGNEMPFR
FT                   YGDLRAEMDMINHAYIEVMSAGDANGRVFTFPIPTYNITPDFDWDSENAERLFAMTAKY
FT                   GLPYFQNFLNSDLEPHMVRSMCCRLQLDLRELLKRGNGLFGSAEQTGSIGVVTINCARL
FT                   GFQHRGNRSSLFERLDVLLAHACDSLEIKRQVIGQYLDAGLFPYSKRYLGTLRNHFSTI
FT                   GVNGINEMIRNFTADTDDITTPVGHRMACDLLDHIRARIISFQEQTGHLYNLEATPAEG
FT                   TTYRFAKEDLRRYPEILQAGTPDKPYYTNSSQLPVGFTEDPFEALTRQDELQGKYTGGT
FT                   VLHLYLGEQISSSAACRDLVRRALTRFRLPYLTVTPTFSVCPVHGYLPGAHHHCPRCAA
FT                   EEPATIPRACEVWTRVMGYHRPVSSFNIGKQSEFTERRFFVEPRAMCHATA"
FT   CDS             30297..31004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="ACMV_P3_00320"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00320"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83181"
FT                   /db_xref="GOA:F0J7W4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7W4"
FT                   /protein_id="BAJ83181.1"
FT                   /translation="MPQPDEPQIGGWAPFTTLDVPGRLAATFFLRGCPLRCRYCHNADL
FT                   QARRGTFPLRWLEALTWLDQRRGLLDSVVFSGGEPTMDRCLEQMIRDVRSLGFEVALHT
FT                   AGVSPKRLGRVLPLLQWVGLDIKAPFGDYARITGSEASGARARVALAMLRESGVPYEVR
FT                   TTVHPALLDAQVLQTLALDLRASGIGRWVLQPFCGRGCVEPALSAENISIATSLVTHLR
FT                   RIIPEIVVRTNGC"
FT   CDS             31250..32335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00330"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83182"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7W5"
FT                   /protein_id="BAJ83182.1"
FT                   /translation="MVAFSSLLDILAEVPDPRRAEGKLYKLPHVLLFSILAIISGSNSY
FT                   RGIVTFIDVHRRRLNRSFGLKWRRAPSHTAIRYILQGLDPAAVEAAFRRHAAQLQAARA
FT                   KPGTASIALHGKTLRGSFDRFHDRTAAHVLSAFATDTRLVLAHVDIGEKSSEIPAAQAL
FT                   LAEMGIAEDAIVTLDALHCQKSLQRRPDRQHPPHRPGQGQSTDVETGDPPYRRHHSGRA
FT                   RNRHTQSRNRAAQAGTRYHLLRRQHLAHRRHRRKGHPRTLGHRKFLPLCPRRHLRRGSI
FT                   PDPNQPWRHRPIAQLRLQHPDEQQSQRQHPQPGPLPRSSRRTRSPSRPHYYPKALNSPA
FT                   ENPIHVTVTLNLAYPVVTHTH"
FT   repeat_region   complement(32295..32302)
FT                   /rpt_type=FLANKING
FT   mobile_element  complement(32303..33382)
FT                   /mobile_element_type="insertion sequence:ISAcr1"
FT   repeat_region   complement(32303..32344)
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   CDS             complement(32319..33335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00340"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00340"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83183"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:F0IZR7"
FT                   /protein_id="BAJ83183.1"
FT                   /translation="MDVLAREDLPFPQSLPEFQRIFPNDAACAAYLESARWNGGFACPR
FT                   CGVVGEPFRFEARPGVLRCRACRKDVSLMAGTVMERSHTPLSTWFWAAYLIASQTPGMS
FT                   AVQFQRQLGLSRYETAFGILHKLRAGMVRPERDKIGDTPQEHVEVDETWVGGRTRGDGR
FT                   GVHHKVLVACAVEVRHRKPGTKLDNRKDGRYAGRVRLAVVPDRSANSLCGFVENAVAPG
FT                   SLIVTDDWSGYAGLGRRGFDHHAIAECGDPEVAEEFLPIVHLVFTNLKTWINGIHHGVS
FT                   AKHLQAYLNEFTFRFNRRLYPFNAFRSLLGIAGRAAAPTFDELYSGEWTHPTFSGCG"
FT   repeat_region   complement(33341..33382)
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   repeat_region   complement(33383..33390)
FT                   /rpt_type=FLANKING
FT   CDS             complement(33390..34505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00350"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83184"
FT                   /db_xref="GOA:F0J7W7"
FT                   /db_xref="InterPro:IPR012830"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7W7"
FT                   /protein_id="BAJ83184.1"
FT                   /translation="MPEIDPLVEVRSGAEICNACRFCDSYCAVFPAMELQRAFSDGDLR
FT                   YLAYLCHNCRGCYYACQEAPEPIDINLPRSFAELRDESHARFVWPGLFAPLFRRNGLVV
FT                   SVTCLVSIMLVFLATLLLPPHPGAITRAQSGPGAFYQVIPWVLMASIAGGSLLFSVFAL
FT                   AVSGVKFWQESGRKGKWIKLTVIMHAMRDIATLQNLGRGDQNCSDHDKSFSILRRRFHH
FT                   AMAYGFLFCFLATCTATIYAHFFDQPAPYPLFSLPVLFGTIGGIGITIGTSGLIWVKII
FT                   SDPAPAVARLMSTDFALLVLLWLAAMTGLVLLAMRTTAAMGVLLALHLGIILALFLLLP
FT                   YSKFVHGLYRSLALLRAAADRSQLDRKNCSP"
FT   CDS             complement(34978..35403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00360"
FT                   /product="cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00360"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83185"
FT                   /db_xref="GOA:F0J7W8"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7W8"
FT                   /protein_id="BAJ83185.1"
FT                   /translation="MVNRIALASFAAVFVAGFATAATPVFPTPALAGGMPDGNAVKGKT
FT                   IFSAQCAACHSVVAGQNGIGPSLYGVFGKPAASVAGFPFSPALKSAHIVWTAAALDKFL
FT                   TNPQAAVPGTKMPYMGMPNAQKRANVIAYLATLKDQN"
FT   CDS             complement(35450..35773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00370"
FT                   /product="putative cytochrome c"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00370"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83186"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7W9"
FT                   /protein_id="BAJ83186.1"
FT                   /translation="MSELLFQKYGITESFRTVYGNSDPLLYAPSPIGGSANGKPDTNSW
FT                   TTELDYYPFNNGGPKWLPWLNAKLFVTDTFYPTFNGLANNYDGFGRSAGANDTLFAGLW
FT                   VAF"
FT   CDS             complement(35979..36818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00380"
FT                   /product="putative cytochrome c"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00380"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83187"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7X0"
FT                   /protein_id="BAJ83187.1"
FT                   /translation="MKTWSHPYSWRLAAAGMVAAAWLAAPHAAYAIPAFAAQTGEPCSA
FT                   CHIGFPQLTPYGRDFKLEGYIAGGTFPKWKNFAIASQIGFTQLHDKIPGGLRPGFKSND
FT                   VVVPQQTSLFYGGALDAQLGLGAFIQATYSGVSKSVHWDGMDIRFAHPATLFGKPLFFG
FT                   LTFNNAPTITDLWNTIPAWGFPYIHSNVQPEPVADDQIDALGGEVYGIGTYGALNITPS
FT                   DMLYTEADLYKSLPNHLSYALGVGPAPRVNGVIPYVRLAFQHTWANNSFEVGSYALI"
FT   CDS             complement(36864..37694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00390"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00390"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83188"
FT                   /db_xref="GOA:F0J7X1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7X1"
FT                   /protein_id="BAJ83188.1"
FT                   /translation="MFRSLGALIRATLDREVVAIDGKTNRGSFDRSRDQAALHVVSAWA
FT                   SDRGLVLGQRQVGDKSNEITAIPELLDVLDIKGAIVTLDAMGCQRAIAAKILERGADYL
FT                   VTLKANQGEKHSAVEELCATTCFSRSPTYRPVHDEFDDGHGRLVGRRVFVCPDAVALET
FT                   LRDWPGLKSVLAVETIRGVNGSGKIEPEILAKAIRQHWQIENSLHWVLDVTFNEDHYRI
FT                   RDRNAVQNFSLLRKIVINLVRRHQASKVSLKGRRKMAAWDNRYMEQILTGIFHA"
FT   CDS             37880..38152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00400"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83189"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7X2"
FT                   /protein_id="BAJ83189.1"
FT                   /translation="MRWRTEEVFRSSKSVCLRLKETEMQDARRLFKLALIGLAATTRTV
FT                   QFVDARNGSSRPATDVIDPGLLPAADAIGPTLEGKTPRQKNLHPP"
FT   CDS             38378..39049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00410"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83190"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7X3"
FT                   /protein_id="BAJ83190.1"
FT                   /translation="MAETKFPVLLATNVLGLLPAPALMRATILLTRRLGRTHPRLFRAL
FT                   AAHKPCTIGIEPTDLRHRFVLRFGGRPVSLVPTSTLEQSLNACVRGRLATLVGLLEGRL
FT                   DSDALFFSREIIITGDMEAVVSLRNALDRETVNVFKAATTLFGPGERAARRVALMLERR
FT                   LAAAHQRLTMGHEALHAARREEHPVTANCERVEAELQALRMRMAKIEAQTRRRNPIGAV
FT                   T"
FT   CDS             39046..40041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00420"
FT                   /product="putative peptidase U32"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00420"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83191"
FT                   /db_xref="GOA:F0J7X4"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7X4"
FT                   /protein_id="BAJ83191.1"
FT                   /translation="MTRYLELVCPAGTLAALRVAVDAGADTVYCGFQDCTNARNYPGLN
FT                   FTREDLHAGISYAHARGCRVFVAVNTFPRAGDLGPWQRAIDDAASCDADAVILADLGVL
FT                   DYAARRHPNLRRHLSVQAAAASPLGIRFYRDIFGISRVVLPRVLSVEEVTSLIGQTGIE
FT                   AEVFAFGSLGTMVEGRCFLSSYMTGRSPSSDGVCAPAECASYHENGDRLVSRLGEVMIN
FT                   RFARDEPAAYPTPCKGRFLVHGRPSYLFEEPTGLNVIPLLAELKAAGVTALKIEGRQRS
FT                   RTYVATVVTAFRHILDALAEGAPPAPIPAVLRAVAEGGRETFGAYAKGWR"
FT   CDS             40038..40937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00430"
FT                   /product="putative peptidase U32"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00430"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83192"
FT                   /db_xref="GOA:F0J7X5"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7X5"
FT                   /protein_id="BAJ83192.1"
FT                   /translation="MSCLTLGPLQFHWPAARRRDFYARIADEAPVDCVYLGEVVCSKRL
FT                   PWFEKDLPKIAERLRRAGKQVVFSTPALIITDHEIAMIRALCETGDLIEINDLACLQLL
FT                   NGQAFVSGPLVNVFNEGTLDVLLRLGAMRVNAPMELSIAAIATLAARSQAGEIEVFVFG
FT                   RQPLAISQRCYHARAHDLHKDNCQFVCGQDADGLAIAQLDGRPLLAINGTQTLSHGHVA
FT                   LLDELADLQAAGVTHFRLSPHALDMVEIATLYRAVLDGIYDAKEALTRLRELTAQLPFV
FT                   NGYLHGRAGMDWQPSRAG"
FT   CDS             41007..42167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00440"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83193"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7X6"
FT                   /protein_id="BAJ83193.1"
FT                   /translation="MDCSGRVISKSFGRMTGGSEHYIVIEPPADLDLTEQLACLEQRYD
FT                   ETRQELCLPAGGAVFRRLFVSDAMNQAPLLRHSRFAEDEDNSPVALSIIQQPPLSGTKL
FT                   SLLAYHVSGALDLSKRRLTPRHVVVEKNGLAYLWTTGLCPGSDERQVPVTQQTRRLFDT
FT                   LIDELDGLGGTLHNNCVRTWIYVKDIDVFYKDMVTSRSEVFLEQGLSAETHFIASTGIE
FT                   GACAHRFDIVTMDAYSILGLAPQQVSYLNDFDHLCPTKDYNVTFERGTRIAYADRAHLF
FT                   ISGTASIDRSGQIVHPGNVLRQFDHALDNVEALLRAGSAGLSELMHLIVYLRDPTDHPR
FT                   IKTALSERLPGVPAIIVQGPVCRPEWLVEVEGIAIADNEDPTLSSF"
FT   CDS             42383..43312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxS"
FT                   /locus_tag="ACMV_P3_00450"
FT                   /product="pyridoxal biosynthesis lyase PdxS"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00450"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83194"
FT                   /db_xref="GOA:F0J7X7"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7X7"
FT                   /protein_id="BAJ83194.1"
FT                   /translation="MSDMPTNLIETSPLRLKTGLAEMLMGGVIMDVTTAEQAKIAENAG
FT                   AVAVMALERAPAQIRAEGGVARMASPKKIKEIMTAVSIPVMAKCRIGHFAEAQVLQALG
FT                   VDFIDESEVLSPADEMHHINKHAFVSPFVCGARNLGEALRRIAEGAAMIRTKGEAGTGD
FT                   VMHAVRHVRQIAKDIHALTVLREDELYAAAKELAAPYELVRIVASIGRLPVPNFAAGGI
FT                   ATPADAALVRHLGAEAVFVGSGIFMRDSQHFVDPSEAQSRAEAIVQATTHYDNPQILAE
FT                   ISESCLGAIHGLAAASLKEEALLQTRGW"
FT   CDS             43339..43926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="ACMV_P3_00460"
FT                   /product="glutamine amidotransferase subunit PdxT"
FT                   /EC_number="2.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00460"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83195"
