Dbfetch

ID   AP012036; SV 1; circular; genomic DNA; STD; PRO; 271573 BP.
XX
AC   AP012036;
XX
PR   Project:PRJDA60101;
XX
DT   02-MAR-2011 (Rel. 108, Created)
DT   28-SEP-2016 (Rel. 130, Last updated, Version 3)
XX
DE   Acidiphilium multivorum AIU301 plasmid pACMV1 DNA, complete sequence.
XX
KW   .
XX
OS   Acidiphilium multivorum AIU301
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acidiphilium.
OG   Plasmid pACMV1
XX
RN   [1]
RP   1-271573
RA   Hosoyama A., Yamada R., Ito N., Takarada H., Narita-Yamada S., Nakamura S.,
RA   Katano Y., Ichikawa N., Nakazawa H., Fujita N.;
RT   ;
RL   Submitted (28-DEC-2010) to the INSDC.
RL   Contact:Director-General Department of Biotechnology National Institute of
RL   Technology and Evaluation, NITE Bioresource Information Center (NBIC),
RL   Department of Biotechnology; 2-49-10 Nishihara, Shibuya-ku, Tokyo 151-0066,
RL   Japan URL    :http://www.bio.nite.go.jp/
XX
RN   [2]
RA   Narita-Yamada S., Nakamura S., Ito N., Takarada H., Katano Y., Nakazawa H.,
RA   Hosoyama A., Yamada R., Fujita N.;
RT   "Whole genome sequence of Acidiphilium multivorum AIU301.";
RL   Unpublished.
XX
DR   MD5; fc17b652847911a7397bee34e2e929e1.
DR   BioSample; SAMD00060977.
DR   EnsemblGenomes-Gn; EBG00001461298.
DR   EnsemblGenomes-Gn; EBG00001461299.
DR   EnsemblGenomes-Tr; EBT00001615060.
DR   EnsemblGenomes-Tr; EBT00001615061.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00519; suhB.
XX
CC   ##Genome-Assembly-Data-START##
CC   Genome Coverage       :: 8x
CC   Sequencing Technology :: ABI3730
CC   ##Genome-Assembly-Data-END##
CC   Please visit our web site.
CC   URL:http://www.bio.nite.go.jp/
CC   DOGAN ; Database of Genomes Analyzed at NITE
CC   The database contains genome sequence data, physical maps
CC   and the genomic and proteomic data of the microorganisms
CC   analyzed.
CC   URL:http://www.bio.nite.go.jp/dogan/Top
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..271573
FT                   /organism="Acidiphilium multivorum AIU301"
FT                   /plasmid="pACMV1"
FT                   /strain="AIU301"
FT                   /mol_type="genomic DNA"
FT                   /note="strain coidentity: NBRC 100883"
FT                   /db_xref="taxon:926570"
FT   CDS             1..1194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="ACMV_P1_00010"
FT                   /product="replication protein RepA"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82797"
FT                   /db_xref="GOA:F0J6T0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR017818"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6T0"
FT                   /protein_id="BAJ82797.1"
FT                   /translation="MDQIESPPDKIVRHATLLSNQLHVLRQRMYPPEAQKSLRPFATHE
FT                   VSSLTSIPESTLRTMSIEGKGPIPSRRENNHRTYTLEQVNELRQFFAAQKPNDALRYLP
FT                   RRRAGEHLQILGVVNFKGGSAKTTSSAHLCHYLALQGYRVLAIDLDPQASLSAMFGAQP
FT                   ELDVGANETIFASLRSGEDRRPMREIVRKTYFTGIDLIPGNIEVMEYEHETPRLLAESN
FT                   GGEAALFFERLRMSIAEVEDDYDIVILDTPPSLGFLTLGAICAATGLIVTVHPAMLDMM
FT                   SMSQFLLMMGDLISVIGSAGAALQQDFLKYLITRHDPNDQPQTQIVSLMRHLFADDVFI
FT                   PTAIESTAVESAGLHKKSVYELAPGDVGRDTYRRARDSMDAVNFAILEMINRAWGRK"
FT   CDS             1191..2231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repB"
FT                   /locus_tag="ACMV_P1_00020"
FT                   /product="replication protein RepB"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82798"
FT                   /db_xref="GOA:F0J6T1"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR011111"
FT                   /db_xref="InterPro:IPR017819"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6T1"
FT                   /protein_id="BAJ82798.1"
FT                   /translation="MSKKPSRSIVGSFNLLSESLRPDKEPVEPNNPSFSPASHHTPRMP
FT                   AGVVAATERSISQLREERDQLRARLSNMAPDELDPAILEPSPIPDRLPDDDQEGFNALV
FT                   DSISAEGQKLPIQVRPHPSKPGRYQIVYGHRRWRAAQHLGVKVRAFVVDLDDRELIITQ
FT                   GLENESRQDLSWIERASFARKMEDGRIDPRDIKGALSIDDAELSKMRMVTRVISRELIE
FT                   TIGRAPKIGRPRWLNLAKALESDPSREADVRQTLSGDKAPTSSNERFSLAMATLQAEHL
FT                   KSSDEIDLLTSKDVRIGTASFSGSSVTIRFSKDHAAPLREFIRSALAELADAYERQVAS
FT                   NRSKKG"
FT   CDS             complement(3009..4136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00030"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00030"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82799"
FT                   /db_xref="GOA:F0J6T2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6T2"
FT                   /protein_id="BAJ82799.1"
FT                   /translation="MPDNTEFAPQDRPDAPSAGSLVPSPPPLAGDGHAVRRWFSEIEDE
FT                   PVPVADGTLAGARSAASAYARRAKADNTRRAYRAAVRVWCLWCDRHGLTPLPASGADVA
FT                   AFLADERGRGVSTETLKLRRAAIRYLHRLAGCPVPTDDACVAETMAGIQRDAASRGEIR
FT                   RKKVAATATVIRRLLAAIGDTELTDLRDRALILVGFAGALRRSELAGIRIEHLTPSERG
FT                   LRLTLPQTKGSQAEAVTVALPYGDTELCPVHALERWRVAAGLQRGPLFRRIWSPPSGRK
FT                   GRERTAPPGPVIGEQALTPQSVALIIQRRAMAAGFGRRDLGGHSLKRGALTTGMERGVH
FT                   PARLKRLGRHKSYDVLGEYLEFGDLFDGHPLDGVL"
FT   CDS             4610..5725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82800"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6T3"
FT                   /protein_id="BAJ82800.1"
FT                   /translation="MAPPEMPAQQLLMIALERAAGAFARLDQALSMHPLRGAFLYRFRL
FT                   DAVRRQAMVDGQMIEPWHLAALLEGVRLRMDPWLSLAERGDIFDAARHAFSMHQWIVEP
FT                   DFDQEGEIQVAMKAIERDVARASPLLGAAHAAHAWLAGGGRRAPLRGALIRFWRQSGLL
FT                   HLPVPITGPQALGGDLPFDRESWIPLLLHALANEAAAAQDLIRDLDRAWQVARASIGKR
FT                   RKNSRAAMAIDILAATPIISAKSLAERLGMNVANAHTLLGELLEAGLVVELTHRSKRRL
FT                   FGLSGMGRMRDYVAPPRRPQPGRGRGRPRIEPEMPQPAPPAELPPAPSGGVLPRLAFDF
FT                   SDLEEAMAAADAAIRETRISLDRIRQAGRPE"
FT   CDS             complement(5831..7021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sgaA"
FT                   /locus_tag="ACMV_P1_00050"
FT                   /product="serine--glyoxylate transaminase"
FT                   /EC_number="2.6.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82801"
FT                   /db_xref="GOA:F0J6T4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6T4"
FT                   /protein_id="BAJ82801.1"
FT                   /translation="MSLQNPVFIPGPTNIPEVIRKACDMPTVDHLSPAFAPILKAALAG
FT                   CRGVMKAERGEIFIFPSTGTGGWETAISNTLSAGDTVLAARNGMFSDRWIKMCRRFGLE
FT                   VIQIDVTWGEGIPLPRFAELLHEDKAGRIKAVLATHNETATGVVSDIAGLRRVVDEASH
FT                   DALLLVDGVSSIGSMPFEFDDWRVDVAVTGSQKGFMLPPGLAITAFSEKALAASRDAKL
FT                   PRNFFNIDDMRATNVANGYPYTPLVGLLNGLALSSRMLLDEGLDNVFARHARIANGVRA
FT                   AVAAWGLAPCAAASELYSNSVTAIRVPHGFDPARIVTHAAERYGMAFGAGLGDVAGQVF
FT                   RIGHLGMLTDAMALSGLAVAEMCMADLGLDIRLGAGVAAAQALYRHGCEQMKAAAD"
FT   CDS             7153..7386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82802"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6T5"
FT                   /protein_id="BAJ82802.1"
FT                   /translation="MKTEIAVLGIDLGKNSCSLAGLDGTGAVIKRRRMRPETVVTFTKE
FT                   LPPCVIAMEACWARVRGHEADLAVCGLGKWLN"
FT   repeat_region   7324..7325
FT                   /rpt_type=FLANKING
FT   repeat_region   7326..9284
FT                   /note="Belongs to IS1634 family"
FT   repeat_region   7326..7349
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 24 bp inverted repeat"
FT   CDS             7493..9202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00070"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00070"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82803"
FT                   /db_xref="GOA:F0J6T6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6T6"
FT                   /protein_id="BAJ82803.1"
FT                   /translation="MYLRVTQRRNRDGSTVRYYGLAENVWNTDSKRSETQVIHSFGRAD
FT                   QLDRAALERLVRSINRVLGDDEQVGDGAPAGTAPPDIEIDAAFEFGIPLTARHLWEELG
FT                   IGPPVRDCLSKAELTAPHEAALFAMAANRLDDPGSKRACAERWLTDTAWLPEATGLTVD
FT                   HLYRALDVLAVWADAIERAVFLRAADLFRLDVDLIFYDTTTAYFEIDEADETEQVWAGR
FT                   LFAPLRRRGHSKEGRDNQPQVIIAMAVTRDGMPVRSWVLPGDTADVATVARIKEDLRAW
FT                   NLGRCLFVGDAGMYSADNLMALSKGLGRYILAVPMRRLRDVDEAVLTRPGRYRKVADNL
FT                   QAKEVVVGDGERRKRYVLCLNPEEAERQRQHRDEVLAGLRAELALLAARDAEHPKAACA
FT                   LLTSRRYGRYLSTDAAGRPHLDSGKIAHAARFDGKFVVITNDDTLSTEDVALGYKGGTI
FT                   IEACFRRMKQTGLEVRPMYHWSPRRIEAHVRLCVLALQIQRSAELRCGLPWARIAHILA
FT                   GLKAVRYQIAGRTIVQRTKISPEAAETLKNLGISKPKKLLTVIEPPQANATS"
FT   repeat_region   9261..9284
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 24 bp inverted repeat"
FT   CDS             9269..9628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00080"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82804"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6T7"
FT                   /protein_id="BAJ82804.1"
FT                   /translation="MTANPGYVDRGYRGHSVEAEGRRIFISRQKRGITPTIRRELRRRT
