Dbfetch

ID   AP012037; SV 1; circular; genomic DNA; STD; PRO; 65564 BP.
XX
AC   AP012037;
XX
PR   Project:PRJDA60101;
XX
DT   02-MAR-2011 (Rel. 108, Created)
DT   28-SEP-2016 (Rel. 130, Last updated, Version 3)
XX
DE   Acidiphilium multivorum AIU301 plasmid pACMV2 DNA, complete sequence.
XX
KW   .
XX
OS   Acidiphilium multivorum AIU301
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acidiphilium.
OG   Plasmid pACMV2
XX
RN   [1]
RP   1-65564
RA   Hosoyama A., Yamada R., Ito N., Takarada H., Narita-Yamada S., Nakamura S.,
RA   Katano Y., Ichikawa N., Nakazawa H., Fujita N.;
RT   ;
RL   Submitted (28-DEC-2010) to the INSDC.
RL   Contact:Director-General Department of Biotechnology National Institute of
RL   Technology and Evaluation, NITE Bioresource Information Center (NBIC),
RL   Department of Biotechnology; 2-49-10 Nishihara, Shibuya-ku, Tokyo 151-0066,
RL   Japan URL    :http://www.bio.nite.go.jp/
XX
RN   [2]
RA   Narita-Yamada S., Nakamura S., Ito N., Takarada H., Katano Y., Nakazawa H.,
RA   Hosoyama A., Yamada R., Fujita N.;
RT   "Whole genome sequence of Acidiphilium multivorum AIU301.";
RL   Unpublished.
XX
DR   MD5; 75123ca072923efb9de8b9930c30ce5b.
DR   BioSample; SAMD00060977.
DR   EuropePMC; PMC3834237; 24312089.
XX
CC   ##Genome-Assembly-Data-START##
CC   Genome Coverage       :: 8x
CC   Sequencing Technology :: ABI3730
CC   ##Genome-Assembly-Data-END##
CC   Please visit our web site.
CC   URL:http://www.bio.nite.go.jp/
CC   DOGAN ; Database of Genomes Analyzed at NITE
CC   The database contains genome sequence data, physical maps
CC   and the genomic and proteomic data of the microorganisms
CC   analyzed.
CC   URL:http://www.bio.nite.go.jp/dogan/Top
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..65564
FT                   /organism="Acidiphilium multivorum AIU301"
FT                   /plasmid="pACMV2"
FT                   /strain="AIU301"
FT                   /mol_type="genomic DNA"
FT                   /note="strain coidentity: NBRC 100883"
FT                   /db_xref="taxon:926570"
FT   CDS             1..1353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00010"
FT                   /product="replication protein C"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83081"
FT                   /db_xref="GOA:F0J7L4"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7L4"
FT                   /protein_id="BAJ83081.1"
FT                   /translation="MPVSPPTGRVSPKPVGVSMQLPHQAERGRMPPPLPSRPTGLRRLT
FT                   PAMLPTARLADGFAGGDITPGQALAAFKAAAPFLGIGPRVAQAIDWLFRFTQPQDWQPG
FT                   ARPIVWPSAAMMSAELGITETQTKRLNRHLAELRLIVMRDSPNGKRYGHRDRSGRIIEA
FT                   YGFDLSPIAQRIEEFRALAEAGREERAAVAKLRRRASIARASLRQTWETFREQEIDLPA
FT                   PLRTAAQAASRGLKDLESSQRLKPAVEALEAIAVDARRALEMTLAGASLEQTSISESVE
FT                   MCPKGHADVPHITTTNQRLNPKKDTVIALKECSRGDLPGRTAQTKPPARPERQDRGTSL
FT                   KLTPDELVRLAPRLVPYLRQPSPSWPEIVDAADWLRHDLGVSKPLWGEACLAMGREQAA
FT                   IALALVSAKPEGYFRSSPGGYFHGMVERARDGGLHLDRTIWGLRGASAHKS"
FT   CDS             complement(1439..1720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00020"
FT                   /product="Xre family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83082"
FT                   /db_xref="GOA:F0J7L5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7L5"
FT                   /protein_id="BAJ83082.1"
FT                   /translation="MSNERFSSVWDAIEDTPAEAENMKLRSALIMALKERITREGLSQS
FT                   QAAKLFGVTQPRISDLLRGKINLFGLDTLVNMAVAAGLHVELRVMEAA"
FT   CDS             complement(1717..1992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00030"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83083"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7L6"
FT                   /protein_id="BAJ83083.1"
FT                   /translation="MSARREAGHQLDQVQQGRDPDDWKPMRTIGQGVREIRIRDEAGAF
FT                   RVIYVAKFADTIYVLHCFQKKTQATSKPDLELATKRYRDLVKELNS"
FT   CDS             2269..2928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="ACMV_P2_00040"
FT                   /product="putative partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83084"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7L7"
FT                   /protein_id="BAJ83084.1"
FT                   /translation="MLAVAFCTQKGGTGKTTIATALAVAAHRAGKKAALLDLDPQTNAV
FT                   DWFDRREGDGPDVASIQPGAIRRSLDAYRKLGMEWVFIDTPGKMDSASTEAAKHADIVL
FT                   IPTQAQIFAIDTLEPLKRLLDMAGSPPAFVVLNLVHPNAAGRAGEDAAAIAERFKVPVA
FT                   PVHMSRLKAYEDAPALGQSPQEYEPKGRAAREISELFEFLTAQGNMVTGKRESMKA"
FT   CDS             2925..3266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83085"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7L8"
FT                   /protein_id="BAJ83085.1"
FT                   /translation="MSRKPSLLASALKTSEPETTVPVGKAPTEPKAAAVTAPREQRAEH
FT                   QSGAYVPPSRANKTAKTHYLPPAYWDTLEEISFRTRDEKGKRVPQERLVAEALNLLFVK
FT                   YNYPQVRDE"
FT   CDS             3339..4019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83086"
FT                   /db_xref="GOA:F0J7L9"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7L9"
FT                   /protein_id="BAJ83086.1"
FT                   /translation="MVATGAAAAAIITHPGDQATETHAQRAGAAGEKRVARALERAGVP
FT                   AIHDITLQDQRGTHQIDHVAAAGDCLYCLETKTWRGELLGRADAQHWILKKPDGAAQSV
FT                   YNPLMQNETHRDVIRRVAQVPVRPLVILAGHLRLAGGPVPGMIPLTSAIMEMTRAGAAS
FT                   GRALAALESLARFRGQSRQAALSAAHSRRMRRQKPTRTRQLWTLAVGAALVFLILAVEQ
FT                   AIFS"
FT   CDS             4086..4328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00070"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83087"
FT                   /db_xref="GOA:F0J7M0"
FT                   /db_xref="InterPro:IPR011660"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7M0"
FT                   /protein_id="BAJ83087.1"
FT                   /translation="MPLYIRDDATAELVAKLAKERGLTKQDAVRIAVQAELDRTHDAKP
FT                   LRERLREWREANPLPPPTGLKADKAFFDDLSGEGE"
FT   CDS             4325..4735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00080"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83088"
FT                   /db_xref="GOA:F0J7M1"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7M1"
FT                   /protein_id="BAJ83088.1"
FT                   /translation="MIFIDASALIAMIAGEEGADMLADLLAQERTRLVSPVAMWEATAG
FT                   LCRRFGLSMDGARQKVRSFMSALGIEVISLGEREYDLAIQAYVDFGKGRHPAALNMGDC
FT                   FAYGAAKSYRAALLFKGDDFTKTDIRKAGMNS"
FT   CDS             4801..5004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00090"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83089"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7M2"
FT                   /protein_id="BAJ83089.1"
FT                   /translation="MDQLVSRISEAEMTRRRHAIEQARAANIRQGYVHDPVLEAANERF
FT                   IRGEIDMVELDRLMIAAIEAGR"
FT   CDS             complement(5100..5363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00100"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83090"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7M3"
FT                   /protein_id="BAJ83090.1"
FT                   /translation="MQERGAALVEAANRLHRRTVHDRPLIARMPGPFIDLGKQISVDRL
FT                   QVRRIEGTARAFTEHQVCQAVVGQAVFGPRQGRVASQAKSVA"
FT   CDS             complement(5447..6154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsH"
FT                   /locus_tag="ACMV_P2_00110"
FT                   /product="arsenical resistance protein ArsH"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83091"
FT                   /db_xref="GOA:F0J7M4"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7M4"
FT                   /protein_id="BAJ83091.1"
FT                   /translation="MGDPAEFPALRPEMLAPPDLSRLEPASRATHKPRILLLYGSLRER
FT                   SYSRFLTLEAARLLDLMGAETRIYDPRELPVTNTVPVDHPKVQELRNLSIWSEGQVWCS
FT                   PEQHGAVTGVMKNQIDWIPLEVGAVRPTQGRTLAVMQVSGGSQSFNAVNTLRLLGRWMR
FT                   MFVIPNQSSVARAYEQFDEAGRMLSSAYYDRVVDVMEELLRFTLLLRDRRAYLVDRYSE
FT                   RKAHQPPVDVEVI"
FT   CDS             complement(6147..7466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsB"
FT                   /locus_tag="ACMV_P2_00120"
FT                   /product="arsenical pump membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00120"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83092"
FT                   /db_xref="GOA:F0J7M5"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7M5"
FT                   /protein_id="BAJ83092.1"
FT                   /translation="MLALAVFVATLVFVIWQPRGLGIGWSAMAGAILDLALGVIHWRNI
FT                   PTVWHIVWNATFTFVALIIISLLLDEAGLFRWAALHVARWGRGRGRILLPLIVLLGAVI
FT                   AAFFANDGAALLLTPIVMAILVSLEFPPTVALAFVIATGFVADTTSLPLVISNLVNIVS
FT                   ANFFKIGFDRYAMVMVPIDIVALIATLAVLGVTYGRTANRTYAVAALDAPRSAIRDPLV
FT                   FRAAWPVLLVLLGAYFITAPLGLPVSFVTIVGAVVLLALAARITGRGAPIIEVRSVLRS
FT                   APWQVVVFSLGMYLVVYGLRNAGLTNYISSALRAFAAHGIWAASLGTGVLAAALSSIMN
FT                   NMPSVLVGALAIGQFGHVAPPIHDAMVYANVIGCDLGPKFTPIGSLATLLWLHVLAQKG
FT                   TRITWGQYMRIGLLITPPVLLATLAALALWLPVVGSIGHG"
FT   CDS             complement(7490..7912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00130"
FT                   /product="arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00130"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83093"
FT                   /db_xref="GOA:F0J7M6"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7M6"
FT                   /protein_id="BAJ83093.1"
FT                   /translation="MSVTIYHNLACGTSRNVLALIRNAGIEPTIIEYLKTPPSRETLID
FT                   LIARTAMPVRSVLREKDTPYAELGLADPALPDHALLDAMMAHPILINRPIVVTPLGVKL
FT                   CRPSETVLDILPAPQRSAFTKEDGEAVVDPAGRRIR"
FT   CDS             complement(7909..8433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00140"
FT                   /product="arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00140"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83094"
FT                   /db_xref="GOA:F0J7M7"
FT                   /db_xref="InterPro:IPR014064"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7M7"
FT                   /protein_id="BAJ83094.1"
FT                   /translation="MTNQPLNVLFLCTGNSARSIMAEKLVERWGMGKFRGFSAGSHPKG
FT                   DVHPGALAMLEEAGLPIEGLRSKSWDEFAAPGAPVMDFVFTVCDDAAGEMCPVWPGQPM
FT                   TAHWGVPDPAAVGGTDLERMTAFRTAFRMLETRIRLFASLPFAKLEQASLRRRVQEIGR
FT                   IGSNADEGSAA"
FT   CDS             complement(8430..8822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsR"
FT                   /locus_tag="ACMV_P2_00150"
FT                   /product="putative arsenical resistance operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00150"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83095"
FT                   /db_xref="GOA:F0J7M8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7M8"
FT                   /protein_id="BAJ83095.1"
FT                   /translation="MRMPRSPKKDPAWMVAALAALAHEHRLAAYRILVEAGPAGIAAGD
FT                   IAEKIGLVPSSFTFHVQALRNAGLISQRRVSRHVIYAADFAAMNTLVGFLVENCCGQGL
FT                   SICSPACDPALPSAKQEAMRSKAKSA"
FT   CDS             8972..9454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00160"
FT                   /product="arsenite oxidase small subunit"
FT                   /EC_number="1.20.9.1"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00160"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83096"
FT                   /db_xref="GOA:F0J7M9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014067"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7M9"
FT                   /protein_id="BAJ83096.1"
FT                   /translation="MKVSRRDFVRTSAVAGVVASPLIAKANMVMPDGKPWPSVKAGNIN
FT                   QLSPGKPVSFQYPDATSPAWLLKLAEPAYEGAGSSGDVVAFSGICTHMGCPVAFKDGRF
FT                   VCPCHFSMFDPARNGVPYQGLASDYLPQIELRIDSAGDIYAERMSGLVWGRTSDVA"
FT   CDS             9488..11902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00170"
FT                   /product="arsenite oxidase large subunit"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00170"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83097"
FT                   /db_xref="GOA:F0J7N0"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR014066"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7N0"
FT                   /protein_id="BAJ83097.1"
FT                   /translation="MALYRREESIPLPPKNAEAYNTACQYCTVGCGYKVYVWPDGLAGG
FT                   LKAGDNAFGIDFSGPQPPIVGFSYTESMHSTIRKRDGRTYHVAIVPTHDSPINPMGNHS
FT                   SRGAVNAKTTWSDSRPTQARLHYPLLRSGSEFNAIPWDAAIELQARVIKGVADKHGADA
FT                   LCSKIYDHGGGGGGMENTYGTGRLLFTGLQMKHVGIHNRPGYSSETWGTRDRGVHELNY
FT                   CYEDARLADTIMLWGSNAYVTATVFFVAHMMPNLQGATTDEKKRHYAKGEAITPARMVI
FT                   VDPRISATVNAAHETGAKVLHLRPNLGTDYMLMNAVARVVWEKKYYNKNFLNQHTDMTS
FT                   FEDYKKKSLELDIPYKDFMARAQKISGVPVAQIEQAAAWIAQPKPGGHPRRSLILYEKG
FT                   VIWNYRQYDAVAAIAQLGALSFNIGRPGTGTGRVGGHQEGYARPDYPGPKPPPDVDKYV
FT                   QDGNGKIFWLTGCNPYLAAQNNAYFRKRIGERAQALTDYLSAQKQGDGEPASIEHLAAR
FT                   ILEGLDKTNGLFVTVQNIYMIESARDAHLILPAAQWGEAENISLNCGDRLMRLDDRFMD
FT                   PPGDAKPDWEIHGLVGQKLEELYKADGKADIARRFAGMDWKHGADVVKSIQDDLYAGMN
FT                   TKVPASRASTLDPESFKGVDYAYLRKIGQKGIQTPVRTDPNTGELVGTKRLYSTFYFMT
FT                   KDGRFSWYGTRPWDDHASAKVVAGYLKSDRTKYPFWFTMGRDQPLWQTSYHMRHLPEKA
FT                   ETIPLPFVQVNPADVKKLGVTNGDIVMIYNDPCLSGCYPHPLNVGCVHSPE"
FT   repeat_region   complement(11833..11840)
FT                   /rpt_type=FLANKING
FT   mobile_element  complement(11841..12920)
FT                   /mobile_element_type="insertion sequence:ISAcr1"
FT   repeat_region   complement(11841..11882)
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   CDS             complement(11857..12873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00180"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00180"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83098"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:F0IZR7"
FT                   /protein_id="BAJ83098.1"
FT                   /translation="MDVLAREDLPFPQSLPEFQRIFPNDAACAAYLESARWNGGFACPR
FT                   CGVVGEPFRFEARPGVLRCRACRKDVSLMAGTVMERSHTPLSTWFWAAYLIASQTPGMS
FT                   AVQFQRQLGLSRYETAFGILHKLRAGMVRPERDKIGDTPQEHVEVDETWVGGRTRGDGR
FT                   GVHHKVLVACAVEVRHRKPGTKLDNRKDGRYAGRVRLAVVPDRSANSLCGFVENAVAPG
FT                   SLIVTDDWSGYAGLGRRGFDHHAIAECGDPEVAEEFLPIVHLVFTNLKTWINGIHHGVS
FT                   AKHLQAYLNEFTFRFNRRLYPFNAFRSLLGIAGRAAAPTFDELYSGEWTHPTFSGCG"
FT   repeat_region   complement(12879..12920)
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   repeat_region   complement(12921..12928)
FT                   /rpt_type=FLANKING
FT   CDS             12967..13161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00190"
FT                   /product="arsenite oxidase large subunit"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00190"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83099"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7N2"
FT                   /protein_id="BAJ83099.1"
FT                   /translation="MPPGTVFALMYHWLGTSNSLTSPYTDPMSTNPWYKGTRVGIRKLS
FT                   GGLASVVATTSYRQTNTFT"
FT   CDS             complement(13372..14166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00200"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00200"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83100"
FT                   /db_xref="GOA:F0J7N3"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7N3"
FT                   /protein_id="BAJ83100.1"
FT                   /translation="MRHDPATGALVIMLRSLKMHGMAQAVDELAQQGAPAFEAAIPVLS
FT                   QLLKAETAEREVRSMAYQFKAARFPAYRDLAGFDFASSEVNEALVRQLHRCDFIEPADN
FT                   VVLVGGPGTGKTHIATALGVQAVEHHKKRVRFFSTVELVNALEQEKAQGKAGQIAGRLI
FT                   HADLVILDELGYLPFSASGGALLFHLLSKLYERTSVVITTNLSFSEWSAVFGDAKMTTA
FT                   LLDRLTHHCHILETGNDSFRFKNSSVQKSQKRKEKNPALTPS"
FT   CDS             complement(14156..15694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00210"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00210"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83101"
FT                   /db_xref="GOA:F0J7N4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7N4"
FT                   /protein_id="BAJ83101.1"
FT                   /translation="MLDMAFLSIIRRWHKREHVPIREISRRTGVSRNTIRKYLRSDVIE
FT                   PKFQVPDRPSKLDPYAEKLSAWLRREGNRPRKQRRTVKQLYGDLVSLGYDGSYNRVAAF
FT                   ARAWKEECQRLQQTAGRGTFVPLAFAPGEAFQFDWSEDFAIIGGVRVKLQVAHTKLSHS
FT                   RAFIVRAYLLQTHEMLFDAHNHAFQALGGVPRRGIYDNMRTAVDKVGRGKERSVNARFL
FT                   AMTSHYLFEAEFCNRAAGWEKGQVEKNVQDARHRLWQSMPPFESLDALNDWLERRCREL
FT                   WEQTAHGNEPGTIADVWASEVESLMPVGRPFDGFVEHTKRVSSTCLIHLERSRYSVPAS
FT                   FANRPVSLRVYPDRLVVAAEGQIICEHPRIIDRTHNGPGRTLYDWRHYLAVIQRKPGAL
FT                   RNGAPFLELPDAFKRLQQHLLRRPGGDREMVEILALVLHHDEQAVLVAVELALEDGVPS
FT                   KTHIINRLHRLIDGKQAPPPVITAPQALTLANEPKADVERYDSLRQSEEARHAS"
FT   repeat_region   complement(15746..17078)
FT                   /note="Belongs to IS110 family"
FT   repeat_region   complement(15746..15767)
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 22 bp inverted repeat"
FT   CDS             complement(15988..17004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00220"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00220"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83102"
FT                   /db_xref="GOA:F0J7N5"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7N5"
FT                   /protein_id="BAJ83102.1"
FT                   /translation="MEFKRISIDTSKHIFTIHGVDGQDRVILRRDLRRGQMEAFFAKVP
FT                   ATEIALEACAGSHHWGRKFGALGHRVKLIPPQYVKPFVKRGKNDRNDAEAISEAAARPD
FT                   MRTVPVKTVDEQAATIIVKHREMLVGQRTQAINALRGHAGEFGIVAAKGCGNVAALVCV
FT                   LTNEAAIPEGARTMFAQMGRHIAELDLKIEAIDRQLLEQHKANPVSQRLAAIPGVGPIT
FT                   AITMAISINPANFESGRHFAAWLGLTPREHSTGGKHRIGRISKAGNERLRQLLVVGAMS