FT                   /db_xref="GOA:F0J7X8"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7X8"
FT                   /protein_id="BAJ83195.1"
FT                   /translation="MSLKIGVVALQGDYAAHAEALRSSGTEIVLVRATKELADLNGLVI
FT                   PGGESTALLKLLTRENMYEAVREFSMAKPVFGTCAGCIILAKEVLPSPQQSLAVLDIVV
FT                   QRNAYGRQTESRVAMGNCALSGGGLEMVFIRAPCIVRTGSHVEILARYGGFPTLVRQGN
FT                   ILAATFHPELSTDRRIHRFFCAMIRSGQPCLT"
FT   CDS             complement(44091..44231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00470"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83196"
FT                   /db_xref="GOA:F0J7X9"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7X9"
FT                   /protein_id="BAJ83196.1"
FT                   /translation="MLIGYMRVSTDNDRQVLDLQRDALLGAGVDERHQKKSLACSLKWR
FT                   T"
FT   CDS             44776..45363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00480"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83197"
FT                   /db_xref="GOA:F0J7Y0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Y0"
FT                   /protein_id="BAJ83197.1"
FT                   /translation="MGGPLAVRDNRHDSAYLFGAVCPERSIGAAIIMPAVNSEAMAEHL
FT                   REISTQVAPGAHAVLVLDGAGWHQAGERLPVPDNISLLSLPPYAPELNPVENIWQFLRG
FT                   NFLSHQPSSLEQLRRNSCRLPKRLEQVHADARTNRFNHPTRLDQKSHRIGRLLPWALRF
FT                   AFARQSASSKNFRRACDQHAASMIGPGDRFNS"
FT   CDS             complement(45225..45680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00490"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00490"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83198"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Y1"
FT                   /protein_id="BAJ83198.1"
FT                   /translation="MTSWPRDLIGATCVALEPVFKHIETMVFAGARLHGDDTTVPVMAR
FT                   GQTDTARVWVYVRDDRPFGGSGSPCAVFYYSRDRAGVHPQTHLAGYHGIFQADAYGGYN
FT                   KLYELNRSPGPIIEAACWSHARRKFFELADCRANAKRKAQGNSLPIR"
FT   CDS             complement(45736..46413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00500"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83199"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Y2"
FT                   /protein_id="BAJ83199.1"
FT                   /translation="MQYPPVPAVEDIAQHFMRAVRQSECGDWPYRHWKLRDVLPLDVCT
FT                   GILTLPIAPPMLGLTDGTRNTYNDSRCFITPALRRKYPGCEALAQALQRPDVAALMAEI
FT                   CDIQVNGSYLRMEYIQDLDGAWLEPHRDIKEKLFSMVIYLFLGPDAAEWGTDIYDADKR
FT                   WVSQSSGEFNSGTIFIAGPATWHGFDPRPIVGVRRLMEINYVSPDWRDRQQLALPEAAI
FT                   QVG"
FT   CDS             complement(46413..47102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00510"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83200"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Y3"
FT                   /protein_id="BAJ83200.1"
FT                   /translation="MADTSAPFKMLDEAAITAAALRRDPYDYCFVENAMPQLLKEEVLG
FT                   DAPTIPERGSYALPDLQHGPHFGAVVQDLMSDRFRHLVEAKFDIDLSKRPACIVMMGNT
FT                   SGHYNEGYAHPDSPHKIITVLVGFTRAWPYERGRLRVLRSKNRNDYAFEFAPEFGHMLM
FT                   FRVCDHSWHGFLPQKGQRKSLQLCYVDSEWYVRKEYARHSLSAYAKSVPLLRKAIDWAP
FT                   RRLPGGR"
FT   CDS             complement(47218..47436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00520"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83201"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Y4"
FT                   /protein_id="BAJ83201.1"
FT                   /translation="MTFERGNLTRQRARVLGNVDALLHAGGATIEAMSHFIVYLRDSSD
FT                   YNVVEACFSDKFFKCPAPDSARPAMPP"
FT   CDS             complement(47465..48229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00530"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83202"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Y5"
FT                   /protein_id="BAJ83202.1"
FT                   /translation="MASAHGVSCHSFRTNSGDTEHYIAIATPAQLSLARQIDALGQRYA
FT                   AVRQTLRLPPDSAVFRRLYVSDALNQAAMVRDSSLYREPLDSPVAVSMVQQPLLSGAKV
FT                   AMLAYHVDSATPLCKARAPSCDLLLHRGDLRHLWSTQLCTSTTAAPNSAAEQPRDIFKR
FT                   LIGAVQAQGGTLADNCVRSWIYVKDMDVFYQDMVAARTVLVQQHGLTRDTHYLPSTGIE
FT                   DACGHQCDVVLMDTYSISIIGLATEQVSYECL"
FT   CDS             complement(48358..48645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00540"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83203"
FT                   /db_xref="GOA:F0J7Y6"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Y6"
FT                   /protein_id="BAJ83203.1"
FT                   /translation="MARQAPRWHVHFTPTGASWINQVERFFALVTEKQIRRGVHRSTQQ
FT                   LESDIRAFIDAHNADPKPSRWTKSADNILAAIQRFCQRSSQIRETTESRH"
FT   CDS             complement(48555..48965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00550"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83204"
FT                   /db_xref="GOA:F0J7Y7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Y7"
FT                   /protein_id="BAJ83204.1"
FT                   /translation="MHIRARSRRCVDEKSQIQALDRTQPLLPMRPGQIERRTHDYTRHG
FT                   TTSLFAALDIATGAVIGRCYPKHRSSEFRKFLDQIEANVPSNLDVHLVMDNYATHKTKP
FT                   IRDWLAKRRAGMSTSPPQEHPGLTRSSASSPW"
FT   CDS             49167..49580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00560"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00560"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83205"
FT                   /db_xref="GOA:F0J7Y8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Y8"
FT                   /protein_id="BAJ83205.1"
FT                   /translation="MNMTMSSVPDSRCGRVEVITSVQCRRRWTTAEKVRLVEEAMQPGL
FT                   SVSYVARRAGISPSQLLSWKRRMLEGGATAVQADDDVVGVARVQELEKRVRDLECLLGR
FT                   KTMEAEILKEALALAAPKKPVLRLASLDRDGSP"
FT   CDS             49814..50152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00570"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83206"
FT                   /db_xref="GOA:F0J7Y9"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Y9"
FT                   /protein_id="BAJ83206.1"
FT                   /translation="MLRIMQANGLVLARHTAYRPARTHDGVVIALRSNIRWCSDHLELK
FT                   CRNGDIVRVLFVIDDCDREIIAWSAVAHVLRRPLMEERNRARAGREAAKISIIKINILI
FT                   RNFAPYAV"
FT   CDS             50494..51435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00580"
FT                   /product="putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00580"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83207"
FT                   /db_xref="GOA:F0J7Z0"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Z0"
FT                   /protein_id="BAJ83207.1"
FT                   /translation="MTSPKGRKNPVPGRLIGYARVSTEEQGTDPQLDELQAAGCADILE
FT                   EHASGADRGRPVLARLLRTIQAGDTLVVVRLDRLARSVSHLLAVIEQLEDVGAHFRSLR
FT                   DPIDTTTPQGMFSLQVLGAVAQLERALIAERTRAGLCAARVRGRIGGNPGLRARDPEAI
FT                   RKIRKSRDAAYLDGILSQLDSWLPTVRRMRPDQPWGDVVRVLNRGQATPAHHASGRIWT
FT                   VERLRRTVHRLVAEGLADRSLLGRAPPQRSDDRLVRLVAGIKTAAPGHTLQQIATQLEA
FT                   MRERTPRGGTRWHPSSVRLLLIRAGRLGLLSA"
FT   CDS             52124..53275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00590"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00590"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83208"
FT                   /db_xref="GOA:F0J7Z1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Z1"
FT                   /protein_id="BAJ83208.1"
FT                   /translation="MGKHITFIGLDVHKETITVALAESGGRDDVREYGRIANTPEALTR
FT                   VVTKLQRVGGELRFCYEAGPCGYGIQRQLTAAGHGCVVVAPSLIPRKPGERIKTDRRDA
FT                   VNLARLHRAGELTAVWVPDPAHEAIRDLVWTRECLSASYRERENSRFLLKERNSLFHEN
FT                   GNSDNITFMKTIVIANQKGGSGKSTTAVHLAAAAEAAGDGPVVISDTDPQGTAADWFNQ
FT                   RKQSGIETPRYSELSLDDLAGRVQALDQAGAAYLFIDTAPSIGAVNADLFALADLILIP
FT                   LNPTPADLRALVKGLPLIRESGKPFQFVLTRVRPKLRNNDGAAMALGALGLVLSSRMHE
FT                   RVIYAETFAHGKTALETEVKGIAAQEITALWHEIREKLERENS"
FT   CDS             53289..53594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00600"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83209"
FT                   /db_xref="GOA:F0J7Z2"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Z2"
FT                   /protein_id="BAJ83209.1"
FT                   /translation="MSKRPAIDLAALTSEAARPMTEAVQRVPRPTPAAVPPPAPANAQH
FT                   AAERPTRTANLQALAFKVSPAFRKRFRQRAAAADLKLNELLFEALDAWEVQRGLKR"
FT   CDS             53849..54061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P3_00610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P3_00610"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83210"
FT                   /db_xref="GOA:F0J7Z3"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Z3"
FT                   /protein_id="BAJ83210.1"
FT                   /translation="MPKAAASYVGRNIRYRQRLRDAGAQEVLFQLPDETVALIDEIKKR
FT                   QGLRSRSQALLQLIERGREPTQQTA"
XX
SQ   Sequence 54248 BP; 10651 A; 16072 C; 17132 G; 10393 T; 0 other;
     atggagacgg aaagtcccgg tttcgggcag aattcaagga caaatcaggg gtttggcggg        60
     cttcgccggc tgagcctggc gatgcttgcg acggaccgga ccgcggcagg tttcacggga       120
     ctgtcagacg gggcaggggg gccaggtgcg gttctggcgg cgttcaaggc ggcggcgccg       180
     tatctcggcc tgccgccacg ggtggtgcat gcggtggact ggctgttccg ttttacccag       240
     cggcaggact gggaggcggg tgcgcggccg gtggtctggc catctgctgc cgtccagcag       300
     gcggatctgg atctcggggc atcacagacc aaggcgctga accggcatct ggtcgagctg       360
     ggcctggtgg tgatgcggga cagtcccaac ggcaagcgtt acggccggcg ggaccgtggg       420
     ggccggatta tcgaggcgta tgggttcgac ctgtcgccgc ttggggtgcg gttcgacgag       480
     ttccgggctg tggcggagaa ggggagggcg gagcgcgagg cggttcgcca gctgcgccgg       540
     cgggtgacga tagcccgcaa ggcgatcgag cagatcgtgg agacggcggt ggaggtaggt       600
     ctggaaccgg gtgtcttcgt gcgggaggcg gaggaagcgc ggcgcctgtc caggcgtctg       660
     gcgaaggcgg agagttccgc tgttctcgcc tttggcgtga cgcggctcga ggatcgccat       720
     ggcgatctgc gccagcggct ggagagcctg atcgcggcgc ggcagggaac cggcagcgcg       780
     caaaaagatg tggaaaccga ccccaaggcg ccggaaaacc ggccccacca atacagatac       840
     aaatcagacc taaatcctga acaggatacg gtatctggca ttgagaaaag tagtccggcc       900
     ccggtggggt cgggggcaac ggcagagacg acggggctgc ggaacggtcg gtcaggcagt       960
     gagacgggga ggggcgagca aaaacctgcc cgtcgggatg atggaacggt gctgcggatc      1020
     acgccggacg agctggtgcg cctcgcgccg cggctgcttc cctatctcgg gcggtcgtcg      1080
     ccggcctggc ctgacgttgt ggaggcggcg gactggctgc ggcacgatct gggggtgtcg      1140
     aaaccgctct ggggcgaggc gtgtatcgcc atggggcggg agcaggcggc gattgcgctg      1200
     gccatcgtct cggcacggcc cgcggggcat ttccggagca cgcccggcgg gtatttccac      1260
     ggcatggtcg caaaagcccg ggccggcgaa ctcaacctcg gcaagaccat ctggggcatg      1320
     cggagcaagc gtgacactca cggctggaat cagccgcagt gagacaatac gggacggcgc      1380
     gataatgaca ctggaagccg attatcttga ggcgcttggg ctgctcggcc gcgtctgcga      1440
     gcaatatcgc cgcgagaccg gaagtcccgc gtacctcgtt ggaggggccg cggttgcgct      1500
     gtggaccggt ggggctttcc attccgcgga tttcgacctg atcgtggcct cagctatatc      1560
     acaccttcag cgcggatatc gtccgcttgc gaggtgtctc aatcaaccgt gctgcggggg      1620
     acgcgttgcg atacaccgac gtgattatgg cccgctgtga ggcgttgagc ctgtttccta      1680
     gggctgtggc caccccattt cgtcttccgg ttgggcacct atcagcctat tctggcgtta      1740
     atcaggggtg gataggccgc ctatctggcc tgaagtaacg aaacggcctg cgctgtagca      1800
     taagcggaca aagcaggaac atcaggctgc ctttatggtc gtgtcgggga ttggcctgag      1860
     aggtcgcaat ccggcatggt tttccgtcga tttctgattg gcgctccaga tgtagtcgcc      1920