FT                   AIEPVIGQMKTDGHLGRNFLLGVDGDAINAVLAGVGHNLRLLRRWLIRLLCALVAWLSA
FT                   TNRSPSLGFAHRQIT"
FT   repeat_region   9285..9286
FT                   /rpt_type=FLANKING
FT   CDS             9682..10242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00090"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82805"
FT                   /db_xref="GOA:F0J6T8"
FT                   /db_xref="InterPro:IPR011644"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6T8"
FT                   /protein_id="BAJ82805.1"
FT                   /translation="MLGIIPHTIDQYLRTRVPPEARAGILGRAGFPDGQTFRLDTEYDD
FT                   EACCALVDAIAAETGTTTEAVFDEISAFFLDWAERTFSGFFKVAPDTRGFLLLQPEIHS
FT                   SLACGLRASGQRKVADKFRVEALPDGVRMHYRSSNRLGYFYCALARCLAARRGEVAEIS
FT                   FLDGDVDSAAAIIEVRLKPALAA"
FT   CDS             10248..12110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00100"
FT                   /product="putative signaling protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00100"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82806"
FT                   /db_xref="GOA:F0J6T9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6T9"
FT                   /protein_id="BAJ82806.1"
FT                   /translation="MDQAETLDRAAVEALCEAMCGVVSGDLSVRLRTASADLTVQKLSL
FT                   LANFMLETAQRAVERSRAYAGALDNVQRIARLSAWQLVLPDQEVVPVGTAAGLPDAAAA
FT                   PLRGTAWFLDRVGPGCRAAMAALFQGDGGTLEWLAADGEAWFRTEVAALRDEGGLSGYL
FT                   VITQDVSERRRATERIRYLAEHDPLTGLANRRRLHEQLEGELEAGRRQGTKFAVHVIDV
FT                   DRFKTVNDLFGHAAGDRLLVDLATCLRQEARESDMIARIGGDEFVVLQTGIGDARDAGA
FT                   LAGRLVGAVSARLAETGARALAATVSIGIALAPDDGTTAEALLSHADMALYQVKSTGRN
FT                   GFAFFNTEINEAQLARRRMEAELRGACERGEMAVHYQPLFEIASDRVVGFEALVRWRWN
FT                   GEEISPATFIPIAEESGSIIEIGRFVLREACREAAGWPAKLRVAVNISALQIQDGGLPD
FT                   LVATVLEETGLEAGRLELEVTESLLLANAEAATEVLARIRALGVTISLDDFGTGYSSLA
FT                   TLRMFPFDKIKLDRSFVNDLGRLGEAEAIVMAVLGLGRALDVSVVAEGVETKEQAAMLR
FT                   EAGCSLLQGYLIGRPAPIARFSAEVGRDVTSRMTKTPIPADSPG"
FT   CDS             complement(12455..13078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82807"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6U0"
FT                   /protein_id="BAJ82807.1"
FT                   /translation="MARVKRLTMSPMCLAFMIFIPLQEGQFAHELWRVFVGPIGDDEIA
FT                   ETIRLTLETTPPGATHWSLRLMARAVGYVPSTIHRIWCAFGLQPHRSETFKLSNDPLFV
FT                   EKVRDIVGLYMAPPERALVLCVDEKSQIQALDRTQPLLPMRPGQIERRTHDYTRHAEPR
FT                   CSPRSTSPPVRSSAAATPSTVPASSGSSSTRSRPTCRATSTSIW"
FT   CDS             complement(13087..13239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00120"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82808"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6U1"
FT                   /protein_id="BAJ82808.1"
FT                   /translation="MEGGGLDTTIPKACAGRAPRAVVRVRGPSLEVEDHEDRRPMVAVL
FT                   LSRSM"
FT   CDS             complement(13414..13650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00130"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82809"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6U2"
FT                   /protein_id="BAJ82809.1"
FT                   /translation="MTSDRQIQPLDLAQEIGSHLLMRHSRPEIGPGFSDGGIEEPPLGI
FT                   EFKIDLENGPVHNDSVITYPGTSGSNSFVRFMF"
FT   CDS             13656..13934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00140"
FT                   /product="plasmid stabilisation system family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00140"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82810"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6U3"
FT                   /protein_id="BAJ82810.1"
FT                   /translation="MQVEWHQLALEDRDVIVAYLELLNPNAASSVLRGLVLAGDSLALF
FT                   PARGRLGLAAGTRELVAVWPYLIVYEVDTSSDTVRILRIWYEAQDRP"
FT   repeat_region   14881..14888
FT                   /rpt_type=FLANKING
FT   mobile_element  14889..15968
FT                   /mobile_element_type="insertion sequence:ISAcr1"
FT   repeat_region   14889..14930
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   CDS             14936..15952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00150"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00150"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82811"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:F0IZR7"
FT                   /protein_id="BAJ82811.1"
FT                   /translation="MDVLAREDLPFPQSLPEFQRIFPNDAACAAYLESARWNGGFACPR
FT                   CGVVGEPFRFEARPGVLRCRACRKDVSLMAGTVMERSHTPLSTWFWAAYLIASQTPGMS
FT                   AVQFQRQLGLSRYETAFGILHKLRAGMVRPERDKIGDTPQEHVEVDETWVGGRTRGDGR
FT                   GVHHKVLVACAVEVRHRKPGTKLDNRKDGRYAGRVRLAVVPDRSANSLCGFVENAVAPG
FT                   SLIVTDDWSGYAGLGRRGFDHHAIAECGDPEVAEEFLPIVHLVFTNLKTWINGIHHGVS
FT                   AKHLQAYLNEFTFRFNRRLYPFNAFRSLLGIAGRAAAPTFDELYSGEWTHPTFSGCG"
FT   repeat_region   15927..15968
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   repeat_region   15969..15976
FT                   /rpt_type=FLANKING
FT   CDS             16116..16937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00160"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82812"
FT                   /db_xref="GOA:F0J6U5"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6U5"
FT                   /protein_id="BAJ82812.1"
FT                   /translation="MKNDFNIYKNKKYDHQYLIFVISYDQNIIEKFKYKKIYLAPFLVG
FT                   DDETIFSLLFEKKEGEINFDICIFYSENYSYNIIKIIPEIKLITDIPILAISGSYDELF
FT                   VVDLLRIGADDCVVSAIGAIDLNLRIEKLIEKNRSSADHQNHNIQNNPINKNNNNNNNN
FT                   KIFVFEKFYKYFTPSEDKILSELIENKGKVVSRESLSLHTRDSYKNTSKRTVDNIICRI
FT                   RKKFDMLSINNYVIKTYSSLGYSFIGDPDKFFYDLAINIEKYEKTLPENRN"
FT   CDS             complement(16999..17520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00170"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82813"
FT                   /db_xref="GOA:F0J6U6"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6U6"
FT                   /protein_id="BAJ82813.1"
FT                   /translation="MIAAFYQRVEMVPRALQFALGSRRAVIGTMVLFVAALGFYAMLLP
FT                   ATSTGGVVGLVSLRFLTPGQFVLALIMAVLLALTVTLGVYGIRQGARVGPTGTVLGAVL
FT                   ATLPALLCCTPILPLAIATIASVLPAVGQLGLPIQGFIATHEGAIYGVAIALMLWGLYS
FT                   SARRALSCAC"
FT   CDS             complement(17517..18116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00180"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00180"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82814"
FT                   /db_xref="GOA:F0J6U7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6U7"
FT                   /protein_id="BAJ82814.1"
FT                   /translation="MRMTKTNNLFHSRFLRLGKPLLAALAFTGLASATAFAGPTGKMGP
FT                   TSAPAPQDMTAPNAPFIVDGKSVELKTYMGHPLVVWQVTTWCPSCKAGLRTFAQHQAEI
FT                   DKSDMTILVLRDDKNGGYSGPSMHQFVEQAAPKLLNDPHFVIGDDTKALFDLYNPHKFV
FT                   DVYQVIAPDGHVAVVSSTPSATFGKIASFIKPKTGS"
FT   CDS             complement(18176..19816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merA"
FT                   /locus_tag="ACMV_P1_00190"
FT                   /product="mercuric reductase"
FT                   /EC_number="1.16.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00190"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82815"
FT                   /db_xref="GOA:F0J6U8"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR021179"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6U8"
FT                   /protein_id="BAJ82815.1"
FT                   /translation="MTSLTLSVTGMTCEHCARIAEKALNSLPDVRADVNYDRRTARIDG
FT                   ADGLDLAALRAALAPHGYGMETLNDDTTRGTTAPHGGGLHIAIIGSGGAAFAAAIRAVD
FT                   AGARVTMIERGEVIGGTCVNAGCVSSKITLRAAEIRHERGHHPFDGIARSEEPVDRRVL
FT                   LAQLRGRVDALRGAKYQKIIDDNPGITLLRGEARFADARTLTITEHTGKVTRQTPDRIL
FT                   IATGAAPMIPPVPGLAETPYWTSTESLFADELPTSIAVIGSSFVALELAQAYRRLGVDV
FT                   TVLARSTLLTRDDPELGAALQEAFEAEGIRVLNETRVQNVAYEAGRFIVAFGTGRIEAE
FT                   RLLVATGRWPTTGGLGLEQAGVTTDRNGAIVVDDHLRTSAANIYAAGDCSTMPQLVYVA
FT                   AAAGTRAAINMTGGDASLDLSVVPAVIFTDPSVATVGLDEGQARTAGIEAIVRRLDLEN
FT                   VPRALANFDTRGFVKLVAEAGTNRLIGAQILAHNAGEMIQTAALAIRHRMTVQELGDTL
FT                   FPYLVMSEGIKLAAQTFTKDVKQLSCCAG"
FT   CDS             complement(19813..20220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00200"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82816"
FT                   /db_xref="GOA:F0J6U9"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6U9"
FT                   /protein_id="BAJ82816.1"
FT                   /translation="MAACCNRSDTGVRVNWRRLLTSRVTIIGGLTLAVAGGLAAGGWSW
FT                   LVAAGVAPIILTILPCAVTCALGLCALGLCADRSQMLRQPVTPPSRHGAAITRKDDPMP
FT                   SPAAAVVVRHQDQQSLEAHNINCTGTIGDLA"
FT   CDS             20510..20923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00210"