FT                   VVRYAKPGSKSASTWLLQLLERRPRKIAAIALANKIARIIWAMMARGEAYRRQPASA"
FT   CDS             complement(17027..18892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00230"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83103"
FT                   /db_xref="GOA:F0J7N6"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR025902"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7N6"
FT                   /protein_id="BAJ83103.1"
FT                   /translation="MIIHTAKTHAFLAYVLAFVLTGAEAFPVIGALVPGTAIIVGLGAL
FT                   VPTGALHFWPLVAWSTGGAILGDGLPFWFGSRFRDRATELWPLNLHPGLLPKGQAFFER
FT                   HGGSAVIIARFTPGVRAVVPIVAGVSGMRPLRFYLLDVGSAVIWAPAHVGAGVLVGASL
FT                   AILGVMAGRLEALLVGSVVGLVLLLWLVPRLLRLAINWLDTGRGPALAWARGGKGRIRS
FT                   AVASILDPARTELSGLITLACALAGSLWLLLGILQDLIAGDPLVYADHAILHFLAPYRS
FT                   GIPMEAAVTFSRLGSGVVTLAVAVVALVWLDRQSAWRGAAYGIAAVIGASLFTAGLDLA
FT                   LHRAPPSPIAPGWSLMPFPGGDLATSCAVYGILTVIAGRQLGTRARLTLITATVLFAAL
FT                   QLGSRVYLGLDWFSSELAALSFGFAWAAGLGLAYVARPVEPVAPWRLVAITAATLAIAG
FT                   TPAIALNRHADLARHEGGRTSSTMTCRDWLQRGWQNLPARSLGMLGSFSGALTIQWIGP
FT                   AGGLRRALVQLGWRSPAPWTFRNALAFLAPHATPSVIPVLPRWDDGRSADLVMILAAHG
FT                   LVADQRLVLRLWKTGVSVITLLISAEICWGGTAHGIGCAKMRSLK"
FT   repeat_region   complement(17057..17078)
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 22 bp inverted repeat"
FT   CDS             complement(19401..19805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00240"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83104"
FT                   /db_xref="GOA:F0J7N7"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7N7"
FT                   /protein_id="BAJ83104.1"
FT                   /translation="MEEGFPPPPDAPGRSAGFASQLGRALLGLLRGALRFLVAAVLDVL
FT                   ILAVRFVLWFRRLLFWLGFFSALSCILNYEVHKLRLAAFALGAGILMMTLSRASLLLND
FT                   RLRFGQLQLHAWAQAWPVKRYAFTVLPPRR"
FT   CDS             complement(19810..20295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00250"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83105"
FT                   /db_xref="GOA:F0J7N8"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7N8"
FT                   /protein_id="BAJ83105.1"
FT                   /translation="MRQARDGLAQTIDQAFKAAKAQAEAAHADLSRQFVASFAQAAEQR
FT                   LKAMSRWVWWRTLASCAALAIVILALGFGLGYWRGNAAGYSQAAGTIHAAGAVEQSVLA
FT                   SQGPAGLAQWHQLMRDNAILDTMKSDCTGKNVAHQDGRTACHLWLWTTPNVAPAAHG"
FT   repeat_region   complement(20434..20439)
FT                   /rpt_type=FLANKING
FT   repeat_region   complement(20440..22009)
FT                   /note="Belongs to IS5 family"
FT   repeat_region   complement(20440..20464)
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 25 bp inverted repeat"
FT   CDS             complement(20452..21819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00260"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00260"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83106"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7N9"
FT                   /protein_id="BAJ83106.1"
FT                   /translation="MPPKLSASQDDLELFRSRLENIIDQRHPLVRLARLIDWRVFEERF
FT                   GALYAEAAGRPALPTRLMVALHLLKHMDGLSDEAICARYLDSPYVQAFCGETHFQHTLP
FT                   LDRSSMTRWRKRIGAERMEALLAETLVAAERGGAVAETHYERVTIDTTVQPKAVTHPTD
FT                   SKLLHSGIETLARMARRHGITLRQSYRRVARYARQEAARLHHGGKRREAEARVRKLRTW
FT                   LGRLARDITRKIAGNAEAKAAFAETLGLINRLLRQKRSDRGADKLYSLHAPEVECIGKG
FT                   KARTRFEFGVKVSIATTNAAAPGGQFVLGMQSRPGNPYDGHTLAGQIEQVERITGVAVA
FT                   RAYVDRGYRGHGVEAEGRKIFISRQKRGITPTIRRELRRRAAIEPVIGHMKTDGHLGRN
FT                   FLLGVDGDAINAVLAGAGHNLRLLRRWLIRLLCALVAWLSAARPSPDLRLRNSKVA"
FT   repeat_region   complement(21985..22009)
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 25 bp inverted repeat"
FT   repeat_region   complement(22010..22015)
FT                   /rpt_type=FLANKING
FT   CDS             complement(22087..22593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00270"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83107"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7P0"
FT                   /protein_id="BAJ83107.1"
FT                   /translation="MEFAIAEKQTAIIDLGGGDTILRTIAGEMPGFDAMIEDAGMAVVM
FT                   FYLAGPHPEDLTPAATLGALGFKPRARAFVLNEGMALAGQSRDQAFGRVTSSNVYRDET
FT                   ADGALTLWMPRLHAAEAVEARTASFVAARDGQTEPPLGVFNRSRVGHWLKAMDEQFAGV
FT                   KSWMP"
FT   CDS             22718..23041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00280"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83108"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7P1"
FT                   /protein_id="BAJ83108.1"
FT                   /translation="MRWSVETLDVVDDEIMELPPKLQARLLRLFEMVESLGLDQLHEPH
FT                   VKHLDGKLWELRAKAAEGIARGIYVAVTGRRVVVLHVFVKKSQKTPRRALELAQERMKE
FT                   VKP"
FT   CDS             23038..23310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00290"
FT                   /product="Xre family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83109"
FT                   /db_xref="GOA:F0J7P2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7P2"
FT                   /protein_id="BAJ83109.1"
FT                   /translation="MTKLGELKKKLMENPEFRVEYAQADADYRLIEEMIRVRMEAKLTQ
FT                   SELALKIGTTQSAIARLEGGKVSPSVSTLRRYAEATGHQLKVSFV"
FT   CDS             complement(23400..25712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00300"
FT                   /product="putative cation-transporting ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00300"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83110"
FT                   /db_xref="GOA:F0J7P3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7P3"
FT                   /protein_id="BAJ83110.1"
FT                   /translation="MSADIEQGLPSAEAERLLRQFGTNEVADKSESWPHALAAKLWAPL
FT                   PWMLEATILLEVFLGHGLQAVIISVLLIFNAILGLTQEARAKAAVKALRRTLAVMASVR
FT                   RDGRWMRLGASQLVPGDLVKLALGAVVPADIKIAAGNVLADQSMLTGESLPVERKPGDL
FT                   AYAGAMIRQGEATGIVVATGARTYFGKTASLVQDAHGVSSEQRAVLAVVRDLAVVNGAV
FT                   VLAMLAYAHAIGRSFAETVPLLLTALLASIPVALPSTFTLAAALSARRLVRGAVLPTRL
FT                   AAINEAATMSLLCSDKTGTLTQNALSIETIIGFDGMAENAVLAAAAAASSEGGDPVDQV
FT                   IINAARLRGVAVPEATGFTPFDPACKYAQARLADGSLLRKGALGALLQVPLSAEQEVAR
FT                   QHLAEAGCRVLAVTRTVGAATVLLGLLGLADPPREDAASLITALQELGVRVVMVTGDAP
FT                   ETARVIAKSVGITGDICDSATLETLAAPGDYGVFAGVFPEQKFRLVKLFQHGGHVVGMC
FT                   GDGTNDAPALRQAQMGIAVSTATDVAKAAAGLVLTSPGLAGILDAIREGRAAFQRIRTY
FT                   TLSMVVRKIAFVLYLALGLVMTGHAVLTPLLMVLLLIVNDFLTMAITTDRALPSSHPRR
FT                   WRIGRIITEGGVYGLATLGYAALMLLAGRVIWHLPLPQIRSLSFLTLMLAIQASVYVIR
FT                   EERWFWSSTPSLWLSVATLAMVGFSLLVAGMGILMAPLGWKILGTIMISAAVFTLLLDL
FT                   LKHLAVRVERRGFSHAG"
FT   CDS             complement(25741..26250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00310"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83111"
FT                   /db_xref="GOA:F0J7P4"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7P4"
FT                   /protein_id="BAJ83111.1"
FT                   /translation="MRQARDGLAQTIDQAFKAAKAQAEAAHADLSRQFVASFAQAAEQR
FT                   LKAMSRWVWWRTLASCAALAIVILALGFGLGYWRGNAAGYSQAAGTIHATGAVEQSVLA
FT                   SQGPAGLAQWHQLMRDNAILDTMKSDCTSKNVAHQDGRTACHLWLWTTPNVAPAAIAAM
FT                   HMKARQ"
FT   CDS             complement(26466..27356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00320"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83112"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7P5"
FT                   /protein_id="BAJ83112.1"
FT                   /translation="MTEAPSSEKKPTGAQKPAPPVFRPGSAVAGLKPAEIKPLLTSEQT
FT                   RSKPVAQGLDLADRPKIILAAGRGKTGKTTFLRWIVEMAQRDGKAPLLADIDPTNATFS
FT                   TYFGGVARPDTFNQAAVRDWLQDFMEFAIAEKQTAIIDLGGGDTILRTIAAEMPGFDAM
FT                   IEEAGMAVVMFYLAGPHPEDLTPAATLGALGFKPRARAFVLNEGVAPPGQSRDQAFGRV
FT                   TSSNVYRDETTDGALTLWMPRLHAAEAVEARTASFVAARDGQTEPPLGVFNRSRVGHWL
FT                   KAMDEQFAGVKSWMP"
FT   CDS             complement(27366..28046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00330"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83113"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7P6"
FT                   /protein_id="BAJ83113.1"
FT                   /translation="MQRICCVFASYLLRIWRTLCCDSAVVVLRSIDVQRLKSVGFPMPA
FT                   PDLDIEKLSAAMASGLRRRSPLMVWFIEHHDEFAALLDKHGAHWKGLAEHFAAAGLVSR
FT                   TGQPLTPRTVENYWLRARRLVAKQRAEGRPVAAAPASTPAPEPRFKPVRLRNEGRGVSP
FT                   AERQALGDPTAPADQAAQPVPKFQRSWMRNEGRGVSAAERRALGDPTAPADPDDPKWSG
FT                   DKSR"
FT   CDS             28185..28523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00340"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83114"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7P7"
FT                   /protein_id="BAJ83114.1"
FT                   /translation="MPEPETAPMPPKDDRLDAVIQALRLMIETQNTHSQMLARLIELAT
FT                   PSEESPLEESLAEIAGALRDQTTALLQIGTTLDGLGAEVEAGVMRGLATALESGEEATQ
FT                   QEAGGETC"
FT   CDS             28517..33616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00350"
FT                   /product="TrwC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00350"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83115"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7P8"
FT                   /protein_id="BAJ83115.1"
FT                   /translation="MLTFRAGAASTSSGAAGKMADHLMTMTLPGFEQDMATYYQRGMMA
FT                   EGGLWQPGTEAAEDNAAATATDAARPGTIPEPRRDMHPAVAAALGIDTSRPLTRDEIAE
FT                   LLAGNRADGEKIAGKQYQRAVTPLAEVFGLDPMRLPTRAELENLLAGKRADGSDLPAAP
FT                   VEVLPSTRAQDAVPTAPEADETEDRDAALAAEAAALGELGHAPDGPPPWPDDFAPPPME
FT                   EAAAYDRDAALAADWQADVARGGEPAVPPRGPAAEERPAEPRAIDVAAALDAAGVPYRT
FT                   SGGRLRLQATWRGVDSWTVSVNATTGQWTDFAASEGGRFESLVRRLGVKAEAVELDPEA
FT                   AKAAREAEVRRNAFRKSIAGKVWDEAIPGAGELREPNLRGSVGQKLRQRAAHEARVEEA
FT                   EGMRAPVRAYLSGRGLDADWLMSQVRLVRPHPNYDSAEVAAGAAVVMLTPMFGQDEDGR
FT                   VRLTGVQRTYLTEGGAKIGRRMLGASGAWLLHPPAGAAVPIGGHEQARVAGEGFETVAS
FT                   VVQATRQAGVVGYNAGGLVAWAGQFTGSTPVALLADRDNARLHNGRDVGEAGQKAAAKA
FT                   AALIEANGGEAVYLEPPADVAGGAKGTDWADALRAGGAAGLRQALAVAEASSAADRARI
FT                   EAKLAPASPSAAPDGPSAQEAEQNQPAPHPELVRLYKALGAKDGNGLSETERANILDGK
FT                   RADGAALDAADWRNAVNRSKTPIGYVDFTFSADKTISLAWAFAPTEAERNQLAQAHKDA
FT                   VAATMAEIEQVIGQARKGKGGKEGTEQGRIGWITFDHYTARPTLEIARETADGRTETEI
FT                   VSVKVAGDPQLHTHVAVPNVIVTESGRVVSLNTLQMHGRIHEWGAIYQAHLAQNLRRAG
FT                   ASIELDRTTGAARLSAVPEEIRAAFSKRTRDALSDAKAYAASVGAEWDRMTGDERIKLL
FT                   KGGAFASRSAKADDMSDFASWRRQAEERGYQHKSVLQDAAPAETLTEAARLDRAYEAAA
FT                   RVLGEQFARRAVIKDEDERVAAARGLVAAGIKDGGDVDRVIARLRARGVVETGVSAGNG
FT                   EPARTQIIAVETVRDDPDNPDVKITTTRLTTRAHVEQESALVELAAQAGRDRRGTLNPA
FT                   QIKRGIAASGLSFTGEHGVAQRRMIDHLGMSGRFAVGIGAAGAGKTTLLKPLVAAWRDQ
FT                   GADIHGISLGWRQARELREAGLNTEAETGGRDTIAAVSVFINRVESGRLDLSNRSVVVI
FT                   DELGTIGTRQMLDLLRLQERHGFRMVAIGDPKQCQSIEAGQVIGLLEKGLGEVPSIESS
FT                   VRQTNERAREIAGLLRKGGAEAVGKALDMKRQDGTAEIVAGGHSEVIARAAALWDERRA
FT                   ANADRSRFTLSISTPTNQDARAIGEAIRQRLLASGELGQSCMTLAAIDKNTGEHYAMPI
FT                   ATGEKIRLFARTNAAMLDGGKGAIGDNGSILEITSIRDEGLVLRNDHGREGFVKWDTLA
FT                   DKETGRMRLAYGYAMTTNTAQGITTTEHIFVTPGGSQTTDGFKTYVSGSRHRERDYWLT
FT                   SEGAERQEIAGRRPLGDPRPIREHDIWTNWTRNIARQPEKTNALDLVKIGEEARRNAAR
FT                   AFLKGLAADEKREAAGLPSDLSQRFARTQARAGAQGSLTETMARAAEEKGQALARIERA
FT                   APAVRAAVAAGWERARPLIEAAHRSARARLQRALEGHRRQAQHQAEERPVEQESRKRGR
FT                   GR"
FT   CDS             complement(33848..36454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00360"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83116"
FT                   /db_xref="InterPro:IPR026866"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7P9"
FT                   /protein_id="BAJ83116.1"
FT                   /translation="MTTEAEALANILAWSADSPGWQRDALRRLATQAALESAEIDELAS
FT                   ICKGDNLAVPLEAGHLRGPNRDQGEVYLRQVHGVLHVNALAPDQRLTLHRVGLTIIYGD
FT                   NGSGKSGYARILKKVCRARMPGRAEEIAPDIYDAAPGTPSATIEYAISGQNRTCAWQLG
FT                   QAADNALSGISVFDSRTANVHVDDTNDVAYTPFPLKLLGALAQLCKSVKDKLAAEIAQI
FT                   KAQTPEAIRTPACSRDTAVGKLMARLTANTAPATVEALATLTQAEQDRLAQLTADLAGD
FT                   PARAARQLAAMKAKVDGHIARLDRLFASISDDSANNLRRLAVDSDAARRAAEAASSALF
FT                   RDEPLPQIGSEVWQALWASARAFSDAEAYPERRFPVTDHGSVCVLCQQELTPVAADRLN
FT                   RFEAFVRDDSQQRADAARVAYDRALATFKGEAVSLADLVNIVATVRDELRQDALAMEIR
FT                   GATLRALWRHRQIRRRHANPSAAIDVPVTEYSRQALVDQAAGIETRANALVAEAGSPAR
FT                   AAVLAEKAELVDRQWLGSIKADVLAEIERQKKIARLEAAQRDTATNRVTTKSTEIAQAL
FT                   VTDALRAQFAREVASFEIAGLAVELRQQNSVQGIPRFKVALTRKPTAAVGQVLSEGEHR
FT                   CVALAAFMAELATTENKSGIVFDDPVSSLDHMHREAVAKRLVAEAAHRQVIVFTHDLAF
FT                   LFELNRAADDAQPKPPVAISSISRGADKAGFCRSEPPFKARRVSDITTSLSNQLAGERY
FT                   HFEQGNLDEWRKSVKSIAATLRDTWEIAVEEVVGHVIRRLSNEVKTPGLVKLTAITVPD
FT                   CEAMRDGFGRCSELLHSAAAALNRPLPRPEALTAEIDALATWADSLRQRQGAARLP"
FT   CDS             complement(36451..36675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00370"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83117"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Q0"
FT                   /protein_id="BAJ83117.1"
FT                   /translation="MKPHDESEPFFITEDVAAELTAAGYEFVPPGHARTASIRDLFGWQ
FT                   PDETLSEAVSRHLEKADTDSGREPRGEGV"
FT   CDS             complement(36734..38902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00380"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83118"
FT                   /db_xref="GOA:F0J7Q1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Q1"
FT                   /protein_id="BAJ83118.1"
FT                   /translation="MNAVTDKIGLAPATAATALECDFPLVEISQIAEQESWRKEINRPI
FT                   YHIHKWWATRLGSVFRGITLGALSQPGTDTWAHFYKTHDLAGKVVLDPFMGSGTTLGEA
FT                   IKLGAKAIGCDINPVSTFLVRQAFTPAPEAQLRAAFKRLERDVAPEIRRYYQTRDPQTG
FT                   EVIPVLYCFWVKTVTTPEGEVIPLLSRYVFAQDAYPKKKPRAQIVCPGCWGVLEDRYDA
FT                   TDMHCQYCGHHFNPQEGPAAGQYVTTKGGQRYRIKELLPKDGTPPAHRMYAMMALRADG
FT                   TKVYLPVRAEDLALYEEAQGRLASETLPLPEISVRPGHNTDQARGYNYTHWRDFFNARQ
FT                   LLCLGLLLREILSIDDQAVQEQMLCLFSSTLEFNNLFCSFKGEGTGAVRHMFSNHILKP
FT                   ERTPLENSVWGTDKSSGTFSTLFESRLLRAKRYLDEPFEIAFEHDQDGNRAGSRKTVAS
FT                   HPIRARRVETWGELATADHGLLILNGDSSELPMPAGSVDAVVTDPPYFDFVHYSELSDF
FT                   FFAWLSPVLRGRYPWMAREDSSDQGEVQHKDPRVFARQLAAVFTEACRVLKDDGVLAFS
FT                   FHHSRAEGWAAIYEAISEAGLAVVAAHPVHAELRAASPKTAAKDPISLDAILVCRKKAF
FT                   ALHQSPAVQDVRQAVDALSSRLQAAGLRISAGDRFVIGAAQTLIARAADELGFDEIKVD
FT                   LEAIRLAVGPKAGDSDEPETAGAELATV"
FT   CDS             complement(38899..39717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00390"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83119"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Q2"
FT                   /protein_id="BAJ83119.1"
FT                   /translation="MTKKTTAFDVFEKCVQAVQAGELIESVSAKDKEFHFQNWFQKRLQ
FT                   SLSMHFEGSGRNTYPDFCLVEHTEGYEIKGLAWPGRERDYDSNSQVPTGYHNGRQIFYV
FT                   FGRYPADLSGYADQGNGRKQYPVVDLVVCHGDFLNADHNYVHKNKSVKGFGTYGDIMIR
FT                   DRKMYVAPTPFALTEGTTGLMTLILPEDFGADDRYQMVGNLTRVEAETLVVGYNFDLRT
FT                   NELSAERVPNPKAGTQHRFVAYRLKGQASKLVSMTGTPVQPDENNFADEE"
FT   CDS             complement(39714..40301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00400"
FT                   /product="putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00400"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83120"
FT                   /db_xref="GOA:F0J7Q3"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Q3"
FT                   /protein_id="BAJ83120.1"
FT                   /translation="MNQRIGYARVSTDDQHLDLQRDALTQAGCSVIYEEAASGKNATRP
FT                   ELEQCRKALRAGDTLVVWRLDRLGRSLPDLVQIVADLEQQGVGFESLAEKIETSSAAGK
FT                   LIFHVFAALAEFERGLIRERTQAGLAAARARGRTGGRKPKLDAKQIRQIKVLLRDPNTS
FT                   VAEVARDYGVSRTTIYKYCGVVRPSEFIEGTT"
FT   CDS             complement(40569..41243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00410"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83121"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Q4"
FT                   /protein_id="BAJ83121.1"
FT                   /translation="MCGRFASVQPPDAMRALFRTTNPLPDIAQPSWNIAPSQPALAVRR
FT                   HPETGARHLDLLLWGLVPHWTKDLKAARRPINARAETIASSPMFGSAFVTRRCLVPVDA
FT                   WYEWQVTPEGKQPFAFARPDRETMAFAGLWESWMTPGMAKVLRTFAIITTTANATAAPV
FT                   HDRMPVIVQREDWPVWLGEAAGNAAELLHHAPAGLVETWPVGRGVNSPRNNGPELLAPA
FT                   KE"
FT   CDS             41317..41694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="umuD"
FT                   /locus_tag="ACMV_P2_00420"
FT                   /product="UmuD protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00420"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83122"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Q5"
FT                   /protein_id="BAJ83122.1"
FT                   /translation="MVGYNGGNTTGFVSPAGDGLEGPIDLAAILDLRQPSRYPVRVMGD
FT                   ALAGRGILSGDILIADAAKPPAAGQVAVVMLAGDVLVAQLAYRRGHWWLLSGRPDTAPL
FT                   AVEGDDAEIWAVVTGLVRTKV"
FT   CDS             41697..42953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="umuC"
FT                   /locus_tag="ACMV_P2_00430"
FT                   /product="UmuC protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00430"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83123"