     ggtcaggttc acatgctccc agccgatcgg cgagagatgc ctgaggaggg ttccgggcac      1980
     atcctcgacc tggcgtaggg cctgtagggg tcgtttgcgg gagggagcgg aatcctacgt      2040
     taacgcctga atctatttct tgagtacgaa cctctgcgac acgctgattg tgatacgggt      2100
     tatggagcaa ggaaattggt ttttgctcgt catctgccgg ccgtatgcca aacactcgtt      2160
     tgcgatacat agtcgattag gcgattgaac aatcctccct tttccggcaa caaagtgatt      2220
     ttcgcttcag gaactcgcga tcaggccgtg gtgctgacgg tccaggttgc ggtcttgatc      2280
     gggccggctt tttccagtgc ggcgacgacg gcatcgagtt cgtcgggctt ggcgttggtg      2340
     ggcaccaggg ttgccgccag ttcaaccagt tcctcgctgt cggatagggt ggcaatctcg      2400
     cggatcgggt agtgtgcggc ctccagttcg gagaacaaaa ggtcgcgcac atccgacacg      2460
     tcggccgggt cacacagcgc atggatcgcg tattgcgctt cggtggcgcg cgcgtcgatc      2520
     ggccggcggt tgatgtaatt atgggatggc ccgcccctct cgcggcgatc gggtagtatc      2580
     gccgctggtt tggagagagg agcagaccga tggatatcgt gattgtcggc atcgatcttg      2640
     gcaagaactc ttgcagcgtg gtgggcatgg acgccgccgg ccgggttgtt ttgaggcgga      2700
     gacttcggcg gggaacgttg gaaagtttcg ttggcgagct tgggtcgtgc attgtggcaa      2760
     tggaagcatg ttgcggcgct catcacctcg ggcggatttt cgccgcgcgg ggccacgagg      2820
     tgcggctgat gtcgccggaa tatgtccgtc cgtacgtgaa ggcgcagaag aacgatgatc      2880
     tcgacgcgga ggcgatcgca gaggctgcga cgcggccaac gatgcgtttc gtgccggtga      2940
     agagccagga ccaatctgat ctccaggctt tgcaccgagc ccgggagcgc ctggtctcgg      3000
     aacggacggc gctgatcaat cacttgcggg cgttgctgct ggagcgaggg atcgtcgttc      3060
     cgcaaggccg gaggaaactg gaagccgagc ttgagacatt ggccgaagat ggcggttttg      3120
     ccgcgttgag cccgcgcatc cggacgttga tcgaagatct tcgggcggaa tggcgttcac      3180
     tcgaccagag gatcaccggc ttcgacgccg agttcgttca gttggctcgt gacgacgtgg      3240
     ctgtgcgacg tttgaccaaa atcccaggaa tgggaacgat aaacgctacg gcgctggcgg      3300
     cggcggtcgg cgaggcgcag gcattcaaac gtgggcggga catggcggcg tggctggggc      3360
     tcgttccacg gcaaatgaca acgggtggaa aaccgcgcct gctcggcatc agcaaacgcg      3420
     gcaatcgtta tttgcggaag aacttgatcc atggcgcacg agcggcgctg ccttatcttg      3480
     tcgaacgcga tacaccgttg ggccgctggg cgcggggatt gctcgatcga gcgcataaga      3540
     acgtggtcgt agtcgcgctg gccgcgaagc tggctcggat cgcatgggcc gttttggcgc      3600
     acggttgcga ttacgacgcc caattcgaag cggcggctgc ggccgcatga cggaatcgcc      3660
     cgaacagcgc tcatagttgg gcgcgaaagg gcagtcgatg tctgcgtgag gtgaaaggaa      3720
     gatggcctga cagtcgaacg gcggcttgaa aacctgaccc agtgaacggc ctccgaggcc      3780
     ggtgtgatta tgaggatcag gccgcgcgga tctccatctt ggccgggttc gaagcccgag      3840
     accggatacg ttgaagcaga ctgattagag ccagatgaaa atcacccctt gcggacgggg      3900
     cgggccatac gttcacgagg ggacggagca gcgtgttgcc ggcaaggatg aaaacggtca      3960
     gcaaggtggc ctcggcggag tagccgcagc cgcagaacgc gccgaccgca gccgagcacc      4020
     agagggttcc cgccgtgttg atgccgcgga tattggcgcc ctccttcagg atgacgccgg      4080
     cgccgagaaa gccgatgccg gagacgatgt aggcgaccac gcgggtcgat ccggcgggac      4140
     cggcgaggcg aaccccgaga tcggcgaagg cggcggcgcc gagggcgacc agaacggtgg      4200
     tgcgcaggcc ggcggagcgc tgccgccatt ggcgttcggc accgatcagg gtgccgagca      4260
     cgaaggcgac cgcgaaatca ccgactgtcg tgagaaatgg aactggaaat ggttgggata      4320
     aatctgtcat tcaaaacctc gctggtcagc ctatcccccc gcaacatgaa gaaatcccca      4380
     gcccatgacg atcagcatga cgccgatata gaggcgcaga ccccagaaca cggcctgctg      4440
     ccagggccgc agagctaccc gctcgatcgg catgagtggc gtcaaccagc cttccgcgcg      4500
     ggcaatcgcg gcgatgtcgg cactgttgtc atgggcggtg cggtcgaggt cgcgctgact      4560
     ggcccaggcc gcgcgcagca ccggtatccg gctgacgcct ttcgagcgac gggtctcact      4620
     ggcaggaaaa cggttgtcct ggttcatgac ttggcgctcc tgagcgacga attttcaaag      4680
     ggcatgggga aacacggtcg cgatgccgta gaggccattg caggcgatca gcatgaccat      4740
     gacgccgacc gacaggatgt tgcggatcgg tgaattcacg tggtcgccca gcaattcccg      4800
     atcattgagc agcatgagca ggaacagcat ggccgttggc atgaacacgg ttgcgatcac      4860
     ctggacggtc aggttgagga acccgaccgg cacgtgcggc agcatcggca cactcgccgc      4920
     aatcgcggta ccgagaatcg ccggcgcata gaaatacagt gagcggcgcg gcgagatgtt      4980
     gaccgagcgc ggtacgtcga gcgcctcgcc gatcgcccag gcggtgctgg cggtgatcac      5040
     gatcgaggcg atcaggccgg cctcgaacag gccaagcgcg aagatcacca tcgcgccgtg      5100
     gccgagccgt gaaccgatat cggcaagcac cgagtggtcc cctagcgacg ccgtgtttgc      5160
     cagaccgtgc aggtattgcc cagaaatcac gatgatcgag gtggcgacca ccaccatccc      5220
     gatcacgccg agcatcagat cgcgtcggct tgccttgatg tcctgcggca gaatcccctt      5280
     atcgaccacg caggattgct ggaaaaacaa ctgccacggc gcgatcgtgg tgccgatatt      5340
     cgccgaaatc aggatcagga acccagccga gagcaacccg cccggtagcg cccagccggt      5400
     gccggtgaag gttcggccga tcgcactcca gtcgggatgt gagaacagcg ccagtggcac      5460
     gaacaccatg ttgaatgccg caacgaacag cgagatccgc tcccaggtat agtatttcag      5520
     gaacagcaga atgctgacga taaagacgaa ggcggcggga atcgtcacga ggtaggggat      5580
     atgaaaaatc gcgctggcga cccggatgcc gatgaactcg gtcatcagcg tcaggatatt      5640
     cgcgactacc agatcgatca gcgaaaacgc gccccagaac gcgccgtagc gcttccagat      5700
     catctcggca tggccgcggc gggtgacggc gccgagccgg atggtcattt cctggaccag      5760
     ataggcgatg aagccgagcg ggatcatcag cgggatgaac aggctgaacc cgtaggtggc      5820
     gccggtctgc gcgtaggtga tgacgccacc ggcatcgttg tcgccgagca tgaccagcag      5880
     gccaggaccg accaacgcaa ggccaagggc gatgcggctg cccaggctct gcttgccgat      5940
     acgcagccgc tgaatgcgca gccgatcgcg cagccgggct tcaagaccct ctggaaaggt      6000
     gatgcgggcc gtttctggtg agatcaggag atcggtttcg gcggacatgg catgtctccg      6060
     tgatcggcaa atgtgaggtg ggaatgatgc ggaagttgac ggtgatccgg accggattca      6120
     gccgggggct cgccgcgtgg tgctgcgacc actttccaat aggtcacgag ccgccccgaa      6180
     ccgtcggggc gccaacaggt gacaagccga cggcggggga atgccgcgtc actcgatggg      6240
     ttactcctga tcggcgaaga cggccgatca gttcgttttc tgcggaagat catcgtgatc      6300
     cctcctcctg gtcagcattg gctggaaccc gggagggatg ggcggggttc agcgcgttgc      6360
     gcgcatcact ccagccgcgt atccggcccg ggcaatcgtc catcccacgg ttgaacggac      6420
     agcaagcgaa aagcgcttac tatcgtcctc cgaaggctgg ctggtcgatc gcggtttcat      6480
     ggggtccttg gaaatttggt tgatcaaaac cgcagaaatt cgccttccgc agctatccgt      6540
     gccatatacc cccccatagt atttggtcaa gaggcgatgc aatacaccga aaaggaaaaa      6600
     cgcaagctgg tgaaccggct cagccgcatt cgcggccaag tcgaggcgat gcaggcggcg      6660
     ctggacgcgg atgcgcgatg cacggcattg ttgcagcagg caacggcgtg ccgcggtgcg      6720
     ctggacgggt tcatcggcac cgtgatcgaa caccatatcc gccagcatat cgtcgatcca      6780
     aagcagcagg agaccgatcg cgctcaggcg gcggaggaac tgatcggtgt ggttcattcc      6840
     tacctgacgt aggttgaatt acgtaggttg aatttctgat caaaccgcct caagggcgac      6900
     agcggcgttc cccaacaatt tgataccagg cgacttcaat gtcccatctg ctttcatata      6960
     atgataaagc gtgctcgccg ggatgccgcc caactcccga catatagacg ggatgctgcg      7020
     cgtggaatct gccatcaggt gttgagcata tcgcaaacgc tcggctgtca tcatacgggg      7080
     ccggccgccc ttacgacctc ttgcacgggc cgcgacgata ccctctcgca cccgttgtct      7140
     aatgacgttc cgctccatct ccgcaaatgc agcctgtatt tgcaggaaag cccggccggc      7200
     cggcgttgtt gtatcaaagg cggtgttcag cgcgcggaag ccaacgccgc gtgcttccaa      7260
     gtcatcaacc agcccgatca gttcgccggc aagtcgcccc agccgatcga ggtccaggac      7320
     gaccaggaca tcaccgcgcc ggagatagtc aaggcaagcc ttgataccgg gccgatccga      7380
     acgcgctccg ctgccgcgat cttcaaaaat tcgctcacag ccggcaaccg tcaaagcatc      7440
     catctggcga tcgaatatct gtcgttcctc tcgcgtggag acccgtgcat accccaccat      7500
     cgacatagcc gttccttatc gaattagttc acgaaaattg ttcgaataga atattttctg      7560
     tcaatagatt tttgcggatt tgtcgtggat aaaatgccgc tgctccaccg ggacggtcac      7620
     actcacgaaa aagaagtgtt tgtcgtgaat ggactcaccc gatgattggc ctcttacaga      7680
     gtttgtggcg ttcttgcttg gttcaccctt agcgttgtct ggcgaacaac agatgctatg      7740
     gcctctatta cgtcgaatgg catctgcgcg acgccctcaa gcccctgctg ttccaggatc      7800
     acgaccggcc aggcgcggaa actgaacgct catcgccggt tgcccccgca tcgacatccc      7860
     cggccgccga tcgcaagcgc gggcgacgcc gcaacgacca gaacctgccg atttcgagct      7920
     tcaccgacct gatggcgcat ctcgccacac agaccctcaa caccgcctcc ctacccaagg      7980
     cgccgaacgc caccttcacc gctctggcaa accccacgtc gctgcaaacc accgccttcg      8040
     ccctgatcgg gatcgacccc atgcgtgtcc agtaagcgtc aaaatcaaat cagaaagttt      8100
     gttgataaat gcagggagtt tgcattcaaa ttagtgaaaa cttcagtctc aagcacatgg      8160
     atgggctgtc cgacgaagcg atctgcgtgc gctatctcga cagtccgtat gtccaggcat      8220
     tctgcggcga gacgcatttc cagcatgccc tgccgctcga tcgatcctcg atgacgcgct      8280
     ggcgcaaacg gatcgggtcc gagcggatgg aggccctgct cgccgagacg ctggcggcgg      8340
     ccgagcgggg tggcgccgtg gcggagaagc actacgggcg ggtcaccatc gataccacgg      8400
     tccagccaaa ggccgtgacg catccgaccg acagcaaact gctgcacaag ggcattgaga      8460
     cactcgcccg catggcgcgc aagcacggca tcacgctacg ccagtcgtat cgccgggttg      8520
     cgcgctacgc caggcaggag gcggcgcgcc tgcaccatgg tggcaaacgc cgcgaggccg      8580
     aggctcgcgt gcgcaagctg cggacctggc tgggccggct ggctcgtgac atcacccgca      8640
     agatcgcagg caacgctgaa gcgaaggcgg cgttcgccga aacgctgggc ctgatcaatc      8700
     gcctgcttcg ccagaagcgc tccgaccgcg gtgccgacaa gctctattcc ctgcacgcgc      8760
     ctgaggtgga gtgcatcggc aagggcaagg ccaggacgcg cttcgaattc ggcgtgaagg      8820
     tctccatcgc caccaccaac gccgctgcac ccggcggtca gttcgttctc ggcatgcaga      8880
     gccggccggg aaatccctat gacggccaca ccctggccgg ccagatcgag caggtcgagc      8940
     ggatcaccgg cgttgccgtc gcccgcgcct atgtcgaccg cggctatcgc ggctacggcg      9000
     tagaagccga gggcagaagg atcttcatat cccgccagaa acgcggcatc acccccacca      9060
     tccgccgcga gttgcgccga cgcgccgcca tcgaacccgt catcggccac atgaagaccg      9120
     acggccatct cggaagaaac ttcctgctcg gcgtcgacgg tgatgccatc aacgccgtcc      9180
     tcgccggcgt cggacacaac cttcgcctcc tccgcagatg gttgatcagg cttctttgtg      9240
     ccctcgtcgc atggctctct gccgcaaacc gctcaccaag cctcggcttc gcccaccgcc      9300
     agatcacata gttcacaggc gacttcctac tccgcctcat ccatcgtatc gagaaacccg      9360
     ccaaccacat ccatgcaccg cgcggtctcc tctacatgcg gcatatggct cgactggtcg      9420
     aacagcaccc agcgcgcgcc ttcgatcagt tcgacatagg ggcgaaccgt ctccggtgtt      9480
     gcctcgtcga acgcgccgga caggacgagc gtcggcaccg cgatcacgtg cagacgctcc      9540
     gtgatgtccc acgtcctgag cgtgccgatg acatgaaatt cgctcggacc gttcatcgtg      9600
     tggtaaactg ttgggtcttc cgccatctgc gcgaagctgc gtttcacctc gtccggccag      9660
     tgatccagcc gacagagatg tcgatgataa aacacatcga ccgccgcctc gtagtccgga      9720
     tgatcggtcg tccccgcgcg ctcgtgcgcg agcagggtct gctggacctc ggcgggcaat      9780
     tccgcccgca gtcggttcgc ttccgcgacc caggtgacca tcgaagcagg ggaattggcg      9840
     atcaccagcg ccttcagccc gggaggacgc cggaccgcgt gttccgccgc cagcattccg      9900
     ccccaggact ggccgagcac cgcataacgg tcccggatgc cgagatgatc gagcagattg      9960
     tcgagctccg cgaggaacag atcgacggtc cagaacgcag ccccccggtc gggcaggtgg     10020
     gtggaccgcc cacagccgag ctggtcgtaa tggatcaccg cccgccttgg tgtggcgagc     10080
     agccggaacc ggtctacata gtcatgcgcc gcgcccgggc cgccatgcag caccaccagc     10140
     ggcggcccgc ccgcctcgag gtcgccgctg acgcgatacc atgtccgata tccatcgaac     10200
     ggcgcgaagt tccctgcatc catgatcgtt cctcacaaat aacgggcggc gcgccgccgg     10260
     gtcaggtttc cggaaaatga caggcgcagt cgcgcccatc atccagtgcg cgcagtgcgg     10320
     gccgctcggc gcggcagcgc tcctgcgcgc gcgggcagcg cggatggaac cgacagcccg     10380
     aaggggggga tatcgggttc ggcacgtcgc cggtcaggat gatccggcgc ggtcgccgcg     10440
     ctgggtccgg atcgggcatc ggaacggcgg aaatcagcgc catcgtataa gggtgggacg     10500
     ggctagtgaa cacgaggtcg gtcggcccgg tttcgacgat cgagccgaga tacatcaccg     10560
     cgacacgatc cgtgatctgg cggacgatgc tgagatcatg cgcgatgaac acataggtca     10620
     gcccgagccg ctcctgcaga tcctgaaaca ggttgaccac ctgcgcctgc accgagacat     10680