FT                   /product="MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00210"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82817"
FT                   /db_xref="GOA:F0J6V0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6V0"
FT                   /protein_id="BAJ82817.1"
FT                   /translation="MEPIGKVARQIGCGIDTIRFYEKIGVLRQPRRTGSGRRVYGPAEI
FT                   ARLAFICRARELGFSLDEVRGLLDLAEEKERPCEDVKQAAVRHRQDVRRKISDLRAVEA
FT                   TLGTLIQQCEADGPAECPLIEALSQPSIVVPRL"
FT   CDS             complement(20946..21182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00220"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82818"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6V1"
FT                   /protein_id="BAJ82818.1"
FT                   /translation="MGGARFGCVLADTGYGLSAPFRQALSARNLRWAVGIPFKQKVYPA
FT                   DVALIFPTAGRGRPRQRHIPAWFSSVALLGLGL"
FT   CDS             21380..21589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00230"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82819"
FT                   /db_xref="GOA:F0J6V2"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6V2"
FT                   /protein_id="BAJ82819.1"
FT                   /translation="MRQYDSHADCRAAVGPITSITMALSAVNPANFESGRHFAAWLGLT
FT                   PREHSTGGKHRLGRISNAGNERLR"
FT   CDS             21608..21787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00240"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82820"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6V3"
FT                   /protein_id="BAJ82820.1"
FT                   /translation="MGVFRYAKPGSKSANTWLLQLQERRPRKIAVIALANKIARIIWAM
FT                   MARGEAYRRQPAAA"
FT   CDS             21965..22255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00250"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82821"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6V4"
FT                   /protein_id="BAJ82821.1"
FT                   /translation="MTAFVPPPNSRTVDLESRAVPHMTPSIERRDRWRAALPYLVERDT
FT                   PLGRWARGLLDRAHKNVGVVALAAKLARIAWAVLAHGCDYGAQFEAAAAAA"
FT   CDS             22784..25222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00260"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82822"
FT                   /db_xref="GOA:F0J6V5"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6V5"
FT                   /protein_id="BAJ82822.1"
FT                   /translation="MADENDLSADIARVRRRLTDLDAERTRLKAELETLEKRRASDRRP
FT                   AEQPFPGDAAVTNHSSSLEKVDLFRRLFAGRPDVFPVRWDNRKTGRSGYSPACSNEWAK
FT                   GICGKPAVKCGECPHQAFIAPSEDVIERHLRGGGTSTSGFVAGVYPLLQDETCWFLAAD
FT                   FDKESWADDARALQDTCHAKGIAAALERSRSGNGGHVWIFFSEPVPARAARQLGSALIT
FT                   ETMESRPEIGFSSYDRFFPNQDTMPIGGFGNLIALPLQRKARECGNSVFVDKDLQPYDD
FT                   QWAYLSSLPRVPAATVFRIADEAESSGRVLGVRMPVEDKYAEEPWKMSPARRSEPRRIE
FT                   AAIPKTVRIVVGDQVYIDRTELPPALITQFIRLAAFQNPEFYRAQAMRLPTFGKPRIVS
FT                   CAELYPRHVALPRGCLEEVIDLAKSHGAVTELEDRRESGTPLPAGVVFQGELQRPQSRA
FT                   FEALVAHDAGVLAATTAFGKTVVAAALIAHRSRNTLILVHRRELLKQWVERLRTFLNIG
FT                   RNQIGVIGGGKRKPTGIIDVALIQSLVRNGEVADTVADYGHLIVDECHHLSAASFELVA
FT                   RRSKARYVVGLSATVARKDGHHPIIFMQCGPVRHRVDARVQAAEGGIRHRVRDRSTTFE
FT                   LPPSLASVERPSIPAIYAALAQDGSRNDLIFGDVLKSLEAKRSPVVLTERKDHLDRLRQ
FT                   RFSPFVKNLVVLRGGMSAGDRKMAEAAMRVPDDQERLILATGRYIGEGFDDARLDTLFL
FT                   TMPIAWKGTLAQYVGRLHRQHAGKRDVLVVDYVDHAVPVLARMAVKRRAGYRALGYIIE
FT                   "
FT   CDS             25402..25737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00270"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82823"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6V6"
FT                   /protein_id="BAJ82823.1"
FT                   /translation="MSAKPEATLPIPVRRALRKLGADIRDARRRRRIPTTTMAERSLIS
FT                   RVTLTKVEKGDPSVSFGIYATVLFVLGMTERLAELADPKHDTIGLSLEDDLLPQRIRSP
FT                   NKPKGTG"
FT   CDS             25737..25982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00280"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82824"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6V7"
FT                   /protein_id="BAJ82824.1"
FT                   /translation="MDREIFVYIDLHGEPILVGRLWSRVRKGRESASFEYDPAWLAHPE
FT                   RFALEPALTLAPGPFHTPPEKALFGAIGDSAPRGYA"
FT   repeat_region   25957..25966
FT                   /rpt_type=FLANKING
FT   repeat_region   complement(25967..27194)
FT                   /note="Belongs to ISAs1 family"
FT   repeat_region   25967..25984
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 18 bp inverted repeat"
FT   CDS             complement(25973..27106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00290"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82825"
FT                   /db_xref="GOA:F0IZE6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:F0IZE6"
FT                   /protein_id="BAJ82825.1"
FT                   /translation="MSVRRLVEEFSALEDPRCGGKVEHRLIDILVIAVCAVIAGAESWE
FT                   DMALYGRSKQEWLGTFLALPNGIPSHDTFRRVFMLIDTGRFEACFEAWARSFGTTLDRE
FT                   VVAIDGKTIRGSFDRSRDQAALHVVSAWASDRGLVLGQRQVGDKSNEITAIPELLDVLD
FT                   IKGAIVTLDAMGCQRAIASKILERGADYLVTLKANQGKKHSAVQEYCATTCFSRSPVDR
FT                   PVHDEFDDGHGRLVRRRVFVCPDAVALEPLRDWPGLKSVLAVETIRGVNGSGKIEAEIR
FT                   YFLSSSDDQPEILAKAIRQHWQIENSLHWVLDVTFNEDHCRIRDRNAVQNFSLLRKIAI
FT                   NLVRRHQASKASLKGRRKMAAWDNRYMEQVLTGFFHA"
FT   CDS             27035..28234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00300"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82826"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6V9"
FT                   /protein_id="BAJ82826.1"
FT                   /translation="MLNLAAAAGVFQRRKFLHKPPHRHARLPISRRLPESHPIPCRQLC
FT                   PKFSCVAPDSAPDRWGRVLMRRAERRRAERERQAPRTLFEADFLLLVDDVARQGALRFR
FT                   AEPDGPFLAPEDSMRIPPLIELPRLLSAVERVSNEEEDDEDLRVLIVPGSSLGGARPKA
FT                   SVRDHDGHLALAKFPHKQDDINVVLWEGVALSLAEKAGIGVPEWRIETIGEKPVILIRR
FT                   FDRKGGLRVPFLSAMSMLGANDNEQHSYLEIADALRQFGAATKDDLAQLWRRIVFSVLI
FT                   SNTDDHLRNHGFLYGSHKGWRLSPAYDLNPVPVDIRPRVLSTAIDMDDPTASIELALEM
FT                   ANYYGLKPVDAKAIAQQVALAVAKWRGDAAKLGISAREIERMASAFEHEDARKAQTPSC
FT                   "
FT   repeat_region   27377..27394
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 18 bp inverted repeat"
FT   repeat_region   27395..27404
FT                   /rpt_type=FLANKING
FT   CDS             complement(28300..28539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00310"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82827"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6W0"
FT                   /protein_id="BAJ82827.1"
FT                   /translation="MSIVPLVLDRQHGDTQLWVKEVWIGKGKAAQRYIVPVNEGAEAEK
FT                   DREDRQAIIDGLQAELKEGRRSEMGVFARKRPAC"
FT   CDS             28852..29448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00320"
FT                   /product="MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00320"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82828"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6W1"
FT                   /protein_id="BAJ82828.1"
FT                   /translation="MPLPSAPRGSKSSNIPRPAGLTTGITNSSLRSGRVNDYLTYDSDD
FT                   VHRLRFIRRGRALGYLIATICQLLALWGDTNRPSADVKRIALAHPESMRRKIAELVSMD
FT                   RAIEHLADFCTSDHQRDCPILDDLTSASLLPDDGEPGLSDRRNHCWLRRRAPHPQRDRR
FT                   TCAYFLELHDDLQHPVPGGIITPCATCPVHRTCCA"
FT   CDS             29622..30344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00330"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82829"
FT                   /db_xref="GOA:F0J6W2"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6W2"
FT                   /protein_id="BAJ82829.1"
FT                   /translation="MVQGNKPNPARVRITLAFGALGLFAVVGIAAFAAGLSFHGLTASP
FT                   DAIVRIIRSWGAWGALAAIALMIAHSFLPLPAEVIAVANGIIFGPVWGTVITWTGAMLG
FT                   AWAAFGLARLFGRPLVETFVPARYRHTLDDWAETRGAMPLLILRLIPIVAFNLINYAVG
FT                   LARISWWTFTWTTGLGILPMTLLMVVFGDRLASVSGEAGLVVLAGVLLAWLAVKLLRKR
FT                   LPLHRPGRRSPARPRSGS"
FT   CDS             30507..31160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00340"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82830"
FT                   /db_xref="GOA:F0J6W3"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6W3"
FT                   /protein_id="BAJ82830.1"
FT                   /translation="MLGHLSDTIVHAARTHALLAYGLAFVLTAAEAFPVIGALVPGTAI
FT                   IVGLGALVPTGALHFWPLVAWSTGGAILGDGLPFWFGSRFRNQATGLWPLSLHPDLLPR
FT                   GKAFFERHGGSAVIIARFTPGVRAVVPIVAGVSGMRSLRFYVLDVVSAVIWAPAHVGAG
FT                   VLVGASLAILGVMAGRLEALLIGLIVSLVLLLWLVPRLLRFVIMGWPAPLAAIG"
FT   repeat_region   31125..32497
FT                   /note="Belongs to IS110 family"
FT   repeat_region   31125..31146