FT                   /db_xref="GOA:F0J7Q6"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Q6"
FT                   /protein_id="BAJ83123.1"
FT                   /translation="MPTFALIDGNSFYCSAEQAFAPELRAKPLVVLSNNDGCAIARSPE
FT                   AKALGVKMGEPWHLFRKRPGSQAVAWRSSNYALYGDMSRRVYDVLTERVPAVEPYSIDE
FT                   MFLDLTGIADLDRFCRDLRRDVRQLAKIPTCIGIGPTKTLAKLANRIAKNTPALGGVCD
FT                   LQCPADRAAYFTMLPVADVWGIGNRAAAKLAGAGIETIADFVSHDPQAVRDLLTVTGAR
FT                   VHAELRGVSCLPLSLMAPTRQGIAVTRTFGSLIETWPGLREALTSYTARAAEKLRAEGL
FT                   EAGQIAVFAHTNPHNGDPWYSAQRAAEIEPTADTGALIGEAVRLLRAVWRPGFRYFKAG
FT                   VMLNDLTPAGQQPMLFATRDKVKSAAAMAAMDAVNARFGRETMRMASTGTARPWRARQQ
FT                   QLSPRYTTRADEILIGRAF"
FT   CDS             complement(42971..45007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /locus_tag="ACMV_P2_00440"
FT                   /product="putative conjugal transfer protein TraG"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00440"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83124"
FT                   /db_xref="GOA:F0J7Q7"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Q7"
FT                   /protein_id="BAJ83124.1"
FT                   /translation="MAIYRCEIKNISRGQGRSCVAAAAYRHRTSLHDQRQELDHAYTHK
FT                   GDVELSEIVAPENAPEWVHDRERLWNAADAAEKRKDARTAKEVLVALPRELNTAEQAGL
FT                   VREFARAEFASKGLVADIAIHAPKAQDGETQPHAHIMLTTRPLENGSFAKGKDYSLDKP
FT                   PGIEAIRDAPIRAPTDNHGHARWMTMEEARARFPGPTPEYGGLVVGEAYEVHRDSVASM
FT                   PFRPKDRASWGQGGKAPLLIDPCEIGSTHCMMFAGSGGYKTTTAISTLLTWTGSAIVLD
FT                   PSVELGPMLRQAREAMGHKVYMLDPRTAREVGFNVLDWIDVSSLLAEIDVQAVVEWVCG
FT                   DTKQGGDENASFFKNSGKELVTALLAHMLWDERLEPHEKTLRAVRAAIVTPEKELRNIL
FT                   AHIHKNSQSRLARDLAGSLKDIVDETFSGIYKNATQDTAWLSTAAYADLVSGNTFRCAE
FT                   LTLGKATVFINIPLKALDATPAVARVITGALLNAAYEADGAIEGRVLFLLDEAARLGPM
FT                   KILETARDCARKYKITLFPFYQSIGQLRELFGQDGPAKWFESVSWYGFAGVKTKAVAEE
FT                   LAAAIGEYGVLAWSEGSNTGNSAKGLEAGTRSTGQTKTYHELKRQLIRAEEIMHDMRDD
FT                   EQIIFPKSGRPLRCGRAIYFRRPEMAVRVGENRFAGKAIKAAE"
FT   CDS             45201..45530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00450"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83125"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Q8"
FT                   /protein_id="BAJ83125.1"
FT                   /translation="MAKRTDDEILADLTAKQREIEMRINAVKARSKERARKEETRRKVL
FT                   VGAVILAEAERSEAAKQRLQALLDKHLVRPVDREVFGLPPRPDRPGQVGVSGDGTLSPD
FT                   GDDSP"
FT   CDS             45624..46163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00460"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83126"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7Q9"
FT                   /protein_id="BAJ83126.1"
FT                   /translation="MAKNSRDGNRERAARRRAALAERGIKQVLLMAPEQAHPLLKQAAS
FT                   LMIRDDDPLEPRAALRRAGGANEPAPDEVSPDLAVELEAAKARIVEVERQAEARLAIVI
FT                   EASERRRRALEVEQERVRASAEEAQKAAKSAQEAEERVTAAQRRAEKAEAAIRQAKALP
FT                   GIKGRLVRFLAGDVLK"
FT   CDS             complement(46721..46885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00470"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83127"
FT                   /db_xref="GOA:F0J7R0"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7R0"
FT                   /protein_id="BAJ83127.1"
FT                   /translation="MVPLRQRLIRAVDCISSKSVIFYDRPIASFAVVMISAIVVMDIAL
FT                   YLHGHYRAL"
FT   CDS             complement(47281..47724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00480"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83128"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7R1"
FT                   /protein_id="BAJ83128.1"
FT                   /translation="MSNSTLYDRDFYAWANEQAALLRAGRLSEADIQHVAEEIETMGKT
FT                   EKRELVSRLKVLLMHLLKWQFQPGGRSTSWRLTIAEQRREVVDHLADNPSLKAKLPEAM
FT                   ESAYGGAILAAARETNLDLITFPSACPWSFEQVMDAEFWPGEG"
FT   CDS             complement(47721..48302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00490"
FT                   /product="putative replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00490"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83129"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7R2"
FT                   /protein_id="BAJ83129.1"
FT                   /translation="MTGLTAPPDIIGTPVKLKPGQWVQTERKAHEAWANLIARKPRAAM
FT                   LLHHLVAQMGHQNAVVIGQKTLAKIMGTHERTVRRAVADLVEERWIQIVRIGSGKEAAY
FT                   VVNDRVAWGQPRDQLRLSTFSATVVADLEDQDTTSLDYADLRRIPTLFPGERQMPIGDG
FT                   EPPPSQPSLDGLEPDLPTRQPHAFRVENAK"
FT   CDS             complement(48488..48703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00500"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83130"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7R3"
FT                   /protein_id="BAJ83130.1"
FT                   /translation="MIKSHRDLPHLVFPHLLPGFAASRARARVLPVAPVGPQGSSGRSL
FT                   RLPSGGLRPSFPVDYRDDKNEGEPQS"
FT   CDS             complement(48980..49543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00510"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83131"
FT                   /db_xref="GOA:F0J7R4"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7R4"
FT                   /protein_id="BAJ83131.1"
FT                   /translation="MATGNPIVDALDALAGEVARCTEAVKAANPDALTRSVDQAATKAV
FT                   TSINTALDGASDAVTEIKKAASDTAQAAAGVVQQVAEVRTATRWLSLRSVAVLALAVLL
FT                   VVSGSIASIWWERHEFHRLHTRVIALHAEIQTAQANLKALKAKGARVEWNTCGGHLCFE
FT                   ASSDQHGGWYTTKGHIKLVIPRGY"
FT   CDS             49542..50156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00520"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83132"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7R5"
FT                   /protein_id="BAJ83132.1"
FT                   /translation="MLHLDPPAAFPAPVRCALLLALLVLVLAGFEDFLGGSDVQHLGGA
FT                   LHVRGGGCGDQGGGQGQSLSEHAGEAGEAFAHGLHEVCAGLADLFPGAAHGAEQAAILP
FT                   DLHGVPEGVSPRAASLACHLHGDGADLGFRGAVQFHGSGGCPDAVGFGLGGVLCGCEGG
FT                   LALIGEGAVIDPFEASGALEGAIAVGGPLLGSPHDLFKIVR"
FT   repeat_region   complement(50120..53907)
FT                   /note="Belongs to Tn3 family"
FT   repeat_region   complement(50120..50159)
FT                   /rpt_type=INVERTED
FT                   /note="perfect 40 bp inverted repeat"
FT   CDS             complement(50153..53119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00530"
FT                   /product="putative Tn3 family transposase for insertion
FT                   sequence element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00530"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83133"
FT                   /db_xref="GOA:F0J7K1"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7K1"
FT                   /protein_id="BAJ83133.1"
FT                   /translation="MPLRVLLSAEQRARLFSIPTDMASMSRHYVLDAADLAMVRVRRRA
FT                   SNRLGFAVQLCVLRFPGRTLDPSEYPPAPALAFVAEQIGVDPLLFAEYARRAETRREHL
FT                   VELQKFTGLRSFGLDDWRACLHAGADTAWATDRGEPIIQAMLVHLRESRVLLPSATVLE
FT                   RIGLAARVRARKKTFEVLAAGMADAERSALTELLTVDPELRRSRFAWLRDYSESPAPSN
FT                   IVSLLDRLEYVRAMGIDPARAGRIHAARLVRLTDEGALMTVQHIADLEPARRTAILIAQ
FT                   IASLETRLTDATLAMFEKYVGTLFSRARNRDERRFQATRRDVAKALLLFRRTIAALRQA
FT                   KEAGEDGITAIEREIGMNQLEDVLPIIGAVADVADQDILVTAAERYTVLRRFSPRFLAA
FT                   FDFRSNMPNDPVLAAIELLRALNRGAIRSLPKRPPSTFLPPQWRKLIFAGGTADRRLYE
FT                   TAVLAVLRDKLRGSNIWVAGSRDYQAFETYLLPAGAGAATGIDGEADPDRYVASRAEML
FT                   RERLTFVAARAAQGDLDGVEIEDGKLFIARTPPTVPDAARDLALRLNSMLPRVRITEVL
FT                   SEVDAWTGFTDRFVHLRTGNPVTDKAALLAAVLADGTNLGLARMADASRGLSYHHLVNV
FT                   AQWHISDDNYVAARAAIINAHHAHPMAAIWDDGTSSSSDGQYFRAAGRAGAGGSVNAKY
FT                   GIEPGAVIYTHVSGQYGPFHTRVISATMSEAPYVLDGLLHHVHQTDLRIAEHYTDTAGA
FT                   TDHVFGLCHLLGYRFAPRIKDLRDRKLYTIEKPGTWPLLVPLIGDAVETTAILGQWPEL
FT                   MRLKASINAGTVLPSVILRKLAAAGGGNTLSRALRAVGRIERTLFTLQWLSDPALRQRS
FT                   HAGLNKGEASNALRRAVFFHRQGEIRDRTFENQSFRASGLSLITAAIVHWNTIYLDQAV
FT                   QHLRAQGTAVPDDLLAHVAPLGWEHIALTGDYVWNPANPNASFRPLRDVRAPFIPRAA"
FT   CDS             53293..53874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00540"
FT                   /product="putative resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00540"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83134"
FT                   /db_xref="GOA:F0J7K2"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7K2"
FT                   /protein_id="BAJ83134.1"
FT                   /translation="MAHTLIGYARCSTDRQDLAAQRAELEQLGVKPDRIYTDHGLTGTN
FT                   RARPGLAQALAAVRKGDTLVVPKLDRLARSVPDARAIADELITRGVKLALGAAVYDPTD
FT                   PMGKMFFNILATFAEFEADLIRLRTREGMAIARAKGKLRGKRPTLSERQQKELRRMYDT
FT                   GNYSITDLADLFSVSRPTIYRTLARQPANA"
FT   repeat_region   complement(53868..53907)
FT                   /rpt_type=INVERTED
FT                   /note="perfect 40 bp inverted repeat"
FT   CDS             complement(54216..55283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB11"
FT                   /locus_tag="ACMV_P2_00550"
FT                   /product="type IV secretion system VirB11"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00550"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83135"
FT                   /db_xref="GOA:F0J7R8"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7R8"
FT                   /protein_id="BAJ83135.1"
FT                   /translation="MNDTEFSDDLVAESPAAPLLRFLLAPLQPWLNDGATEELCINRPG
FT                   ECWVRQRGVFERYKMPLDRSALEDIAVLAGALRRQDVGPTSPLCSTELPGGERLQVCLP
FT                   PAVPTGTVSLTIRRPGSTVAPLSSVTSRYQSEGWNTWAQNRETRNFAEALEYYDSGDLE
FT                   GFLAAAVRCRMTILLCGATGSGKTTMSKTLISAIPMAERIITIEDTAELVIPQPNHVRL
FT                   LYSKDGLSTAKIDAEALLQASLRMRPNRVLLQELRDDAAWTYVNEVVSGHPGSITTIHG
FT                   ANPAQAFKKLFSLIKGSPKGAGFDDATLCDLLAAAVDLIIPFETSGSTYRIGKVWFGPD
FT                   AARRGETAAALLRAA"
FT   CDS             complement(55280..55600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00560"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83136"
FT                   /db_xref="GOA:F0J7R9"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7R9"
FT                   /protein_id="BAJ83136.1"
FT                   /translation="MRESWRTRLDRLAQAGQRLNQKIEKAAVKYIQWQDRRHARRRQKF
FT                   LRQGWLYSTLLGLWLVLIILELLGHQSAAVIHSSAGLGLIFLALKIWHTAMVIRAKKRG
FT                   EL"
FT   CDS             complement(55597..56733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB10"
FT                   /locus_tag="ACMV_P2_00570"
FT                   /product="type IV secretion system VirB10"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00570"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83137"
FT                   /db_xref="GOA:F0J7S0"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7S0"
FT                   /protein_id="BAJ83137.1"
FT                   /translation="MANEDKRDRPYGPISHDNAAPSPVEQEQSAVASRQRLTGRQIGGI
FT                   ALACALGAGVVLVVTQLTTHHEPKPAKQAAVTGGTEGRPFVNNASGGTAPASKPAALPL
FT                   PSKQNTGFHNPFLNNQQESPAMKALKAPIMAFNQTGGGVSAQPASNTVGQNGAPTAGPV
FT                   KPTAFASKLNADQFSAADATMIAHPNFTIAAGTIIPCTLQTAINSTLPGFVKCVLPQPV
FT                   RSMNGTVTLLDKGTQVLGEVREGLVQGQDRLFILWDRAVTPQNVAIQLASPAADPLGRA
FT                   GVSGAVNNHFLERFGAAIMMTIIGGSMQVAANAAQNSAGNTYLEYMNSSTNQIANTTLQ
FT                   HTIDIPPTLTKHQGENVSIFVARDLNFSKVYKLSVVSP"
FT   CDS             complement(56723..57613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB9"
FT                   /locus_tag="ACMV_P2_00580"
FT                   /product="type IV secretion system VirB9"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00580"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83138"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7S1"
FT                   /protein_id="BAJ83138.1"
FT                   /translation="MKCSRKLATGGLIWLGMMGTAFAVQYPQPGHEDARVRYVPYQSGN
FT                   VTDIWTAPGAALTVQFGTGEKVVSVAESDSAYLKVVPVQNYLFIKPTGILPAQPIAVLC
FT                   KTADGKLRHYFFQFETVNKQLGAGENVDYAVVFTYPHQAYERQLAKRKAAEAKAVQQEA
FT                   KNRLDEARAVMNAATVDRYQGPRNYEYVARGDHQLAPAEVWDNGYSTVFTFPAMQRIPA
FT                   IFYVQPDGKEATANYSVNGDTVVVPGTAPEWRLRDGHTVLDIYDLKYNPTGATPGTHTI
FT                   SPDVAREMRTFNDGK"
FT   CDS             complement(57610..58311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB8"
FT                   /locus_tag="ACMV_P2_00590"
FT                   /product="type IV secretion system VirB8"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00590"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83139"
FT                   /db_xref="GOA:F0J7S2"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7S2"
FT                   /protein_id="BAJ83139.1"
FT                   /translation="MNADMKSTALPIDNERLASYFQDVESFQASEKRTARRWGRVGWVV
FT                   AGVSLAVNVTLAGAIVMILPLEKLVPAFITVKSDGTTSTTMNFNSLPSNEKAAMTRAAI
FT                   WQYVRARESYDFADAQYRYDVASLMSNPTVQSTYQSWFLDKGPGSTSPQVTVGKKGQIS
FT                   VEMVSLSMVRPNVALVRFRRTVTMYGSDPQTSTWTATVGFENVATLPVSARLADPSGLI
FT                   VTNYQALKDSP"
FT   CDS             complement(58308..58490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00600"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83140"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7S3"
FT                   /protein_id="BAJ83140.1"
FT                   /translation="MKGSRMLSRLIILMCAAGLLAGCAASDPLAKAHGPMFALNPGHWS
FT                   PSSAQLAQPPQVPRT"
FT   CDS             complement(58490..59377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB6"
FT                   /locus_tag="ACMV_P2_00610"
FT                   /product="type IV secretion system VirB6"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00610"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83141"
FT                   /db_xref="GOA:F0J7S4"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7S4"
FT                   /protein_id="BAJ83141.1"
FT                   /translation="MSVPNTTINIFEFMYSQYSTGFLQSLNSDVGSALSAALPPLSAAL
FT                   VIWVIILGYLMMTGSLDIRYGISKVSTMAIVVGIIASTSLYDSYVQTLFMKSLPSFIAS
FT                   TFSSGNTSNIPQSLDQTFNNFWVAGQIIYKKANCATCVLEPYVLGIEIELVLVVFFIAL
FT                   ALVFAVYLIATTLTGLLVAIGPFLLIGYLFEATKGIPERWLGKLIGLAILLLLITALLS
FT                   LFTGGMTDFLNTKVSTTFVADPVQTEIIILGEIAAYTAITAFITIMLPGIAAYIGGGVD
FT                   FNISGIVNPANWFK"
FT   CDS             complement(59377..59610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00620"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83142"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7S5"
FT                   /protein_id="BAJ83142.1"
FT                   /translation="MKLIIAALIGAGVIAGGGAYYVYVIAPPSVQDKLVPMPNGGRETN
FT                   SQLDASIRASCLAAGKNAVPACKPYLDGKTSN"
FT   CDS             complement(59607..60365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB5"
FT                   /locus_tag="ACMV_P2_00630"
FT                   /product="type IV secretion system VirB5"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00630"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83143"
FT                   /db_xref="InterPro:IPR014158"
FT                   /db_xref="InterPro:IPR023220"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7S6"
FT                   /protein_id="BAJ83143.1"
FT                   /translation="MLKPARLLGIAFAIATLGFASPALAQVPVIDSASLAQLISQLNEA
FT                   KQQYSELVSQYDELKSTYNALSQDVNPNQWAQQLDQSAMQDTVPNTSILPDMLDGISPP
FT                   SSLSGNVGSLAQQYYNMNKVYIPTGSDFGSTQMQQGANETANFEAIATQNLQSLEAREQ
FT                   ELPQIQSQLNSAKTIQQVASIQARLSAEQNYVQAQQAQAQNLQLLAFEENRAGQEAAAQ
FT                   ENAQGGEQTLSTLCSDAQTLGGEPSACQGQ"
FT   CDS             complement(60375..62768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB4"
FT                   /locus_tag="ACMV_P2_00640"
FT                   /product="type IV secretion system VirB4"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00640"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83144"
FT                   /db_xref="GOA:F0J7S7"
FT                   /db_xref="InterPro:IPR004346"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7S7"
FT                   /protein_id="BAJ83144.1"
FT                   /translation="MPGNQIRAERSAERYLPYLGHVRPDILLMDDGSVLAMAEIPGAPY
FT                   ELAADADRAASLVTVNALCKNVADDNVTLHSAFVRGPGAGQLAHALMPNEFAASLDRAY
FT                   RERVLTGRLYQNTWYLTVIVSPRNPLGGKAGGATGSLFGGKRERQKPHATAEGIRQLEE
FT                   IWQTISQTLAPYDVRRLGLRPAANGQFYFSEIAEALRLILTGTAAPVPLVSGPLGAALY
FT                   TDRAIFGRRAFELRGPGVSRFGAIFGYREYPSETYAGMYDGVFSLPCPVVMVHTFDFHA
FT                   RHTSEKRLGLKSAQMTAANDKAKSQINDLADAQDHLASGKIAMGEHHFSLTVYADTIEE
FT                   LDRLSGLTRTVIANSGGVVAQESAGLEAAYFAQLPGNRKWRTRPGTITTRNFAAFSGFE
FT                   AFPRGQRAGKWGPAMARFRTTAGTAYDYVPHVEDVGMTAIFGKIGQGKTTFMLFLLALF
FT                   PQYFAARNGAVVFFDKDRGGELLCRAVGGRYLVVRAGRDSGLAPLKALDNTPESVAFLV
FT                   QWLTALIQQDGHGPLPPEDDARLTRGVQALLRLAPEMRSLAGLRQFLDWRNPMGAGARL
FT                   ERWCKGGSLGWAFDGEHDDVSLDATTVGFDLTAILDNGTVCAPAANYLLYRISQALDGR
FT                   RFVLSCDEFNFYLLNPLFAKIWADFMLTVRKSNAVVLLATQEPAPVLDSPQGDSILRQC
FT                   QTLVFCPTPGAEENLYRKRLNFTAGEFRAIAEDMLPNSRQLLIKRHGGSAIIDFDLSAL
FT                   PEFVAILSSRKSSVGFVERLRATHGDDPTAWLPEFMARFREEVE"
FT   CDS             complement(62758..63090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB3"
FT                   /locus_tag="ACMV_P2_00650"
FT                   /product="type IV secretion system VirB3"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00650"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83145"
FT                   /db_xref="GOA:F0J7S8"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7S8"
FT                   /protein_id="BAJ83145.1"
FT                   /translation="MSERQRDPLFVAATRPALFLGLPIEMAVAIIMIGAMIVIFGHNPF