     ccagcgccga gaccggctcg tccgcgacga tcaggtcagg ctccagcgca atcgcacggg     10740
     caatcccgat ccgctggcgc tgcccgcctg agaattcgtg cggaaaccgg tccatatgtc     10800
     cccgccgcag cccgacgagg tcgagcaggc gggcaacccg gtccccgatc tcgcgctccg     10860
     gcaccgtcgc gtggatgcgc atcggctcgg cgattaggtc acgcacccga taccgcggat     10920
     tgagcgaggc ggcaggatcc tgaaacacca tctgcatccg ccgccggatc ggccgcagcg     10980
     cgttgcggga tcgatgcgtg atgttgatcc cgtcgaacac cacgctgccc tcgctgacat     11040
     cgtgcaaccg catcaggcac cgcccgagcg tcgatttccc gcacccggac tccccgacaa     11100
     tgccgagcgt ctccccgcgc accacacaca gcgacacacc gtccaccgca tgcaccatcc     11160
     gccgcgccgc cccgatcacc cggcgcccga ctgcgaaccg tttcgacacg ccactcgctt     11220
     cgagcagcac gacgccgtcc ggcgtggtca tgacaaaacc ccggccgtag gcagtgccgc     11280
     aaggacacag gcataacggt gcccgtcgcc gcgcatctcc ggccgaacca cgcaggcgcg     11340
     cgaccggtga gggcagcgcg gcgcgaaact gcatcccggc ggcagctggt cgagtgccgg     11400
     cggcgcgccg gaaatcgagg gcaggcgccg tggccgcacc cccgtcatcg gcgggatcga     11460
     gccgagaaga ccaaccgtgt agggatggcg cggccgttga aaaatcgctc ttctgtcggc     11520
     ctgctcgacg atccgcccgg catacatcac agcaacccgg tcggcgattt cggcaacgac     11580
     gcccatattg tgggtgacca gaatgatcga cgacccgaaa tcccgccgca aattgcggat     11640
     cagatcaaga atcgccgcct gcaccgtcac gtcgagcgcc gtcgtcggtt cgtcggcaat     11700
     caccagcgcc ggattgcacg atagcgccat cgcaatcacc acccgctggc gcatcccgcc     11760
     ggacaactgg tgcggaaacc gctcgatcac atcgcgcggc cccggaatcc ccaccgcctc     11820
     cagcagctcg agcgcccgcg cctttaacgc gcaccccgca agatcggtat gcagccgcaa     11880
     ctgctcgacg atctgtcgcc cgaccgaata aaccggcgtc agcgcggtca tcgggtcctg     11940
     aaaaatcata gcgatctgcc cgcctcgcag cctgcgcatt tcccggtccg ccaacccgac     12000
     cagttcgcgc ccctcgaacc ggatcgaccc ctcgacgatc gcattcggat cgtcgatcag     12060
     ccccatcacc gccatcagcg acaccgactt ccccgaaccc gattccccga cgacaccaag     12120
     aatctcccgc cgcccgagca cgaacgaaac cccatccacc gcacgcatca ccccacgccg     12180
     cgtgcggaac gaaacccgca gatcggaaac ctcgagcaaa ggcgcctcga tcgtcattcg     12240
     gcgccgggcc gggaaaaggg caggggaggg tgataccagt tggcacggcc cacgaccgtc     12300
     ttggcggtcg gatcaaggca gtaaaggaag ggcttctttt ttggaaaaaa gaaacaaaaa     12360
     atttttttga gctgggtcac cggcgttttc acagggaaac acccatatgt ccaaagtttt     12420
     ttttatttct tctttgttta aaaaaaagaa gatgcttatc ttctagaaat gttgctgaga     12480
     ctatcatccg atgcatattc cagtataagt gcttatttta tgtaaaaaag aatcaaaaaa     12540
     ttttcgatta ataaattctc gattgttcac acgatcgagc ggcaatatgg aatcctgttt     12600
     tcgatcagtc atcgcgcacg cgtgggtcga agacggaata aaggatatcg acgagtgcgt     12660
     tggcggcgac gacgaagaac gaggcgtaga tcacggttgc catgatcatc ggcaggtcga     12720
     gattggtcag cgcctgatag gtgaggtagc cgacaccggg cagtccgaac acgacttcga     12780
     cgagcagggc cccgccgccg acgagggcgc cgaaatccag tccgaaaagg gtgaagatcg     12840
     cgatcagcga gcagcgcagc gcgtggcgga tcagcacggc ccggctggac aggcccttgg     12900
     cgcgggcgag gcggatgtaa tcctcctgca tcgcctcgat gatgttggcg cgcaggacgc     12960
     gtccatagat gccgatgaac gcgaccgcca gcgtgcacca gggcagcagc agcgacttga     13020
     accagagtgc ggggttgcgg cgcagcggca catagccgag tggcggcacc catgagaaca     13080
     accacgtctt gtgcagcccc ccctgcgcga tcaggttgac cacctcgccg agccagaaca     13140
     ccgggatgga aatgccgatc aggctcgcga tcatcagtat gcggtcgatc acccggtcct     13200
     tgtaggcggc ggcaagcagg ccgacgagaa tggcgaacac gatccagatc gtcgcggccc     13260
     cggcgacgag cgacaatgtc accggcgccg cgtggaacac cgcgggcacc actttctcgc     13320
     cgagattgac gaaggacgtc aggtttcgct tgacgaccag actgtccatc atccggatgt     13380
     actggaccgg caatggccgg tcgaggccga actccttgcg gatcagcgcg accgtctgcg     13440
     gcgaggcgtt gcgcccggcg atccgcgcgg cgggatcgga accaggggtc gcgaagaaga     13500
     tcaggaacac gagaacactg atgccaaaca tgacgaacag catgtggccg aggcggcgga     13560
     gaatggtgaa gccgagcgac aagctggaat cccgcattta tttcagcgtc aggcgggcgc     13620
     gcgggtcgag cgcgtcgcgc agcgcatcgc ctaggacgtt cagcgcgacc acggtcatca     13680
     cgatcgcaag ccccggcgcg agcgagacga tcgggcgggt atagagcagc tgctcgccgt     13740
     tgcggatgat cgtgccccag ctcgcactcg gcggctggat gccgatgccg aggaatgaaa     13800
     gcgaggcttc ggtgatgata tcgagcgcca tcatgatcgg cgcgaacacg attagcgtcg     13860
     aggccacgtt gggcaggata tcccgccgta agatccgccc gtccgaggcc ccgagcgaga     13920
     tcgacgccgc gacaaaatcc gagcgccgca gcatcattac ccgtgcccgg atcgggcgcg     13980
     cgacataggg aacataaacg atagcgatga tgccgatcgg catgatcagg tcgttcgagg     14040
     tgatgatgac agggccgaga tgaaacccgg cattgatgag gatgaccgaa agcgagatcg     14100
     ctagcagata gatcggaaac gcccataata tatcgagcat gaccgagatc acgcggtccg     14160
     tcatcccgcc ataaaacccc gccgcgacgc cgaggagcga ggcgaggaga aggcagatcg     14220
     cggtcgaggc agccccgacc agcagcgaga cccgcccgcc atagagcagc cgcgccgcga     14280
     cattccgccc ctggccgtcg gcaccgagca tatagggtcc ccagcgccag gtcgggccga     14340
     tcggcgtgac gccgaacccg tcgctcgccg gctgcatcac cgaaacctgt ttgcctgcga     14400
     tcgtgacggt gccgccgaga ttcgacttga acggatcggt atgcgcgaca aaatgcgcat     14460
     agagcggtgc cgccaggcag gcgagcagca ccaccgcgag cacggtggtg gcgacgatcg     14520
     ccgtccggtt ccgcgtgagc ctcgccagag ccgctgccca gtagccccgc gaggccgcct     14580
     ccggcaggtc gggcgcgttc caggcacgca gcgcctcctc gtagtcagca tcgctcacca     14640
     tcactggcga cggagcttca gtcacttgat ccaggccaga tcggggatga aataggtctg     14700
     gccgctgaag acgaaatggt gcagccggct cgagacgaaa tcgacatgct tgggcgtgaa     14760
     cagcggggcg accggcgcct gatcggtcat ttcccggtcg atcttcgtcc acatcacatc     14820
     cgccttcttc ggatgcgcga tcgacatcgt ttccgccacc gccatctcgg tatcgatcga     14880
     cttgtcacag aactcggaaa tattgatcga gttgtccgat ccgggatgga acgacttgca     14940
     cgacagcagc acattgagga agtccgacgg ggccgggtaa tcctgatacc aggtggtcac     15000
     cgccatctgg acatgattgt tcgagttctg gatgtaggtg aactggatgt tcgacgatat     15060
     gcccttcacc ttcgccttga agcccagccg gtcgagcacg ctctgcagat agattccgat     15120
     cgcccggctc gggtcgctgt tctgggtgat gatcgtcacc ttctgccccg ccatgcccga     15180
     ctttttcatg taggccatcg ccttcttcat gtcgggcgca gtccacgtgg tgcccggatg     15240
     ttcggtgaat ggacagaagg gcttgtagcc tggcatcccc ggcggcagga tctcgcaggt     15300
     cgcggtcgcg accgccggtc cgccgaacag tttcaccaga tcggcgcggt cgatcgcgta     15360
     attcaccgcg agccgggcat ccttgttgtc gaacggcttc atccgcgtat tcatcgtcgc     15420
     ataccagagt gcgagcagac tgtgcagata aagccgcgat ttatacttcg tggcgacctc     15480
     gccgagcctg tcgagcggga tcggattata catccagtca tactgatcgt tggcaaccgc     15540
     cgtcacctgc gcgtttggcg tcagcccgaa tcggtagacg atccggtcgg gatagccttt     15600
     cggctgcgcg agccggctcc actggtgaaa atacgggttg cgcaccatca ccagtttgct     15660
     gctcggatcg tatttcgaga tcatgtaggc cccggtgccg ggaatcggaa tcgtccccat     15720
     gtccttgtcc ggcgtgcttg ccggcaggat cgcgccgaac ggcaccgcca gctggtcaag     15780
     aaactccgca tcggggtgac gcaggtgaaa agtcaccgta tccttcgcct gatcaatcac     15840
     aacccccggc agcgtgcagg tggtgggcgc gctggcgcag tgccgcccac cgacgatcac     15900
     gtcataccat gttccggcat tcggattgag caccttaaac aggcggatga agctcgcccg     15960
     cacatccgtc agcgtcaccg gcgcgccgtt ggagaatttc acccccttac gcagggtgaa     16020
     cacataggtc ttcccgccat cggaaatctt cggcatcgcg gtcgcgagat cggggacgat     16080
     gtggaaggcg gcggtgccgc cggccctctc gaacgagacc agcccgtcat agagcatcgg     16140
     gaagatctgc cagtagcgta gcgtatagtt gacctgcgga tcgagcgtcc ccgccgccga     16200
     cgaagcgacc agcttcaacg tgccgccata atgcccacca gccgcccgcg ccggcaccgt     16260
     tgccgccgtc gccgcaaggc aggcgcccag cgccacctgc ccagccaacc gccgcatcca     16320
     cgatccctgt ttccgcatcc cgctccactc cgttgtcaca tcacctgctg catcatccgt     16380
     gccaaccgcc cgccccgatc tgaccacaca gcccgattac gcaaatccaa cgatcgcaat     16440
     cccgtgatat gattacacgg cggtcgcaac gccctcggca acgacatgca tgcctatatt     16500
     tagagcgttt ttatttagag cgtttttcga tcagtccggg tcatatccgc atgagctgaa     16560
     gtagttggcg cattcgcgtg tgcgctcagc gcttataaac ttcgcgtcgg ttgccgattc     16620
     tgacaatgag gatacgcaaa gcgccgtcct cgatgctggc gataattcgc cagttgccta     16680
     cgcggtactt ccagaaatcc cccagcttgg aacctttaag ggcttcgcca atgctgcgtg     16740
     gattgtctag cgcagcaacc cggtcatgga gaaaggcgag aatgcggcga gcggtttgct     16800
     tgtcgatttt atcaagttca cgatcggcag caggatcgag ctcaatcttc caggccatac     16860
     cgcttcatta catcttcgag cggaacggtc ttggttttgc cagcccgcaa gtcaatcagg     16920
     cgttgttccg caagatataa atcttcgagg tcgtctaaat gctccatgat cgcttcacgg     16980
     acgtaaaagc tcttggctcg gcctgtagcc tgggccaacg catcaaggcg gctctcgatt     17040
     tcagggggaa ggcggacagc cagcacggta aaaactcctt ttgttataca tgtatagcat     17100
     cggctcaccg ccccgtaaag tttatttgcc ctgaagagcc gttcatgggg tcgtttgcgg     17160
     gagggggcga aatcctacgc taagccgagg acgcgcttcc catagtctct gagagcctga     17220
     atctgaatgg tagtatggct atttgtgacc cagaagttct aaacttaagt tttcattgat     17280
     ttgaacccga attccctgca tttatcgaca aactttctga tctgattttg ctgcttactg     17340
     gacacgcgtg ggatcgatcc cgatcaggtc gaagacggcg gcttgcagtg gtgtgggctt     17400
     tgccagggtg gtgaaggtgg cattcggcgc cttgggcagg gcggcggtgt tgagcgtctg     17460
     ggtcgcgaga tgcgccatca tgtcggtgaa gcttgagatc ggcaggctct gatcgttacg     17520
     gcgtcggccg cgcttgcgat tggcgaccgg cgacgagcgt tcggcctcgg ctcctgtccg     17580
     gtcgtgatcc tggaacagca ggggcttgag agcatcgcgc agatgccact caacgtaaca     17640
     gaccatcatg cgggagacgg catcgtccaa tcgtcgaccg ccagcccgtc gatcatgcgg     17700
     aacgcctgat cgttggtcac caggacggat cctgtggcga tggcgtgggc agcgatcagc     17760
     agatcgagcg gccccatggt cctgccggta gccgtcagac cggcgcggag ggtgccgtaa     17820
     attcctgccg tggagctatc ccaggccagg acatcgatcc gtcgcagcaa ttccttgact     17880
     acctgatgca gtgcggttgc cttcggccgt ctagccaggc caaacagcaa ctcgccttcg     17940
     gtgatcacgg agatgcacaa ggtggccatg ggcatttcga ccacgcgccg ggtgaccgcg     18000
     ggatgctgcc tgatcagatg acttaccgtg ttagtgtcca gcatccgccg gtttggtgtc     18060
     attccggcca gccggcgaag ggatcgcgct cttgaacgcc ctggttccgc tctgaccgat     18120
     caagaaaatc agccggcact tttgtgttac ggagaatagc gaaaaaccct tcccaatccg     18180
     ctggtcgtcg ggacaggatg acgtcaccgc tatcgggatc gcggcggatg aagacctcgg     18240
     cgccctcgaa gcgataggcc gcgggcaggc ggacggcctg gcttctgccg ttattaaaga     18300
     gtttggcgat ctggctcatg atccctccgg agtttctgac atgatatata ccatatcggc     18360
     gcagtattac aagatatata ccatcatttg tggggagaaa tgccgccggt catttcagga     18420
     accagccgta gatggagcca ttttttgtct ggtagggcag gcagagcggt ttgccgcctc     18480
     tggtcttgat tttccatccc tgtccggagc aggttgcgag ttcgcggata aaaccagcct     18540
     tgtagagttg gtaggcgagc atgccatctg gggtattggc ccaggaggcg cggagtttct     18600
     ggtcatggat gtgggtgagc agatcggctt tgccggtgcg gtagccgtgc tgccagccct     18660
     ggcggtgagc gatgaagacc gaggcaccga aggtgatcgc cgcgatgacg aacgcgatgg     18720
     cgaaggtacg gaggctggcc cggcgggaac gggcggcttc gatctggacc cgtttgtcaa     18780
     gggcttttga agtggcgtcg gcggcgaggc tctgccagtg ctggatgaaa tggtcgcggg     18840
     tttcggtggc gcccgcgcgg agattgttgg cggcctggtc gagcaggtcg gtggcctgac     18900
     ggaacgtctc ggcgatcgcg ccatccatcc tggtcgtgcc ggtggcgatc gtttcagcga     18960
     ttgtgtcttt tgcggcgccg gtggcctgat cgatggagcc gcggagatcg cgcccgacct     19020
     cgagggcggc gttctggatg gatttggcaa gggtggggcc ggcgcggccg atctcgcggg     19080
     cgatggcggt ggcggccttg ccggcgtcgg cggcggcggt tcctgccgcg gctgcgaggg     19140
     tggaggcggc gtcgagcgtg ttgcggatgg cggcgttgtg agcctcgagg gtgatgagga     19200
     ggagccagcc gctgtcctgg tcctgcaggc ggaggatccg tccggcgctg cggatgcggt     19260
     tgatggcctc ctgatcgggc gcaaaaccgg cgatttcgcg gtaggcggtc tcgatatcgg     19320
     tggccatcga cgggctggtc ctttgcgacg ggagtaaggt ccgccgcggc gccggcgaac     19380