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 22 bp inverted repeat"
FT   CDS             31194..32234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00350"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00350"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82831"
FT                   /db_xref="GOA:F0J6W4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6W4"
FT                   /protein_id="BAJ82831.1"
FT                   /translation="MDIVIVGIDLGKNSCSVVGMDAAGRVVLRRRLRRGTLESFVGELG
FT                   SCIVAMEACCGAHHLGRIFAARGHEVRLMSPEYVRPYVKAQKNDDLDAEAIAEAATRPT
FT                   MRFVPVKSQDQSDLQALHRARERLVSERTALINHLRALLLERGIVVPQGRRKLEAELET
FT                   LAEDGGFAALSPRIRTLIEDLRAEWRSLDQRITGFDAEFVQLARDDVAVRRLTKIPGMG
FT                   TINATALAAAVGEAQAFKRGRDMAAWLGLVPRQMTTGGKPRLLGISKRGNRYLRKNLIH
FT                   GARAALPYLVERDTPLGRWARGLLDRAHKNVVVVALAAKLARIAWAVLAHGCDYDAQFE
FT                   AAAAAA"
FT   repeat_region   32476..32497
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 22 bp inverted repeat"
FT   CDS             32504..33940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00360"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82832"
FT                   /db_xref="GOA:F0J6W5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR025902"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6W5"
FT                   /protein_id="BAJ82832.1"
FT                   /translation="MESKRGPALAWAHAGKGRIRSNVASILDPARAELSGLITLAGALA
FT                   GSLWLLLGVLQDLIAGDPLVYADHAILHFLEPYRSGIPMEAAMAFSRLGSGAVTVAVAA
FT                   VVLVWLDRQSAWRGAAYGIAAVIGASLFTAGLDLALHRAPPSPIAPGWSLIPFPGGDLA
FT                   TSCAVYGILTVIAGRRLGARPRIGLITATVLFAALQLGSRVYLGLDWFSSELAALGFGF
FT                   AWAAGLGLAYVARPVEPVAPWRLVAITAATLATAGTAAVALNRNADLARHDVGRMSTTM
FT                   TCPDWLQHGWQNLPTRSLGMLGSFSGSLTIQWIGPADGLRHALAQLGWRSSAPWTFRNA
FT                   LEFLAPHASPAEIPALPRWDDGRRADLIMVFVGHGLAADQRLVLRLWKTSVSVTMPTGS
FT                   VRTLRIGEIEMQRLRRMVSTLTIPVSEGSAYTVLPRIAAALPASRLVTRAADGATVLLA
FT                   GDRAVDTEGCLTQHRGDGAQ"
FT   CDS             33937..34614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00370"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00370"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82833"
FT                   /db_xref="GOA:F0J6W6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6W6"
FT                   /protein_id="BAJ82833.1"
FT                   /translation="MRVLIVEDEAKTAAYLRKGLEENGFTTDVATDGETGLQFARHGGY
FT                   DAIILDIMLPRRDGFEILAEIRRRDSHTAVLLLTARDQVTDRVAGLEAGADDYLVKPFA
FT                   FSELLARVRTILRRGHARQPALIQIADLEIDLSGHRATRAGQALDLTPKEFRLLSLLAR
FT                   RAGDVISRTVIAEQVWDINFDSGTNVVDVHMYRLRAKLDDPFSRRLIHTVRGVGYVLED
FT                   RGG"
FT   CDS             34643..35986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00380"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00380"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82834"
FT                   /db_xref="GOA:F0J6W7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6W7"
FT                   /protein_id="BAJ82834.1"
FT                   /translation="MSLRMTAWYAGTAFLLVLLATSLLTWSFGARIARQEDRTLHVLAR
FT                   IARPLGGAADPSASLAIASALERAGNTREIQFRVIGPHGRITIQSNGNHLPLPPSVGLP
FT                   NVATLDSGGMAFRVLTQPLPNGFMLQIAIASPGSQALLLRYRETLTLVLAVSIILCAVL
FT                   GYLIARSGMRPIERIAETAENIRLSTLHERLDVAGLPAELAALANTFNLMLDRLEQSFL
FT                   QLSQFSADLAHELRTPISNLRGELEVALSRPRSDDTYREVLGSALEECTRISRVIQSLL
FT                   FLARAEMVGAPPAVEALDLATEIATVLEFYQPMAAEAGLSLTARVRPGLPIRFDRILLQ
FT                   QALGNLVANAIAHTGTGGQITIEVAEVLEQLSIRIKDTGQGIAPEHLPHVFDRFYRADP
FT                   ARSHVGGNLGLGLAVVRAIMDLHGGRVSIESTQGQGTTVSLLVAATAR"
FT   CDS             36086..37459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00390"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00390"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82835"
FT                   /db_xref="GOA:F0J6W8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6W8"
FT                   /protein_id="BAJ82835.1"
FT                   /translation="MKKTSRHLRFRPNRVGALALATLLAGCARYQPAPLHPGTSATALL
FT                   GRRLDEPALGQFLAAMGVHPRGHWGLRALTLVAVYERPDLRISVAAYDAAKAAVTTAQQ
FT                   IPNPTLSLAPSFNATQAFPSPIKIGPVISFLVSNLGAREAGIAAARDRQQAARILIAAA
FT                   AWRERSNVRNALLTLWLDERIARIKARVASYAATASRLVAQRVTSGMLADTVLASTTEA
FT                   ANKASFGTAEARVQIGMDRAHLAAAIGMPAAALRGKHLSFTAFEHPLPPANLAALTRTA
FT                   LVTSPSVVAAYKNYRAADASLRKAIDQQFPGFRIGPGYHYDQGASKFILALSLPLPILN
FT                   QNQDPIAEARARRQLAAALFDRAQVRVLHEIDAAKAALQGSVSVARAARLLLATARERE
FT                   RQAIEAYRAGATGQLRMVEAEQQATLVREQELTTDAQRLRALAAVADALHHPIFRESH"
FT   CDS             37459..38385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00400"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82836"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6W9"
FT                   /protein_id="BAJ82836.1"
FT                   /translation="MKRHLQAIAASLSLVCAAAVAHAAALRSVTINAATMSSGLIKTSV
FT                   LRLETKHPSSAAYGLVIDPSPIITLRHRIVSAHAKLTLDDANLARAQKLYRSGGNVSKA
FT                   SLQQIQAKTAIAQARVEELLAQAKMRYGAALGTAIADNGPSFRTINGGGSLVSVVQAGA
FT                   TLVSPPAASARAPDGSRVMLRPVGSAGRIPKGLLGQTFFYTGPALPIGVPLAITLRAPG
FT                   VVTGYAVPAAALIWHNNGPFIFVRIGASRFAMYRVTRSHPLYRSGTISGFFVPGADLPA
FT                   HPAIVTSGVGLLNSALAGGGASAANND"
FT   CDS             38395..41496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00410"
FT                   /product="efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00410"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82837"
FT                   /db_xref="GOA:F0J6X0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6X0"
FT                   /protein_id="BAJ82837.1"
FT                   /translation="MLSPIVRAALRYRLVVVLLVAGFAALQLARLPTARYDVFPTFTAP
FT                   TVVIQTAAPGFSALQTEQVVTDRLERTLTGLPGLAKMRSSSESGLSVIHLVFHGGTDPY
FT                   QDRQRVAGRLSELGGVLPAGILPRLAPMQSSTGTALEIGLYARRGMSLERLTAIAEAGL
FT                   RPALQAVPGVANVVIFGARPPQLNVEVQPRSLIATGFTMQDVARAARHGSAVLGAGFID
FT                   NGNQRLVLAPHGQARTAAVLAKTWLGTSDGAPISLGDVASVRLSAPPRYGAALIHGHPG
FT                   LLMIVSSLYGANTLAVADQAARTVARLTPGLEAQGIEIDPRAFTPATFIHVALADLGHV
FT                   LLIGAALILLVLLIALRDWRASVISFVAIPVSLLAATAIITALGITLNTMALAGLAIAL
FT                   GELVDDAVVDVENITRRLRENRIAGSPEPPLRVIFRASLEVRSAIIFASAAVAIAFTPV
FT                   IALGGVAGRLFAPLGIAYIAAIGASLVVALVLTPALAALLLVRPTAAADHTPPIALLRP
FT                   AYRRALGRLEHHGRAFIAAALALILLAGISVPLLQIRFLPRFRENDVIVHYLAAPGTSI
FT                   DAMLAIGRLAIHTLENLPSVGDVVMHIGRASMSNGHAGVNKAEIDITLSETGNRHVERS
FT                   TRQILASVDHIDGLSWWSRTFLSERVDESLSGVTAPVSVSVFGPSLDAIDIAAARIVAA
FT                   SHGVPGVRAASMAAVQQVPALAIDLNRAAMLRYGITPGAALEAMKIAYSGATVGHVYRG
FT                   TLVEPIVVTLPAELRHQPAAIGDLPVAAAGGMIVPLDRIATIRQTRVPAQILHNDGRRV
FT                   QVVTVQVAHGHAVPVIRSLRQRLARLRLGTGVYVRYGGTAVAGGTARRELAIHAAIALA
FT                   GILILIALALREARAVVLMMAIMPVAFSGGITATWAFLGGHLELGAMVGLATLFGLTLR
FT                   NGLLLLIHMRRLMEGSGKPWSADVARQAAADRLPAILITACVTALGLLPLALATGSPGD
FT                   AIEGPMAIVILGGLATATILTLFVLPILAPRVLRLAAPKPDGLG"
FT   CDS             complement(41574..42929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00420"
FT                   /product="multicopper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00420"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82838"
FT                   /db_xref="GOA:F0J6X1"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6X1"
FT                   /protein_id="BAJ82838.1"
FT                   /translation="MAPGEQFRVKLLNRTADHTIIHWHGQLPPWTQDGFPWPQTPPLAP
FT                   AATRAYDYVPIPGTYWMHSHQGLQEQSLMTAPLIVQDAAVLAEGRQEVVVMLHDFSFTA
FT                   PDALLAGLTGQTPSAIHAMARSTENAAPAPMTVGNRMGPMQGMAHTAAGKGMGMSMSGM
FT                   SMSGMSMSGMSMSGMSMDLNDINYDAFLANDRTLHDPETIQVERSGRVRLRIINAASSS
FT                   QFWIDLGALTGRVVAVDGHPVVPVVGRRFPLAIAQRLDIVVDLPGAGAFPVLARLEGSR
FT                   RRTGVVLATPGSRVVRIQDTGLDQMLPVDNSLETRLVARAPLAARKPDLVHRIVLGGGM
FT                   KPYSWSLNGEFWPNITPLMLRKGQRVEIEMVNHSMMAHPMHLHGHAFPVVAVNGRPLNG
FT                   AVRDTVLVTPMMGSVRIAFDADNPGRWALHCHNLYHMMTGMMTEVRYDGIEV"
FT   repeat_region   42975..42983
FT                   /rpt_type=FLANKING
FT   repeat_region   42984..44384
FT                   /note="Belongs to IS256 family"
FT   repeat_region   42984..43026
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 43 bp inverted repeat"
FT   CDS             43080..44351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00430"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00430"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82839"
FT                   /db_xref="GOA:F0J2N3"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2N3"
FT                   /protein_id="BAJ82839.1"