FT                   YLTLVLPLWFGARWLVRYDYNAPRVAWLWFRTKATGAGENQAWGGASPAPFPMKVQKGR
FT                   GMRDAG"
FT   CDS             complement(63094..63459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB2"
FT                   /locus_tag="ACMV_P2_00660"
FT                   /product="type IV secretion system VirB2"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00660"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83146"
FT                   /db_xref="GOA:F0J7S9"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7S9"
FT                   /protein_id="BAJ83146.1"
FT                   /translation="MKQRLTKLRAGVANIAAGTASKMGRGSWLQPAVIVAASLLLPAVA
FT                   HAQVVSGGTSPTTIIDNIATFILGPFGEGVAVLAVAAVGFMCWTGRVGFHAIGWLAAGL
FT                   VLVFGSSYLVTTFVGGG"
FT   CDS             complement(63440..64144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB1"
FT                   /locus_tag="ACMV_P2_00670"
FT                   /product="type IV secretion system VirB1"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00670"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83147"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7T0"
FT                   /protein_id="BAJ83147.1"
FT                   /translation="MLIAPAIFLALANRCAPEVAPGTLAAVASTESGFNILAIHDNTTR
FT                   QSIRPLDAPGAIALAKRLIAAGHSVDLGLMQIDSANLTHLGLTVSTAFDACASVRAGGK
FT                   LLAQDYKQPNGQGRQAALLAALSRYNTGSAWQGFQNGYVNRVVSTARYVVPEIDSADSV
FT                   QAPKASASRQASPSSASSPPRSPSWDVFPNSIGPAGFAAAHAVTLQASRASGPSGPAQP
FT                   SKQETHGETKAH"
FT   CDS             64314..64625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00680"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83148"
FT                   /db_xref="GOA:F0J7T1"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7T1"
FT                   /protein_id="BAJ83148.1"
FT                   /translation="MDAERVVVRLPTPAVKAIPSLLADHEDRSDFMREAAELEIAIRSL
FT                   DVYPELLGYLTANESLADFCARAVRQAAQRRIKMLKENIAEDEPKSPGQASGPGGASR"
FT   CDS             complement(64727..65131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P2_00690"
FT                   /product="Xre family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P2_00690"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83149"
FT                   /db_xref="GOA:F0J7T2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7T2"
FT                   /protein_id="BAJ83149.1"
FT                   /translation="MGKTEHPATKPVSSPNKRTSELSAIDGRVLKAPERFVFGANVRAG
FT                   RNALGLSLTQMANLIDADRAYIGKVEHGKINVSIDRMSSIAELFRVHLYELLQPEFALS
FT                   YKNIRFQDSQNITTKQTTAPAKGRRRSKDE"
XX
SQ   Sequence 65564 BP; 12737 A; 19664 C; 20934 G; 12229 T; 0 other;
     gtgccggttt caccccctac cgggcgggtt tcacccaaac ccgtaggagt ttccatgcaa        60
     ctgccccacc aggcagagcg ggggcgcatg ccccctcccc tgccctcacg tccgaccggc       120
     ttgcgccgtt taacacccgc catgctgccc acagcccgcc ttgctgatgg atttgccggg       180
     ggtgacatca ctcccggcca ggctctggcc gcgttcaagg ctgctgcgcc gtttctcgga       240
     atcgggccgc gtgtcgccca ggcgattgac tggcttttcc gattcacgca gccgcaggat       300
     tggcagccag gcgcaaggcc cattgtttgg ccgagtgcgg cgatgatgtc ggccgagctg       360
     gggatcactg agacgcagac aaagcgcctc aaccgccatt tggctgagct cagattgatt       420
     gtcatgcgag acagccccaa cggcaaacgc tacggccata gagatcggtc tgggcggatt       480
     atcgaggcgt atggctttga cctctcccct atcgcacagc gtatcgagga gtttcgtgct       540
     ttggcagaag ccggccgcga ggaacgcgcc gctgtagcca agttgcgccg gcgcgcttcg       600
     atcgcccgtg caagcttgcg gcagacgtgg gagacatttc gggagcagga aattgatctg       660
     cccgcgcccc tcagaacggc cgctcaggcc gcaagccgtg ggctcaaaga tttggagagc       720
     agccagaggc tcaagccagc cgtggaggct ctggaagcga tcgcggttga tgcgcgccgg       780
     gcgctagaga tgacccttgc tggcgcttct ctggagcaaa caagcatttc tgaatctgtg       840
     gaaatgtgcc ccaaggggca cgctgatgtg ccccacatta caactacaaa ccaacgcctt       900
     aatcctaaaa aggatactgt aatcgccttg aaggaatgta gtcgcggcga cctgccgggt       960
     agaacggcac agacgaagcc gcctgctagg ccggaaaggc aggatcgggg cacttcactg      1020
     aaattgaccc cagacgagtt ggtccgcttg gcgcccagat tggtgccgta tctgcgacag      1080
     ccctccccca gctggccgga aatcgtggat gcggcagatt ggttgcggca tgaccttggc      1140
     gtgtctaagc ccctttgggg cgaggcgtgt ctggccatgg gccgagaaca agcggctatc      1200
     gctcttgccc tggtttcagc taaaccagag ggatatttca ggtcgagccc tggcggatat      1260
     tttcatggga tggtcgagcg tgcccgcgac ggcggcttgc atttggatcg tacgatctgg      1320
     gggctacgtg gcgccagtgc ccataaaagc taggcttttc cagcattttt catggataca      1380
     taattgcatg tttacatgta atcgtgttta cgttttgggg ctgtgagcgt gtgtcacctc      1440
     acgccgcttc catcacccgc aactcaacat gcaaaccagc tgcgaccgcc atgttgacca      1500
     aggtatccag gccaaagagg ttaatcttgc cgcgcagcag atcggaaatg cgaggttgcg      1560
     tgacgccgaa aagcttggcg gcttggctct ggctcaatcc ttcacgggtg atccgctctt      1620
     tgagcgccat aatcaacgct gaacgaagct tcatattttc ggcctcggcc ggggtgtcct      1680
     cgatcgcgtc ccatacgctt gaaaagcgtt cgttgctcat gagtttagct ccttcactag      1740
     atcccgatat cgctttgtcg ctaattctaa gtccggttta ctggttgcct gggttttctt      1800
     ttgaaagcag tgcaggacgt aaatcgtgtc tgcgaacttg gcgacataaa tcacacggaa      1860
     tgcacctgcc tcatcccgaa tcctaatttc tcgaacgcct tgcccgatcg ttcgcattgg      1920
     cttccagtcg tcagggtcac gaccttgttg cacttgatcc agttggtgcc cggcttcgcg      1980
     gcgggcggac atcggaaagt ctcgtagatc atcgagggcg gagcccctga accgattagc      2040
     tttgaacgct cgggcatagg agggttatac aaaaaattgt atacttctgc aacatgctca      2100
     atggcggtgt gtagcacgtt gccttacatg aaatcatgta aacatggtta taatattcca      2160
     tgtcatcatg aaattatgct tgcacgtcca gtgatcgtat gggcataaag aaatgcctgc      2220
     atgcttagat atcagcatgg aagcaggttt tcatgaaagg gtgtaaacat gcttgcagtt      2280
     gctttctgca cccaaaaggg cggcaccgga aaaacgacga ttgccaccgc tcttgcggtt      2340
     gctgcgcatc gtgctgggaa aaaggctgcc ttgctggacc tcgacccgca gaccaacgcc      2400
     gttgattggt ttgatcgccg tgagggagac gggccggatg tggcctcgat ccagccgggc      2460
     gcgatccgcc gatccctcga cgcctatcgc aaacttggga tggaatgggt gtttatcgat      2520
     acgccaggga aaatggatag cgcctctact gaggccgcca agcacgctga cattgtgctg      2580
     ataccgaccc aggcccagat tttcgcgatc gataccttag agccgttgaa gcgcttgctc      2640
     gacatggcgg ggagtccgcc ggcttttgtg gtgctcaatc tagttcatcc gaacgcggcc      2700
     ggccgagctg gtgaggacgc cgcagctatt gccgagcgtt tcaaggtgcc agttgcgccg      2760
     gtccacatgt cccgcctgaa agcttatgag gatgcgccag cgttagggca gtcaccccaa      2820
     gagtatgagc ccaagggaag ggcggcccgc gaaatttccg aattatttga gttccttacc      2880
     gctcaaggaa acatggttac aggtaagcgt gaaagcatga aagcatgagt cggaagccct      2940
     cactccttgc atctgccctc aagaccagcg agccggaaac caccgtgccg gtaggcaagg      3000
     caccaacgga accgaaggcc gcggccgtta cggcccctcg ggaacagcgt gcagaacacc      3060
     aaagcggggc ttatgtgccg ccatcgcggg ccaataagac cgcgaaaacc cactatttgc      3120
     ccccggccta ttgggacact ctggaagaaa tcagctttcg gacgcgcgac gagaagggca      3180
     agcgcgtgcc acaggagcga ttggttgccg aagccctcaa cctgcttttc gtgaaatata      3240
     attatccgca agttcgtgat gagtagtgca atcatactta cacgtcatca tgtaaacatg      3300
     gaagcatgat tgtttttctg gtcgagctgg tgagtggcat ggtggcgacc ggcgcggcag      3360
     cggccgcgat catcacgcac cccggcgacc aggccacaga gacccatgca cagcgcgctg      3420
     gtgcggccgg ggagaagcgt gtcgcgcgtg cgttggagcg ggcaggggtg cccgcgatcc      3480
     acgacatcac cttgcaggat cagcgcggca cgcatcagat cgatcatgtc gcggcggccg      3540
     gcgattgcct ctattgcctc gaaacaaaga cctggcgcgg cgagctgctg gggcgcgccg      3600
     atgcccagca ttggattcta aaaaagccgg atggcgccgc gcagagtgtc tataacccac      3660
     ttatgcaaaa cgagacccac cgcgacgtga tccgccgggt ggcacaagtg cccgtccggc      3720
     cgctggtcat cctggccggg catctgcggc ttgccggcgg gccagtgccg ggcatgattc      3780
     cgctcacgag tgcgatcatg gagatgacga gggcaggggc ggcctctggc cgcgccctgg      3840
     cggccttgga gagcctggcg aggttccggg ggcaatcgcg gcaggcagcc ctgtccgccg      3900
     cgcacagccg acgcatgagg cgacagaagc caacccgcac acgccagctt tggactctgg      3960
     ccgtaggggc ggcgctggtg tttcttattc tggcggtcga gcaggcaatt ttctcgtgaa      4020
     tatccttgct tttcgtaaga tatttagata ttcaaaaata gatattcgga tatcataggg      4080
     agcccatgcc gctttacatc cgcgatgatg cgactgccga gcttgtcgcc aaactggcga      4140
     aagagcgcgg cctaactaaa caggatgccg tgcggatcgc cgtgcaggcc gagcttgacc      4200
     ggacccacga cgcaaagccc ttgcgcgagc gcctgcgcga gtggcgcgaa gccaatccgc      4260
     tgccaccgcc aacaggcttg aaggcagaca aggcattttt cgatgatctg tcgggggagg      4320
     gggaatgatc ttcatcgatg cctcggccct gatcgccatg attgccggcg aggagggtgc      4380
     ggatatgttg gccgatcttc tggcccagga acgcacccgc ttggtttcgc cggttgccat      4440
     gtgggaggcc acagccgggc tttgccgccg cttcgggctt tcgatggatg gcgcccggca      4500
     aaaggtgagg agttttatga gtgccctcgg catcgaggtc atttctctcg gtgagcgtga      4560
     gtatgatctg gcgatccagg cttatgtcga tttcgggaag gggcggcatc cggccgcctt      4620
     gaacatgggc gattgctttg cctatggtgc cgccaaatcc taccgcgcgg cgctgctgtt      4680
     caaaggcgat gattttacca agacggatat tcgcaaagcc gggatgaata gttgaaatct      4740
     cttgaatttt acggcgtttt tccttaaatc ttaacattgg tggagaaagg acgcggcgcg      4800
     atggatcagc ttgtcagcag gatttcggaa gctgaaatga cgcggcgccg gcatgcgatt      4860
     gagcaggctc gcgcggcgaa tatccgccag ggctatgttc atgatccagt gcttgaggct      4920
     gcaaacgagc ggtttatccg gggcgagatc gacatggtcg agctggatcg cttgatgatc      4980
     gccgcgatcg aggccggacg ttaaggcgcc cggtttggct ttccggcatg gcggaagatc      5040
     gcgagccgca cggctacacc tatccgaaca cgtcagacga tcccgatcag attgatgttc      5100
     tacgcaacag atttggcttg cgaagccacg cggccctggc gcgggccgaa taccgcctga      5160
     ccaacaaccg cctggcagac ctggtgctcg gtgaaggccc gcgcggtgcc ttcgatgcgg      5220
     cgcacctgaa ggcgatccac cgatatctgt tttcccaggt ctatgaatgg gccgggcata      5280
     cgcgcaatga gcggccgatc gtggacggtg cgccggtgga gcctattggc ggcttctaca      5340
     agggcggcac cgcgttcctg cacggatcgc ggatcgagat ggggcttgag gaagccctgc      5400
     ggccgctccg cgacccggat ttgagcagaa gacccgcgac ggagtgtcag ataacctcga      5460
     catcaacggg cggttggtgt gctttccgtt cgctgtagcg atcgaccaaa taggcccggc      5520
     gatcacgaag cagaagcgtg aaccgcagta attcctccat tacgtcaact acccggtcgt      5580
     aataggctga tgacagcatg cggccggctt cgtcgaattg ctcataggcg cgggcgacgc      5640
     tggattggtt gggaattacg aacatgcgca tccatcggcc gagcaggcgc agcgtgttca      5700
     ccgcattgaa gctttgcgaa ccgccggaca cctgcatgac ggcgagtgtc cggccctgtg      5760
     tcgggcgcac cgcaccgact tccagaggaa tccagtcgat ttggtttttc atgacgccgg      5820
     tgacggcgcc gtgctgctct gggctgcacc agacctgacc ctccgaccag attgataaat      5880
     tgcgcaattc ctgaaccttc ggatgatcga ccggcactgt gttggtgacc gggagctcac      5940
     gcgggtcata gatgcgggtt tcggctccca tcagatcaag cagccgagcg gcttccaggg      6000
     tcaggaaccg cgaataagag cgctcgcgca atgaaccata gagcagcaag atgcgcggct      6060
     tgtgggtggc gcgcgatgcc ggctcgagcc gtgaaaggtc gggaggtgcc agcatctccg      6120
     ggcgcagtgc gggaaattcg gcgggatcac ccatggccga ttgatcccac tactggcagc      6180
     caaagtgcaa gcgccgcgag tgtggcgagc aacacgggcg gcgtaatgag caggccgatc      6240
     cgcatatact gaccccaggt gatccgtgtg cccttctgcg ccagcacgtg cagccatagc      6300
     agggtggcga ggctgccgat cggggtgaat ttggggccga gatcgcagcc gatgacgttg      6360
     gcgtaaacca tggcgtcgtg gatgggcggg gcgacatggc cgaactggcc gatcgccagc      6420
     gcgccgacca gtacactcgg catgttgttc atgatagagg aaagggcggc cgccagaacg      6480
     ccggtgccca gcgaggcggc ccagatgccg tgggcggcaa aggccctgag cgcgctggag      6540
     atatagttgg tcaagccggc attgcgcagg ccatagacaa ccagatacat cccgagactg      6600
     aataccacga cctgccaggg cgccgagcgg agcacgcttc ggacctcgat gattggggca      6660
     ccgcggccag tgatgcgggc agccaaggcc agcaatacca cagcgccgac gatggtgacg      6720
     aacgataccg gtaagccgag tggggcggtg atgaaatagg cgcccagcaa caccagcagc      6780
     accggccagg cggcgcggaa caccaggggg tcgcggatcg ccgatctggg ggcgtcgagt      6840
     gccgcgacgg cataggtccg gttcgcggtg cggccgtaag tcacacccag gacggcaagg      6900
     gttgcgatca gtgcgacgat gtcaatcggc accatgacca tggcgtagcg atcgaagccg      6960
     atcttgaaga agttggcgct gacgatgttg accagattgg agattaccaa aggtaggctg      7020
     gtggtgtcgg cgacgaaacc ggttgcgatg acgaaagcga gggctacagt cgggggaaat      7080
     tcgaggctga ccagaatcgc catgacgatc ggggtgagca gcagggcagc gccgtcattg      7140
     gcgaaaaacg cagcgatcac ggcgccgagc aacacgatca gcggcagcag aatccggcca      7200
     cggccacgtc cccagcgcgc gacatgcaac gccgcccagc ggaacagccc ggcttcgtcg      7260
     agcaggagcg aaatgatgat cagcgccacg aacgtaaagg tcgcgttcca gacgatgtgc      7320
     cagacggtgg gaatgttgcg ccaatggatc accccgagcg cgagatcaag gatggcgccc      7380
     gccatcgcgc tccagccgat gccgaggccg cgcggctgcc atatgacgaa caccagggtt      7440
     gcgacgaaca ccgcaagagc gagcatggcg agcctcggaa actgggggat tagcggatgc      7500
     gccgaccggc gggatcgacc acggcttcac cgtcttcctt ggtgaaggcg gaacgttgcg      7560
     gagccggcag gatatcgagc acggtctcgg atggccgaca gagcttgacg cccagcggtg      7620
     tcaccacgat cggccgattg atcaggatcg gatgcgccat catcgcatcg agcagcgcgt      7680
     ggtcgggcag ggccggatcg gcaagaccga gttcggcata cggcgtgtcc ttttcgcgca      7740
     gcacgctgcg cacaggcatt gccgttctgg caatcagatc gatcagggtt tcgcgcgacg      7800
     gcggggtctt cagatattcg atgatagtcg gttcgatgcc ggcgttgcgg atcagggcga      7860
     gcacgttgcg cgacgtgccg caagcgaggt tgtggtagat cgtgacgctc atgccgccga      7920
     accctcatcg gcgttcgacc cgatccggcc gatctcctgc acgcggcgtc ggagcgaggc      7980
     ttgttccagt ttggcgaagg gcaggctggc gaacagtctg atacgggttt cgagcattct      8040
     gaacgctgtc cggaacgccg tcatgcgttc gaggtcggtt ccgcctacgg ccgccggatc      8100
     gggcacgccc caatgcgccg tcatcggttg tccgggccaa acagggcaca tctcgccagc      8160
     cgcatcgtca caaacagtga acacgaaatc catcaccggc gcaccgggag ctgcgaattc      8220
     gtcccaggat ttcgagcgca gtccttcgat cggcaaaccg gcttcttcga gcatcgccag      8280
     tgcaccggga tggacgtcgc ctttcggatg gctgccggcg gaaaagccgc gaaatttgcc      8340
     catgccccag cgctcgacca gtttttcggc cattatgctg cgggcggaat tgccggtgca      8400
     tagaaacagc acgttgagcg gctgattggt cacgccgatt tcgccttcga gcgcatcgct      8460
     tcctgcttcg ctgacggtag tgcgggatcg caggctgggc tgcagatgga taatccttgc      8520
     ccgcaacagt tctcgacgag aaatcctacc agcgtattca tcgccgcaaa atcggcggca      8580
     tagatgacgt ggcggctgac gcgccgctgg ctgatcagtc ccgcattgcg aagtgcctgg      8640
     acatggaagg tgaacgagga cggcaccaaa ccgatctttt cggcgatgtc tcccgctgca      8700
     atacccgcag ggccggcctc gacaaggatt cggtacgccg ccagtcgatg ttcatgggcg      8760
     agagcggcca gggctgcaac catccaggca ggatcttttt ttgggctccg tggcattctc      8820
     atttccataa ttatcgtaat gtcaccgatc tagcatcgtc ggctcaaatc cgtcaagtca      8880
     accgtgccaa ctgaaatgcg aaattttctt gacgattttt atataacgat tctattaatg      8940
     tcgtaatatc ataattcagg gagagaagct ggtgaaagtg tcacgtcgag actttgtccg      9000
     gacatccgcc gtagcgggcg tggtagcatc tcccttgatc gcaaaggcca acatggtgat      9060
     gccagatggc aaaccttggc cttcggtcaa agcaggcaac atcaaccagc tcagcccggg      9120
     caagcccgtt tcatttcaat accccgacgc gacatcaccc gcctggttgt tgaagctcgc      9180
     cgaaccggcc tacgaaggtg caggttcgtc gggtgatgtc gtcgcgttct cgggcatctg      9240
     cacgcatatg ggttgccctg tggcattcaa ggacggccgc ttcgtgtgcc cctgccattt      9300
     ttcgatgttc gacccagcac ggaacggcgt cccctatcaa ggattggcgt cggattatct      9360
     gccgcagatc gaactcagga ttgatagtgc gggtgacatt tacgccgagc gcatgtccgg      9420
     cctggtctgg ggccggacca gcgacgttgc ctgaacgaga aactccgaaa atcaaaggga      9480
     gacgactatg gccttgtatc gccgtgagga atccatcccg ctaccgccca aaaatgcgga      9540
     agcctataat actgcttgcc agtattgcac ggtcggctgc ggctacaagg tctatgtctg      9600
     gccggatggg ctcgccggtg ggctcaaagc aggcgacaat gctttcggga ttgatttctc      9660
     cggcccacaa ccaccgatcg tcggattttc ctatactgaa tcgatgcatt caacgatccg      9720
     caaacgcgac ggtcgaactt accacgtcgc gattgtacct acgcacgact cgccaattaa      9780
     ccctatgggc aaccattcga gccgcggcgc ggttaatgcc aaaacaacat ggtccgatag      9840
     ccggccgacc caggcgcggc tgcattaccc gctgctgcgc agcggcagcg aattcaacgc      9900
     gatcccgtgg gacgctgcca tcgagttgca ggcccgggtg atcaagggtg tcgccgacaa      9960
     gcatggtgcg gacgcacttt gctcgaaaat ctacgatcac ggcggtggtg gcggcggcat     10020
     ggagaacacc tacggcaccg gccggcttct gttcaccggc ctgcagatga agcatgtcgg     10080
     cattcataac cggccggggt acagttcgga aacctggggc acacgcgacc gtggcgtcca     10140
     tgagctcaat tattgctatg aggatgcaag gctcgcagat actattatgc tgtggggctc     10200
     aaacgcctac gtcaccgcga ccgtgttttt tgttgcgcac atgatgccca acctgcaagg     10260
     cgcaactacg gacgagaaga agcggcacta cgcaaaaggg gaggcgatca caccggcgcg     10320
     catggtgatc gtcgatccgc ggatctccgc aacggtcaat gcagcgcatg aaactggtgc     10380
     caaggtgctt cacctgcggc ccaatctggg cacggattac atgctgatga acgcggtagc     10440
     gcgtgtggtt tgggagaaaa agtactacaa caagaacttt ctgaaccagc ataccgacat     10500
     gacgagcttc gaggactaca agaaaaaatc cctcgaactg gatatcccct acaaggactt     10560
     catggcgcgt gcacagaaga tttccggcgt gccagtcgca cagatcgaac aagccgctgc     10620
     atggattgcg caacccaagc cgggcggcca tccgcgacgc agcctgatcc tatacgagaa     10680
     aggtgttatc tggaattatc gtcaatatga tgccgttgcc gcgatcgccc aacttggcgc     10740
     actcagcttc aatattggcc ggccgggtac cggcacggga cgagtcggcg ggcatcagga     10800
     aggttatgcg cggccggatt accccggccc gaaaccaccg ccggatgtcg ataagtatgt     10860
     ccaggacggc aatgggaaga ttttctggct gaccggctgc aacccgtatc tcgcggccca     10920
     aaacaatgcg tattttcgca agcggatcgg cgagcgggcg caggccctga ccgactatct     10980
     gtcagcgcag aagcagggcg atggcgagcc tgcttcgatt gagcacctcg ccgcccgtat     11040
     cctggaagga cttgacaaaa ccaacggttt gttcgtcacc gtgcagaata tttacatgat     11100
     cgaaagcgcg cgcgacgcac atcttatcct gcccgcggcg caatggggtg aagcggagaa     11160
     catctctctc aattgcggcg accgtctcat gcggctcgac gacaggttta tggacccgcc     11220
     gggcgacgcg aaacccgact gggaaatcca cggcctcgtc ggacagaagc tcgaagaact     11280
     ctacaaggcc gacggcaagg ccgacatcgc caggcgtttc gccggcatgg actggaaaca     11340
     cggcgcggat gtcgtcaaat cgatccagga tgacctctat gccggcatga acacgaaggt     11400
     tcccgcatcg cgtgctagca cgctcgatcc cgagagcttc aaaggcgttg attacgccta     11460