     ctgggactgg atgctggcgt tctggcggcc tggggttggt ccggttcagg cccgggcggt     19440
     ggtgagcggt tgagcctcga ggaggggggc aaaagcctcg gcgcaatcgg tgcgccattt     19500
     ttcgagggcg atgcgttcga acagcggggc ctgggcaagg atggcggcgg gggagcggcg     19560
     atcggtcttg attgcggtgg cgagcggtcg gggcaggatg gggaaggggc ggagcgtgcc     19620
     gccgcgggcc tcgatctcgg cgcggatcct gctgtcgcga tagacggcga agctgccggc     19680
     ctcgtcgaag aaacggttgc cgatgacgtc gacgcgccca ggatagccct ccatgaaatc     19740
     ccgcagggcg aggaggctgt cgcgctcgtc gttgatcacc caggcgatgg cgagcgggat     19800
     ggcaagggct tcggcgccgc ggtggagata gtcgccatag cgacgcatgg cgtcgttgtc     19860
     gcgggcgccg gcattgatga cgcaggtctt gtcctgatgc tgttcgatgg cgttgagcat     19920
     ggtctgccat ccggcctcgg tgcgggtatc ggcggcgagg gtggcgttga tttcggtgcc     19980
     gagacatttg gcggcgtcgg ggttggcggt atcggtctcg accaggaaga cggggagatt     20040
     gcgggtgtgg cggagatgat cggcgagggc gatagcgacc atggacttgc cgacgccgcc     20100
     cttgttgccg ccgacataga tgatgcggct catacgtcat cgctcccgat ggcgaaggtg     20160
     cccgcgccga caggtttttc tgtcactgcc gggggagagc gggctggcat ctttgctggc     20220
     ggcgccggat tcgacggacg atcggccgcg tcgcgggcaa tgcctgccgc atctttaccg     20280
     ggctgtgacg atccatgtgc tgtggcttct ccaatctttg ccgccgatcg tgcggatgat     20340
     cctggcttac ggctgcgctt gctggcgagg gctgcgcgaa tggtggcggc gctggcggcg     20400
     aggggggtgt tgttgcgcag ccaggcggcg atctggtcga tggtatagcc cttgtcgcgc     20460
     atggctctga tctcgctgct gagagcttcg atcgcggcac gcttggtcag gagtgcggca     20520
     tcacgggcgg cgggaagcgc cttcatctgt gccgcgatcg ccttgatgtc gtcacggctg     20580
     attccggcgg ccggctttcc cgatgtgtcg tctgccatgg cgcttatcct ctccatttga     20640
     tctcatagtg atcgttgccc aatgtgaccc atgaggcaat accggtctat cacgtatagc     20700
     taaccgaata tcgatccaat atcggcatcc actcaatgga caaccatatg gcaatcagag     20760
     ccctattttc tgtctatcga cgactagctg cgctagtctt ttacacacaa ccgcacctat     20820
     aatgcatggc aagtccaaaa ccggggtatc atgtcccagc cccggcaagc aagcggaaac     20880
     ggcctgctat ccttctggtg atatctgcca tgatgatcga cagcgaaaac ggtgaagaca     20940
     gcgaggaccg aacgatgatc tcatacagcc acctgactgc gcagggctcc gggcagggtg     21000
     ccgggtcagg tggcgggtcc ggcgccagta ttgccggcgt agtccgctat cttgaggcga     21060
     tgcggcagga cgggccggtc gcggaggcgg agcgcggcgc tgcggcgatg ggctactacc     21120
     agggccgtgc ggcgccctcg atgtggctgg gggccggtgc ggccgaactc ggcctgtccg     21180
     gtgcggtgga cggtgcggcg ctggcggaac tgctgtcggg ctgtctgccg gacgggacgg     21240
     atctgagcgg gcgtggcaat cggacgggaa gccggcggct ggggcatgac ctgacgatca     21300
     gcacgccgaa aagtgtcagc atcctggcgc tggcgggcgg cgatgcaagg ctgctggcgg     21360
     cgcatgacca ggcggttcag gtggcggcgg gtgaggtgga gcggctgatg gtggtggcgc     21420
     ggcgtggcaa ggcgggtgcg gtggtggagc ggaccgggcg gatggtggcg gctgcatatc     21480
     ggcatgagga cagccggccg gtggatgggg tggcggatcc gcagctgcac acgcatctgg     21540
     tgatcgccaa catgacgcgg cgatcggacg gggtgtggag cgcggcgtcg ctggattttg     21600
     gggcgcggaa cgagattctg catatgctgg atgtggtcta caaggcggag cttgggaaac     21660
     gggtggcgga gctgggctac gggatcgaac ggacgcgtga cgggttcgag attgccggtc     21720
     tgacgcggga gcagatcgcg gcgttcagcc ggcggacggc ggagatcgac cggactttgg     21780
     ctgcgggcgg gctggaccgg gaggtggcga gtgcggcgca gcgggtgcgg gcgaatgtat     21840
     cgacgcggct ggagaagggc cagcccggcg aggtggagca gcgctatggg tggcgagccc     21900
     gggcgcggga ggttggtctt gatctggatc gggcgcgaag cgccgccctc gagcgggcgc     21960
     gatccggtct ggatcgtggc ggcgccgtgg aacgcgatgc cgttggcccg gaccatgaga     22020
     tggagatggc acgggaggca gtggcgggag cggcgcggca tctgggcgag cgggcgagcg     22080
     tgttcagcga ggcggagctg gtacgggagg cgctgctggc ggggctgggc cgggtggggt     22140
     cggccgcggt gacgcgagcg atcggcgagc gtgccggtgg cctggtggcc gggacggatg     22200
     agaggcgcgg tctggtgttc acgacgcggg acgcgctgga aaccgagcgg cttgtgctcg     22260
     atgtggtgcg gtccgggcgg ggtacggcca agccagtggc cgagccgggc gcgatcgcgc     22320
     aggtgctgga gcggcaggag cgagaccagg gcctggtgtt caccgccggg cagagcgagg     22380
     cggtgcggtt cgccctgggt tcggcggatc ggcatgtcgg gatcgtgggg gcggcgggat     22440
     cgggcaagac gcgcgcgctg gcggcgatcg ccgaagcata ccgggaggtg ggctacgaga     22500
     ttgtcgggct ggcgccgagt gccgcggcgg cgcgcgagtt ggggcaggcg ggctgtgacc     22560
     tgacccagac gctggaggcc ggtttgcgcc ggccggcggc cgaagtgggt ggagttacgc     22620
     ctggggcgcg gctctgtctc tatgtgctgg acgaggcggg gatggtgtcg gcgcgcgata     22680
     tggacaggct gatgcggcgt gccgaggcgg agggggcgcg gacgctgctg gtgggggatc     22740
     cgcggcagct ggcgagtgtg gaggcgggat cgccgtttca gcagctgctg gagacgggcg     22800
     cactgcggca tgtgcggatg gatgaagtgc aacggcagcg cgatccggcg ctgcgggaga     22860
     tcgtgcagct gttcgcgcgc ggcgacgcgg cgggcgcggt gcgtgcggcg cagccctata     22920
     tggcgatggt ggagaaagac cggctcgccc tgacagcggc cacgacttat ctcggcctga     22980
     cgccggcgga gcgggcggat acactggtgc tggcaggcac caaccggatg cgcgaggcgg     23040
     tcaacgcgga aatccggtcc ggtcttcggc agcggggcga actcgaccgg gacgaactga     23100
     cggtgcaagc gctggacaag gcgaacctga cccgggagca ggcgaagcga ccgcacgcct     23160
     acgagccggg aatggtggtg gtgttctccc gggagctgaa ggacgggcgg cgcctggtgg     23220
     cggcgcgggg cagccagtgg acggtggccg ggcaggcggg cgatcacgtg atgttgcggc     23280
     cactggctgc ccctgccggc ggggcgggcg cccgggagat cgcctggcgg ccatccggcg     23340
     agatggcgac cgcctatcat gtgcgcgcgc ttgccctggc cgagggcgag cgggttgtct     23400
     tccgggagaa cgaccgcgcc cgtggcgtca gcaacggcat gggtggggtg gtaaccaggc     23460
     tggaccgtgc gcggggcgag gcgctggtac ggagcgatgc cggagcggaa ttgcggatcg     23520
     gcgcggatcg ggcgcaggca atcgatcacg gctattgccg gaccatccac agcagccagg     23580
     gggcaacggt ggaccgggcg atcgtggtgg gggaggcggg gcgggtggcg acggcgcaga     23640
     ccgcctatgt ggcggcatcg cgcgagcgtt cggtgctgca catcatcacc gacgaccggg     23700
     acaaactgtc cgccgcctgg tcacgctggg cggaacggca gacggcgcgg agcctgctgg     23760
     cgcgggaggc cgaacgggaa atgcctctca gcgacatcag ccgggaacgg gcgcggcaga     23820
     agaccttcga gcaggcacgg cagcgggccg ccgaactggc caaagcccgg gaggtcgccg     23880
     gcgagaaaca ggccgaggtc cagaaacaac tcgagcgcac ccgcgacagg ggcatggcga     23940
     tggggagata gctgctcgct tttactggcg cctgtgctcg aattcatcgc agatttctgc     24000
     tcgaattacg tgatcgcagg ccggccggcg tgctcggatt atctgcctcg acgctcgaat     24060
     tatgtgatcg gtgctcgata tcaggcggtc gtgctcacat tcgtcgaaga aactgggtta     24120
     cgtcccgaaa gccgctttgg cgaactcagc gccaccatcg ccaaaaggat tgacgatggt     24180
     cacgccgccc agtgttcttc cggcctgtcc atcttctgtg aaaaggatcc ggcaaccgtg     24240
     ttttttggcg gttgcccaaa tcatggcctc ccagaacgac catccatgat ggatcacggc     24300
     atcctgccat tcctgcacga tgtcggcggc cagtgcggcc ggtactttca ttttcggccc     24360
     ggtgagagca cggaataatt cggcgagaga ttgaagcgtc aagacgcagt cccggccccg     24420
     agcacggcgg gcgatgtcga gggcaatgca gtgccggtca cccgcgtccc ggtctacggc     24480
     gtagactagg agatttgtat caagggtgaa gcgcacagga tcaccgatcg tacaggctgt     24540
     cgcgatcgaa gcggtgaccg ccgagaggca ggcctttctc gagcgtggcc agcaggcgat     24600
     cccaagcttg atccctggcc tcatcggccg gccggcggcc gagcggagta agctgggcga     24660
     ctggagcgcc acggcgcgtg atgatcacag tctctccctg aacagcctgt ccgaggattt     24720
     ccgagaattg ccggttggca tcggcggctg atacgaggcg aggcattgag cgctccagta     24780
     gtgatatgac tactctatgg aagttctaca ggccgggcaa tcgaaaatag ttatataact     24840
     attttattga ctcatctggg tatacccaag agaggcgtct tcgtgagacg attttcccgc     24900
     ttcaatagga ttgtttttga gattctgata caataacgtg aagacatcta gagcctcgcg     24960
     agtcaattca tgactgctta tagctatgcc cgtgtcagca tgatcgacca ggatctcaca     25020
     atccagcagg aagccctgcg ggcggccggg tgatccgtgc ggaaaaagcc agtggcttac     25080
     gccgcggtgg gcgaaccgaa ctggccctcc tgctagactg aagttttcac taatttgaat     25140
     gcaaactccc tgcatttatc gacaaacttt ctgatctgat tttgccgctt actggacacg     25200
     catggggtcg atcccgatca ggtcgaaggc ggcggcttgc agtggtgtgg gctttgccag     25260
     ggtggtgaag gtggcattcg gcgccttggg cagggctgcg gtgttcaggg tctgggtcgc     25320
     gagatgcgcc atcaggtcgc tgaagctcga aatcggcagg ttctggtcgt tgcggcgtcg     25380
     cccgcgcttg tgatcggcgg ccggggatgt cgatgcgggg gcaaccggcg atgagcgttc     25440
     agtttccgcg cctggccggt cgtgatcctg gaacagcagg ggcttgaggg cgtcgcgcag     25500
     atgccattcg acgtaatagg ccatcatgca gaggaagacg tgggcacgca cccgcggcga     25560
     gagccagtga tgcaccgggc ggatcgcgag atcgaccgat ttgagggacc ggaacgcccg     25620
     ttccacccgt gagagatcct tgtaggctga caccgcctcg gtctcgctca tgacgtccgc     25680
     gctcacactg gtgcggatga catagatccc gtcgagggcc gcctcgcgcg cgatgctggc     25740
     ggcgttgcgc tggaaatcga agcggctggc ggtgatggtg agatcgaaat gcttggccat     25800
     cttgcgctgg ttgatcaccg cccccaccgc cagcccgatc gcggcctcgc catgaagagg     25860
     agcgcgtttg cgccgtgtcg catcccggat ccgcgccagt tccgtctcgg tggccacgag     25920
     cagcgcctcg cgcttgcgcc gtcgttcggt cgccagggcg gcgttgcgac aggcgatcag     25980
     ccgctcgccc ggataatcgg gcgacgtgat cgcggcgata tcgcgctcgt cgaacagcga     26040
     catctgcagc ggtccctcgg caagatcctg gatctgcccc gcgcgcaggc agctgatcca     26100
     gtccagcccc gccggcttga tcgtctcgcg gatccgcgcc gtggtgatca ttccgcgatc     26160
     acccaccagg acgacgcgct cgagatggaa ccggcgcttg agtgtctcca cctgggcggc     26220
     gaccgtcgcc ggatcggcgg tgttgccttc gaacacttcc accgcgatcg gccgcccctc     26280
     gcgatcgcac agcaagccat agacgatctg cggccgatcg ggccggtgat cccggctgta     26340
     tccgtggtgt gccagttcgc aatgccggcc ttcgaggtag gatgaactga cgtcgtagag     26400
     caccagcgtg ccgtcgcgca gatggcgcct tgcaaactgc cgttcgatcc gcccctgctg     26460
     cgtgcccagc cagtccagcg ccgcatagat ctcgcgctct tcaatgacac cgagatcgag     26520
     catctgcccg aggctcgatg ttgcggtctc cgggttcagg ccgcgcaggg tcgagagctt     26580
     cgatcccggc gcgatcaccc ggccggcgat cagcgccagg gcgagactgc gctcgcgcga     26640
     cgccctccgg cccagcaggc gaggtatccc gagcttgcgc atcatcccga gtgccgccgc     26700
     cacatgacca tgcggcagcg aacgccggat ctccagcgcc tgatcggcac caccaaccac     26760
     cgcgccaccc gcgagcagcg ctcgtaggcc atcgatcaac gcgggcggca tctggctcag     26820
     attggcgatg gtacgcttgt gaaccttccg cccctcgcgg aaactctccc gcaacagcac     26880
     ggccggcgcc gatcggccat tcggaaccac atcgatgaac ataacccgag cgaatcacag     26940
     atcgagtcgc accgcaagcc ccatttatgg acacaaaacg ctcgcaagaa atcagcgcta     27000
     cgcgaggcta tccgccacgt tcaggtcatt cccaagtaaa aacttcaggc tagacttcct     27060
     caatgccggc gacacgctgg tcgtcacccg gatcgaccgg ctggcccggt cggctgaaag     27120
     acctccagga tactccaaga tcggcgatgt cggtgtccgt accgtgctct acgaagcggc     27180
     gaacgtcatt ctcacccgac cggtgaaggg atcgcggctg aagagttggg ccatgcgcgt     27240
     ggccggccgt gccgggatgc gcaaggccaa ggtcgcgctg gcccgcaaac ttgccgtcgt     27300
     gctgcatcgg atgctggccg acggcaccgc cttcgatgtc acgctggccg ccgcggcgcg     27360
     cgcatcggca tgaacgacgc atagcacagg aggacatctc gagttcgggc gaggctgaca     27420
     tctctcgtcc ggagcaggtc ccgtcgccgg gacgatggat ctggtcaggt cgcaaatgcg     27480
     ggagcggcac catcggatga ccgcgcgtcc ctagattgac cgaccggtcc tttcagaccc     27540
     catgaggcag cggcctcgcg ctgactgcgg acagaagcaa gaccctggcg acggatcctc     27600
     gctcaacgag ggattgacat ccaagggccc gttacagaag cccgcattat gcatgaaggt     27660
     tggcgagcat agcgtaaacc gttgatttga tgtaagaaat tggtgtcgag accaaatctt     27720
     catcagcacg gaacgcgatg cccgccacgg ttgaaactac cccatgcctc cccggtctgt     27780
     cacctgtcgc cggcaaaccg gtgctggccc gcttcgacgg cgagatgctg tcctctgaga     27840
     gatcttcctg gccttcaaac cacgcccacc gccggctcag gacgtcaggg cgctcctgct     27900
     cggcggcgcg cgcggtcttt tttgcgcgtg atacgatgcc gctggaagaa gcgcctcagc     27960
     gtcccgtaac cgaattggtg gccctgtgtg gccagcgcac tgcgcagttc ctcaatcgtc     28020
     gcatcgcgca tctgctccag caggtcgaga accacatgcg cctgcttctc gatccgcccg     28080
     gagcgtcggt cgccaccatg tcgaccgggc ttcaggttcc tctgcgcgct cagcaggctg     28140