FT                   /translation="MNENSTITSFHQPGSIMDPLTDIAREGARQMLMAALKAEAASFVA
FT                   QFSEELLPDGRQRVVRHGAGPERAVQTGIGPVPVQRPKVRDRAPGVSAETRIRFTSAIL
FT                   PRWARRSKSLDALLPVLYLRGVSTGDFQEALTALLGADAPNLSPAVISRLTAGWQEEYD
FT                   RWQRRDLSARRYVYVWADGVYLQARMEPQAECMLVIIGATPEGRKELLGFQVGFRESAQ
FT                   SWRELLVDLKARGLAVPPELAVGDGALGFWKALDEVFPGTRHQRCWFHKIANVLNHFPK
FT                   SMQPAVAADLREISHAETRAAALAAIDTFKAKYAAKYQRGVACLTKDTEVLLAFYDYPA
FT                   EHWEHLRTSNPIESVFATVRHRTVRTKGALSQKTAKLMVFTLIRAASKKWRKLNGTSQL
FT                   PRVIEGVRFNDGVAQSDATQSRAA"
FT   repeat_region   44342..44384
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 43 bp inverted repeat"
FT   CDS             complement(44352..44507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00440"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82840"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6X3"
FT                   /protein_id="BAJ82840.1"
FT                   /translation="MAASLTLSAADMAVARAATAARAGQRLVAGTRSLEVNGRAAELWR
FT                   NLGDAA"
FT   repeat_region   44385..44393
FT                   /rpt_type=FLANKING
FT   CDS             complement(44758..45423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00450"
FT                   /product="ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00450"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82841"
FT                   /db_xref="GOA:F0J6X4"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6X4"
FT                   /protein_id="BAJ82841.1"
FT                   /translation="MKSSSGPKQQIFSHLAEIAAALAHPHRIEILELIAQGERSVEDLA
FT                   ERIGLSLSNTSRHLQVLRRARLAAPRREGKNVFYSLVSETEVVTLLASLGRVGERNIAE
FT                   IDQVMQAYFRARDSLEPVSRLTLLERLRDGSVTLLDVRPTEEFAHGHLPGALNIPLDQL
FT                   DAMLDSLVARSPVVAYCRGPYCVLSFEAVAKLRACGIEAIRLEDGYPEWKAAGCPIEC"
FT   CDS             45509..46240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00460"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82842"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6X5"
FT                   /protein_id="BAJ82842.1"
FT                   /translation="MILRQFLHTDPTAASYLLGCVGKGAGVVVDPLFPIEPYLHAASAS
FT                   ATPIRLVIDTHLHADHRSAGRALAEAAGAEYAIHESAEVGYACRRLVDGERLELGNVVL
FT                   EVLHTPGHTPEHLCLTVTDRTRADEPWSVLGGHTLMVGDVGRTELATDAARGARDLFTS
FT                   LVRLKALPDHIEVLPGALAGSVCGRGLSGKPVSTIGFERRHNPAFRIGDADRFVAFMLE
FT                   NIPPAPEGAAELRAWNAGFTA"
FT   CDS             46237..47487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00470"
FT                   /product="putative major facilitator superfamily
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00470"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82843"
FT                   /db_xref="GOA:F0J6X6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6X6"
FT                   /protein_id="BAJ82843.1"
FT                   /translation="MTMVANASDHIRGITANRGQFTLQALQVFFVGLVIGMERAVLPTL
FT                   AHEFGVAPGAFLFLASFVLSFGLVKGALNLVAGGLADRFGRKPVLIAGWIAAIPIPLLI
FT                   WAAPNWWWIVIANVFLGISQGFTWTMTVTSQIDLAGSHQRGLAVGINEATGYVAVGLAG
FT                   ACAALLAEAVGARDALLIFGMATIGLAFATITRVRDTLAWVKAEHAEAGAGASQDHTLT
FT                   LRAIFVRISFRDRVGRAICQGGIVNKIADTLVWVMFPLFFKAHGARLVEIGWLTGTYAM
FT                   VWGVSQLWTGHLGDRVGRRAPVIAGFFLLAAGIAITAAGRDASLWLPGAIVMGVGMALL
FT                   YPNLIAAMSDQAAPLIRGKALGTYRYWRDTGYALGAVALGLIAQFAHATLPALWITAAL
FT                   VAGSGLWLARDMPRAAE"
FT   CDS             complement(47499..48242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00480"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00480"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82844"
FT                   /db_xref="GOA:F0J6X7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6X7"
FT                   /protein_id="BAJ82844.1"
FT                   /translation="MTVAPEISGRIVAVAVHDNERVRKGQVLFRIDPADFANRLAVARA
FT                   TLAADRAIAGMKAADAARRARLPSIAVSAETRGNAAAARAAAARVQADEAGVAQAALDL
FT                   ARTVVRAPVSGTITNLTAHAGDYAHAGSGAITMVDTGELWVTAYFEETELDQIRPGAPA
FT                   RIELMSDPGRVLDGHVQGIGRGVADANMQDARSGLPRVDPVYSWVRLSQRIPVYVTLDH
FT                   VPPSMLLAAGMTATVRVVAPAARER"
FT   CDS             complement(48297..48500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00490"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00490"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82845"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6X8"
FT                   /protein_id="BAJ82845.1"
FT                   /translation="MALRGWVRRAERDQGLRPGPTSADQKRIKSLEREVRELRQANEIL
FT                   RKASPYFAMVELDRRFWLGFAT"
FT   CDS             complement(48504..48677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00500"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00500"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82846"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6X9"
FT                   /protein_id="BAJ82846.1"
FT                   /translation="MIAPGAGVRVYLACGRTDTRKGLDGLAMMVQQVFGGNPFDGAVYA
FT                   FRGRRAVICART"
FT   CDS             complement(48674..48853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00510"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82847"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6Y0"
FT                   /protein_id="BAJ82847.1"
FT                   /translation="MVPGFARAVVSGTAPALGLAAPTAMETIEIALPDGVVLRFGAGVS
FT                   QAALSRVLAVLRGA"
FT   CDS             complement(48911..49660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobF"
FT                   /locus_tag="ACMV_P1_00520"
FT                   /product="precorrin-6A synthase"
FT                   /EC_number="2.1.1.152"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00520"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82848"
FT                   /db_xref="GOA:F0J6Y1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012797"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6Y1"
FT                   /protein_id="BAJ82848.1"
FT                   /translation="MIALSLIGIGTGNPEHLTLQAIRALNAADVVLIPCKGESKADLAE
FT                   LRRTICAEFITNPATRMVEFNQPVRDPATPDYRRRVDDWHDAIAKAWRAAITKELPGGD
FT                   GRVALLVWGDPSLYDSTLRIAARLGLRTEVIPGITSIQALAAAHVIPLSEIGTPFTVTT
FT                   GRRLRDGGWPEGVDTILVMLDGDCAFQDLAPEGLSIWWGAYVGMAEELTEAGLLAETGP
FT                   RILARRAEARAQHGWIMDIYLLRRTGS"
FT   CDS             complement(49657..50385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00530"
FT                   /product="uroporphyrinogen-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00530"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82849"
FT                   /db_xref="GOA:F0J6Y2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6Y2"
FT                   /protein_id="BAJ82849.1"
FT                   /translation="MNGFVSFVSSGPGDPELLTLKAAARIAAADAILFDDLSSGPALAH
FT                   ARADADLVGVGKRAGRASPKQDQVSRLLVDYAKTGARVVRLKSGDAGLFGRLEEETTAL
FT                   RDAGIGFEIIPGVPSACAAAAAAGIPLTRRITARRVQFVTGHDVTGGLAEDLNLAALAD
FT                   PMATTVVFMGKRTFPAFLTMLTGAGLPPGTPALLAEAVGRAEQQLVRTTVAELAERLSG
FT                   DPGTAPALILYGPLAEAAEA"
FT   CDS             complement(50382..51719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobB"
FT                   /locus_tag="ACMV_P1_00540"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00540"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82850"
FT                   /db_xref="GOA:F0J6Y3"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6Y3"
FT                   /protein_id="BAJ82850.1"
FT                   /translation="MSGARATVAGPVPGLMISAPASGSGKTTLMLGLARAFANAGLAVQ
FT                   PFKSGPDYIDPAFHSAAAGRASVNLDSWAMPPGRIAAEVGRAKGADLILAEGSMGLFDG
FT                   VAKPGLAGTGASADIATLAGWPVLMVIDPKGQAQTAAAVALGLARFRPDLPIAGVILNR
FT                   VASPRHEALIRAGMAEAGLPVLGALPRVATITMPERHLGLVQAGEHPALEALIEAAAAL
FT                   VTEHCDLEAIHIAAAARVLPAPVATRLPPPGQRIALARDAAFSFTYPHLLDDWRAEGAE
FT                   ILPFSPLADEAPDPGADACWLPGGYPELHAGRLAAAARFRAALRAFAETRPVHGECGGY
FT                   MALGAGLVDAEGTRHEMAGLLGLVTSFAKRQMHLGYRRARLAGPCLGLPGGAVIAGHEF
FT                   HYAGVVEQPDAPMAAVADAAGQTVAETGSRRGNVSGSFFHLIGGTS"
FT   CDS             complement(51716..52501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobM"
FT                   /locus_tag="ACMV_P1_00550"
FT                   /product="precorrin-4 C(11)-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00550"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82851"
FT                   /db_xref="GOA:F0J6Y4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6Y4"
FT                   /protein_id="BAJ82851.1"
FT                   /translation="MTVHFIGVGPGAPDLLTLRGRDLIAASPVCLYAGSLVPPVVLAHC
FT                   PEGAWIVNTAPLSLDEIIAEITAAHAAGQDVARLHSGDLSVWSAMGEQLRRLRALAIPF
FT                   DVTPGVPAFAAAAATLATELTLPGVAQSVVLTRTSGRATPMPGGETLAAFAVTGATLAI
FT                   HLSIHVLSKVVEELTPHYGADCPVAVVWRASWPDERVLRGSLATIEAQMAAEIDRTALI