     tcttcgcaag attggccaga agggtatcca gacaccggtt cgaaccgatc caaacaccgg     11520
     cgaactggtc ggcacaaagc gcctttattc gaccttctat ttcatgacca aggacggcag     11580
     gttcagttgg tacggcacgc ggccctggga tgaccatgcc tccgctaagg tggtcgcagg     11640
     ctatctaaaa tcagatcgga ccaaatatcc gttctggttc actatgggtc gcgaccagcc     11700
     tctctggcag actagctatc atatgcgcca cttgcccgaa aaagcagaaa cgattccgct     11760
     tccgttcgtg caggtcaatc cggcggacgt taaaaagctc ggcgtcacca atggtgacat     11820
     tgtgatgatc tacaatgatc cttgcctatc cggttgttac ccacacccac taaatgtagg     11880
     gtgtgtccat tccccggaat aaagctcgtc aaaggttggt gcggctgccc tacccgcgat     11940
     tccgagcagc gagcggaacg cgttgaaggg atagaggcgc cggttgaacc gaaacgtgaa     12000
     ttcattgagg taggcttgta gatgtttggc gctgaccccg tgatggatgc cgttgatcca     12060
     ggtcttcagg ttggtaaaga ccaagtggac gatcggcagg aattcttctg ccacctccgg     12120
     gtcgccgcat tcggcgattg catggtggtc gaacccgcgc cttccgagac cggcatagcc     12180
     gctccagtcg tcggtaacga tcagcgatcc gggagcaacg gcgttttcga cgaatccgca     12240
     gagcgaattg gcgctacggt cggggacaac agcgagacga acgcgtcccg cgtagcgacc     12300
     gtctttccga ttgtcgagct tggttcccgg tttccggtgg cgcacctcca cggcacaggc     12360
     gacgagaacc ttgtgatgga caccccgtcc atcgcctcgg gttcgtcctc caacccacgt     12420
     ttcatccact tcgacgtgtt cttgcggcgt gtcgccaatc ttgtcgcgct cggggcgcac     12480
     catcccggcg cgcagcttat gaaggatgcc gaaggcggtc tcgtagcgcg acaggccgag     12540
     ttgccgctga aattggacgg ccgacattcc gggcgtctgg ctggcgatca agtaagccgc     12600
     ccagaaccaa gtcgacagcg gcgtgtgact gcgttccata acggtcccag ccatcaggct     12660
     tacgtctttg cgacaggccc ggcagcgcag aacgcccggg cgcgcctcga aacggaacgg     12720
     ctcgccaacg acgccgcacc ttgggcaggc gaaccctcca ttccagcggg cgctttcgag     12780
     ataggcggca caggccgcgt cgttcgggaa aatacgctgg aattccggca gagactgcgg     12840
     gaacggcagg tcttcacggg ccaggacatc catgcccaac actagatcta gtaggtatgg     12900
     gagtcaaccg gataggcaag caatgatcaa ggcaatgaga ccttcgccgt ctatgaaacc     12960
     gacgcggtgc cgccaggaac agtgtttgca ctaatgtacc attggctcgg cacctcaaac     13020
     agcctcacct cgccctacac tgacccgatg agcacaaatc cctggtataa aggaacgcgc     13080
     gtcggaatcc gaaaattatc cggtggcctt gcgagtgttg tggcaacgac aagttatcgg     13140
     caaaccaata cgtttacttg aatctcttgt gtcggcggca cttgaatata ggacagctga     13200
     tcttgcctgg agggcttcgt agagcgcaga tttacctgcc tggagtcttt tcttacggtc     13260
     agtcaggcca gaccttatga gtgcgtatgc ttcttggatg ttgatttccg ctgagatctg     13320
     acccggggat tccatcgaga tttgacccgc ccatagttta tgatttgagt ttcatgatgg     13380
     ggtcaaggct ggatttttct cctttcgttt ttgggatttc tgcacggagc tatttttgaa     13440
     cctgaagctg tcatttccgg tctcgaggat atggcagtgg tgggtgaggc gatcgaggag     13500
     cgcggtggtc atcttggcgt cgccgaagac ggcggaccat tcgctgaagc tcaggttggt     13560
     ggtgatgacg acgctggtgc gctcgtagag cttgctgagc agatggaaca gcaaagcgcc     13620
     gcctgaggcg ctgaagggca gatagccaag ctcatcgagg atgacgaggt cggcatggat     13680
     cagacggccg gcgatttgcc cagcctttcc ctgagccttt tcctgctcca gagcatttac     13740
     cagctcgacg gtggagaaga agcggacgcg ctttttgtga tgctcgacgg cctgcacgcc     13800
     gagcgcggtg gcgatgtggg ttttgcccgt gcccgggccg ccgacgagca cgacattgtc     13860
     ggcgggttcg atgaagtcgc aacgatgcaa ctggcggacc agggcctcat tgacctcgct     13920
     gctggcgaag tcgaagccgg ccaggtcgcg ataggccggg aagcgggcgg ccttgaactg     13980
     ataggccatg gagcggacct cgcgctcagc ggtctcggcc ttgagcaact gggagagcac     14040
     cgggatggcg gcttcaaagg ccggggcacc ctgctgggcc agttcatcga cggcctgtgc     14100
     catgccgtgc attttgaggc tgcgcagcat gatgacgagc gcgccggtgg cgggatcatg     14160
     acgcatggcg ggcctcctca gattggcgca agctatcgta gcgctcgacg tcagccttgg     14220
     gttcattggc caatgtcagt gcctgtggcg cggtgatgac cggaggcgga gcctgtttgc     14280
     cgtcgatcag ccggtggagc cggttgatga tatgcgtctt ggacggcacg ccgtcctcca     14340
     gcgccagttc caccgccacc aacaccgcct gctcgtcatg gtgcagcacc agggccagga     14400
     tctccaccat ctcccggtca ccgccaggac ggcgcaggag atgttgctgc agccgcttga     14460
     aggcatcggg caattccagg aacggcgcac cgttgcgcaa ggcgcccggc ttgcgctgga     14520
     tcaccgccag atagtggcgc cagtcataca aagtgcgccc tgggccgttg tgcgtccggt     14580
     cgatgatgcg cggatgctcg cagatgattt gcccctccgc cgccaccacc agcctgtcgg     14640
     gatagacccg caggctgacc ggccggttgg caaaagaggc cggcacgctg tagcggctgc     14700
     gctccaagtg gatcaggcag gtcgaggaga cccgcttggt gtgttccacg aagccatcga     14760
     acggacggcc cacaggcatg aggctctcaa cctcgctggc ccagacatcg gcaatggttc     14820
     ccggctcgtt gccatgcgcg gtctgctccc acagctcccg gcagcgccgc tccagccagt     14880
     cgttcagggc gtccaagctt tcgaacggag gcatggactg ccacaggcgg tggcgtgcat     14940
     cctgaacgtt cttctcaacc tgccccttct cccaaccggc ggcccgatta cagaactcgg     15000
     cctcgaagag ataatggctg gtcatcgcca ggaagcgggc gttgacgctg cgctccttgc     15060
     cacggccgac cttgtcaacg gcggtgcgca tgttgtcgta aatcccgcgc cgcggcacgc     15120
     cgccgagagc ttggaaggcg tggttatgcg cgtcgaacaa catctcatgt gtctgcagca     15180
     gataggcccg gacaatgaac gcccggctat gcgacagttt ggtgtgcgcc acctgcaact     15240
     tgacgcggac gccaccgatg atcgcaaaat cttcgctcca gtcaaactgg aacgcctcgc     15300
     caggcgcaaa ggccaagggc acgaaggttc cccggccggc ggtctgctgc agccgttggc     15360
     actcctcctt ccaagcccgg gcaaaggccg ccacacgatt gtaggaaccg tcatagccca     15420
     ggctgacgag atcaccgtac agctgcttga ccgtccgccg ctgcttgcgc ggccggttcc     15480
     cctcacgccg cagccacgcc gaaagcttct cggcataagg atcaagcttg ctcggccggt     15540
     ccggaacctg aaacttcggc tcaatcacat cagaccgaag atatttgcgg atcgtgttcc     15600
     gcgacacgcc tgtgcgccgc gaaatctctc ggatcggcac atgctcacgc ttatgccacc     15660
     ggcggataat gctcaaaaac gccatgtcca acactccgtt cgcccccgcc tcttccagac     15720
     ggggaaacag tcaaacatgg gtcatgtgtg gaacggcccg ggattcaaga gcgagcttcg     15780
     aagatgtggc ggcggcacga atgcggtcat gtgtccggct tatcggtgcg gcctcatgac     15840
     cgccagccca gatgggatcc gcgaatgaca tccaaacaaa tctgcggcat cgacgtgccg     15900
     ttgacccagg ctggattatc gccattcgtc ggttcgaccg atcaccatca tcttctgtcg     15960
     ctcctgcctc cccggcaccg gccgcggtca ggctgatgcc ggctgccgcc ggtatgcctc     16020
     gccacgcgcc atcatcgccc agatgatccg ggcgatcttg ttggccagag cgattgccgc     16080
     gatcttgcgc ggccgccgct ccagcaattg cagcagccat gtgctcgccg atttgctgcc     16140
     aggcttcgcg tatcgaacga ccgacatcgc accgacgacc agcaactggc gcagccgttc     16200
     attgcctgcc ttgctgatcc tgccaatccg atgctttcca cctgtcgaat gttctcgtgg     16260
     cgtcagtccc agccacgcag cgaagtggcg gccactctcg aaattcgccg ggtttatcga     16320
     gatcgccatg gtaatcgcgg taattggtcc aacgccgggg atcgcagcga gacgctggct     16380
     gactgggttg gccttatgct gttccagcaa ctgccggtcg atcgcctcga tcttcagatc     16440
     gagttcagca atgtgtcgcc ccatctgagc gaacatcgtc cgagcacctt ccgggatggc     16500
     agcctcattt gtcagaacgc agaccagcgc cgcaacattg ccgcagccct tggccgcgac     16560
     gataccgaat tcaccggcat ggccacgtaa ggcgttgatc gcctgcgttc gttgcccgac     16620
     aagcatctcg cggtgcttca cgataatcgt cgcggcctgc tcgtcgaccg tcttcaccgg     16680
     cacagtgcgc atgtccggcc gagcggcagc ctcgctgatc gcttccgcgt cgttgcgatc     16740
     gttcttgccg cgctttacga agggcttcac atactgggga gggatcaact tgacccggtg     16800
     acccaaggcg ccaaattttc ggccccaatg atggcttccc gcgcaggctt ccagagcaat     16860
     ctctgtcgcg ggcaccttgg caaagaaggc ttccatctgc cctcgccgca gatcccgcct     16920
     cagaatgaca cgatcttgcc cgtcaacgcc gtgtatcgtg aaaatatgct tcgacgtatc     16980
     gatcgatatc cgtttaaatt ccatcggagc ggccctttca tgatggtcat ttgagcgacc     17040
     tcatcttggc acatccgatg ccgtgggccg ttccacccca acagatctca gcggaaatca     17100
     acagcgtgat gacagataca ccggttttcc acagacgcag caccagccgc tgatcggcga     17160
     caagcccgtg cgcggcgaga atcatcacca gatccgcact ccttccgtca tcccagcgcg     17220
     gcaacaccgg gatgacagaa ggcgttgcgt ggggtgcgag gaacgcaagc gcgttgcgga     17280
     acgtccacgg cgccggtgag cgccaaccga gctggacgag agcgcgccga agcccgccgg     17340
     ccgggccgat ccactggatt gtcagcgcgc cagaaaagct gccgagcatg ccgaggctgc     17400
     gtgctggcag gttttgccat ccgcgttgta gccagtcgcg gcacgtcatc gtcgagctcg     17460
     tgcgcccccc ttcatgacgc gccagatcgg catggcggtt gagggcgatc gccggcgtac     17520
     cggcgatggc gagcgtggcc gccgtgatgg cgacgaggcg ccagggggcc accggttcga     17580
     ccgggcgcgc aacataggcg aggccgagac cggccgccca cgcgaatccg aagctcagcg     17640
     cggccaattc ggatgaaaac cagtccagcc cgagatagac gcgactaccg agctgcagcg     17700
     ccgcgaacag gaccgtcgcc gttattagtg tcaggcgcgc gcgtgtgccg agctggcggc     17760
     cggcgataac ggtcaggata ccatagaccg cgcatgacgt tgcaagatcg ccgcccggaa     17820
     acggcatcaa gctccagccg ggcgcaatcg gcgacggtgg cgcgcgatgc agagcgagat     17880
     caagccccgc tgtaaacagg gacgcgccga tcaccgcggc aatgccgtag gccgcaccac     17940
     gccacgcact ctgccggtcg agccagacga gcgcgactac ggcgaccgct agcgtgacca     18000
     cgccgctgcc aagccgcgag aacgtcaccg ccgcttccat cgggatgccg cttcgatagg     18060
     gcgcgaggaa atgcaggatc gcgtgatcgg catagaccag cggatctccg gctatcaggt     18120
     cctgcaggat accgagcaaa agccacaggc taccggcaag ggcgcaggcg agggtgatca     18180
     ggccggacag ttccgtcctt gccggatcga ggatggaggc caccgcgctc cggatccgcc     18240
     ctttgccgcc gcgggcccag gcaagagcag gcccgcgccc ggtatccagc cagttgatcg     18300
     cgaggcggag aagccgtggg accagccaga gcaggagcac gaggccaacg actgagccga     18360
     cgagcagggc ctcgagcctg ccggccatga cgccgagaat ggccagcgag gcgccgacga     18420
     gaaccccggc gccgacatgt gcgggcgccc agatgacagc ggacccgacg tcgagcagat     18480
     aaaagcgaag cggacgcata ccgctgacgc cggccacgat gggcaccacc gcccgcacgc     18540
     caggcgtgaa gcgcgcaatg atcacggcgg acccgccgtg gcgctcgaag aacgcctggc     18600
     ctttcggcaa gagccccgga tgcaggttca gcggccagag ttctgtcgcc cggtcccgga     18660
     accgagagcc gaaccagaag ggcagcccgt ctcccaggat ggcacctccc gtggaccagg     18720
     ccaccagtgg ccagaaatgc agggcgcccg taggcacgag agcacctaat ccaacgataa     18780
     tagcagttcc gggcacaagt gctccgatga caggaaaagc ttcggctccg gtaagcacaa     18840
     aagccagaac gtacgcgagg aacgcgtgtg tcttggccgt atggataatc atatcagaga     18900
     ggtgacccag caaacctcaa tagctccgct tcggtgttca acgcctaatc tccgtccccg     18960
     gcggtcgccc tgcaagcgtg gcggcgcgaa tgatatcagg caggcatgat cagatagggc     19020
     cgcagatcgc aactatggcc atcgactgag cgtatggccc gcttttcaca aatcgagaca     19080
     tggggtcgtg tttgccacgc gaagcaccgt ctccaaagtc ggcctcgcga acgcaaacga     19140
     tcccgaaaag ccgacaggcc acgctatcag aagaaaacat ttacactttt ggaaggtcgg     19200
     cttcagagca tccaattaga gccggggatg accgggaagg gcgcagagcc gttgcaggcc     19260
     agcgccgccg aatgaccggt cttgggttcg ggttgcctcc tccctatggc tcggtagggt     19320
     cgatttagac ccaccaacac ggcaacatgt ttacatgtaa tcatttggct tctggtagac     19380
     attaaaaatg gccagctcca tcaacgccga ggcggcaaaa cggtgaacgc atatcgcttc     19440
     accggccagg cttgcgccca ggcatggagt tgcagttgcc cgaaacgcag ccggtcattg     19500
     aggagcaggc tggcgcgtga aagcgtcatc atgaggatgc ctgcgccgag cgcgaacgcg     19560
     gccaagcgga gcttgtggac ctcataattc aaaatgcagg acagggccga gaagaagccc     19620
     agccagaaca ggaggcggcg gaaccagagc acgaaccgca ccgcgagaat gagcacgtcg     19680
     agcacagccg ccaccagaaa gcgcaaggcg ccccggagca ggccgagcaa agcgcggccg     19740
     agctgggagg cgaagccagc cgagcggccc ggcgcatccg ggggaggtgg gaagccctcc     19800
     tccatcccgc tacccatgcg cggccggggc aacgttcggc gtggtccaaa gccagagatg     19860
     gcaagccgtg cggccgtcct gatgcgccac gttcttgccg gtgcagtcgg atttcatcgt     19920
     gtcgaggatg gcgttatcgc gcatgagctg gtgccattgc gccaagccag ccgggccttg     19980
     cgaggcgagg acggattgct caacggcgcc ggcagcatga atcgtcccgg cggcctggct     20040
     gtacccggcc gcgttgccgc gccagtagcc caggccgaac ccaagggcga ggatcacgat     20100
     tgccagcgcc gcgcaggagg cgagggttcg ccaccatacc caccgtgaca tggccttgag     20160
     gcgctgttct gccgcttggg caaaggatgc cacaaactga cgcgacaaat ccgcatgcgc     20220
     ggcctcggcc tgggctttcg cggccttgaa ggcttgatcg atggtttgcg ccaggccgtc     20280
     ccgcgcctgg cgcacggcgc tgaaatcccg atcgacatgc aggcggtgtt cagccatggc     20340
     gcggcgttga tcggcggcga tggcagcggt cgagcccagg aatacccgga gcgccaggag     20400
     cgtgtgagcg gtggggtcat tgtcgagccg ggcaagctgg tcgtctgtga attaagcgac     20460
     tttgctgttc cgtaggcgaa ggtctggaga gggtcttgcg gccgagagcc atgcgacgag     20520
     ggcgcaaaga agcctgatca gccatctgcg gaggaggcgt aggttgtggc cggcgccggc     20580
     gaggacggcg ttgatggcat caccgtcgac gccgagcagg aagtttcttc cgagatggcc     20640
     atcggtcttc atgtggccga tgacgggttc gatggcggcg cgtcggcgca actcgcggcg     20700
     gatggtgggg gtgatgccgc gtttctggcg ggatatgaag atctttctgc cctcggcttc     20760
     gacgccgtgg ccgcgatagc cgcggtcgac ataggcgcgg gcgacggcaa cgccggtgat     20820
     ccgctcgacc tgctcgatct ggccggccag ggtgtggccg tcatagggat ttcccggccg     20880
     gctctgcatg ccgagaacga actgaccgcc gggtgcagcg gcgttggtgg tggcgatgga     20940
     gaccttcacg ccgaattcga agcgcgtcct ggccttgccc ttgccgatgc actccacctc     21000
     gggcgcgtgc agggaataga gcttgtcggc accgcgatcg gagcgcttct ggcgaagcag     21060
     gcgattgatc aggcccagcg tttcggcgaa cgccgccttc gcctcagcgt tgcctgcgat     21120
     cttgcgggtg atgtcacgcg ccagccggcc cagccaggtc cgcagcttgc gcacgcgcgc     21180
     ctcggcctcg cggcgtttgc caccatggtg caggcgcgcc gcctcctgcc tggcgtagcg     21240
     cgcgacccgg cgataggact ggcgcagcgt gatgccgtgc cggcgcgcca tccgcgccag     21300
     cgtctcgatg ccgctgtgca gcagcttgct gtcggtcgga tgcgtcacgg cctttggctg     21360
     gaccgtggta tcgatggtga cccgctcgta gtgcgtctcc gccacggccc caccccgctc     21420
     tgcagccacc agcgtctcgg cgagcagggc ctccatccgc tccgccccga tccgcttgcg     21480
     ccagcgcgtc atcgaggatc gatcgagcgg cagcgtgtgc tggaaatgcg tctcgccgca     21540
     gaatgcctgg acatacggac tgtcgagata gcgcgcgcag atcgcttcgt cggacagccc     21600
     atccatgtgc ttgagaagat gcagcgccac catcaggcgg gtcggcagcg cgggacgtcc     21660
     ggccgcctcg gcgtagagtg cgccaaagcg ttcctcgaaa acccgccagt cgatcagccg     21720
     ggccagccgc accaggggat gccgctggtc gatgatgttc tccagccgcg agcggaacag     21780
     ttcgagatca tcctgcgagg cactcagctt cggcggcatt ctttcctcca cgccaaacac     21840
     atgatgttcg gcatcaacgg gagagaatca cgatcgcgac caccgcgcaa cgctccaacg     21900
     gttttgcaag gttttcccac tcaggtctcc cagaccttgc aaatcccgat actacccgat     21960
     cctaaaaaat catgaatata tcaacaaagt tcgatttttc acaggtgaca agctgttcgg     22020
     cccgatccag ctccgcttgc gcggcgcgga tcgcggcctc tgtctcgctc tgatcgacag     22080
     cctcgctcat ggcatccacg atttcacgcc ggcgaattgc tcatccatcg ccttgagcca     22140
     gtggcccacc cgcgagcggt tgaacacccc gagcggcggt tctgtctgac cgtcccgtgc     22200
     cgcgacgaaa ctcgcggtgc gggcctcgac cgcctcggca gcgtgcaggc gcggcatcca     22260
     gagggtgagt gccccgtctg ctgtttcatc gcgatagacg ttcgaggagg tcacgcgccc     22320
     gaatgcctgg tcacgcgatt gtccggccag agccatacct tcattgagca cgaaggctcg     22380
     tgcgcggggc ttaaagccca aagcgccgag cgtggcggct ggggttaaat cctcgggatg     22440
     cgggccggcg aggtagaaca tcaccaccgc catgcccgca tcctcaatca ttgcatcgaa     22500
     gccgggcatt tctccggcta tggtgcgcag gatcgtatcg ccacccccca gatcgatgat     22560
     ggcggtttgt ttttcggcga tggcgaactc catgaaatct tgcagccagt cgcgaacggc     22620
     ggcctgattg aaggtgtccg gccaatagta tcgagttttg agcagggcag ggtaaaccgg     22680
     gcttgcagca atatagctaa tacgctatat agcgtatatg agatggtcgg ttgagactct     22740
     ggatgtcgtg gatgatgaga tcatggagtt gccgccgaag ttgcaagccc ggttgctacg     22800
     gctgttcgag atggttgaaa gcctcggatt ggaccagctt catgagccgc atgtcaaaca     22860
     tttagatggg aagctttggg agcttcgagc aaaggcagcg gaaggaatag cgcggggcat     22920
     ctatgtagcg gtgacagggc gacgagtggt cgtcttgcat gtctttgtca agaagtcaca     22980
     gaaaacccca aggcgggcat tggagcttgc acaagagaga atgaaagagg tgaagccatg     23040
     acaaaacttg gcgagttgaa gaaaaagcta atggaaaacc ccgagtttcg ggtagaatat     23100
     gcacaggcgg atgcagatta taggctgatc gaggagatga tccgcgtgcg gatggaagct     23160
     aagctgacgc aatccgaatt ggcactgaag attggaacca cacagtctgc cattgccaga     23220
     ttagaaggcg gtaaagtgtc accatccgtt tcgacgctgc gtcgctatgc ggaagcaacg     23280
     gggcatcaac tgaaagtctc gtttgtttaa gtttacgcag aggaagcggg tgtccagctg     23340
     attgggcatt tggccgctat acgagcctgg gcaaatcgtc aagctcgcaa cacgggtcgt     23400
     cacccggcgt ggctgaatcc cctgcgctcc acccgcacgg caagatgttt caaaagatcg     23460
     agcagcagcg tgaacacggc cgcgctgatc atgattgtgc ccagaatctt ccacccaagc     23520
     ggtgccatca agatacccat ccccgcaacc agcaggctga acccaaccat ggcgagcgtg     23580
     gcgacgctca gccagaggct gggcgtcgag gaccagaacc agcgctcctc gcggatgaca     23640
     taaacgctgg cctggattgc cagcatgagg gtgaggaaag agagcgagcg gatttgcggc     23700
     agtggcagat gccagatcac gcgcccggcc agaagcatca acgccgcata gccgagcgtg     23760
     gccaaaccat aaaccccgcc ttcggtgatg atccggccga tgcgccagcg ccggggatga     23820
     gaagagggca aggcgcgatc cgttgtaatc gccatggtca ggaaatcatt gacgatcagc     23880
     agcaaaacca tcagcagcgg cgttagaacc gcatgtccgg tcatcaccaa tccgagcgcc     23940
     agataaagaa cgaaggcgat tttgcggacc accatcgaca gcgtgtaagt gcggatgcgc     24000
     tgaaacgccg ccctgccctc gcggatggca tccagtatgc cggccagccc gggtgaggtg     24060
     agcaccagcc ctgccgccgc cttggcgaca tcggtggccg ttgaaacggc aatgcccatc     24120
     tgcgcctgac gcagcgccgg ggcgtcgttg gtgccgtcgc cgcacatgcc gacgacatgg     24180
     ccgccgtgct ggaacagctt taccaggcgg aatttctgct ccggaaacac gccggcgaac     24240
     acgccgtaat cacctggcgc ggccaatgtt tcgagcgttg cagaatcgca aatatcgccc     24300
     gtgatgccaa cggatttggc aatcaccctg gccgtctccg gcgcgtcgcc cgtgaccatg     24360
     accacacgca cgccaagctc ctgcaaggct gtgatgaggc tggccgcatc ctcgcgcggc     24420
     gggtcggcaa ggccgagtaa tccgagcagg acagtggcgg cgccaacggt ccgggtgacg     24480
     gcaagcaccc ggcagccggc ctcggccaga tgctgccgtg caacttcctg ctcagcggaa     24540
     agcgggactt ggagcaacgc gccaagcgcc cctttacgga gcaggctgcc atccgctagc     24600
     cgcgcttgcg catatttgca cgctggatcg aaaggcgtga agcccgtggc ttcaggcact     24660
     gccacgccgc gtaaccgggc ggcattgata atcacctgat caaccggatc gccgccctcc     24720
     gacgaagcgg cagccgcggc ggccagcacg gcgttttcag ccatgccgtc aaagccgatg     24780
     atcgtttcaa tcgacagcgc attctgcgtt aatgttccgg ttttgtccga gcagagtagg     24840
     ctcatcgtcg ccgcctcgtt gatcgcggcg agccttgtgg gcagcaccgc gccgcgcacc     24900
     agccgccggg ccgaaagcgc cgcggccagg gtaaaggtgg aaggcagggc aacggggatg     24960
     gaagcaagca gggcggtcag cagcaagggc acggtttcgg cgaagctccg gccaatcgca     25020