     cgccaccgac tgacgctcgc tgcgctgaca ccaagccgtg ccgccgcctc gcggtgcgtc     28200
     gctccctgtt ccacagccgc caccacacgg ccccgcagat cctccgaaag agtctttgcc     28260
     attcctgccg gcctccaaac tccggcagat agcttcaatc agatttcaac cgcttccggt     28320
     accccagcgg ttcagatggt tcggctaccg ctctgatcaa aaggctacat attgcgatta     28380
     taatcgattc gtgccactat atattgagag acgcggagga tttctgatgt gcgatacagc     28440
     ggttgtaggg cggggatttg ctcagcgagt aaccgagggt tttgctacgc aaaacgtcgt     28500
     cgatcccatt gccacacttg aagagtacct caatcgtgaa gactggcggg ttaaggccaa     28560
     tgccaaccag agttactcgc ttggcggatt gattcttcac ggcgcggcaa agctcgttgc     28620
     caattactgg ctcgatcata tttatccacc tgaggtcggc cgcgcccatc gggaggctga     28680
     cctccatctc catgatctgg atatgcttgc tggctattgc gccggctggt ccctacgcac     28740
     attgctcgtg gaaggcttca acggcgtcgc ggatcgtgtc gaggcgtcgc caccgagaca     28800
     cctttcaagc gcggtcggcc aaatggtaaa cttcctaggc acaatgcaga acgagtgggc     28860
     cggagcacag gcattcagtt cttttgacac ctatctcgcg ccgttcgtgc gcaaggatgg     28920
     cctttcctat gccgaggtta ggcagaatat ccaggaattc atctacaacc tcaacgttcc     28980
     atcccgctgg ggaagccaga cgccattcac caatattacg tttgactggg tatgccccaa     29040
     ggatctccgt gatcagatac ccctgattgg gggcaatgaa atgcccttcc gctacggcga     29100
     tctgcgggcg gaaatggaca tgataaacca cgcctatatc gaggtgatga gtgccggtga     29160
     tgccaacggc cgcgtcttca cctttccaat cccgacctat aatatcacgc cagattttga     29220
     ttgggattcg gagaacgccg aacgtctttt cgcaatgacc gcgaaatatg gattgcccta     29280
     ttttcagaat tttctgaact cagatctcga gccccatatg gtgcgctcga tgtgctgccg     29340
     actgcagctc gacctgcgcg aattgctcaa gcgcggtaac ggcctgttcg gatcagccga     29400
     acagaccgga tcgatcgggg tcgtgacgat caactgtgca cggctcggct ttcaacacag     29460
     gggtaatcgt tcaagtctct ttgagaggct cgatgtgttg cttgcgcatg catgcgacag     29520
     cctggagatc aagcggcaag tgatcgggca atatctcgat gccggtctgt ttccctattc     29580
     aaaacgctat ctcggaaccc tgcgcaatca tttttcgacg atcggcgtca atggaatcaa     29640
     cgaaatgatc cgcaatttta cagcggatac cgacgacata acgacgccgg tgggacatcg     29700
     gatggcctgt gacctgcttg accatattcg ggccaggatc atcagcttcc aggaacagac     29760
     cggccatctc tacaatcttg aagcaacacc agctgaagga accacctatc gctttgcgaa     29820
     agaagacctg cgccgatatc cggaaattct tcaggcaggt actccggaca agccctatta     29880
     cacaaattcc tcacagttgc ctgtcgggtt taccgaagat cctttcgagg cgcttacccg     29940
     tcaggatgaa ctacagggta aatataccgg cggcacggtt ctgcatctct atctcggcga     30000
     acagatctct tcctccgcgg cctgccgaga cctggtgcgg cgggcactga cgcgcttccg     30060
     gctaccctac ctcactgtaa ccccgacctt ttctgtttgt ccggtgcacg gctatcttcc     30120
     aggcgcgcat catcactgtc cgcgctgcgc cgcggaagag cctgccacaa tcccacgcgc     30180
     gtgtgaggtc tggacgcgtg tgatgggtta tcatcgtcct gtttcctcgt ttaatatcgg     30240
     taaacagagc gaattcaccg aacggcggtt tttcgtcgaa cccagagcca tgtgccatgc     30300
     cacagcctga tgagccgcag atcggtggct gggcgccgtt caccaccctt gatgttcccg     30360
     gacgccttgc tgcgacgttc tttctccgtg gctgcccact ccgttgccgc tattgccaca     30420
     atgcggattt gcaggcacgc cgagggactt ttcccttacg atggctagaa gcgctgactt     30480
     ggcttgatca gcgacgtggt ctgcttgata gtgttgtctt cagtggcggc gaaccaacga     30540
     tggatcggtg cctggaacag atgatacgtg acgttcgctc attggggttt gaggtcgctc     30600
     tgcatacggc cggcgtttcg ccgaaacgtc ttgggcgggt actgcctttg ctccagtggg     30660
     ttggtttgga catcaaggcg ccgttcggcg actatgctcg gatcactggc tccgaggcga     30720
     gcggtgcccg agcgcgagtc gcccttgcga tgctccgtga aagtggcgtg ccgtatgaag     30780
     tgcggaccac cgtgcaccca gcgttgctgg atgcacaagt gcttcagact ctggcgctcg     30840
     atctccgagc gagtggcatc ggacggtggg tgcttcagcc gttttgtggc cgtggctgcg     30900
     tggagccagc gctaagcgca gaaaacatca gcattgcgac atctcttgtt acacacttgc     30960
     gacggattat tccagaaatc gtcgttcgta cgaatggttg ttgatcgagg accattttct     31020
     ggatgggtaa tcttacaaag ttcgtgcttt cgctgaacaa gagaggcgcg agaaatggtc     31080
     agcatttgtc ccagccgctg ttccagacgt cgctccatca gctgggctgt tcaacgcttt     31140
     ggcccgagtt ggacagtggg tgggcgagaa ttgatttttc ggggagcgcg gggattcccg     31200
     acgggcggga tttcggattc ttgggaaggc aaccgatccg gaggttgtca tggtcgcgtt     31260
     cagttcgttg ctcgatatac tggcagaggt ccccgatccg cggcgcgcgg aaggcaagct     31320
     ctacaagctg ccgcatgtcc tgctgttctc gatcctggcg atcatcagcg gcagtaactc     31380
     gtatcgcggc atcgtgacct tcatcgacgt tcatcgccgc cggctgaacc gcagcttcgg     31440
     cctgaaatgg cgtcgcgcgc cctcgcacac ggcgatccgc tacatcctcc aggggctcga     31500
     tccggccgcg gtggaggccg cgttccgacg ccatgcggca cagctgcagg cggccagggc     31560
     caagcccggc acggccagca tcgccctcca cggcaagacc ctgcgcggca gtttcgacag     31620
     gttccatgac cgcaccgcgg ctcatgtgct cagcgccttc gccaccgaca ccaggctggt     31680
     gctcgctcat gtcgacatcg gtgagaaatc cagcgagatc cctgccgccc aggcgttgct     31740
     cgccgaaatg ggcatcgccg aggacgcaat cgtcaccctc gatgccctgc attgccaaaa     31800
     aagccttcaa cgtcgcccag acaggcaaca tccgcctcat cgtccaggtc aaggacaatc     31860
     aaccgacgtt gaaacaggcg atccaccata tcgccgccat cattcaggtc gagcgcgcaa     31920
     tcgccacacg caatcccgaa accgggctgc tcaagctggc acacgatacc accttctacg     31980
     tcgccaacac ctcgctcacc gccgccatcg tcgcaaaggc catccgcgca cactggggca     32040
     tcgaaaattc ctcccactat gtccgagacg tcaccttcgc cgaggatcga tcccggatcc     32100
     gaaccaaccc tggcgtcatc gcccgattgc gcagcttcgc cttcaacatc ctgatgaaca     32160
     gcaaagccag cgccagcacc ctcagccagg accgctaccg cgcagctctc gccggactcg     32220
     atcaccttct cgccctcatt actatcccaa agcgttgaac agccctgccg agaaccccat     32280
     ccacgtaacg gtaacgttga accttgccta tccggttgtt acccacaccc actaaatgta     32340
     gggtgtgtcc attccccgga ataaagctcg tcaaaggttg gtgcggctgc cctacccgcg     32400
     attccgagca gcgagcggaa cgcgttgaag ggatagaggc gccggttgaa ccgaaacgtg     32460
     aattcattga ggtaggcttg tagatgtttg gcgctgaccc cgtgatggat gccgttgatc     32520
     caggtcttca ggttggtaaa gaccaagtgg acgatcggca ggaattcttc tgccacctcc     32580
     gggtcgccgc attcggcgat tgcatggtgg tcgaacccgc gccttccgag accggcatag     32640
     ccgctccagt cgtcggtaac gatcagcgat ccgggagcaa cggcgttttc gacgaatccg     32700
     cagagcgaat tggcgctacg gtcggggaca acagcgagac gaacgcgtcc cgcgtagcga     32760
     ccgtctttcc gattgtcgag cttggttccc ggtttccggt ggcgcacctc cacggcacag     32820
     gcgacgagaa ccttgtgatg gacaccccgt ccatcgcctc gggttcgtcc tccaacccac     32880
     gtttcatcca cttcgacgtg ttcttgcggc gtgtcgccaa tcttgtcgcg ctcggggcgc     32940
     accatcccgg cgcgcagctt atgaaggatg ccgaaggcgg tctcgtagcg cgacaggccg     33000
     agttgccgct gaaattggac ggccgacatt ccgggcgtct ggctggcgat caagtaagcc     33060
     gcccagaacc aagtcgacag cggcgtgtga ctgcgttcca taacggtccc agccatcagg     33120
     cttacgtctt tgcgacaggc ccggcagcgc agaacgcccg ggcgcgcctc gaaacggaac     33180
     ggctcgccaa cgacgccgca ccttgggcag gcgaaccctc cattccagcg ggcgctttcg     33240
     agataggcgg cacaggccgc gtcgttcggg aaaatacgct ggaattccgg cagagactgc     33300
     gggaacggca ggtcttcacg ggccaggaca tccatgccca acactagatc tagtaggtat     33360
     gggagtcaac cggataggca agcgttgaac tacggagagc aattctttcg gtcgagttgt     33420
     gagcggtcgg cggcggcgcg aagcaaggca agactacggt ataagccatg gacaaatttg     33480
     ctgtagggaa gcagcaggaa tagtgcgagg ataatgccca gatggagcgc aagcaggacg     33540
     cccatggcgg ctgtcgtgcg catagcaagc aacacgaggc cggtcatcgc agctagccag     33600
     agcaacacga gcaaggcaaa gtcagtgctc atcagccgtg ccacagcagg ggcaggatca     33660
     ctgattattt taacccagat aagccccgat gtgccgatag tgatcccgat gccaccaatc     33720
     gtgccgaaca aaactggtag gctgaatagt gggtagggtg ccggctggtc gaagaaatgt     33780
     gcataaatgg tcgcggtaca ggtcgccaaa aaacagaaca aaaaaccata ggccatggca     33840
     tgatggaatc gtcgccgcag gatcgagaag cttttatcgt gatcgctaca gttctgatcg     33900
     cctcgaccga ggttttgaag tgtcgcgata tcgcgcattg cgtgcataat aacagtcagt     33960
     ttgatccact tacccttcct gcccgattct tgccaaaatt tgacgccgct tacagctagc     34020
     gcaaaaacag agaacagcag gcttccacca gcgatgctgg ccatcagcac ccaggggata     34080
     acctgataga aggcgcctgg gccactctgg gcacgtgtaa ttgcccctgg gtgtgggggc     34140
     aacaataaag tggctaaaaa caccagcatg atgctgacta agcaggtgac agatacgact     34200
     aagccgttac gtcgaaacaa aggtgcgaat aggccgggcc aaacgaagcg tgcgtggctc     34260
     tcgtctctca actccgcgaa actccggggt aaattgatat cgattggctc cggagcctcc     34320
     tgacaagcgt agtagcagcc acggcaatta tgacaaagat aagcaaggta acgtagatcg     34380
     ccatcagaaa atgcgcgctg tagttccatc gctggaaata ccgcacaata gctatcacaa     34440
     aaccggcagg cgttgcagat ttccgcgccg cttcggactt ccactagcgg gtcaatttca     34500
     ggcatgcttt cctgcctcca cgtcggtggg ccgcacgaaa tcggcgccgg caaccatgaa     34560
     aatcttacct aaactgagcg cttccgaatg atacaaacgc ccagttcttt atcggtagca     34620
     gcggtcgttt cttgcgttcg gtcggattag gatgagcgcg aatatctcgg gatacaaggg     34680
     gaactgcatg ggttgttgcc ttgcggtcac tgcgacgact tgttctgggc gacggccaag     34740
     tcggtcaaga agctcataac cagggctgta gtagagtgtt cgattaacgg ttaggccgat     34800
     ctgcttcggc tgttgccaag cggcatggac tcgccgtcga ggtgccgagt ggtgtgacac     34860
     gctcgcgatc gatacccatg atcgggcggc ggtactccag gcagttggga tcacgctatt     34920
     cttcctgtcg aattggtcag gcgtgtcccg cacggtcatt tgccgcccac acgttgatta     34980
     attttggtcc ttcaaggttg ccagataggc gatcacattc gcgcgcttct gtgcattcgg     35040
     catgcccatg taaggcatct tggtgcccgg cacggcggct tgcgggttgg tcaagaattt     35100
     gtccagtgcg gccgcggtcc aaacgatgtg ggcggatttc aacgcgggcg agaacgggaa     35160
     gccggccacg ctcgcggctg gctttccaaa gacgccgtaa aggctcgggc cgatgccgtt     35220
     ttgcccggcg accacgctgt ggcatgcggc gcattgtgcg ctgaagatcg tcttgccctt     35280
     gaccgcattg ccatcgggca tgccgccggc cagagcgggc gtggggaaaa ccggggttgc     35340
     cgctgtggca aaaccagcca cgaagacggc ggcgaatgag gcgagggcga tacgattaac     35400
     catggggaag cctcctgcag aatgtgcctc tagagtggca ccaatcgttt cagaacgcca     35460
     cccacagtcc agcgaacagc gtgtcattgg ctccggcgct acgaccgaag ccgtcgtagt     35520
     tgttggccaa tccattgaac gtgggataaa acgtgtcggt cacaaataat ttggcgttca     35580
     accatggtag ccacttgggt ccgccattat tgaacgggta gtagtcaagc tctgttgtcc     35640
     agctattcgt gtctggtttg ccgtttgcgc ttccaccaat tggtgatggt gcgtacagca     35700
     gcggatcaga attgccataa actgtgcgga aagattcagt aataccgtat ttttgaaata     35760
     gaagttcaga cacactaact gttagtatat ctagagtatc ggaaggattt gcagtaatcc     35820
     cgagcggata gcttgccctc caatcctgtg tctcgtgaac gaaatttgct tggatcgaaa     35880
     gtgcctgctt cgctgtgatg tactggaatt gagagtcagc ggcgacgtcg aggattctat     35940
     cggtaggtcc gttgagcctg cccgatggat aggggcggtc aaattaatgc gtatgacccg     36000
     acctcgaacg agttgtttgc ccaagtgtgc tggaacgcaa gcctgacata tggaatcacg     36060
     ccattaacgc gcggcgctgg tccaaccccc agtgcgtagc tgaggtggtt aggaagcgac     36120
     ttgtaaaggt cggcttcagt gtaaagcata tctgatggcg tgatgttcaa ggcgccgtac     36180
     gtaccaatgc cgtagacttc gccgcctaag gcatctatct gatcatcagc aacgggctcg     36240
     ggttgcacgt ttgagtggat atacgggaag ccccaagcag gtattgtgtt ccacaggtcc     36300
     gtgatcgtcg gggcattgtt gaacgtaagg ccaaaaaaca acggcttccc gaacagcgta     36360
     gcggggtgtg cgaaccggat atccatacca tcccagtgaa cactctttga tactccagaa     36420
     taggttgcct gaatgaatgc gcctagccca agttgcgcat cgagagcacc accatagaac     36480
     aggcttgttt gctgcggcac cacaacgtcg ttggatttga agcccggacg tagtcctccc     36540
     ggtattttgt cgtgcaactg ggtaaaacct atttgagaag cgatggcaaa atttttccat     36600
     ttcggaaaag ttccgccggc aatatatccc tcaagtttga aatcacgacc gtacggagtg     36660
     agttgaggaa agccgatatg acaggccgag cagggttcgc cagtctgcgc cgcaaaggcg     36720
     gggatcgcgt aggcagcgtg aggcgccgca agccaggctg cggcaaccat gcctgcggcc     36780
     gcaagccgcc aggaataggg atgtgaccaa gtcttcattt acagtctccc gtgattttaa     36840