FT                   LVGRTLAAEGFAESRLYAGDYDRRYRPVGSEPRFPEGRE"
FT   CDS             complement(52498..52866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00560"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82852"
FT                   /db_xref="GOA:F0J6Y5"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6Y5"
FT                   /protein_id="BAJ82852.1"
FT                   /translation="MRVAGLGFRDGTTPAALAEAIAAAGGGALSSLATAADKAEAPPLL
FT                   VLAAELGLAVTLVPLATLANTETLTRSPRVAARYGTGSLAEAAALAAAGPGARLLGPRA
FT                   TSADGTATAAIATTEAKV"
FT   CDS             complement(52863..54080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobL"
FT                   /locus_tag="ACMV_P1_00570"
FT                   /product="precorrin-6Y C(5,15)-methyltransferase"
FT                   /EC_number="2.1.1.132"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00570"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82853"
FT                   /db_xref="GOA:F0J6Y6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6Y6"
FT                   /protein_id="BAJ82853.1"
FT                   /translation="MAEPWLSIIGIGEDGREGLVPAALAALEAAEVVFGGPRHLALAGV
FT                   AEGVDERGQAWPVPFSVAPVLAHAGRRVAVLASGDPFWHGAGGSLSRHLSPGDWRAFPA
FT                   PSTLALVTARLGWRQEEVTTLALHAALFAEARRHLAPGARLLCLLRDGAAAPAFAQWLA
FT                   SQGFGASRLWRLKALGGPRERIEVMTADALAARPVPSAAPGGPPVAVALEAAGGPALPR
FT                   ASGLPDALFAHDGQITKRPVRALTLSALAPKPGEHLWDIGLGSGSISIEWLLAAPGTRA
FT                   SGLEADPTRAARARANAESFGLGARLGVTEARAPEGLDGLAPPDAVFIGGGATETLLAA
FT                   LWPRLPEGARLVANGVTLETEALLAQWSAAKGGSLLRIELAEAQPLGRKRGWSAARPVV
FT                   QWSVVK"
FT   CDS             54148..54894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobK"
FT                   /locus_tag="ACMV_P1_00580"
FT                   /product="precorrin-6A reductase"
FT                   /EC_number="1.3.1.54"
FT                   /note="protein synonym:precorrin-6X reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00580"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82854"
FT                   /db_xref="GOA:F0J6Y7"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6Y7"
FT                   /protein_id="BAJ82854.1"
FT                   /translation="MRVLLLGGTSEASALARALAEAGVDAVFSYAGRTGAPVAQPLPQR
FT                   IGGFGGVAGLVNWLTAERITHMIDATHPFAAQMSAHAVAAAAETGVALLAFERPPWRAG
FT                   AEDRWTHVPDTAAAIAALPWAPRRIFVAIGRQGLSAFAAAPQHHYLLRLVDPPEVPLPL
FT                   PDAEAVVARGPFSAAGDRALLESHRIELILAKNAGGSGARAKLDAARALGLPVILIDRP
FT                   EVPDRPVAVSIAEVMAWIFHSTCPEP"
FT   CDS             complement(54870..55667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobJ"
FT                   /locus_tag="ACMV_P1_00590"
FT                   /product="precorrin-3B C(17)-methyltransferase"
FT                   /EC_number="2.1.1.131"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00590"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82855"
FT                   /db_xref="GOA:F0J6Y8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6Y8"
FT                   /protein_id="BAJ82855.1"
FT                   /translation="MSGWLAIAGLGPGDAALVTPEVEAALAEATHVVGYIPYIARVAPR
FT                   AGLTLHPSDNRVELDRARHALEMAAAGARVVVVSSGDPGVFAMASAVFQALEGAPEWQE
FT                   LDIRVLPGITAMLAAAARAGAPLGHDFCAINLSDNLKPWVVIERRLRLAAQADFAMAFY
FT                   NPRSRGRPEGFARALEILREECGAHQLITFARAVSTLEERINTVTLVEATPEMADMRTV
FT                   VLMGNSATRRVGRFVYTPRMFPGEAGTGSPSESARAQGSGQVE"
FT   CDS             complement(55664..56401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobI"
FT                   /locus_tag="ACMV_P1_00600"
FT                   /product="precorrin-2 C(20)-methyltransferase"
FT                   /EC_number="2.1.1.130"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00600"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82856"
FT                   /db_xref="GOA:F0J6Y9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6Y9"
FT                   /protein_id="BAJ82856.1"
FT                   /translation="MSMGRILCAGLGPGDPELMSVKADRAIRGARHIAFFRKAGHAGQA
FT                   RRIVEGMLAPGSIEHAMEYPVTTEIAFDSLEYTETLARFYDLWADHLAQLAETEEVVVL
FT                   CEGDPFFYGSFMHLYTRLKGRVPVEVIPGITGMSGCWTATGVPITWGDDILCVLPGTLP
FT                   EARLVAQMREAEALVVMKTGRNLPKVRRALAEAGRLADAWLVERGTMADERVARLADLP
FT                   EGDYPYFAIVLVHGQGRRPEIDA"
FT   CDS             complement(56398..57027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobH"
FT                   /locus_tag="ACMV_P1_00610"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.99.61"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00610"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82857"
FT                   /db_xref="GOA:F0J6Z0"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6Z0"
FT                   /protein_id="BAJ82857.1"
FT                   /translation="MPHAYETDGAAIYRQSFATIRTEADLARFTPEEEPVVVRMIHALG
FT                   FVGLEASVAFTPGLAEAARTALMAGAPILCDARMVSEGITRSRLPAENEILCTLHDPKV
FT                   PALAQHLSTTRSAAALELWRPRLAGAVVAIGNAPTALFHLLNMLEDPGCPRPAAIIGCP
FT                   VGFVGAAESKAALMEAPPVSSMAVMGRLGGSAVTVAAINALASRKE"
FT   CDS             complement(57027..58175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobG"
FT                   /locus_tag="ACMV_P1_00620"
FT                   /product="precorrin-3B synthase"
FT                   /EC_number="1.14.13.83"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00620"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82858"
FT                   /db_xref="GOA:F0J6Z1"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6Z1"
FT                   /protein_id="BAJ82858.1"
FT                   /translation="MSEPEIRGWCPGALTPMASADGLVVRLRPPLGRLSSAQARAVAAA
FT                   AVRFGSGEVELTSRANLQIRGVAEADHAALLAELAAHGLVDPDPETERARAIAIAPFYR
FT                   EAAEITSLANILTEALRAAPLPSKFGATLDIGSAPVLAGTAADLRLERAADGRLVLRPD
FT                   GSATGWPVTAETLPAILTKLIGWFLETGGVRNGRGRMRKHLIGKHDLPGGCNVAPALPA
FT                   ALPKPGPVGDGQLAIVAFGLMPAQTLSALADLSAEIRLTPWRGVFMPGLRALPALSGIL
FT                   AYPEDPLLRVHACTGRLGCPQALAETRALARALAPKLAAGQSLHVSGCAKGCAHPGPCG
FT                   LVLTATPKGFDLARDASAGAPPLRPALSPAALLATPYPFGAP"
FT   CDS             complement(58172..61426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobN"
FT                   /locus_tag="ACMV_P1_00630"
FT                   /product="cobaltochelatase CobN subunit"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00630"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82859"
FT                   /db_xref="GOA:F0J6Z2"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6Z2"
FT                   /protein_id="BAJ82859.1"
FT                   /translation="MHVIFRESHGLEETETPQDLGQDPADLVVLSFSDSDLGAFAAGWH
FT                   RAREAGSTLPTLRLANLVALRHPLSVDTYAERTLAGAKAMLVRLIGGEAYWSYGLSTLR
FT                   DLSQRQGLALAVLPADGREDPALDAYSTLPVSTLRRLSALCDAGGAVAAQAALAQLSLA
FT                   AGLYAGPVAGAKTMPEVGLYLPGRGVVAALPEDPRPAAAVTFYRAYLTAADLGAIDALI
FT                   GALEAEGFAAYGLFAPSLKAPSAAPLVSELLAAHPPAVIVNATAFSAQGAEGRSPLDGP
FT                   GAPVFQVALSTAQRRDWAGSDRGLSPADLAMHVVLPEVDGRLFAGAVSFKAATPRDDAL
FT                   QYSRFVHRAEPEQVARAAARVGGWQRLAATPAAERELALILSTYPGRAHQMAHAVGLDA
FT                   LASAEAILSDLAAAGYVTGPEAGLAARLGAETLAWPLADYRVALTTLPEALREQLNEAW
FT                   GAPEEDPAVRDGVFHFAAFALGRMLVALQPERGHRAGREASYHDLASTPRHAYVAFYLW
FT                   LRARRLAALVHIGAHGTLEWLPGKSVALSADCWPEALTGAMPVIYPFIVNDPGEAAQAK
FT                   RRLGAVTLGHLPPPLVGSTLPEGLARLESLLDEYSTAEGLDPARRSRLVAAIREEARAQ
FT                   GVEDDLALPPGASAAEAITRIDRFVCDLKESRFGEGLHVFGRGACGIEERTGLLAALDG
FT                   RRVASGPSGSPARGRSDVLPTGRNLFAVDPRAVPTRAAHAQGVKLAEELIRRHLQDQGD
FT                   WPRGLIVDLWGSATMRTAGEDFAMALHLAGLAPVWDEGSTRVSGFEVIPPALLGRPRID
FT                   VTLRVSGLFRDIFPGLAQLFEAGAAALADREEDPAENPYAALSPRVFGPKPGAYGLGIA
FT                   ADPIDFSDAARAAAGEAWLAASAWAIGADGASREARSALEARVGTADAFVHSQDLPETD
FT                   LLLAEDFAAHEAGIAAAAARLGRPAPALYHLDATNPEAPRARALSEEIARVMRARAANP
FT                   AWAEGMMRHGFRGGAEIAATLDHLAAFAHLARAVPPHLFDLYHEATLGRIEVAEFLARE
FT                   NPAALARMNETFAALRDAGLWITQRNSIAAALEGRA"
FT   CDS             complement(61442..62476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobW"
FT                   /locus_tag="ACMV_P1_00640"
FT                   /product="cobalamin biosynthesis protein CobW"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00640"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82860"
FT                   /db_xref="GOA:F0J6Z3"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR012824"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6Z3"
FT                   /protein_id="BAJ82860.1"
FT                   /translation="MNDLAKIPVTVVTGFLGAGKTTLIRHLMANPGGRRLAVLVNEFGS
FT                   QGVDGEILKSCANESCPVENIVELANGCICCTVADEFLPTMEAILALPKRPDHILIETS
FT                   GLALPKPLLKAFDWPAIRSRITVDGVIALADAEAVAAGRFAPDPNAVLAQREADDSLDH