     tgggcatagg cgagcatcgc cagcaccacg gcaccgttga ccacggccag atcccgcacc     25080
     accgccagaa ccgcgcgctg ctcgctgctg acaccgtgag catcctgcac caaggaagct     25140
     gttttgccga aataggtgcg cgcgccggtg gccaccacga tgccggtggc ctcgccctgg     25200
     cggatcatcg cgccggcata ggccagatcg cccggtttgc gctcaaccgg cagggattca     25260
     cccgtcagca tcgattggtc cgccagcacg ttgcctgcgg cgattttaat atcggcgggc     25320
     accaccgcgc caagcgccag ttttaccaga tcgccgggca ccagctgaga tgcaccgagg     25380
     cgcatccagc gtccatcgcg ccggaccgag gccatcaccg ccagtgtccg ccggagcgcc     25440
     ttgaccgccg ccttggcgcg ggcttcctgg gtcagcccca gaatggcgtt gaaaatcagc     25500
     aatacggaaa taatgacagc ctgcagcccg tgaccgagaa acacttccag caggattgtg     25560
     gcttcgagca tccaaggcaa aggcgcccat aatttggctg ccagcgcatg cggccagctc     25620
     tcggatttat ccgcaacctc gttcgtacca aattgccgca agagcctctc ggcctcggca     25680
     gacggcaaac cctgctcaat gtccgcgctc ataccggcat ccgttgggtc tataccctgc     25740
     tcattgtctc gctttcatgt gcatggccgc aatagcggcc ggtgcgacat tcggcgttgt     25800
     ccatagccat agatggcaag ccgtgcggcc gtcctgatgc gccacgttct tgctggtgca     25860
     atcggatttc atcgtgtcga ggatggcgtt atcgcgcatg agctggtgcc attgcgccaa     25920
     gccagccgga ccttgcgagg caaggacgga ttgctcaacg gccccggtag cgtgaatcgt     25980
     cccggcggcc tggctgtacc cggccgcgtt gccgcgccag tagcccaagc cgaagcccaa     26040
     ggcgaggatc acgattgcca gcgccgcgca ggaggcgagg gttcgccacc atacccaccg     26100
     tgacatggcc ttgaggcgct gttcagccgc ttgggcaaag gaggctacga actgacgcga     26160
     caaatccgca tgcgcggcct ctgcctgggc tttcgcggcc ttgaaggctt gatcgatggt     26220
     ttgcgccagg ccgtcccgcg cctggcgcac ggcgctgaaa tcccgatcga catgcaagcg     26280
     gtgttcagcc atggcgcggc gctgatcggc ggcaatggcg gcggtcgagc ccaggaacac     26340
     ccggagcgcg aggagcgttt gagcggtggg gtcgttgtcg agccgggcaa gctgttcggc     26400
     ccgatccagc tccgcttgcg cggcgcggat cgcggcctct gtctcgctct gatcgacagc     26460
     ctcgctcatg gcatccacga tttcacgccg gcgaattgct catccatcgc cttgagccag     26520
     tggcccaccc gcgaacggtt gaacaccccg agcggcggtt ctgtctgacc gtcccgtgcg     26580
     gcgacgaaac tcgcggtgcg ggcctcgacc gcctcggccg cgtgcaggcg cggcatccag     26640
     agggtgagcg ccccgtccgt tgtttcatcg cgatagacgt tggaggaggt cacgcgcccg     26700
     aatgcctgat cgcgcgattg ccccggcggt gccacgcctt cattgagcac gaacgcgcga     26760
     gcgcgaggct tgaagcccaa agcgccgagc gtggcggcgg gggttaaatc ctcgggatgc     26820
     gggccggcga ggtagaacat caccaccgcc atgcccgcct cctcaatcat tgcatcgaag     26880
     ccgggcattt ctgcggctat ggtgcgcagg atcgtatcgc caccccccag atcgatgatg     26940
     gcggtttgtt tttcggcgat ggcgaactcc atgaaatctt gcagccagtc gcgaacggcg     27000
     gcctggttga aggtgtccgg ccgagcaacc ccgccgaaat aggtcgagaa ggttgcgttg     27060
     gtggggtcaa tatcagccag gagcggagct ttcccgtccc gctgtgccat ctcgacgatc     27120
     cagcgcagga aggtggtttt gccggttttg ccccggccag ccgccaggat gatcttgggc     27180
     cgatcggcga gatccaggcc ctgagccacg ggtttggaac gggtttgctc gctggtcagc     27240
     agtggcttga tttccgccgg cttgagtccg gcgacggcgc tgccggggcg gaatacaggg     27300
     ggggcgggtt tttgcgcgcc ggtgggcttc ttttctgatg agggggcctc agtcatcaaa     27360
     ttctcctatc gggatttatc gccactccat ttcggatcgt caggatcggc cggagcagtt     27420
     ggatcgccga gggcgcggcg ttccgcagcg gaaacgcccc ggccctcatt tctcatccat     27480
     gaccgttgaa acttgggcac tggctgggcc gcctggtcag ccggagcagt aggatcaccg     27540
     agggcctggc gttccgcagg ggaaacaccc cggccctcat tccttaacct aacgggcttg     27600
     aatcgaggtt cgggcgccgg cgtgctagcc ggggccgccg caaccgggcg cccttcggcc     27660
     cgttgcttgg cgaccaggcg ccgcgcccgc agccaatagt tttcgacggt gcgcggcgtg     27720
     agcggctggc cggtgcgcga gaccagcccg gccgccgcaa agtgctctgc cagccctttc     27780
     caatgcgccc catgcttatc gagaagggcg gcaaattcgt cgtggtgctc gataaaccag     27840
     accatcaacg gcgaccgccg gcgaaggccg gaagccatcg ccgcactgag cttttcaata     27900
     tcgagatcag gcgcgggcat ggggaatcct accgatttca acctctgcac gtcaatagaa     27960
     cgcagcacaa ccacagcaga atcacagcat aaagtccgcc atattcgtag cagatacgat     28020
     gcaaaaacac agcatattcg ctgcatatcc gcgccagaaa tctcgccaaa ctcccgccag     28080
     tgtgcgggcg gagaaagcgg agaagaagtt acagaccatt gcacctatgg agcttgcggc     28140
     gcaagaggca atggcgttag gttgatgggc aggagttccg cccgatgccc gagcccgaaa     28200
     ccgccccgat gcccccgaaa gatgaccgcc tcgatgccgt catccaggcg ctgcggctga     28260
     tgatcgagac gcagaacacg cacagccaaa tgctggcgcg gttgatcgag ctggcgaccc     28320
     cttcggaaga aagcccgctt gaggaatccc ttgcggagat tgccggggcg ctgcgcgatc     28380
     agaccaccgc gctcctgcaa atcggcacga cgctggacgg gctgggggcc gaggttgagg     28440
     ccggggtgat gcgcggcctc gccaccgcgc tagagtccgg cgaggaggct acgcagcaag     28500
     aggcgggcgg agagacatgc tgacgttccg cgccggtgcg gcttccacct catccggtgc     28560
     cgccgggaag atggcggacc acctgatgac catgacgctg ccgggcttcg agcaggacat     28620
     ggcgacgtat tatcagcgcg gcatgatggc cgagggtggc ctttggcagc cgggcactga     28680
     ggcggcggaa gataacgcgg cggccaccgc cacggacgca gctcgccctg gcaccattcc     28740
     cgagccccgg cgcgacatgc acccggccgt tgctgccgcg ctggggattg acacctcgcg     28800
     cccgctgacc cgtgacgaga ttgccgagct gctggcgggc aatcgggcgg atggcgagaa     28860
     gatcgcgggc aaacaatatc agcgcgcggt gacgccgctt gccgaggtgt tcgggcttga     28920
     tccgatgcgg ttgccgaccc gcgcggagct ggaaaacctg cttgccggca aacgggctga     28980
     cgggtccgat ctgccggccg cgcccgtgga ggtgctgcct tcaacccgtg cgcaggacgc     29040
     ggtgccgacg gcgcccgagg cggacgagac ggaggaccgc gacgcagccc ttgctgccga     29100
     agcggcggcg cttggcgagc tggggcacgc gccagacggc ccgccgccct ggccggatga     29160
     ttttgccccg cccccgatgg aggaggcggc cgcatatgat cgtgatgcgg cgctggcggc     29220
     cgattggcag gcggatgttg cgcggggcgg tgaacctgcg gtgccgccgc gtggcccggc     29280
     ggccgaggag aggccagcgg aaccgcgcgc gattgatgtt gcggcggcgc ttgatgccgc     29340
     cggtgtgccc taccggacca gcggcggccg gttgcgcctg caagcgacct ggcgcggggt     29400
     ggatagctgg acggtttcgg tcaacgccac cactggccaa tggaccgact ttgccgccag     29460
     cgaaggcggg cggttcgaga gcctggtgcg ccggctgggc gtcaaagccg aggcggtcga     29520
     gctggacccc gaggcggcca aggcagcgcg cgaggccgag gtgcggcgca acgcctttcg     29580
     caagagcatc gccgggaaag tctgggatga ggcgattccg ggcgcgggcg aattgcgcga     29640
     gccgaatttg cgcgggtcgg tggggcagaa attgcggcag cgggcggcgc atgaggcgcg     29700
     cgtggaagag gccgaaggca tgcgggcgcc ggttcgtgcc tacctcagcg ggcgcggcct     29760
     cgatgccgat tggctgatga gccaggtgcg gctggtccgg ccgcatccga actatgattc     29820
     ggcggaagtg gcggctgggg cggcggtggt gatgctgacg ccgatgtttg gccaggatga     29880
     ggacggccgg gtacggctga ccggcgtgca gcgcacctat ctgaccgagg gcggagcaaa     29940
     aatcggccgc cggatgctgg gggcctcggg cgcctggctg ctgcatccgc ctgctggcgc     30000
     ggcggtgccg atcgggggtc atgagcaggc gcgggttgcc ggtgaaggct tcgagaccgt     30060
     cgcgagcgtg gtgcaggcaa cgcggcaggc tggtgttgtc gggtacaatg ccggcggtct     30120
     ggtggcctgg gccgggcagt tcaccggctc gacgccggtt gcgctgctgg ccgatcgcga     30180
     caatgcccgc ctccataatg gccgtgatgt tggtgaggcc gggcagaagg ccgcggccaa     30240
     ggcggcggcg ctgatcgagg ccaatggcgg cgaggcggtc tatcttgagc cgccggctga     30300
     tgttgcgggc ggggcgaagg gcaccgattg ggccgatgcc ttgcgcgccg gcggagccgc     30360
     cggtttgcgg caggcactgg cggtggccga ggcgtcgagt gcggctgacc gggcgcggat     30420
     cgaggcgaag ctggcgcccg cctctcccag cgcggcgccg gatggtccgt ccgcccaaga     30480
     ggccgaacag aaccagcctg ccccccatcc cgagcttgtg cggctctaca aggcgctagg     30540
     ggccaaggac ggaaacggcc tttccgagac cgagcgggcc aacatccttg atggcaagcg     30600
     ggcggatggc gcggcgctgg atgcggccga ttggcggaac gcggtgaacc gctcgaaaac     30660
     cccgatcggc tacgttgatt ttaccttctc ggccgacaag acgatttcgt tggcatgggc     30720
     cttcgcgccg accgaggcgg agcgcaacca gcttgcccag gcgcacaagg atgcggtggc     30780
     cgcgaccatg gccgagatcg aacaggtcat tggccaggcg cggaagggca aaggcggcaa     30840
     ggaaggcact gagcagggcc gcatcgggtg gatcaccttt gaccactaca ccgcccgccc     30900
     caccctcgaa atcgcccgcg agacagcgga cggccgcacg gaaaccgaga tcgtctccgt     30960
     gaaggtggct ggtgatccgc agcttcatac gcatgtcgcg gtgccgaatg tcatcgtcac     31020
     tgagagcggc cgtgtggtgt ccctgaacac gttgcagatg catggccgca ttcatgaatg     31080
     gggggcgatc taccaggccc atctcgccca gaatctccgg cgggcggggg ccagtataga     31140
     attggaccga accaccggcg cggcgcggct cagcgccgtg ccggaggaga tccgggcggc     31200
     gttcagtaag cggacccgcg atgccctttc cgacgcgaaa gcctatgccg cttcggtggg     31260
     cgcggagtgg gaccgcatga ccggcgacga acggatcaag ctgctgaaag gcggcgcctt     31320
     tgccagccgt agtgccaagg ccgacgatat gagcgacttc gcgagctggc ggcgccaggc     31380
     ggaggaacgc ggctaccagc ataagagcgt tctgcaggac gcggcgccgg cggagacact     31440
     gaccgaagcg gcccggcttg accgggccta cgaggccgct gcgcgggtgc tgggcgagca     31500
     gtttgcccgg cgggcggtca tcaaggacga ggacgaacgc gttgccgcag cgcgtggcct     31560
     ggtggcggcc ggcatcaagg atggcggcga tgtggaccgg gtgattgcgc ggttgcgggc     31620
     gcgtggggtt gtcgagacgg gcgtttctgc tggcaacggt gagcccgcgc gcacccagat     31680
     catcgcggtc gagaccgtgc gggatgaccc ggacaacccg gatgtgaaga tcaccacaac     31740
     caggctgacg acgcgcgccc atgttgagca ggagagcgcg ctggtcgagc tggcggcaca     31800
     ggcgggccgg gaccggcgcg ggacgctcaa cccggcccag atcaagcgcg ggatcgcggc     31860
     gagcgggctg agcttcaccg gcgaacatgg cgtggcgcag cgccggatga tcgatcatct     31920
     cggcatgagc ggccggttcg cggtggggat cggtgcggcc ggggctggca agaccacgct     31980
     gttgaagcca ctggtggcgg cgtggcgtga ccagggcgcg gatattcacg ggatcagcct     32040
     tggctggcgc caggcgcgcg agctacgcga agccgggctg aataccgagg ccgagaccgg     32100
     cgggcgtgac acgatcgcgg ccgtgtcggt gttcatcaac cgggtggaga gcggccggct     32160
     ggatttgtcc aaccgcagcg tcgtagtgat cgatgagctg ggcacgatcg gcacgcgcca     32220
     gatgcttgat ctgttgcggc ttcaggagcg gcacgggttc cgcatggtgg cgatcggtga     32280
     tccgaagcaa tgccagtcga tcgaggcggg ccaggtgatc ggccttctcg aaaaagggct     32340
     gggcgaggtg ccctccatcg aaagcagcgt gcggcagacc aatgaacgcg cgcgcgaaat     32400
     cgcgggcttg ctgcgcaaag gtggcgccga agccgttggc aaggcgctgg atatgaagcg     32460
     gcaggacggc acggccgaga ttgtcgccgg tggtcatagc gaggtgattg cgcgggccgc     32520
     cgcgctctgg gatgagcgta gggccgcgaa cgctgacagg tcgcgcttta cgctttcgat     32580
     cagcactccg accaatcagg acgcgcgcgc gattggcgag gcgatccggc aacggctgct     32640
     ggcctctggc gagctggggc agagctgcat gacgctggcg gcgatcgaca agaataccgg     32700
     cgagcactac gccatgccga tcgccactgg cgaaaaaatc cggctattcg cccggaccaa     32760
     cgccgcgatg ctggatggcg gcaagggcgc gatcggggat aacggctcga tcctcgaaat     32820
     caccagcatc cgcgacgagg gcctggtgct gcggaacgac catggccgcg agggctttgt     32880
     gaagtgggac acgttggccg acaaggaaac cggccggatg cggctggcct acggctatgc     32940
     catgaccacc aacacggccc agggcatcac cacgaccgag catatctttg taacaccggg     33000
     cggctcgcag accacggacg gcttcaagac ctatgtatcc gggtcgaggc accgggagcg     33060
     ggattactgg ctcacctcgg aaggcgccga gcgtcaggag atcgcggggc ggcggccgtt     33120
     gggtgatccg cgtcccatcc gcgagcacga catctggacg aactggacgc ggaacatcgc     33180
     gcgccagcct gaaaagacca atgcgctcga tttggtgaag atcggcgaag aggcccgccg     33240
     caatgccgcc cgcgccttcc taaaggggct ggcggccgac gaaaagcgcg aggccgctgg     33300
     cttgccctct gacctgtccc agcgtttcgc gcgcacccag gcccgtgctg gtgcgcaagg     33360
     aagcttgact gaaaccatgg cccgcgctgc cgaggagaag gggcaggcgc tggcccgcat     33420
     cgagcgggcg gcccctgccg tgcgggcagc tgtggcggcg ggctgggagc gggcgcggcc     33480
     gttgatcgag gcagcgcatc ggagcgcccg ggcgcggcta cagagagcgc tggaggggca     33540
     tcggcgccag gcgcagcacc aagccgagga acggccggtt gaacaggaaa gccggaagcg     33600
     cggacgcggg cggtagcaac ggccagaagg ggggtctctt ggctactgag agactgcact     33660
     cttgggcagc cgaagagggg atctgggttc agatggttaa ctgcgaaccc aagctaacta     33720
     tagttcccac tctatcataa atagacaaga aatcaccata tacatcaata ctttactgaa     33780
     tgctgctcta caagtgccat gaacaatacc atgctcagct ccacagcact tgggtgacgc     33840
     caaggattca gggcaacctc gcagcgccct gacgctgccg aaggctgtcc gcccaggtcg     33900
     ccaaggcatc aatctcggcc gtcagtgctt ctggccttgg cagagggcgg ttcaacgcag     33960
     cggcggcgct atgcagcagt tcggaacagc gaccaaagcc gtcacgcatg gcctcgcagt     34020
     cgggaaccgt gatcgcggtc agcttgacca agccaggcgt cttcacttcg ttggacagtc     34080
     gccggatgac gtgtccgaca acttcttcaa ccgcgatctc ccacgtatca cgcaacgtcg     34140
     cagcgatgga tttgacggac ttgcgccact cgtcgagatt gccttgctcg aaatggtagc     34200
     gttcacccgc aagctgattg ctcagacttg tggtgatgtc actgacccga cgcgctttga     34260
     atggcggctc gctgcggcag aagcctgcct tgtcagcacc ccggctgatg gagctaatcg     34320
     caaccggcgg ctttggctgc gcatcgtcag ccgcgcgatt caactcgaac aggaacgcaa     34380
     ggtcatgagt gaagacgatg acctggcgat gagcggcctc agcaaccagg cgtttagcta     34440
     cggcttcccg gtgcatgtgg tcgagcgagg aaacgggatc gtcaaagacg atgccggact     34500
     tgttttcggt ggtggcgagt tcggccatga acgcggccaa ggcaacgcag cgatgctcgc     34560
     cttcgctcaa gacctgtccc accgcagccg tgggctttcg tgtaagtgcg accttaaagc     34620
     gagggatgcc ctgaacgctg ttttgctgtc gaagctccac agcgaggcca gcaatctcga     34680
     agctcgccac ctcgcgagca aattgcgcgc gtagcgcgtc tgtcaccaaa gcctgagcga     34740
     tctcagtgct ctttgtggtg acgcggttgg tagcggtgtc tcgctgggcc gcctcaagcc     34800
     gcgcgatttt cttctggcgt tcgatttcgg cgagaacatc ggcttttatg ctaccaagcc     34860
     attgccgatc cacaagctcg gccttttcgg caagcacggc ggcgcgggct ggagagccag     34920
     cctccgcgac aagggcgttc gcccgagtct caatgcccgc tgcttgatcg accagcgcct     34980
     ggcgcgaata ttctgtaacg ggcacgtcaa tggcggcgct tggatttgcg tggcgtcgcc     35040
     tgatctggcg atgacgccac agggcgcgaa gggtcgcgcc cctgatctcc atcgccaagg     35100
     catcctggcg cagttcgtcg cggacggttg ccacaatgtt cacaagatcg gccaacgaaa     35160
     cagcctcacc cttgaacgtt gccagcgccc tgtcgtatgc gacgcgcgca gcgtcggcac     35220
     gttgctggct gtcgtcgcgc acaaaagcct cgaagcgatt gagccgatca gcggcgacgg     35280
     gcgtcaattc ctgctggcaa agcacgcata cgctgccgtg gtctgtgacg gggaatcgcc     35340
     gttcgggata ggcttccgca tcagaaaatg ctcgggcact ggcccatagc gcctgccaaa     35400
     cctccgaccc aatctgcggc aacggttcgt cgcggaaaag cgcactggaa gcagcttctg     35460
     cggcccggcg tgcggcatcg ctatcaacgg caaggcggcg caggttattg gcggaatcgt     35520
     cgctgattga agcaaatagc cgatccaggc gcgcaatgtg cccgtcaacc ttggccttca     35580
     tcgccgcaag ctggcgcgcc gcgcgagccg gatcacctgc caggtccgcc gtgagctgcg     35640
     ccaatcggtc ttgctctgct tgcgtgagcg ttgccaacgc ttcgaccgtc gccggcgcag     35700
     tgttggcggt gagccgggcc atgagcttgc cgaccgctgt gtcccggctg cacgccgggg     35760
     tcctgatcgc ttcgggcgtt tgcgccttta tctgcgcgat ctcggctgcc agcttatcct     35820
     tgaccgactt gcagagctgc gccagcgcac ctagcagctt gagcggaaac ggcgtgtaag     35880
     ccacgtcatt cgtatcgtcc acgtggacgt tcgcggtacg ggaatcgaac acgctgatgc     35940
     ctgaaagcgc gttgtcggca gcctgaccaa gctgccaagc gcaagtgcgg ttctgaccgc     36000
     taatcgcgta ttcaatcgtg gcgctcggcg tgcctggtgc agcgtcatag atgtcggggg     36060
     cgatttcctc ggctcggcca ggcatacggg cgcgacatac cttcttgaga atccgcgcgt     36120
     agccggattt tcccgatccg ttgtcgccat agatgatcgt caaaccgaca cggtggagcg     36180
     tcagccgttg gtcgggagcc agagcattaa catgcaggac tccatgcacc tgccgcagat     36240
     agacttcccc ctgatcgcgg ttcgggccgc gaaggtgccc cgcttccagc gggaccgcca     36300
     gattatcgcc cttgcagatg gaagccagct cgtcgatctc ggccgactcc agggccgctt     36360
     gcgttgcaag tcggcgcagt gcgtcgcgct gccagccagg actgtcagca gaccacgcga     36420
     ggatgttggc gagcgcctcc gcttccgttg tcatacgcct tcgcctctcg gttcgcgccc     36480
     gctatctgta tcagccttct ccaggtgcct gctcacggcc tcggatagcg tctcgtcggg     36540
     ctgccagccg aacagatcgc ggatgctcgc cgttcgcgca tggcccggcg gcacgaactc     36600
     gtagccagcg gcggtcaact cagccgccac gtcctcggtg atgaaaaacg gctcgctttc     36660
     gtcgtgcggc ttcatactgc ctccgtggcg ggtttcctga aagaacgaaa tgctgtcatc     36720
     ccatgctccc gcctcacaca gtggctagtt cggcgccggc cgtttcgggc tcgtcagaat     36780
     cgccagcctt cggcccaaca gccagacgga tcgcttccag atcgaccttg atctcatcaa     36840
     aacccaattc gtcagcggct cgggcgatca aggtctgggc cgcaccgatc acaaagcgat     36900
     cacccgccga gatgcgcaga ccagcagctt gcagccgtga cgacagcgca tcgactgcct     36960
     ggcgcacgtc ctggacagcg ggcgactggt gcagggcaaa cgccttctta cgacacacga     37020
     ggatcgcatc aagactgatc ggatctttcg ccgccgtctt ggggctcgcg gctcgcagct     37080
     ctgcgtgaac tgggtgagcc gcaacaacgg ccaggcccgc ctcgctgatc gcctcgtaga     37140
     tggcagccca accctcggcc cgcgagtgat gaaagctgaa tgccagtact ccgtcgtcct     37200
     tgagcacgcg gcaggcttca gtgaacacgg cagcgagctg acgggcgaac acacgcgggt     37260
     ctttgtgctg cacctcgccc tggtcggacg agtcctcgcg agccatccac ggatagcggc     37320
     cgcgaagtac tggcgacagc caggcaaaga agaaatcgct caactccgag tagtgaacga     37380
     aatcgaagta aggagggtcg gtcacaaccg cgtccaccga tcctgcgggc atcggcagct     37440
     cggagctgtc gccgttcagg atcagcaggc catgatcggc cgtcgccagc tcgccccaag     37500
     tctcgacgcg gcgagcgcgg atcgggtggc tggccaccgt tttgcgtgac cctgcacggt     37560
     tgccgtcctg gtcgtgctcg aacgcgatct caaagggctc atcgaggtaa cgcttggcgc     37620
     gcagtaggcg cgattcgaac agcgtgctga acgtgccgct gctcttgtca gtgccccaca     37680
     ctgagttttc caacggcgtg cgttcaggct tcaggatgtg gttcgagaac atgtgccgaa     37740
     cggccccggt gccctcgccc ttgaagctgc aaaacaggtt gttgaactcc aaggtgctgg     37800
     agaacaggca cagcatctgt tcctgcacgg cttggtcgtc gatgcttagg atttcgcgca     37860
     gcagtagccc gagacacagt agttggcgcg cattgaagaa gtcgcgccag tgggtgtagt     37920
     tgtagccccg cgcttggtca gtgttgtggc ccggacggac agagatttcc ggtagcggca     37980
     acgtctcact cgcaaggcgg ccctgggctt cctcgtagag cgccaagtcc tcagcacgca     38040
     cgggcagata gaccttcgtg ccatcagcgc gcaacgccat catcgcgtac atgcgatgtg     38100
     caggaggggt gccatccttg ggcagcagct ccttgattcg atagcgctgg ccgcccttgg     38160
     tcgtgacgta ttgaccagcg gccggacctt cctgcgggtt gaagtggtgg ccgcagtact     38220
     ggcagtgcat gtcggtcgcg tcgtagcggt cttccagcac gccccagcaa ccagggcata     38280
     cgatctgtgc tcgcggcttc ttcttcgggt aggcatcctg ggcgaacacg tagcgggaca     38340
     gcagcgggat cacttcgcct tccggcgtcg tgaccgtctt gacccagaag cagtacagca     38400
     ccgggatcac ttcgccggtc tggggatcac gggtctggta gtaacgccga atctccggtg     38460
     ccacgtcacg ctccagccgc ttgaaggcgg cacgaagctg agcctcgggc gcgggcgtga     38520