     acagacggcc cttcctccag gggttacgca tgaaagatgc cggtgagaat ttgctccatg     36900
     tatctgttgt cccatgcggc cattttgcgc cgccccttga ggctgacctt tgatgcctga     36960
     tggcggcgaa cgaggttgat cacgatcttg cgaagcaggg agaagttctg gacggcgttg     37020
     cgatcccgga tccggtagtg atcttcgttg aaggtgacgt cgagcaccca gtgtaggctg     37080
     ttctcgatct gccaatgttg acggatcgct ttcgccagga tttcgggttc gatcttgccg     37140
     gatccgttga cgccgcggat ggtttccacg gccagaacgc tcttcaaccc cggccagtcg     37200
     cgcagcgttt ccagcgctac ggcgtccgga cagacgaata cccggcgccc aacaagacgg     37260
     ccatgaccat catcgaattc gtcgtggacc ggccgataag tgggtgagcg gctgaagcag     37320
     gtggttgcgc aaagctcctc cacggcgctg tgtttttccc cctggttggc tttcagggtg     37380
     acgagataat cggcgccccg ctcaaggatt ttggcggcga tggctcgctg gcaccccatc     37440
     gcgtccaacg tgacaatggc gcccttgatg tccagcacat ccagcaattc cgggatcgcg     37500
     gtgatctcgt tcgatttgtc gccgacctgg cgctggccga gcaccagtcc ccgatcactc     37560
     gcccaggcac tgaccacgtg aagagccgcc tggtcccggc tgcgatcaaa cgaaccgcgg     37620
     ttcgttttcc cgtcaatcgc caccacttcc cggtccaaag tcgcccgaat gagcgcgcct     37680
     aggcttcgaa acatgcctcg aaatgtccgg tatcgatcag catgaataca cgccggaagg     37740
     tgtcgtggga cggaatgccg ttcggcagcg ccagaaacct gtccgcctga ccatgatcga     37800
     ggcgcgccga tattgtcgcg cctgctgacc acgatcgagg ccaacgacgc tgccggcgcc     37860
     gccgaagcgg ctctaccggt tgaggtggag aaccgaggaa gtgttccggt cttcgaaaag     37920
     tgtttgcctc aggctcaaag aaaccgagat gcaggacgcc agacgcctgt tcaagctggc     37980
     cctgatcggt cttgccgcaa ccacccgtac cgtccagttc gtcgacgcac gcaacggcag     38040
     cagccggccg gcaaccgacg tcatcgatcc cggactgctc ccagcagcgg atgccatcgg     38100
     cccgacgctc gagggcaaaa caccaagaca gaaaaacctt catccaccct gatccctcgc     38160
     ctggatcatc gcccgcctcg gtggctggaa ctcatactac aagtcgccaa gtttcaaaac     38220
     catgcacgcg aaacctcggt agttacaata tgtgtgattg cgtcgacgcg ccttgatcta     38280
     aatcaaggcg cgttcgtctt ctgcatgttg acaagatgcg gttgtcgttg cggtgcggcg     38340
     ttgcggtgcg gcatggaaat agcaggagtg ctggctcatg gcggagacga aattcccggt     38400
     tctgctcgcg accaatgtgt tgggattgct tcccgcgccg gctctgatgc gtgctacgat     38460
     tttgctgacg cgccggcttg gccgaacaca tcctcggctg ttccgcgccc tcgcagccca     38520
     taagccctgc acgatcggta tcgagccgac cgatctgcgg catcgattcg tgctccgctt     38580
     cgggggaagg ccagtatcgc tggtgcctac atcgaccttg gagcagtcct tgaatgcctg     38640
     cgtgaggggc cggttagcga cgttagtggg gctgctcgaa ggccgactcg acagcgatgc     38700
     gctgttcttt tccagagaga ttatcattac aggagacatg gaggcggtcg tcagcttgcg     38760
     caacgcactc gatcgcgaaa ccgtcaatgt attcaaagcg gcaaccacac tgttcggacc     38820
     gggagagcgt gccgcccggc gggtggcact catgctcgag cggcggctcg ccgcagcgca     38880
     tcagcgcctg accatggggc acgaagcgct gcatgcggca agacgagaag aacatcccgt     38940
     cactgcgaat tgcgaacggg tggaggcaga gttacaggca ttgagaatgc gcatggccaa     39000
     gattgaagcg caaacgaggc gtcggaatcc catcggggcg gtgacatgac acgctatctc     39060
     gaactggtct gtccggcggg cactcttgcc gccttgcgcg tcgcggtcga cgctggagcc     39120
     gacaccgtct attgcggttt ccaggactgc acaaatgccc gcaactatcc tggcctgaat     39180
     tttacccgcg aagatttaca tgcgggcatc agctacgccc atgcccgcgg ttgccgcgtc     39240
     ttcgtcgctg tcaacacgtt tcctcgagcc ggcgaccttg gaccatggca gcgcgcgatc     39300
     gatgatgctg cttcatgcga cgcagatgcg gttattcttg ccgatctcgg cgtgctcgat     39360
     tatgcggcgc gccgccatcc gaacttacga cggcacctct cggtgcaggc ggccgcagcg     39420
     agtccgctcg ggatccgatt ctaccgggac atatttggaa tcagccgtgt cgtgctacca     39480
     cgcgtgcttt cggtcgaaga agtcacgtcg ttgatcggac aaacaggcat cgaggccgag     39540
     gtgtttgcct ttggcagcct tggcacaatg gtggagggcc gctgctttct ctcctcttac     39600
     atgaccggtc gttcgccgag tagcgacggt gtctgcgctc cggccgagtg tgcctcctac     39660
     catgagaacg gcgatcgctt ggtctcccgt ctcggcgaag tcatgattaa ccgattcgcg     39720
     cgcgatgagc cggcagccta cccgaccccc tgcaagggtc gcttcctagt acacggccgt     39780
     ccgagttatc tgtttgagga gccgaccggt ctcaacgtta tcccgctcct cgcggaactc     39840
     aaggcagccg gggtaactgc cctgaagatc gagggccgcc agcgcagtcg cacctatgtg     39900
     gccaccgtcg tcaccgcttt ccgccacatc ctcgacgcgc ttgccgaggg cgcgccgccg     39960
     gcaccgattc ccgccgtgct gcgtgcggtt gccgaaggag gacgcgagac gttcggcgcc     40020
     tatgcgaaag gctggcgatg agctgtttaa ctttggggcc gctgcagttc cactggcccg     40080
     cggcgcgtag gcgggatttc tacgctcgta tcgctgacga ggcgcctgtc gactgcgtct     40140
     atctcggcga ggtggtttgc agcaagcgtc tgccttggtt cgagaaagac ctaccgaaga     40200
     tcgccgagcg tttgcgtcga gcaggaaagc aggtcgtgtt ctcgacaccg gcgttgatca     40260
     tcaccgatca tgagatcgcg atgatccgcg cgctctgcga gacaggcgat ctgatcgaga     40320
     tcaacgatct cgcttgcctg caactgctaa atgggcaggc attcgtctcc ggccctctgg     40380
     tgaacgtttt caatgaaggt acactcgatg tccttctccg tctgggtgcc atgcgggtga     40440
     acgctccaat ggagctatcc atcgccgcga ttgccacgtt ggcggcacgg agccaagcgg     40500
     gtgagattga agtgttcgtt ttcggccgcc aaccgctggc catctcacag cgctgctatc     40560
     atgcgcgcgc gcatgatctg cataaggata attgccagtt cgtctgtggc caggatgcgg     40620
     atggcttggc gatcgcacag cttgacgggc gtccacttct ggcaatcaac ggcacgcaga     40680
     ccctttcgca cggccatgtc gctctgctcg acgaactcgc cgatctccag gcagcaggcg     40740
     tcacccattt ccgtctttcg ccacacgcac tcgacatggt cgaaatcgcc acactctacc     40800
     gcgccgtgct cgacggcatt tatgacgcga aggaggcgct cacgcgcctg cgcgaactca     40860
     ccgcgcagct gccgtttgtc aatggttatc tgcatgggcg cgccgggatg gactggcagc     40920
     ctagccgggc aggatagagg caatagcagc agcgttctgg acaccacact tttgggatct     40980
     accaaacaac gggaagcatt ctgagtatgg actgtagtgg cagagttatc agtaaaagct     41040
     tcgggcggat gaccggcgga agcgaacatt acattgtcat cgaaccaccc gctgatctcg     41100
     acctcaccga gcagctcgcc tgtcttgagc aacgttatga tgaaacacgg caggagctct     41160
     gcctgccggc cggcggtgcc gtgttccggc gattgttcgt cagcgatgcg atgaaccagg     41220
     cacctttgct gcggcacagc cgttttgcag aggatgaaga taactctcct gtggcactgt     41280
     caatcatcca gcagccgcct ctctcaggaa ccaagctgtc ccttcttgcc tatcatgtca     41340
     gcggagctct cgatctctcc aagcgccggc ttacgccgcg gcatgtcgtg gttgaaaaaa     41400
     atggtcttgc ctatctctgg acaacaggtc tctgcccggg atcggacgaa aggcaggttc     41460
     ctgtgacaca acagacacgg cggttgttcg atactcttat cgatgagctc gatggtctag     41520
     ggggcaccct acacaacaat tgcgtccgca cctggattta cgtcaaggac atcgacgtat     41580
     tctataagga tatggtgaca agcaggagtg aggtgtttct tgaacagggt ctgtcggcgg     41640
     agacgcattt cattgccagc accggcatcg agggagcgtg cgcacacaga ttcgatatag     41700
     taacgatgga tgcctactcg atcctcggac ttgcaccaca acaggtgtcc tatctcaatg     41760
     atttcgatca tctttgtccg acgaaggact acaacgtaac cttcgagcgt ggcacccgta     41820
     ttgcatatgc cgatcgcgcc catctcttta tctcgggaac ggccagcatt gatcgctccg     41880
     ggcagatagt tcatcccgga aatgtgctgc gccaattcga ccacgcgctc gacaatgtgg     41940
     aggcgctttt gcgcgctggc tcggcgggac tcagtgagct gatgcacctc atcgtctatc     42000
     tgcgtgaccc aaccgaccat ccacggatca aaacggcatt gtccgagcgc ttgcccggag     42060
     tcccggcgat cattgtacag ggtccggttt gccggccgga atggctggta gaggtcgagg     42120
     gcatagccat cgccgataat gaagatccga ccctttcaag tttctgatct tccgagtctt     42180
     cgcagtgttc ggccagggag tgtcgtcata agcgaccaca caagaagccg catagcgagc     42240
     cgttgatatt aggctgaagt caaagggatg tatgagcggg cagaagcgag ataactttca     42300
     actctgctgc ctatgcgcgg aaattttagc cgcgcagcgc gtgtcggctt gctagacgga     42360
     cacttacaca ggagttctat atatgagcga tatgccgact aaccttatcg aaacatcacc     42420
     gttgcgactt aagacgggac tagccgaaat gctcatgggt ggggtcatca tggatgtcac     42480
     taccgcagag caggcgaaga tcgcagagaa cgccggtgca gtggcggtga tggcactcga     42540
     gcgggcgccc gcacagatac gagctgaggg tggcgtcgct agaatggctt ctccgaaaaa     42600
     aatcaaggag atcatgactg ccgtttcgat ccccgtgatg gcaaaatgcc gaatcggcca     42660
     tttcgccgaa gcgcaggtgc ttcaggctct cggcgtagat ttcatcgatg agtcggaagt     42720
     tctgagcccg gctgatgaaa tgcatcatat caacaagcac gctttcgtat ctcctttcgt     42780
     ctgtggggca cgtaacctgg gcgaggcact gcggcggatt gccgaaggag ccgcaatgat     42840
     aaggacaaaa ggggaggccg gtaccggcga tgtgatgcac gcagtccggc acgtccggca     42900
     aatcgccaag gatattcacg ccttaacggt tctacgcgag gatgaactgt atgccgccgc     42960
     aaaggaattg gcggctccct acgagttggt aagaatcgtc gccagtatcg gccgactgcc     43020
     cgtgccaaac ttcgcggccg gcggcattgc aacccctgct gacgcggcgc tcgtccgtca     43080
     tctaggtgca gaagcagttt tcgtaggctc tggtatcttc atgagagatt cacagcattt     43140
     tgttgatcct agcgaggcac aatcacgcgc agaagcaata gtccaggcaa caacgcatta     43200
     cgacaacccg cagattcttg ccgagatcag cgaatcatgt ctcggagcca tacacggcct     43260
     tgctgcggct agtttgaaag aagaagcgtt gctccagaca cgaggctggt aggtgctgcc     43320
     gataagggat tgacagactt gtccctgaaa atcggcgttg tggctttgca gggcgattac     43380
     gcggcacatg cggaggcttt gcgcagtagt ggtaccgaga ttgtgttggt ccgcgcgaca     43440
     aaagaattgg ctgatctgaa cggcttggtg attccgggcg gcgaatcgac ggcactcctc     43500
     aagctgctca cacgcgaaaa tatgtacgaa gccgtgcgtg agttttctat ggccaagcca     43560
     gtgttcggta cctgtgccgg ctgcattatc ctcgccaaag aggttctgcc gtcgccgcag     43620
     caaagccttg cggttttgga catagtcgtg cagcgcaatg cttatggacg acagaccgaa     43680
     tcccgtgttg ctatgggaaa ttgcgccctc tccggtggag ggctcgaaat ggtcttcatc     43740
     cgcgcgccgt gtatcgtgag gacaggctcc cacgtggaaa ttttggcacg atatggaggt     43800
     tttcccacct tggttcgtca gggcaacata ctcgcagcca ccttccaccc tgaattgtct     43860
     acggaccgcc ggatccaccg ctttttttgc gccatgatcc gcagcggaca gccttgtcta     43920
     acctgaaaat ttttgacgcg gtattcggct ttggacatta tgtgagcttt acgatcggac     43980
     attgggcagg cgtggagcag cgcaggcgtg tgggtccggg gctggcggaa ttggtgatgg     44040
     ccagacgcct ggattggagg gatgcgggct cggcggggca catgccgctc tcatgttcgc     44100
     catttcaagc tgcaggcaag agatttcttc tgatgccgct catcgacgcc ggcgccgagc     44160
     agggcatcgc gttgcaggtc gagcacctgt cggtcattat cagtcgagac gcgcatgtag     44220
     ccgatcagca tgtacggaaa tccccttcaa gacggtttcc gtatatcatg ccattccgac     44280
     ggtgttttcc gtagataatt cggcgcaaaa ttcggaattt ttcggcaggt ctcggaccac     44340
     cgacggaaaa caggtgtttt ccatacacac gcaattccgg cctcagaacc gcgctctccg     44400
     ctcaaacccg cagaaaaccc cgatcccaac ccgtcagcgt tcccactttg tccgcttatg     44460
     ctacagcgcg gggcgttccg ttacttcggg ccgaatcacc tctcacccga ttcgggaatc     44520
     cccatacgat tcactcaggt cagaaaacgc tctagattga cctgccggat ccggatctga     44580
     tggcatgatg tggcagtcct gcgtactgac cacggacaga agcatgatct tggcgacgag     44640
     atgatcgctt cgttcaatcc ggcttcaacg acgtcccgcc cgcagcagcg acaagacctg     44700
     tgccgcggga cctcgttgaa ccatgattcg agacatgatg attggcggcg cgtcggttga     44760
     agatacactg gagctttggg cggaccactg gctgtgcgcg acaaccgcca tgattccgcc     44820
     tatctgtttg gtgccgtctg cccggaacgc agtattggtg ccgccatcat catgccggcg     44880
     gtcaacagcg aggcgatggc cgagcatctt cgggaaatca gcacgcaggt tgcgccgggc     44940
     gcgcacgccg tgctggtgct cgacggtgcc ggctggcatc aagccggcga acgtttgcca     45000
     gtgccagaca atatcagcct gctgtcgctg ccaccctatg cgccagagct caacccggtc     45060
     gaaaacatct ggcaatttct gcgcggcaac ttcctcagcc atcagccatc aagtctggaa     45120
     cagctacgac gaaattcttg ccgcctgccg aaacgcctgg aacaagttca tgcagatgcc     45180
     agaacaaatc gcttcaatca cccaacgaga ctggatcaaa aaagtcatcg gataggcagg     45240
     ctattaccct gggccttgcg cttcgcgttc gcgcggcaat cggccagctc gaagaatttt     45300
     cgtcgggcgt gcgaccagca cgccgcctcg atgatcggtc caggagatcg gttcaactcg     45360
     tagagcttgt tgtagccgcc ataggcatcg gcctggaata taccgtggta tccggcgaga     45420
     tgggtttgcg gatgaacgcc ggcgcgatcc cgtgaatagt agaacaccgc gcagggggaa     45480
     cccgatccgc cgaacggccg atcatcacgc acataaaccc acacgcgcgc cgtatcggtc     45540
     tgtcctcgtg ccatcaccgg caccgtggtg tcgtcgccat gcaggcgcgc accggcgaac     45600