FT                   DTPLGEVFEDQIACADLILLTKADLAGEAGIAVARAAIEAEAPRRIPMVTVRDGKVDPA
FT                   VILGLNAAAEDDLAARPSHHDGADDHEHNDFDTIVVDLPEQASQEALEVAIEKLAAEQN
FT                   ILRVKGYVALADKPMRLLVQAVGARVRSQFDRPWGSLPRGSQLVVIAERGDVDAARIRT
FT                   ALGA"
FT   CDS             complement(62473..62835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00650"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82861"
FT                   /db_xref="InterPro:IPR012863"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6Z4"
FT                   /protein_id="BAJ82861.1"
FT                   /translation="MGTTLHVCITCRAGQEPVEGMPCLGARLLAALQAGDCPEGVTIRP
FT                   VECLSACNTGAAVALSAPGRWSYIYGRLAPEDAPDILGGAAAYARAPNGLVPWRERPVI
FT                   FRKQSIARIPPQEPAP"
FT   CDS             63175..63792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobO"
FT                   /locus_tag="ACMV_P1_00660"
FT                   /product="cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00660"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82862"
FT                   /db_xref="GOA:F0J6Z5"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6Z5"
FT                   /protein_id="BAJ82862.1"
FT                   /translation="MGRKPVSEEEHAAKKAKIKAARDRMMAEKIGEKGLIIVHTGPGKG
FT                   KSSSGFGMILRCIAHGMPCAVVQFIKGAWDTGERRLLTEHFGDLCQFHAMGEGFTWETQ
FT                   NRARDIAAAEAGWEKAKELIRDPSIRMVLLDEINIALRYEYLDIEAVIAFLREEKPEMT
FT                   HVVLTGRNAAEGLIEAADLVTEMTLVKHPFRAGIKAQAGVEY"
FT   CDS             63868..65313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobQ"
FT                   /locus_tag="ACMV_P1_00670"
FT                   /product="cobyric acid synthase"
FT                   /EC_number="6.3.5.10"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00670"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82863"
FT                   /db_xref="GOA:F0J6Z6"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6Z6"
FT                   /protein_id="BAJ82863.1"
FT                   /translation="MPALMIQGCGSNVGKSMLVAGLCRAARRRRLTVAPFKPQNMSNNA
FT                   AVTADGGEIGRAQALQALASGLEPVTDMNPVLLKPETDLGAQVIVQGRRIGTMRARDYS
FT                   RRKPELMAPVLESFNRLKAAHDLVLVEGAGSPAEVNLRAGDIANMGFARAADVPVVLAG
FT                   DIDRGGVIAQVVGTQTVLDAEDAALVVGFLINKFRGDPQLFEAGYRLIEGRTGWRGYGV
FT                   LPWFPGASRLPAEDALDLGRVAKGGPFRVVCLALSRIANFDDLDPLSAEPAVSVTMLRA
FT                   GEALPGDTDLVILPGSKSTRGDLTFLRAQGWDIDLAAHRRRGGAVLGICGGFQMLGTRI
FT                   ADPEGIEGPAGESPGLGLLDVETIMGGDKTLTRISARHTATGAEFDGYEIHIGRTRGPD
FT                   CARPFAEVAGQPEGAVSGDGRVMGSYLHGMFSVDGFRRDFLDRLGAQGSGLDYRAGVEK
FT                   TLDQLAAHLEAHLDLDGLFALAR"
FT   CDS             complement(65327..66916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobC/bluB"
FT                   /locus_tag="ACMV_P1_00680"
FT                   /product="putative threonine-phosphate
FT                   decarboxylase/cob(II)yrinic acid a,c-diamide reductase"
FT                   /EC_number="1.16.8.1"
FT                   /EC_number="4.1.1.81"
FT                   /note="bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00680"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82864"
FT                   /db_xref="GOA:F0J6Z7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005860"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6Z7"
FT                   /protein_id="BAJ82864.1"
FT                   /translation="MRDHGGNLDEAMAGFGGTAADWIDLSTGINRQPWPVPPLPPEAWT
FT                   ALPTKRALAALIEAARGVWGTEAPMVALAGAQAAIQLIPHLAPPGRARVLAPTYNEHAA
FT                   ALRAAGWAVKEVSRLEELAGADLAVLVNPNNPDGRRIEPEALLALLPQVGRLVVDESFG
FT                   DPDPALSLAAGCGRPGLIVLRSFGKFWGLAGVRLGFAIGPAADIAALAERAGPWAVSGP
FT                   ALEIGRRALLDTAWAEATRQRLAENALRLDALVARAGWELIGGTGLFRLYRTPEGTAAQ
FT                   ARLARHRIWSRIFPARPDWLRLGLPGSEEEWKRMEAALKGPKTFGTEEAAVLSRLLHWR
FT                   RDVRHFRRDPVPDEVLRRLRVAVDSAPSVGNARPWRIFRVEDAGLRSAVRVEFARCNGA
FT                   AASLYSGDQARTYAKLKLAGLEAAPVQFAVFTVTDPDAGHGLGRQTMPETLRQSTAMAI
FT                   HTLWLAARAENLGLGMVSIVEPKRIEELFEVPEGWEFAAYLCLGWPAFSDDTPLLHRNG
FT                   WQQNCATDWEIR"
FT   CDS             complement(66924..67865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobD"
FT                   /locus_tag="ACMV_P1_00690"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /EC_number="6.3.1.10"
FT                   /note="protein synonym:adenosylcobinamide-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00690"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82865"
FT                   /db_xref="GOA:F0J6Z8"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6Z8"
FT                   /protein_id="BAJ82865.1"
FT                   /translation="MSMAAAMAVALGVDWGLGWPDPLYRRIGHPVTWIGDLIGRLDRDW
FT                   NTAGARPGRDRLLGVAAALLVIAVTVAFAAIIAALQPGGWAGLVLTGVLAWPLVAARSL
FT                   DDHVARVAEPLGRGDLPGARRAVAMIVGRDTERLDSAGVARAAIESLAENASDGIVAPL
FT                   FWGAIFGLPGIAGYKAINTLDSMIGHRTPRHEAFGWAAARIDDVTNLIPARLCGLIFAA
FT                   VSALPRASCATMWRDAGHHRSPNAGWPEAAMAGGLGIRLSGPRVYGDRLSDEPWVNAGG
FT                   GDPNSASISAALALYRRALAALAALLLLAAAL"
FT   CDS             complement(67862..68476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00700"
FT                   /product="BluE protein"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00700"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82866"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6Z9"
FT                   /protein_id="BAJ82866.1"
FT                   /translation="MLSKAGAAGLLRSLGVRPEGRFSLRLDMPARVALARAAGVTDPKT
FT                   IVLACLGSEGAVDPLMLDDPEGLLWASRAGRVLARPPAPSRMEIVGRFFGPMRRTDPRD
FT                   AAFPDIADHSDAWPAACGDLAGVAALASESARRTIRLRGPADDPTETLAAAKGALGFVI
FT                   AHTGAAGGLIFAPGTVPETTPAALRASGFRHILRFRIRGGR"
FT   CDS             complement(68470..68616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00710"
FT                   /product="BluE protein"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00710"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82867"
FT                   /db_xref="UniProtKB/TrEMBL:F0J700"
FT                   /protein_id="BAJ82867.1"
FT                   /translation="MNGIEIAVLGHFGEFLQGRIGPGGPVALVTVPCAFPGPSHCTSRA
FT                   RGC"
FT   CDS             complement(68613..69200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00720"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00720"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82868"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:F0J701"
FT                   /protein_id="BAJ82868.1"
FT                   /translation="MSGTETTSLILIRHAPSDAGGRLAGRSDPAARLPGTEALTRARAA
FT                   LAALGAAEARLVTSPARRCRETVAALLPGREAALDPRLWEQDFGAWEGLLPEELPDLGP
FT                   LGRVEIAAHRAPGGESFLDLWARVTPALEGLTQGGMVVVVAHAGTIRAALGLALGEAPA
FT                   GLGFEIAPLSATHLRAQLGGVWSIGFTNRALA"
FT   CDS             69267..69767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobP"
FT                   /locus_tag="ACMV_P1_00730"
FT                   /product="adenosylcobinamide kinase/adenosylcobinamide
FT                   phosphate guanylyltransferase"
FT                   /EC_number="2.7.1.156"
FT                   /EC_number="2.7.7.62"
FT                   /note="bifunctional protein"
FT                   /note="protein synonym:bifunctional adenosylcobalamin
FT                   biosynthesis protein CobP"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00730"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82869"
FT                   /db_xref="GOA:F0J702"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="UniProtKB/TrEMBL:F0J702"
FT                   /protein_id="BAJ82869.1"
FT                   /translation="MILLITGGARSGKSSYAEGRVAALPGRPCYIATSEIRDAEMAERI
FT                   AHHRARRGPEWREREATFDLVAALTETDGDGPRLVDCVTLWLTNLVLTDRDWQAELNAL
FT                   LAALPAQQSPVIFVTNEVGLGIVPENALARAFRDAAGLVNQALAAAADEVQFVVSGLPL
FT                   KVK"
FT   CDS             69764..70792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobT"
FT                   /locus_tag="ACMV_P1_00740"
FT                   /product="nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00740"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82870"
FT                   /db_xref="GOA:F0J703"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="UniProtKB/TrEMBL:F0J703"
FT                   /protein_id="BAJ82870.1"
FT                   /translation="MMQAPLFPAASFGDLRARLADLPAADPTSIAAARVRQDNLTKPPG
FT                   ALGRLEELAIFMAGWQGRARPVLDRAQVVVFAGNHGICRQGVNPFPQEVTAQMVANFTR
FT                   GGAAINQLCRVSGADLSIVALDLDRPTGDFTEGPAMTEAEVLDAMVRGAAAVDTGANVL
FT                   LLGEMGIGNSTVAAAQARASFGGTAWDWVGPGTGADADKIAIKAHVIEAGMERHAAALS
FT                   DPLATLAAFGGREQAAICGAVLAARAARIPVMLDGFICTAAAAVLAPLGIGALDHCMVG
FT                   HASAEPGHRKLLSAIGKKAVLDLGMRLGEGSGAAVALGVLRAALAVHDGMATFAEAGIS