     acgcctggcg cacaagaaac gtgctgaccg ggttgatgtc gcagccgatg gccttggctc     38580
     ccagcttgat ggcctcgcca agcgtcgtgc cgctgcccat gaaggggtcg agcaccacct     38640
     taccggccag atcgtgggtc ttatagaagt gcgcccaggt gtccgtgcca ggctggctca     38700
     aagccccaag cgtgatgcca cggaacaccg atcccagccg ggtcgcccac cacttgtgga     38760
     tgtggtatat gggccgattg atctccttac gccagctctc ctgctcggcg atctggctga     38820
     tctcgaccag agggaaatcg cactccagtg cggtcgcggc ggtcgcagga gcgagcccga     38880
     tcttgtcggt aactgcgttc attcttcgtc cgcgaagttg ttctcgtcgg gctgcaccgg     38940
     ggtgccggtc atcgagacga gcttgctggc ttgccccttg agccgatagg cgacaaatcg     39000
     gtgctgggtg cctgctttgg ggttgggcac gcgctctgcg ctcagctcgt tcgtgcgcaa     39060
     gtcgaagttg tagccaacca ccagcgtctc agcctcgacg cgggtaaggt tgccaaccat     39120
     ctggtaacga tcatccgcac cgaagtcttc tggcaggatc agggtcatca ggcccgtggt     39180
     gccctcggtc agcgcgaaag gggtcggcgc gacgtacatc ttccggtcgc ggatcatgat     39240
     gtcgccgtag gtgccaaagc ccttcacgct cttgttcttg tggacgtagt tgtggtcggc     39300
     gttcaggaag tcgccgtggc acacaacgag gtcaacgacg gggtactgct tgcgaccgtt     39360
     gccctggtct gcgtagccgg acaggtcagc cggatagcgc ccgaatacgt agaagatttg     39420
     acggccgttg tgatagccgg ttggcacctg gctattcgag tcgtagtccc gctcgcgtcc     39480
     cggccacgcc agccccttga tctcgtagcc ttcggtgtgc tcgaccaagc agaaatcggg     39540
     ataggtgttg cgacccgagc cctcgaagtg catggacagg ctctggagac gcttctgaaa     39600
     ccagttctgg aagtggaatt ccttgtcctt cgcagagacg gattcgatca gctccccggc     39660
     ctggactgct tggacgcatt tctcgaacac gtcgaatgcg gtcgtctttt tggtcatgtt     39720
     gtcccttcaa tgaattcgct cggccgcacc acgccgcaat acttataaat cgttgttcgc     39780
     gacactccgt agtcacgggc cacttcagcg acgctagtgt tcgggtcgcg tagtagcacc     39840
     ttgatctggc gtatctgttt ggcgtccagc tttggcttgc gaccgcccgt ccgacctcgg     39900
     gcacgagctg cggccaaccc ggcctgcgta cgctctcgga tcaatccgcg ctcgaactca     39960
     gccaatgccg cgaatacgtg gaaaatcaac ttgcccgctg cgctgcttgt ctcgatcttc     40020
     tccgccaaac tctcgaagcc cacaccttgc tgctcaaggt cggccacgat ctgaacgaga     40080
     tcgggcaaac tgcgaccaag ccgatccaac cgccagacga caagggtatc cccagcccgc     40140
     agcgccttcc ggcactgctc aagctccggg cgggtggcgt tcttcccgct ggcagcttcc     40200
     tcataaatca cgctgcaccc agcctgcgtg agagcatccc gctgcaggtc taggtgctgg     40260
     tcatctgtgg acacgcgagc gtatcctatg cgttgattca ttgacgtaac cagaacattg     40320
     aaaacttgac gagtatgtta acactcatga gccgattcgg ccatcccgga aatgttgttc     40380
     cagaagtgtc tggaaaacca ccgttttctg gacatggatg tacaaaattc gcatccggaa     40440
     aagaaatgcg atcgtaagtc tgataattgt cctgggcgct ttgctgtccc catatgtgga     40500
     tgtttgacgt ccaatcctgc gatcttcttc caaaccggat tgaatcggcc cctgagtttt     40560
     agtccggctt attcttttgc cggcgctagt agctcaggcc cgttgttccg aggtgaattg     40620
     acgccccttc ctactggcca tgtctcaacc agcccagccg gcgcatggtg caaaagttcg     40680
     gctgcatttc ccgcagcttc gcccaaccag accggccaat cctcacgctg aacgatgacg     40740
     ggcatgcggt catgcacggg cgctgccgtg gcattggcgg ttgtggtgat gatggcgaag     40800
     gtgcgaagca ctttcgccat gcctggtgtc atccagcttt cccatagacc agcaaacgcc     40860
     atggtttccc gatccggccg ggcgaaggca aagggttgct tgccctccgg tgttacctgc     40920
     cactcatacc aggcatcaac cgggactagg cagcgccggg tgacgaaggc gctgccgaac     40980
     atcggcgagc tggcgatggt ttcggcgcgc gcgttgatcg ggcgacgggc ggccttcagg     41040
     tctttcgtcc aatgcggaac gagcccccaa agcagcagat ccagatgccg ggcgccggtt     41100
     tccgggtgac ggcggacggc aagagctggc tgcgagggcg cgatgttcca tgatggctgt     41160
     gcaatatcgg gaagtgggtt cgtggtgcgg aacaaggccc gcatcgcatc tggtggctga     41220
     acgctggcaa accgaccaca cataacccct cctcgatcct ttccgcttgc cccgctatta     41280
     tgttctcgtt atgttcccaa actctcggga ggggttatgg ttggatataa tggcggaaat     41340
     actacaggtt ttgtcagtcc ggccggggat ggcctggaag gaccgatcga ccttgccgcc     41400
     attctcgacc tgcggcaacc gagccgttac cccgtgcgcg tcatgggtga tgcgctggcc     41460
     ggccgaggta tcctgtcagg ggatattttg atcgctgatg ccgcaaagcc gcctgcggca     41520
     ggccaggtgg ccgtggtgat gcttgccggc gatgttctcg tggcgcagct cgcctaccgg     41580
     cgcgggcatt ggtggctgct ttcggggagg ccggacacgg cgcccttggc tgttgagggg     41640
     gatgacgccg aaatctgggc cgttgtcacc ggcctggtcc gcacgaaagt ctagccatgc     41700
     cgaccttcgc gctgatcgac ggcaacagct tctattgttc ggcggagcag gctttcgcgc     41760
     ccgagcttcg cgcgaagccg cttgtggtgc tcagcaacaa tgatggttgt gccatcgccc     41820
     gcagcccaga ggccaaagcc ctcggcgtca aaatgggcga gccgtggcat ctgttccgta     41880
     agcggccggg gagccaggcg gttgcctggc gatccagcaa ttatgccctg tatggggata     41940
     tgagccggcg cgtctatgac gtgctcacgg agcgggtgcc cgccgtggag ccatactcga     42000
     tcgatgagat gttccttgat ctgacaggca tcgctgacct cgatcgcttt tgccgcgatc     42060
     ttcggcgcga tgtgcgccag cttgccaaaa ttccaacctg catcggcatt ggaccgacca     42120
     agaccctcgc caagctggct aaccgcatcg ccaagaacac cccggccttg ggcggggtgt     42180
     gcgatttgca gtgcccggcc gatcgggcag cttacttcac gatgctgccc gtggcggatg     42240
     tctggggcat tggtaatagg gctgccgcga agctggcggg tgcggggatc gagacgatcg     42300
     cggatttcgt cagccatgac ccccaagccg tgcgcgacct gctgaccgtg accggcgcgc     42360
     gcgtccatgc cgagttgcgc ggtgtttcat gccttccttt gtccctcatg gcgccgacgc     42420
     gacagggcat cgccgtgacg cgaacctttg gcagccttat tgagacatgg cctgggcttc     42480
     gcgaggcgtt gacgagttac acggcccgcg cggctgaaaa gctgcgtgcc gaggggcttg     42540
     aggctgggca gatcgccgtt ttcgcgcata ccaatcccca taacggcgac ccttggtatt     42600
     ccgcgcagcg ggcggccgag attgaaccga ccgctgacac tggcgcactg atcggcgagg     42660
     ccgtgcgctt gttgcgcgct gtctggcggc ctggtttccg ctacttcaag gccggcgtga     42720
     tgctgaatga tctgacgccg gcaggccagc aaccaatgct gtttgccacc cgagacaagg     42780
     tgaaatccgc tgccgcgatg gcggctatgg atgctgtcaa tgccaggttc ggccgagaga     42840
     cgatgcgaat ggcatcgaca gggaccgccc ggccgtggcg ggccaggcaa cagcagcttt     42900
     cgccccgcta tacgacgcgg gccgacgaaa tcctgatcgg ccgcgcgttt tgatcgtacg     42960
     ttatccgctc ctattcagcc gctttgatgg ccttgccagc aaaccgattc tcgcccacac     43020
     ggacggccat ctcaggccgc cggaaataaa tggcccggcc gcagcgcagc ggccggccgg     43080
     atttcgggaa gatgatctgc tcatcgtccc gcatgtcgtg catgatttcc tcggcgcgga     43140
     tgagttggcg tttcagctca tgataggttt tggtctggcc ggtcgagcgc gtgcccgctt     43200
     ccaggccctt tgccgagttg ccggtgttcg agccttccga ccaggccagc acgccatatt     43260
     caccgatcgc cgcagccagc tcctcggcga cggccttagt tttgacgccg gcgaagccat     43320
     accagctgac tgattcaaac cacttggccg ggccgtcctg gccgaacagc tcgcgaagct     43380
     ggccgatcga ctgatagaac ggaaacagcg taatcttgta tttccgggca cagtcgcggg     43440
     cggtttcgag gattttcatg gggccgaggc gggcggcctc atcgagcagg aacaacacgc     43500
     ggccttcgat cgcgccatcc gcttcgtaag ccgcgttcag cagggcgccc gtgatgacgc     43560
     gggcgacggc cggtgtagca tcgagcgcct tgagcggaat gttgatgaaa accgtggcct     43620
     tgccgagcgt cagctcagcg caccggaacg tgttgccgga gacgagatcc gcataagcgg     43680
     cggtggaaag ccaagccgtg tcttgggtgg cgtttttgta gatgccgcta aaggtctcat     43740
     ccacaatgtc cttcaagctc ccggccaggt cacgggccag acggctttgc gagttcttgt     43800
     gaatatgggc caggatgttc cgcagctctt tttcaggggt gacgatggcc gcgcggacag     43860
     cgcgcaaggt cttttcgtgc ggttccaggc gttcatccca gagcatgtgc gcgagcagcg     43920
     ccgtcaccag ctccttgccg ctgttcttga agaaggaggc gttctcatcg ccgccttgct     43980
     tggtatcgcc gcaaacccac tcaaccacgg cctgcacgtc gatttccgcg agcagggagg     44040
     atacatcgat ccagtccagc acgttaaacc cgacttcgcg ggccgtgcgg ggatcaagca     44100
     tatagacctt gtggcccatg gcctcgcgcg cctggcgcag catcggcccc agctccaccg     44160
     aggggtcaag gacaatggcc gagcctgtcc atgtcagcag tgtggaaatg gccgttgtcg     44220
     tcttatagcc gcccgatccg gcgaacatca tgcaatgtgt tgagccaatc tcgcatggat     44280
     cgataagcag aggtgccttg cccccctgcc cccagcttgc acgatccttc ggccggaacg     44340
     gcatgctggc aacgctatcg cggtgaacct cgtaagcctc gcccacgaca agcccgccat     44400
     attccggggt aggccccgga aaccgggcgc gggcctcctc catcgtcatc cagcgggcat     44460
     gcccgtggtt gtcggttggg gcacggatcg gcgcatcgcg gatggcctcg atgccggggg     44520
     gcttgtcgag gctgtagtcc ttgcccttgg cgaagctgcc gttctccagg gggcgggtgg     44580
     tgagcatgat gtgggcgtga ggttgcgtct cgccgtcctg tgccttgggg gcgtggatgg     44640
     cgatatcggc gacgaggccc ttgctggcga actcggcgcg ggcgaactcg cggaccagac     44700
     cggcctgttc ggcggtgttc agttcgcgcg ggagggcgac caggacttcc ttggcggtgc     44760
     gggcatcctt gcgcttctcg gcggcatcgg cggcattcca caggcgttcg cgatcgtgga     44820
     cccattcggg cgcgttctct ggtgcgacga tctcggagag ttcgacgtcg cccttgtggg     44880
     tgtaggcatg atccagttcc tggcgctggt cgtgcaggct ggtgcgatgc cgataggcgg     44940
     cagcggcgac gcaggatcga ccctgacccc ggctgatatt cttgatctcg caacgataga     45000
     ttgccacaga acgatctcga cgaatgagga aatcaggtta ggctattttg gcgtcatgaa     45060
     caaccacgaa aggattgagt gcgcggttac gtgttgctgc gcaacacacg cggcagtcct     45120
     gggggcgttg cccccgccct gcgggcgtcc cccaccaatg ggcttgcgcg ccccttggaa     45180
     ccccgactag tttttgtgtc atggcaaagc ggacggacga cgaaatcctt gctgatctca     45240
     ctgcgaagca gcgtgagatc gagatgcgga tcaacgcggt gaaggcgcgt tcgaaagaac     45300
     gcgcccgcaa ggaggagacc cgccgcaagg tgctggttgg cgcggtcatc cttgcggaag     45360
     cggagcggtc tgaggccgcg aagcagcggc tccaagccct gctcgacaag catcttgtcc     45420
     gtcctgtcga ccgcgaggtg ttcggactgc cgcctcgacc agaccgtccc ggccaggtgg     45480
     gcgtatccgg cgacggaacc ttaagcccgg atggtgacga cagcccatga tcggcagagc     45540
     tttctttccg gagtagccat gactagtcac gccaagccat gattagtcat gggatatcag     45600
     agcgatatgt gccatgatta gtcatggcga agaacagcag agacgggaat cgagagcgcg     45660
     ccgcccggcg ccgggcggcg ctagcagagc gcgggatcaa gcaagtcctg cttatggctc     45720
     cggagcaggc ccacccgttg ctgaaacaag cggctagcct gatgatccgc gacgatgacc     45780
     ctctagagcc acgggcggcg ctgcgtcggg ctggcggggc gaatgagccc gcgccggatg     45840
     aggtgtcacc cgatcttgct gttgaactgg aagccgccaa agcccggatc gtggaagttg     45900
     agcgtcaggc ggaggcacgg ctggcgattg tgattgaggc atcggagcga cggcggcgag     45960
     ccttggaggt tgagcaggag agagtccggg ctagcgccga ggaggctcag aaggctgcca     46020
     agtctgccca ggaagctgag gaacgggtga cggcggcgca gcggcgtgcg gagaaggcgg     46080
     aggcggccat caggcaggcc aaggccctgc cgggtatcaa aggccgtctg gtgcggtttc     46140
     tggctggcga cgttctgaaa tagcaggagg ccgctgcacc ggacttctgc acctgaaatt     46200
     cctacttccg gcctatgggg cgggtgtggt gcgaaattcg taaattacgc accgactgga     46260
     ctttactgac gattaaagtg acctatcaga acaaagcaag cccattgatt gataaaccga     46320
     atgtgaggtg actcgggagg atttggctga ttcaacgtcc gctttgataa caacctcggg     46380
     caaattgatg caaattgatg tcggagttat ttcgcgtctg agttccgcgg caagatacat     46440
     gcgccccgag ggtgctgaac agctcgcctg gccgaaggcg gcgctattga tttttctcgt     46500
     ctcgattgcg gcctgggctg ccattctggc gttgttcatc tggctttgaa ttgccggcgc     46560
     acacggcacg aggaagctga gctagtcgac cgtcattcgt gccacatcga acaatctctc     46620
     ggctcgacgc tccggtccta caaaagcatg tattacaacc agcctgatga attcagagcg     46680
     cggtccgaat catcggcact gggattctac ctgttcctcg ctacagggca cggtaatggc     46740
     cgtgaagata gagggctatg tccatgacca cgatggcgct aatcatcaca acagcaaaag     46800
     acgcgatcgg acgatcatag aaaatgacgc ttttcgagct gatgcaatcc acagcacgaa     46860
     taaggcgttg ccgcagcggc accatcccaa gggtcctttc ttgtcgaaaa tattacactt     46920
     tttttatttt cgatcttatt gatgtcaaga cccgcggaac agcggaaatt ccgcatggct     46980
     gattttcacg atcttctggc tgcgcaacct taatcagcca ggatccacga ctcggcgatc     47040
     tccaattcta ctctcaggca gaacgagtcc gaatagacgg aacgcctgct ccagaatccg     47100
     tattatggaa acgccccgga agtcgccggg aagtcgtcac atagtcgccg cccggcacgg     47160
     cgcccgagcc cagagtaacc ccgccacaga gactgtcaaa gcaccccgcc acaggcgcgc     47220
     cagggcaccg cgaatacttg cctcagcacc ttcgccagcc gcgtgatcgc cgacccatga     47280
     tcacccctca ccgggccaga attcagcgtc cataacctgt tcaaaggacc aggggcaggc     47340
     ggatggaaat gtgatcagat cgaggtttgt ctcacgagcc gccgctagaa tggctcctcc     47400
     ataggcactt tccatggcct ccggcagttt tgccttgagg ctagggttgt ccgctaggtg     47460
     atccacaacc tcccgacgct gttcagcaat ggtcagccgc caactggtcg aacgaccgcc     47520
     cggctgaaat tgccatttca gcagatgcat cagcaaaact ttcaggcggc tgaccagttc     47580
     acgcttctcc gtcttgccca tggtttcgat ctcctcggcg acatgttgga tatccgcctc     47640
     ggacagacgg cccgcccgca aaagtgccgc ctgttcattc gcccaggcgt agaagtcgcg     47700
     gtcataaagg gtagaattgc tcatttggca ttctccacac ggaaggcgtg aggctgccgg     47760
     gtgggtagat ccggctctag tccatcgaga ctaggttggg atggaggggg ttcaccatcc     47820
     cctatcggca tctgtctttc gccgggaaat aacgtgggaa tgcggcgtag atcggcataa     47880
     tcaagcgagg tcgtatcctg gtcttccaag tcggccacga ctgttgccga gaatgtcgaa     47940
     aggcgcagct gatcgcgggg ctgtccccaa gccactctgt cgttgactac gtaagctgct     48000
     tccttgccgc tgccgatccg aacgatctga atccaccgtt cttcaacaag atcggcaaca     48060
     gcacggcgga cggtgcgctc gtgggtgccc atgatttttg ccagtgtttt ttggccgatt     48120
     actacagcat tctggtggcc catctgggcc accagatgat gcagtagcat ggctgcacga     48180
     ggctttctgg ctatcaaatt cgcccaagct tcatgcgcct tgcgctcggt ttgtacccac     48240
     tgaccaggtt taagcttaac gggggttccg atgatgtccg ggggtgcggt caaaccagtc     48300
     atgtttatgt acttttctgt ccaaaatcgt gactccaaat ttgtccgatt aaaagactgc     48360
     cttgtcaagt ttttggacag accccggaca cagcttgtgt ccgggggtgc ggacacaagc     48420
     tgtgtccgca cccccccata taaccaactg atttaattgg aaattttttc ggcccctctt     48480
     tatgatctta ggactggggc tccccctcat ttttgtcgtc ccggtagtcc acagggaacg     48540
     agggccgcaa gccgcccgaa gggaggcgaa gcgagcggcc cgaacttccc tgtgggccca     48600
     ccggggcgac gggcagtacg cgtgcgcgag cgcgcgaggc tgcgaagccg ggaaggaggt     48660
     gcgggaaaac cagatgcggc aaatcgcgat gcgatttgat cataagcggc ggccctgacg     48720
     ggccgcgctg gcggaaagtg ggggctagcg cgggcgcgtt gcgccctacg ggtctcccgc     48780
     gctgcgctcg acccgcgcca ggcggtcagg ggcagcggca cgggaagcaa aagcggcatt     48840
     ggggacgaag cggcgaggat gctcgccaaa ccccgtcaga cgggcgtaca cgggttttag     48900
     gggttttccg cttcttgggg tgtccgagcc gcaaaggccg ctctacggcc tcctgacggg     48960
     ctggaatggg cattctggat taatagccgc gtgggatgac cagcttgata tgccccttcg     49020
     tggtgtacca accgccgtgc tggtcactgc tggcctcgaa gcacagatga ccgccgcagg     49080
     tgttccactc cacccgagcg cctttggcct tgagtgcctt gagattggcc tgcgcggtct     49140
     ggatctcggc gtgcagggcg atgaccctgg tgtggaggcg gtggaattcg tgccgttccc     49200
     accagatcga ggcgatgctg ccgctcacca ccagcaggac ggccagcgcc aggacggcga     49260
     ctgagcgcag actgagccag cgggttgcgg tgcggacctc ggcaacctgc tggacaacgc     49320
     cggccgctgc ctgagcggtg tccgaggcag ctttcttgat ctctgtcacg gcatcgctgg     49380
     cgccgtccag agcggtattg atgctggtca cggccttggt ggcggcctga tcgacggagc     49440
     gggtgagggc gtcgggattg gctgccttca cggcctcggt gcatctggcg acctcgccgg     49500
     cgagggcatc cagagcgtct acgatggggt tgccggttgc catgctacat ctcgatcccc     49560
     cggctgcgtt cccggccccg gtccggtgtg cgttgctgct ggcgttgctg gttctcgtgc     49620
     tcgcgggttt tgaggatttt ctcggcggct cggatgtcca gcatctgggt ggcgcgttgc     49680
     atgtccgggg tggcggttgc ggcgatcagg gcggagggca ggggcaaagc ctgtctgagc     49740
     acgctggcga ggccggggag gcgttcgcgc atggtctgca tgaggtttgc gccggcctgg     49800
     cggacctgtt cccaggagcg gctcatggtg cggagcaggc tgcgatcctg cctgacctgc     49860
     atggcgtccc ggagggcgtg agcccgcgcg ccgcgtccct ggcgtgccat ctgcatggcg     49920
     acggggccga tcttgggttc cggggcgcgg tccagttcca tggctctggc ggctgccctg     49980
     atgcggtcgg gttcgggctg ggcggggttc tctgcggctg cgagggcggc ctggcgctga     50040
     tcggcgaggg agcggtgatc gacccgttcg aggcttctgg cgcgctcgag ggcgcgattg     50100
     cagtgggtgg cccactgttg gggtcaccgc acgatctgtt caaaatcgta cgctaagcgg     50160
     cgcggggtat gaacggagcg cgaacatcgc gtagcggcct gaagctggca ttgggattgg     50220
     cgggattcca gacataatcg ccggtcagag cgatgtgttc ccatccgagc ggcgcgacat     50280
     gcgccaggag atcatcgggc actgccgtac cctgggcccg caggtgctgg acggcctggt     50340
     cgagatagat ggtattccag tggacgatgg cggcggtgat gagactgagc ccggaggccc     50400
     ggaagctctg attttcgaag gtgcggtcgc ggatttcacc ctggcgatgg aagaatacgg     50460
     cgcggcgcag ggcattgctg gcctcgccct tattgagccc ggcatgactg cgctggcgca     50520
     gagcgggatc ggacagccat tgcagggtga acagggtgcg ctcgatccgc cccacagccc     50580
     gtaacgccct ggacagagtg tttcctccac cggcggcggc cagcttccgc aagatgacgg     50640
     aaggcagaac agtgccggca ttgatggatg cctttaaccg catcaactcc ggccattgcc     50700
     cgaggatggc ggtggtttcg acggcgtcgc cgatgagcgg caccagcagc ggccaggtgc     50760
     ctggcttttc tatcgtgtag agcttgcggt cccggagatc cttgatcctg ggggcaaacc     50820
     tgtaacccag cagatggcag agaccgaaga catgatcggt cgcgccggcg gtatcggtat     50880
     aatgctcggc gatgcgcaga tcggtctggt ggacatgatg cagcagcccg tcgagcacat     50940
     aaggcgcctc gctcatcgtc gcggagatga cgcgcgtgtg gaacggtccg tattgaccgg     51000
     aaacatgggt gtagatcacc gcgcccggct cgatgccgta tttggcgttt accgagccgc     51060
     cggctccggc gcggcctgcg gcccggaaat attgcccgtc cgaagacgag cttgtcccat     51120
     catcccagat tgccgccatg gggtgtgcat ggtgcgcatt gatgatggcg gcgcgggcgg     51180
     cgacataatt gtcatcgctg atgtgccatt gggccacatt gaccaggtgg tgatagctga     51240
     gaccgcgcga ggcgtccgcc atgcgggcaa ggccaagatt ggtgccgtca gcgagcaccg     51300
     ctgccagcag ggccgctttg tcggtgacgg ggttaccggt gcgcagatgc acgaacctgt     51360
     ccgtgaaccc ggtccaggca tcgacctcgc tcaaaacctc ggtgatccgc acccgcggca     51420
     gcatactgtt cagccgcagc gccagatcgc gagccgcgtc gggcacggtg ggcggcgtgc     51480
     gggcgataaa aagtttgccg tcctcaatct ccaccccgtc gaggtcgccc tgcgcggccc     51540
     gggcggccac gaaggtcaga cgctcgcgca gcatctctgc ccggcttgcg acgtaacgat     51600
     cgggatcggc ctcaccatcg atgccggtgg ccgcacccgc cccggccgga agcagatagg     51660
     tctcgaacgc ctggtaatcg cggctgccag cgacccagat attactgccc cgcagcttgt     51720
     cgcgcagcac ggccagcacc gctgtttcat agagccgccg gtcggctgtg ccgccggcaa     51780
     aaatcaattt ccgccactgc ggcggcagga acgtggaggg cggccgcttg ggcaagctgc     51840
     ggatcgcgcc acggttcagg gcgcggagaa gttcgatcgc ggccagaacg ggatcgttcg     51900
     gcatattcga ccggaaatcg aaggcggcca ggaagcgggg gctgaaccgg cggagcaccg     51960
     tatatcgctc ggccgccgtg accaaaatat cctgatccgc cacatcggcg acggcgccga     52020
     tgatcggcag cacatcttcg agctggttca tgccgatctc gcgctcgatg gcggtgatcc     52080