     accatcgtct cgatgtgctt gaacaccggc tccagcgcca cgcaggtagc accaatcaga     45660
     tcgcggggcc acgaggtcac ccgcgcagaa ggacaatatg ttcccgcacc aagacccatt     45720
     cacaactgta gcggattacc ccacttggat tgctgcctcc ggcagcgcca actgctgtcg     45780
     gtcgcgccag tcggggctga catagttgat ctccatgagt cgccgcacgc cgacgatggg     45840
     tcgcggatcg aagccgtgcc aggtcgccgg gccggcaatg aagatcgtgc cagaattgaa     45900
     ttccccggat gactggctga cccagcgctt gtccgcgtcg taaatgtcgg tgccccactc     45960
     cgccgcgtcg ggaccaagga acaggtagat caccatggag aacagcttct ccttgatatc     46020
     ccggtgaggt tccagccagg cgccgtccag gtcctggatg tattccatgc gcagatagct     46080
     gccgttgacc tgtatgtcgc agatctccgc catcagcgcc gcaacgtcgg ggcgttgcag     46140
     cgcctgcgcc agggcctcgc agccagggta tttgcggcgc agcgccggcg tgatgaagca     46200
     gcgcgagtcg ttgtaggtgt tgcgtgtacc gtcggtgagg ccgagcatcg ggggggcaat     46260
     cggcagggtc aggatgccgg tgcagacatc taggggcagt acgtcccgca acttccagtg     46320
     ccgatacggc cagtcgccac attccgactg gcgcactgca cgcatgaagt gctgcgcgat     46380
     gtcctccact gcgggaaccg gaggatattg catcaacggc cccccggtag gcggcgcggc     46440
     gcccagtcga tcgccttgcg cagcagtggc accgacttag cgtacgcgct cagactgtgg     46500
     cgtgcgtatt ctttgcgcac gtaccactca gaatcaacgt agcagagctg caagctcttg     46560
     cgctggccct tctgcggcag gaaaccgtgc catgaatggt cgcagacgcg gaacatcagc     46620
     atgtggccga attccggggc aaactcgaag gcgtagtcgt tgcggttttt gctacgcagt     46680
     acgcgcagcc ggccgcgctc atacggccag gcgcgggtaa atccgaccaa cacggtgatg     46740
     atcttgtgcg ggctatcggg atgtgcgtag ccctcattgt agtgaccgct ggtattgccc     46800
     atcatcacaa tgcacgccgg ccgcttgctc aggtcgatgt cgaactttgc ttccaccaag     46860
     tggcggaagc ggtcgctcat caggtcctgc accacggccc cgaaatgcgg accgtgttgc     46920
     aggtcaggca aggcatagct gccccgctcc ggaatggtgg gcgcatcgcc cagaacctct     46980
     tccttcagga gctgcggcat ggcgttctcg acaaagcagt agtcgtacgg atcacgccgt     47040
     aacgccgcgg cggtgatcgc ggcttcgtcg agcatcttga atggtgcgct ggtgtcggcc     47100
     atccggggat ttcctttcgt gtgaagcgtc tgggcgcaga cagccttgcg ggggtcgttc     47160
     agaacacagg cagagcggga gcgacagttt gccacgccct cgacttccac cagccattca     47220
     gggcggcata gcgggccgcg cagaatcagg cgcgggacat ttgaaaaact tatcggagaa     47280
     gcacgcttcc acgacgttgt agtcgctgga gtcgcgcaga tagacgatga agtggctcat     47340
     tgcctcgatg gtcgcgccac cggcgtgcag cagcgcatca acattgccca gtacgcgcgc     47400
     acgctggcgt gtgaggttgc cgcgttcgaa cgtcacgttg tagtcacgcg tgtgacacag     47460
     ccggtcatag gcattcatag gacacctgtt ccgtcgcgag gccgatgatg gagatggagt     47520
     aagtgtccat cagcaccacg tcacactggt ggccacaggc gtcttcgatg ccggtactgg     47580
     gcaggtagtg ggtatcgcgg gtgaggccgt gctgctgaac cagcacggta cgggcagcga     47640
     ccatgtcctg gtagaacaca tccatgtcct tcacgtagat ccagctgcga acgcagttat     47700
     ctgctagcgt accgccctgc gcctgcaccg ccccgatcag tcgtttgaaa atatcgcgcg     47760
     gctgctcggc ggcggagttg ggcgccgctg tggtggatgt gcacagctgt gtgctccaca     47820
     ggtggcgcag atcgcccctg tgcagcaata ggtcacagga tggcgcgcgg gccttgcata     47880
     gcggcgtggc ggagtccacg tggtaagcta gcatcgcgac tttcgctccg ctcagcagcg     47940
     gttgctgcac catggagacg gcaaccggac tgtccaatgg ttcgcgataa aggctgctgt     48000
     cgcggaccat tgctgcctgg ttgagggcat cactcacata cagccggcgg aaaaccgcgc     48060
     tgtccggcgg caggcgcaag gtttgtcgca ccgcggcata gcgctgccct agcgcatcga     48120
     tctgccgagc caagctgagc tgcgcaggag tcgcgatcgc gatgtagtgc tcggtatcgc     48180
     cggaattggt gcggaaactg tggcatgaca ctccgtgtgc ggaagccacc aaggccgctc     48240
     ccgtttctgt tacggatacc cggaggctga tcgggaagcg ggtgacttcc gcctgctccg     48300
     ggttggccta ctatgggcga agacggccta gcgtctttga tctggatcaa agcaatgcta     48360
     gtgtcgtgat tctgtagttt ctctgatttg gcttgagcgc tggcagaagc gctggatagc     48420
     ggcgaggatg ttgtcggcgg acttggtcca gcgggagggc ttgggatcgg cgttatgagc     48480
     gtcgatgaag gcgcggatat cgctttccag ctgctgggtt gagcggtgga cgccgcgtct     48540
     gatctgcttt tcggtcacca aggcgaagaa gcgctcgacc tggttaatcc aggatgctcc     48600
     tgtgggggtg aagtggacat gccagcgcgg cgcttggcga gccaatcgcg gatcggtttg     48660
     gtcttgtggg tggcgtagtt gtccatcacc agatggacgt cgaggttgct cggcacgttg     48720
     gcctcgatct ggtcgaggaa cttcctgaac tcgctggaac ggtgcttggg gtagcagcgg     48780
     ccgatgaccg caccggtggc gatgtcgagc gcggcgaaca gcgaggttgt gccatgccgg     48840
     gtgtagtcgt gggttcggcg ctcgatctgg ccggggcgca tcggcagcag tggttgcgtg     48900
     cggtcaagcg cctggatctg cgatttctcg tcgacacacc gccgagagcg cgcccgaata     48960
     tgcattgcca agcgcgttcc ccgcaggcgc ggggatgaac cgtcaaacgc tttctcccgc     49020
     aatgcgcgcc acgccgcgct atcaaagtcc atttggcatc ggtaaggctg cttgcatagc     49080
     gaagatcctc ccggcagtat ggagtgcccc cgttttgacc ggacagggga tatagctcga     49140
     taaggcatat tcataggcat acgcctatga atatgactat gagttccgtc cccgatagcc     49200
     gttgcgggcg tgttgaagtg atcacctctg tgcagtgccg ccggcgctgg acgacggccg     49260
     agaaggtgcg tctggtcgaa gaggccatgc agcccggctt gtcggtttcc tatgtggctc     49320
     gccgggcggg gatttctccc agccagctcc tttcctggaa gcggcggatg ctcgaaggcg     49380
     gcgcgaccgc tgttcaggcc gacgacgatg tcgttggcgt ggcgcgtgtg caggagcttg     49440
     agaagcgcgt gcgcgacctg gaatgcctgc tcggccgcaa gacgatggaa gccgagatcc     49500
     tcaaggaggc gctcgctctg gccgccccca aaaagccagt cttgcggctt gcctcgctcg     49560
     acagggacgg ttcgccatga aagcgatcgc tgacacgctt ggtgttgccc gctccaacct     49620
     ggcggagcag gcgaagcacc ctctcccgac aacgccggac gcaaacccca tgcgaaggct     49680
     gaagatgtcg ccatcctgcc cgcgatccgc gagctgaccg atcagcggcc aagttacggt     49740
     tatcggcgca tcgcggcctt gctcaaccgc agaacgccgc gcccagaacc tgccgccggt     49800
     caatcggaag cgggtgttgc gcatcatgca ggctaatggc ctagtgttgg cccggcatac     49860
     cgcctatcgc cctgccagaa cccatgatgg cgtcgtcatc gcgctgcgtt ctaacatccg     49920
     ctggtgctca gaccatcttg aacttaaatg ccgcaacggt gacatcgtcc gggttctgtt     49980
     cgtcatcgac gactgcgacc gtgagatcat cgcttggtcg gccgtcgctc atgttttgcg     50040
     ccggccgctg atggaggaga ggaatcgggc ccgggccggg cgggaagccg caaagatctc     50100
     catcataaaa atcaatattt tgatccgtaa ttttgcgcca tatgccgtat agcacgaaaa     50160
     aaccattttt ttcagggcgc aaaaaagttt tttcactgat gtcgtgatgt ctggttgtcg     50220
     atactacggc attttcgtag gatcccgggc gcagttgtcg cgcgccctgg atcctgacaa     50280
     aggccgatct gaggccgctt ggcgcgggtt tccgtgccct ggttcgctgc aaagcgtccc     50340
     ctgaatcctg acagaacatg ccctggtcga ttgcaatcgg agcggctcgc agagggatcg     50400
     gcgcttccca gaaacttggc cacctccgca aacggtcgtt tacagatgcc ttgttgaatt     50460
     gtaaaaatcg gccccaagga gggcctgatc gccgtgacat cgcccaaggg ccgaaaaaac     50520
     cccgtccccg gccgactgat cggctacgcg cgggtctcta cagaggaaca gggcacggat     50580
     ccgcaactcg atgagctgca ggcggccggc tgcgccgaca tcctcgagga acacgcctcc     50640
     ggcgccgacc gcggccgccc ggtcctggcc cgcctgctgc gcaccatcca ggccggcgac     50700
     accctggtcg tggtccggct cgaccgcctc gcccgctcgg tcagccacct gctcgccgtc     50760
     atcgagcagc tggaggacgt gggggcgcat ttccgcagcc tgcgcgatcc gatcgacacc     50820
     acaacaccgc aaggcatgtt ctccctccag gtgctcggtg ccgtcgccca gctcgagcgg     50880
     gccctcatcg ccgagcgcac cagggcgggt ctgtgcgcag cccgggtccg tggccgcatc     50940
     ggcggtaatc cgggcctgcg cgcgcgtgac ccggaagcca tccgcaagat cagaaagagt     51000
     cgcgatgcag cgtatctcga cggcattttg agccagctcg attcctggct gccgaccgtg     51060
     cgtaggatgc ggcccgacca gccgtggggg gatgttgtcc gggttctcaa ccgcggacag     51120
     gccacaccag cacaccacgc ttccggcaga atctggaccg tcgagcgact gcgccgcacc     51180
     gtccatcggc tcgtcgctga aggtttggct gaccgtagcc tactgggccg agctcctcca     51240
     cagaggagtg acgatcggct ggtacgcctg gttgccggca tcaagacggc ggcacccggc     51300
     cacaccctgc agcagatcgc cactcagctc gaggccatgc gtgagcgcac ccctcggggt     51360
     ggcacgcgct ggcatccatc ttcggtcagg ctcttgctta tcagggccgg acgtctcggc     51420
     ctcctttcag cctgatatcg cccggtcgcg taattcacgg acgacgccat acgtgggatc     51480
     gcacctgctc cgtcatagcc ttgccatccg gctggtgaac acgggacctc gctcgacgac     51540
     taggttagcg aagtcccgct cagtgcgaag gtctgcccgc ccactacaat gccagggctg     51600
     aatctcttgc cctgccccag ccgcccgctg tgatcgtgct tctgattatc tgcattccct     51660
     gaaactgcac gagaccgagg cgcagcctac gcggtcggcc gctcctgtgc gcttccggaa     51720
     ttccaaaaag atggaaagag agaaaaagtg aaaacaagaa ttacggacag atttggcggt     51780
     aagcgccctt atatatccgt aattcttgag tcgctgtcgc tcccgggcga gttcatcact     51840
     cgtaaacagc gggtgcgacc tcagattgtc ggtaacgacc gcctcgaccg tccatcgagc     51900
     tggctcgcct cgtagagccg catgtagccg tcagagggtc gtagcgcatc gatcagctgc     51960
     ttgtccgtca gcacgccgga cttgccggtg cagcatgtcg agaaagggcg tcgctagacc     52020
     agatgttcgc ctgagattgg ggtgacccgt ctcgcagtat gcaggtttcc gagggttgcg     52080
     ccgggaggtc cggtgccgag cctcaatgca taggagacgg gtcatgggaa agcatatcac     52140
     ttttatcggg ctggacgtgc acaaggagac gatcacggtc gcgctggcgg aatccggcgg     52200
     ccgcgatgac gtgcgcgagt atggccggat cgcgaacacc ccggaggcgc tgacgagggt     52260
     ggtgacgaag ttgcagcgcg tgggcgggga actgcgattt tgctatgaag cgggtccatg     52320
     tggctacggg atccagcgac agctgacggc ggccgggcat ggctgcgtgg tggtggcgcc     52380
     gtcgctgatc cctcgcaagc cgggggaacg gatcaagacg gatcgtcggg acgcggtgaa     52440
     cctggccagg ctacatcggg cgggggaatt gacggcggtc tgggtgccgg atccggcgca     52500
     tgaagcgatc cgtgacctgg tctggactcg tgagtgcttg tcagcatcct atagagaaag     52560
     agagaattct cgttttctcc taaaagagag gaattccctc tttcatgaaa atgggaattc     52620
     agacaatatc actttcatga aaacgatcgt catcgcgaat cagaagggcg ggtcgggtaa     52680
     atctaccacg gcggttcatt tggccgccgc ggccgaggcc gctggcgacg gtccggtcgt     52740
     gatctccgac accgatccgc agggcaccgc cgccgactgg ttcaaccagc gcaagcaaag     52800
     cggcatcgag acgccgcgct actcggagct gtcgctcgac gacctggcgg gtagggtgca     52860
     ggcgctcgac caggcagggg ctgcttatct cttcatcgac acagcgcctt cgattggcgc     52920
     agttaacgcc gatctgttcg cgcttgccga cctgatcctg attccgctca acccgacccc     52980
     ggccgacctg cgcgcgctgg tcaaaggcct gccactgatc cgcgagtctg ggaagccctt     53040
     ccaattcgtc ctgacgcggg tgcggcctaa gctccgcaac aacgacggcg ccgctatggc     53100
     gctcggtgcg ctcggtctcg tgctcagctc ccggatgcac gagcgcgtca tctacgccga     53160
     aaccttcgct cacgggaaaa ccgccttgga aaccgaggtc aagggcattg cggcgcagga     53220
     gattacggcg ctttggcacg aaatcagaga aaagttggaa agggagaatt catgaaagag     53280
     ataattccat gagcaagcgc ccggccattg atctcgccgc gctgacctcc gaggccgccc     53340
     ggccgatgac tgaggcagtc cagcgtgtcc cgcgcccgac tccagcggca gtgccgccgc     53400
     cagcgccggc caatgcgcag catgcggccg agcgacccac ccggactgcc aatctccagg     53460
     cgctcgcgtt caaggtgtcg cccgccttcc gcaagcgatt ccgccagcgt gccgccgctg     53520
     ccgatctcaa gctgaacgag ctgctttttg aggcactcga cgcttgggaa gttcaacgcg     53580
     gccttaagcg gtagaattcc ctttttcatg aattcttgct ttcgcgcttt ctaatcgaat     53640
     cgcgtggagc attagtacag ctgcgtctgg gcagggggca cgagtcgcgc cccttttctg     53700
     tgttcgcgga ccaaatgtcc ataacgaaaa ttcacaagga aaccgggctt ttcagtgctc     53760
     aagcacgaat cgctgcgaag aagtggtaga caatcccgaa cgaagcgccg acagttaatt     53820
     ccctagggaa ttgattcgag attcgccgat gccaaaagcc gccgcttcct atgttgggag     53880
     gaacatccgc taccgccagc gccttcggga cgccggcgcg caggaggtgc tgttccagct     53940
     ccccgacgag actgtcgccc tcatcgacga gatcaagaaa cgccagggtc tgcggagccg     54000
     cagccaggcg ctgttgcaac tgatcgagcg cgggagagaa cctactcagc agaccgcttg     54060
     aaatgcgaaa gcccgccttg ccgggcgggc tttgcataaa ttcgtgacgg gccgtggtgg     54120
     ctaggccgtc tggaacagtt tgcttcccca gacatagcca ttgcgagctt ttttgccaag     54180
     cggaaattgc cgtttctgct gaggggagag ctttgcctgt cgcgatccag ccacaacgga     54240
     ggatcacg                                                              54248
//