     catcttctcc ggcctccttc gcctggcgaa gggcggcgat cgtccggcgg aacagcagta     52140
     gcgccttggc gacatcgcgc cgcgtggcct gaaaccgacg ctcatcgcgg ttgcgcgccc     52200
     ggctgaacaa agtgccgaca tatttctcga acatggcaag cgtcgcgtcc gtcagacggg     52260
     tttccaggct tgcgatctgg gcaatgagaa tggctgtgcg ccgcgccggc tccagatcgg     52320
     cgatgtgctg cacggtcatg agcgccccct cgtcggtcag ccggaccagg cgggcagcat     52380
     ggatacgacc agcccgtgcg ggatcaatgc ccatggcgcg gacatattcg aggcgatcga     52440
     gcagggagac gatgttggag ggagctggtg attccgaata atcccgcagc caggcaaaac     52500
     gggagcgacg caactcggga tcgaccgtca gcagctcggt cagagcactg cgctccgcat     52560
     cggccatccc ggctgccagc acctcgaatg ttttcttgcg tgctcggaca cgggcggcca     52620
     gtccaattcg ctccaacact gtcgccgagg gaagcaatac ccggctttct ctcagatgaa     52680
     cgagcatagc ctggatgatg ggttcgccgc gatctgtggc ccaagccgta tccgcaccag     52740
     catgtaggca ggcgcgccag tcatcgaggc caaaactacg cagaccagtg aacttttgga     52800
     gctcgaccaa atgctcccga cgggtttcag cacggcgcgc gtattccgca aacaacaaag     52860
     gatcgacacc gatctgttca gcaacaaaag ccagcgccgg cgccggtgga tattccgatg     52920
     gatccagagt gcggcctggg aagcggagaa cacagagttg cacggcaaag ccgagccggt     52980
     tgcttgcccg gcgtctgacc ctgaccatag cgaggtcagc agcatccagt acgtaatgcc     53040
     ggctcatgga ggccatgtcc gttggaattg aaaacaaacg ggctcgttgt tcagcggata     53100
     aaagaacgcg gagtggcata tcgggttccg gttgatgaga aaattagcgc ccaccgtgcg     53160
     tccgcaagag gatcgttcaa cggacagatg taacggcctg gcactggtgg ctgtttccct     53220
     cggcaacgga tggatcattt aactggtacg atatcttttg caatgaaggg gggtcatacg     53280
     ttacaattcc gcatggccca caccctgatc ggttacgccc gctgttcaac cgaccggcaa     53340
     gatctcgccg cgcaacgcgc cgaactcgaa cagctcgggg taaagccgga ccgcatctat     53400
     acggaccatg gcctcacagg caccaatcgt gcccgccccg ggcttgctca agccttggcg     53460
     gcggtgcgta aaggcgacac cctggtcgtg ccaaaactcg accgccttgc acgctccgtt     53520
     ccagatgccc gtgcgatcgc cgatgaactc attacccgcg gtgtcaaact cgcgctcggc     53580
     gcggccgtct atgacccaac cgacccaatg gggaagatgt tcttcaacat tctcgccacc     53640
     ttcgcagagt ttgaggccga cctgatccgg ttacgtacca gagaaggcat ggccatcgct     53700
     cgcgccaaag gaaaattacg cggcaaaagg ccgacgctat ccgaaagaca acaaaaagaa     53760
     ctgcgccgca tgtacgacac tggcaattat tccatcactg atctcgcaga cctattctcc     53820
     gtctcccgcc caaccatcta tcgtaccctc gccaggcagc ccgccaacgc ttagcgtacg     53880
     attttgaaca gatcgtgcgg tgaccccatc gacgggcttt gtcggggcgt gatcgcggcg     53940
     gagtgaccag ccggtgacgc ggcggccgcg cacaagctga atgaccccgg cgaggaaggg     54000
     gatcgcgaag gctggcacgc cgctgatgac cagccagacc cgcacgacag ggtctccgct     54060
     ggcctcgaaa agatagagcc accattgcca gaacggatgc cggaaatgcc agaaaagccc     54120
     ggtcccgata aggaagatca tcgaggcgag gacggtgaag aacaccaggc cgagcaccaa     54180
     cccgacgagg agccgcatca cgccgcgcca ggtcatcagg cggcccgcaa gagggcggcg     54240
     gctgtttcac cgcgcctggc cgcgtcaggg ccaaaccaga ccttgccgat ccggtaggtg     54300
     ctgccggaag tctcgaaggg gatgatgaga tcgacagccg ccgcgagcag atcgcaaagc     54360
     gtggcgtcat caaagccagc acccttgggg gagcccttga tgagcgaaaa cagcttcttg     54420
     aacgcctggg ccggattggc cccgtgaatg gttgtgatcg agcccggatg cccggaaacc     54480
     acctcgttta cataggtcca tgccgcatcg tcgcgcagct cttgcaggag cacccggttc     54540
     ggccgcatgc gaaggctggc ctgcaacagc gcttcggcgt cgattttcgc ggtggagagg     54600
     ccgtctttcg agtagagcag ccggacatga ttcggctgcg ggatcaccag ctccgccgtg     54660
     tcctcgatcg tgatgatccg ctccgccatg gggatcgccg agatcagcgt tttgctcatc     54720
     gtggttttgc cggagccggt ggcaccacag agcaggatgg tcatgcggca gcgtacggcc     54780
     gccgcaagga agccctcaag atcgccggaa tcgtagtatt ccagggcttc cgcaaaattc     54840
     cgggtttccc ggttttgtgc ccaggtgttc cacccttccg actgataccg ggaggtgacg     54900
     gacgacagcg gcgccaccgt cgagccgggc cggcggatcg tcagactgac cgtgcccgtt     54960
     ggcacggccg gcggcagaca gacttgcagc cgttcgccgc ctggcagttc ggtggaacaa     55020
     agcggcgacg tggggccaac atcctgacgg cgcagcgcgc cggcgagcac ggcaatatct     55080
     tccagcgccg agcgatcgag cggcatcttg tatcgctcga aaacgccgcg ctggcgcacc     55140
     cagcactcgc ccggcctgtt gatgcacagc tcctcagtcg ccccatcgtt cagccagggt     55200
     tgcagcgggg cgagcaggaa gcggagcaga ggcgcggccg ggctttccgc aacgagatca     55260
     tcggaaaatt cggtgtcgtt catagttccc cccgcttttt ggccctgatg accatggccg     55320
     tgtgccagat tttcagagcc aggaagatca ggccgaggcc ggccgagcta tggatgaccg     55380
     cggccgattg atggcccagc aattccaaga tgatcagaac gagccacagc cccagaagcg     55440
     tgctgtagag ccagccttgc cggagaaatt tctgccgccg gcgcgcgtgg cgacgatctt     55500
     gccattgaat gtatttgacg gcggcctttt cgatcttctg gttgagccgc tgccctgctt     55560
     gcgccaggcg gtccaggcgg gtgcgccagc tctccctcat ggcgagacaa ccgacagctt     55620
     atagaccttg gagaaattca gatcgcgggc cacgaagatc gagacattct cgccctggtg     55680
     cttggtcagc gtgggcggaa tgtcgatcgt gtgttgcagc gtggtgttgg cgatctggtt     55740
     tgtgcttgag ttcatatatt ccagatacgt gttgccggcg ctgttctggg cggcgtttgc     55800
     cgccacctgc atcgagccgc cgatgatcgt catcatgatc gccgcgccga accgttcgag     55860
     gaaatggttg ttgaccgcac ccgagacgcc agcccggccg aggggatcgg ctgccggcga     55920
     ggcgagctga atggcgacat tctgcggcgt caccgcgcgg tcccagagga tgaaaagccg     55980
     atcctggcct tgcaccaggc cctcgcgaac ctcgcccaga acttgcgttc ccttgtccag     56040
     caacgtcacc gtgccgttca tcgagcgcac gggctgcggt aatacgcatt tgacgaagcc     56100
     cggcagggtc gagttgatcg cggtttgcag cgtgcaggga atgatggtgc cggccgcgat     56160
     cgtgaaattc ggatgcgcga tcatcgtggc atcggccgcg ctgaactgat ccgcgttgag     56220
     cttgctcgcg aaggccgtgg gtttcacagg cccagcggtg ggagcgccgt tctggcccac     56280
     ggtattgctg gcaggttgcg cggatactcc accgccagtt tggttgaacg ccatgatcgg     56340
     tgccttgagc gccttcatgg caggggattc ctgctgattg ttcaggaacg gattgtgaaa     56400
     ccccgtgttc tgcttggacg gcaggggcag cgcggcaggt ttggaggcag gcgccgtgcc     56460
     gccgctcgca ttattgacga agggccggcc ttcggtcccg ccggtcacgg cggcctgttt     56520
     ggcaggcttt ggctcatgat gggtggtgag ctgcgttacc acgagcacga cgccagcgcc     56580
     gagggcgcag gccagggcaa tgccgccgat ttggcgcccg gtcaggcgct gccggctggc     56640
     aaccgccgat tgttcctgtt cgaccggcga cggcgctgcg ttgtcgtggc ttatcggccc     56700
     ataagggcgg tcccgcttgt cctcatttgc catcgttgaa cgtcctcatc tcgcgcgcga     56760
     catccgggct gatcgtgtgt gtgcctggcg tggcgccggt cgggttgtat ttgagatcgt     56820
     aaatatcgag gaccgtatgc ccgtcgcgca gccgccattc tggcgcggtg cccggcacaa     56880
     cgaccgtatc cccgttgacc gaataattgg cagttgcttc cttgccgtcc ggctgaacat     56940
     agaaaatggc cgggatgcgc tgcatggccg ggaaggtgaa cacggttgaa tagccgttgt     57000
     cccagacctc ggcgggggcg agttgatgat cgccacgggc gacatactcg taattgcgtg     57060
     gcccctggta tcgatcgacc gttgccgcgt tcatgaccgc gcgcgcttca tcaagccggt     57120
     ttttggcttc ctgctggacg gccttcgcct cggccgcctt tcgcttggcg agctggcgct     57180
     cataagcctg gtgcggatag gtgaacacca cggcgtaatc gacattctcg ccggcgccga     57240
     gctgcttgtt cacggtctca aactggaaga aataatgccg gagcttaccg tctgccgttt     57300
     tgcaaagaac cgcgatcggc tgtgccggca gaatgccagt tggcttgatg aaaaggtaat     57360
     tctggaccgg gacgaccttg agataggcgc tatcgctctc cgcgactgag acgacctttt     57420
     ctcccgttcc aaactggacc gtcagcgccg cacccggcgc ggtccagatg tcagtgacgt     57480
     tgcctgactg atagggcacg tagcgaacgc gggcatcttc atgccccggc tgaggatact     57540
     gcacagcaaa ggccgtcccc atcatgccga gccaaatgag cccgccagtc gcgagtttgc     57600
     gcgagcactt catggcgaat cctttagggc ttggtagttg gtcacaatga gcccgctggg     57660
     atcagcaagg cgggcggaaa ccggcagcgt tgcgacattt tcaaaaccga ccgtcgcggt     57720
     ccatgtcgaa gtctgcggat cagagccgta catcgtcacg gtacggcgga agcgcacgag     57780
     tgcgacgttc ggccgcacca tggacaggct caccatctcg acgctgattt gccccttttt     57840
     gccgaccgtc acctgcgggc tggtgctgcc aggccctttg tcgaggaacc agctttgata     57900
     ggtgctttgc accgtggggt tcgacataag agaggcaaca tcatagcgat attgcgcgtc     57960
     ggcgaagtca tagctttcgc gcgcacggac atattgccag atcgccgccc tggtcatcgc     58020
     cgccttctca ttgctgggaa ggctgttgaa attcatcgtg gtgctggtgg tgccgtcaga     58080
     ttttaccgtg atgaacgcag gcacgagctt ttcgagcggc aggatcatca cgatcgcccc     58140
     ggccagtgtg acgttgaccg ccagggacac gccggccacc acccagccca cacggcccca     58200
     gcggcgggcg gtgcgctttt ccgaggcttg gaaagattca acatcttgga aataggaggc     58260
     cagccgttcg ttatcgatcg gcagcgccgt gcttttcatg tccgcattca tgtgcgcggc     58320
     acctgcggcg gttgcgccaa ctgcgctgaa cttggcgacc aatgaccggg attgagggcg     58380
     aacatcggcc cgtgagcctt tgccagcggg tcactggcgg cgcagcccgc cagcaggccg     58440
     gccgcgcaca tgaggatgat cagtcgagac aacatgcggg agcccttcat tatttgaacc     58500
     agttggccgg gttcacgatc ccggaaatat tgaagtccac accgccgcca atgtaggcgg     58560
     caatgccagg gagcatgatc gtgatgaagg ccgtgatggc ggtataggcg gcgatttcgc     58620
     cgaggatgat gatttcagtc tgcacagggt cagcgacgaa agttgtcgag accttggtgt     58680
     tcagaaaatc agtcatgccg ccggtgaaca gcgatagaag cgccgtgatc aggagcaaca     58740
     ggatcgcgag gccgatcagc ttgccgagcc agcgttcggg aatacccttc gtcgcttcaa     58800
     agaggtatcc gatcagcagg aatggcccga tggcgacgag gagacccgtc agtgttgtcg     58860
     cgatgagata caccgcgaac acaagggcaa gagcgatgaa aaagacgaca agaaccagct     58920
     cgatttcgat gccaaggaca tatggttcga gcacgcaggt cgcgcagttt gcctttttgt     58980
     agatgatttg tccggcaacc caaaaattat tgaaggtctg atcaaggctt tgcgggatgt     59040
     tgctcgtatt cccagacgaa aaagtgctgg cgatgaagct aggcagagac ttcataaaaa     59100
     gagtctggac gtaggaatca taaagcgacg tagaagcgat aatgcccacc acgatcgcca     59160
     tcgttgaaac ctttgagatg ccgtaacgta tgtccaggct gccggtcatc atgaggtagc     59220
     cgaggatgat gacccagatg accagggcag cggagagagg cggtaaagcc gccgacaacg     59280
     cggagccgac atcgctattc agcgattgca agaatcccgt gctgtattgg ctatacataa     59340
     actcaaagat gttgatggtc gtgttgggga cgctcattag tttgaggtct ttccatcaag     59400
     ataaggtttg caagcgggca cagcgttctt gcccgcagcc aaacaactgg ccctgatgct     59460
     ggcgtcgagt tgagagtttg tctcacggcc gccattcggc atgggaacga gtttgtcctg     59520
     cactgatggc ggtgcgatga cgtacacgta gtaggcccca ccgcccgcga tcacgccggc     59580
     accaatcagg gcggcgatga tgagtttcat tgtccctgac atgccgatgg ctccccgccg     59640
     agagtttgag cgtcgctgca cagcgtcgag agcgtttgtt ctccgccttg tgcgttttct     59700
     tgggcggcgg cctcctgacc ggcgcggttc tcctcgaacg ccaatagttg caggttttgc     59760
     gcctgggctt gctgggcctg cacatagttc tgttcggcgg agaggcgggc ctgaattgag     59820
     gcgacctgct ggatcgtctt ggcgctgtta agctggctct gaatctgcgg cagctcttgc     59880
     tcgcgagctt ccagagattg caggttctgc gtggctatcg cctcgaaatt cgcggtctcg     59940
     ttggcgcctt gctgcatttg cgtcgagccg aaatccgagc cggtcgggat atagaccttg     60000
     ttcatgttgt aatattgttg cgcgagagaa ccgacattgc cgctcagcga ggagggcggg     60060
     ctgataccgt cgagcatgtc cggcaagatg ctggtgttgg gcaccgtgtc ctgcatggcc     60120
     gattgatcga gctgttgcgc ccattggttc gggttcacgt cctgcgagag cgcgttgtag     60180
     gtcgatttta gctcatcata ttggctgacc agctcggaat attgctgttt tgcctcgttg     60240
     agctggctga tgagctgggc gagggaagcg ctatcgatca ccggcacttg cgccaaggcg     60300
     ggtgaggcaa agccgagtgt ggcgatagcg aaagcaattc cgagcaggcg tgcgggcttg     60360
     agcatgtgat cctcctattc aacttcctcg cggaaccggg ccatgaactc cggcagccag     60420
     gccgtcggat cgtcgccatg ggtggcgcgc agccgttcca caaacccaac cgaggatttg     60480
     cggctcgaca ggatcgcgac gaactcaggc agagcggaaa ggtcgaaatc tatgatcgcg     60540
     gagccgccat gccgcttgat gagcagttgc cgggagttgg ggagcatgtc ctcggcgatg     60600
     gcgcggaact ccccggccgt gaagttgagg cgcttgcggt agaggttttc ctcggcgcca     60660
     ggcgtcgggc agaacacgag tgtttggcac tggcgcaaga tgctatcgcc ctgcggtgaa     60720
     tcgagcaccg gcgcgggctc ttgcgtcgcc agcagcacaa cggcgttgct cttgcggacg     60780
     gtgagcatga aatccgccca gattttggcg aatagcggat tgagcagata gaaattgaac     60840
     tcatcgcaac tcaggacaaa gcggcggcca tcgagggcct ggctgatgcg atagagcagg     60900
     taattcgcgg ccggggcgca gacggtccca ttgtcgagga tagccgtcag gtcaaagccg     60960
     accgtggttg catcaagcga cacgtcatca tgttcgccat cgaaggccca gccgagcgac     61020
     ccgcccttgc accagcgttc gaggcgtgcg cctgccccca tcggattgcg ccagtcgagg     61080
     aactgacgca gcccggcgag cgagcgcatt tccggggcca ggcgcagcag ggcttgaacg     61140
     cctcgggtca ggcgggcgtc atcctcgggc gggagtgggc cgtgcccgtc ttgctggatc     61200
     agggcggtta gccactgaac gaggaaggcg accgattccg gggtgttgtc gagcgccttg     61260
     aggggcgcca ggccgctatc gcgccctgcc ctcaccacca gataacggcc gccgacagcg     61320
     cggcacagca gctcgccgcc ccggtcctta tcgaagaaca ccacggcacc gttgcgggcc     61380
     gcgaaatatt gcgggaacag cgccagcagg aacagcatga acgtggtttt gccctggccg     61440
     atctttccga agatcgccgt catgccgaca tcctcgacat ggggcacgta atcataggcc     61500
     gtgcccgccg tggtgcggaa gcgcgccatg gctggccccc acttgccggc acgctggccg     61560
     cgcggaaaag cctcgaagcc ggagaaggcc gcgaaattgc gcgtggtgat ggtgcccggc     61620
     ctggtgcgcc attttctgtt gcccggcagt tgtgcgaaat aggcggcttc cagccccgca     61680
     ctctcttgcg cgacgacgcc gccactattg gcaatgaccg tgcgggttaa gccggacagc     61740
     cgatccagct cctcgatcgt gtccgcatag accgtcagcg agaagtgatg ctcgcccatg     61800
     gcgatcttgc ccgaggcgag atgatcctgt gcgtcggcca gatcattgat ctgcgatttg     61860
     gctttgtcgt tcgcggccgt catctgagcc gatttcaggc cgagccgctt ttcagaggta     61920
     tgccgtgcgt gaaagtcgaa ggtgtggacc atcaccaccg ggcacggcag ggaaaagacc     61980
     ccatcataca tgccggcata ggtttcggac ggatactcgc gatagccgaa gatcgccccg     62040
     aaccgggaaa cgcccggccc gcgcagctca aaggcgcggc ggccgaagat cgcgcgatcg     62100
     gtatagaggg cggcaccgag cgggccgctg accaggggca ccggcgccgc cgtgcccgtc     62160
     aggatcaggc gcagcgcctc ggcgatttca ctgaaataga actggccatt ggcggcaggc     62220
     cgcaggccca gccggcggac atcataaggg gcgagggttt ggctgatggt ttgccaaatc     62280
     tcctctagct ggcggatgcc ttcggcggtt gcgtggggct tctggcgctc ccgtttgcca     62340
     ccgaacaagg agcccgtggc gccgcccgcc ttgccgccca gcggattgcg gggggagaca     62400
     atcaccgtca gataccaagt gttttggtag aggcggcccg tgaggacgcg ctcgcgatag     62460
     gcgcgatcga gggaggcagc gaactcgttg ggcatgagcg cgtgcgcgag ctgcccggcc     62520
     cccggccctc gcacgaaagc cgaatgcagc gtcacgttgt catccgcgac gtttttgcag     62580
     agcgcattga ccgtgaccag gctcgcggcg cgatccgcat cggccgccag ctcataggga     62640
     gcgccgggga tttcggccat ggcgagaacg ctgccgtcat ccatgagcag gatgtccggc     62700
     cgaacatgtc cgagatacgg caaatagcgt tcggcgctgc gttccgccct gatttgatta     62760
     cccggcatcg cgcatccccc tgcccttctg gaccttcatc gggaacggcg cgggagatgc     62820
     cccgccccaa gcctgatttt ccccggcgcc ggtggccttg gtgcggaacc acagccaggc     62880
     cacacggggc gcgttgtagt cgtagcgaac gagccagcgc gccccgaacc agagcggcag     62940
     caccagcgtc agataaaagg ggttgtgccc aaagatgacg atcatcgcgc cgatcatgat     63000
     gattgccacg gccatctcga tcggcagccc gagaaacagc gccggccgtg tcgcggcgac     63060
     aaatagagga tcgcgctgcc tttcgctcat ggctcagcca ccgcccacga aggttgtcac     63120
     gaggtaggag ctgccgaaca ccagaaccag gccggccgcg agccagccga tcgcgtggaa     63180
     gcccacgcgg ccggtccagc acatgaagcc gactgcggcc acggcgagca cggcaacgcc     63240
     ctcgccgaac gggccgagga tgaatgtcgc gatgttgtcg atgatggttg tggggctggt     63300
     gccgccagaa accacctggg catgtgcgac ggcgggaaga aggagactgg ccgccacaat     63360
     aacggcaggc tgtaaccatg agccccggcc catcttgcta gccgtcccag ccgcgatatt     63420
     tgccacgcca gcgcgtagct tagtgagcct ttgtttcacc gtgagtttcc tgttttgagg     63480
     gttgagccgg gccgctgggg ccagaagcgc gggacgcttg aagcgtcacc gcatgcgccg     63540
     ccgcgaagcc agccgggccg atcgagttcg ggaacacatc ccaggatggc gagcgcggag     63600
     gagatgaggc ggatgacggg ctggcctgac gggaggcgct ggccttgggg gcttgcacgc     63660
     tatcggcgga gtcgatttca ggcacaacat atctggcggt tgagaccacg cggttgacgt     63720
     agccgttctg gaatccctgc caggctgaac ccgtgttgta gcgcgagagc gcggccagga     63780
     gcgccgcctg acgcccctgc ccgttcggct gcttgtaatc ctgcgccagc agcttgccgc     63840
     ccgcccgcac cgacgcacag gcatcaaagg ccgtgctgac tgtcagcccc aagtgggtga     63900
     ggttcgcgct atcgatctgc atgaggccga gatcaaccga atgcccggcg gcaatcagcc     63960
     gcttggcaag ggcaatcgcg ccgggcgcat ccaagggccg tatgctctgg cgtgtggtgt     64020
     tgtcgtgaat cgccaaaatg ttgaaccccg actcggtgct ggcaaccgcc gccagcgttc     64080
     ccggtgcgac ctcgggggcg cagcgattcg cgagagcgag gaaaatggcc ggggcgatca     64140
     gcatctcccg tcattccggc tcaggctggc cactcggctg taatttttca tggttctcat     64200
     attgcagaat cgatgcaaca cagtcaatat cgtggcaacg ttataagata acgtgtcacc     64260
     ttttgatgga atcgatgccc gccattacaa accaacgtat gggacgtaag cgaatggatg     64320
     cagagcgagt cgtggtgcgg ttgccgacgc cggcagtcaa agcgattccg tcgctgctgg     64380
     cggaccatga ggaccgatcg gattttatga gagaggcggc cgagcttgag atcgcgatcc     64440
     gttcgttgga cgtgtatccc gaacttctcg ggtatctgac ggcaaacgaa tctctggcgg     64500
     atttctgcgc gcgggcagta cgccaagctg cgcagcggcg catcaaaatg ctcaaggaga     64560
     acatcgccga ggatgaacca aaatcccctg gccaagcgtc cgggcctggc ggggcatcga     64620
     gataggagcc gctttaaaag tgaggagtcg gttacatctc tgtcatgttt cttgttggat     64680
     tttcccccgg ctttgccacg cagcgcaaaa ttgccggggt ggtatttcat tcgtccttag     64740
     atcgtcgccg tcctttagcg ggagccgtag tctgcttagt cgtaatgttt tgcgaatctt     64800
     gaaatcgtat gtttttataa ctcaatgcaa actcgggttg caagagttca taaaggtgca     64860
     cgcggaacag ttcggcgatc gaggacatgc gatcaatgga aacgttgatc tttccatgct     64920
     caaccttgcc gatataggcg cggtcagcgt cgatgaggtt agccatctgg gtcagcgaca     64980
     ggccaagcgc gtttcgcccc gccctcacgt tggcgccgaa cacgaatcgt tccggcgctt     65040
     tcagtacgcg gccgtcgatt gccgacaact cgctcgttct tttattgggg ctgctcaccg     65100
     gcttggtggc cggatgctcc gttttgccca tacatctatg ttccttatgt ctgacacctg     65160
     ctgttcgcat cagtttgtcc gatgcgcgca catgactcga ccagcgcccc acgattcaga     65220
     aagatggata aacccacatc atcgcattgg acgtgctccc aaaacaacac acagtcgcgc     65280
     gttgacgttg ctctcttggg gagcggcggt catcatcgcg aatgcccgga ctcgcccgcg     65340
     cgagtcgcag gctatacgcc actttgacac aggaggaatg accgcgaaac acgcctagaa     65400
     aagcaaaatc ccgcccaaag aggacgggac ctgcaaacga cataggcttt tggctgatac     65460
     cgtgtccatc agcggcaaac tggtgggcac aaaactcaaa ctgcacagcc aaaatgcccc     65520
     agagccctcg aaaatgcaag ccctagcttg caagggggag tcgc                      65564
//