FT                   AG"
FT   CDS             70789..71544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobS"
FT                   /locus_tag="ACMV_P1_00750"
FT                   /product="cobalamin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00750"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82871"
FT                   /db_xref="GOA:F0J704"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:F0J704"
FT                   /protein_id="BAJ82871.1"
FT                   /translation="MSGSWIQSRTDEARLALMLLTRMPMGRLDAAPTLAAAAWAYPLAG
FT                   AAVGAVAGLVYLLAAGLGLASLPSALLAVAAGVVATGGMHEDGLADLADGFGGGGDRTR
FT                   KLEIMRDSRVGSYGVIALCLALLLRVVLLAEVLPGHAPLFVLLGLGALSRAPLPVLMRL
FT                   LPAARAEGLGHSAALRIGAGQAAAAALTGFVLAALFLPLLLCPVLAAAAAAALTGLLAR
FT                   RQIGGFTGDVLGAAQIAAELAALLALAAA"
FT   CDS             complement(71943..72323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00760"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82872"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:F0J705"
FT                   /protein_id="BAJ82872.1"
FT                   /translation="MVVDPLFPIEPYLLAASTSATPIRLVIDTHLHADHRSAGRALAAA
FT                   AGADYVIHEQCGSLQCLPSARRGSETSASIFSNELNAAMTTSESVAFPRIPNPAGRESP
FT                   RSPKNQFSPRCCGSSPQLRNQY"
FT   CDS             72670..73071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00770"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82873"
FT                   /db_xref="UniProtKB/TrEMBL:F0J706"
FT                   /protein_id="BAJ82873.1"
FT                   /translation="MNKALGIVALICKAGDKSEAKIEATISAERMIFYAREAEAEAGTG
FT                   PGASREREEAEDLMSRAIAGSQEIRSEASDALAAGRNGNAEEAAFIREGIAREIGTMHD
FT                   QIRDEREAVQETPPHHQVEDDGYEFEPGF"
FT   CDS             73177..73824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00780"
FT                   /product="putative DNA topoisomerase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00780"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82874"
FT                   /db_xref="GOA:F0J707"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:F0J707"
FT                   /protein_id="BAJ82874.1"
FT                   /translation="MERLGIGRPSTYASILENITSRSYVIEGKKGFLSPAPIGEKIRDA
FT                   LVSRFDFAELAYTKGLEDQLDEIAEGRAVYEDVVRGAWNALDGGLSKLDTLTITPAHPC
FT                   PECGKALTRRKGQHGFFWSCTGWPDCKVTLPDEKGQPGKKKAPAPPTGIMCPSCGKELA
FT                   RRQGTSKPKMKGMKPRPYDFYSCTGFPKCEAKFQTGADGKPVFENQTKQAAE"
FT   CDS             73830..74504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00790"
FT                   /product="putative single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00790"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82875"
FT                   /db_xref="GOA:F0J708"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="UniProtKB/TrEMBL:F0J708"
FT                   /protein_id="BAJ82875.1"
FT                   /translation="MNRFTFMGWATEKPELKTYGKTTIARIRLIRNDFIGMDEDGKKKE
FT                   METSITFTAFGNLAKVLCKTVMTGDQILVEARVRNNDYEADGRKLYGFNFEILNFEYGA
FT                   PGRAKRERYADEGPGKANRERNAHEGPGKAKRERYAEQFAVRALKKRSDYLQNYLNTVE
FT                   IYAPGTVERWVAEGEYEAVKAIVGRGQNPEHFSREILLAGEKAAIDAARREADANGGGL
FT                   SP"
FT   CDS             74573..75088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00800"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82876"
FT                   /db_xref="InterPro:IPR020358"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:F0J709"
FT                   /protein_id="BAJ82876.1"
FT                   /translation="MPNASCAARQPDPERSDHLDQSRFSPQNRRRLSAPGMRAFLAIAD
FT                   LWGLDEEQRLLILGCPTRSTFYRWAKIAREHGEMTLDVDTLTRISAVLGIHQALGILHL
FT                   SEKEGVAWLKTPHGATVFGGRPPLALVTSGTQDGLMTVRRFLDAVRGGIYMEPFGGLDR
FT                   NFVPCLSG"
FT   CDS             complement(75085..76113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00810"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82877"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:F0J710"
FT                   /protein_id="BAJ82877.1"
FT                   /translation="MTDVAVQERHDMPFPRSLPEFQRLFPDDAACATYLERTRWPGGFT
FT                   CPRCGVVGDPFRIATRPGILTCRSCRRQIGLTVGTVMERSHTPLSVWFWAAYLVASQTP
FT                   GISAVQFQRQLGLSRYETAFGILHKLRAGMVRPDQDRIGGLPGTHVEVDETFVGVRTRG
FT                   EGRGVHHKTLVACAVEVRHRKPGAVQNHRRVGRYAGRVRLSVVTDRSSRSLGGFVEAAV
FT                   TPGALIVTDDWSGYGELQKAGYDHHPIAACGDPEIADEFLPLIHLVFSNLKTWLNGIHH
FT                   GVSEKHLQAYLNEFTFRFNRRFYPMNAFRSLLGIAGGTAAPTYGALYSGERRHPRYGGC
FT                   VS"
FT   CDS             complement(76400..77107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00820"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82878"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:F0J711"
FT                   /protein_id="BAJ82878.1"
FT                   /translation="MSNVFVPRVDVLPAPQIALWRDLDQVPGHFALYGGTALALHLGHR
FT                   ESIDFDFFSSEGVDPDHLLNVMPFLHGAQVLRKAENTLDVSVDRGGAIKVSFFGLPGFK
FT                   RILPTVTCPDNHIQVASLLDIAGTKVSVVQKRSEMKDYLDIAALLVDGRITLPMALSAG
FT                   QVIYGSQFNPLISLKALSYFGDGNLQELPTKSRNLILDAVRRVDLQRLPSILPTKHTHH
FT                   PNGGGHSPGGVGT"
FT   CDS             77233..77514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00830"
FT                   /product="Xre family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00830"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82879"
FT                   /db_xref="GOA:F0J712"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:F0J712"
FT                   /protein_id="BAJ82879.1"
FT                   /translation="MRNERFNSIWDAIEDTPAEAENMKLRSTLMMALKDHIARAGLSQG
FT                   QAAKLFGVTQPRISDLLRGKINLFGLDTLVNMAVAAGLHVELRVMEAA"
FT   CDS             77511..77726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00840"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82880"
FT                   /db_xref="UniProtKB/TrEMBL:F0J713"
FT                   /protein_id="BAJ82880.1"
FT                   /translation="MTNGDAVVLSRYPQLRFIASQLTETTILTEAEALALYERNWRFLD
FT                   LETMDDEERRFLDSLVRGVGKGVLNI"
FT   CDS             complement(77764..78270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00850"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00850"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82881"
FT                   /db_xref="GOA:F0J714"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="UniProtKB/TrEMBL:F0J714"
FT                   /protein_id="BAJ82881.1"
FT                   /translation="MSVRFAIEPLAKAHKRVDFTCGNDRIDSYFRETVSQDLKRKYATC
FT                   FVAREIATDRVAGFYTLSSSNVPLNEVPEPLAKKLPRYPTVPAVLIGWLARHRDYAGQG
FT                   LGDALLFDAIKTVATAPIGAHAIFADAIDDSAAAFYMAFGFTPLVRRPRTLYLPVTSAL
FT                   SLVWS"
FT   CDS             complement(78267..78557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00860"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82882"
FT                   /db_xref="GOA:F0J715"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:F0J715"
FT                   /protein_id="BAJ82882.1"
FT                   /translation="MPKPQVETETARLEARIPIQVYDQMQRAARLRGLTLTGYLIATAG
FT                   EDARRVVEDAEIMRLAREDQIRFAEALINPPNPNERLVRAAKRHAELIERR"
FT   repeat_region   78854..78863
FT                   /rpt_type=FLANKING
FT   repeat_region   78864..80091
FT                   /note="Belongs to ISAs1 family"
FT   repeat_region   78864..78881
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 18 bp inverted repeat"
FT   CDS             78952..80085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00870"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00870"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82883"
FT                   /db_xref="GOA:F0IZE6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:F0IZE6"
FT                   /protein_id="BAJ82883.1"
FT                   /translation="MSVRRLVEEFSALEDPRCGGKVEHRLIDILVIAVCAVIAGAESWE
FT                   DMALYGRSKQEWLGTFLALPNGIPSHDTFRRVFMLIDTGRFEACFEAWARSFGTTLDRE
FT                   VVAIDGKTIRGSFDRSRDQAALHVVSAWASDRGLVLGQRQVGDKSNEITAIPELLDVLD
FT                   IKGAIVTLDAMGCQRAIASKILERGADYLVTLKANQGKKHSAVQEYCATTCFSRSPVDR
FT                   PVHDEFDDGHGRLVRRRVFVCPDAVALEPLRDWPGLKSVLAVETIRGVNGSGKIEAEIR
FT                   YFLSSSDDQPEILAKAIRQHWQIENSLHWVLDVTFNEDHCRIRDRNAVQNFSLLRKIAI
FT                   NLVRRHQASKASLKGRRKMAAWDNRYMEQVLTGFFHA"
FT   repeat_region   80074..80091
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 18 bp inverted repeat"
FT   CDS             80078..80569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00880"
FT                   /product="putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00880"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82884"
FT                   /db_xref="GOA:F0J717"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:F0J717"
FT                   /protein_id="BAJ82884.1"
FT                   /translation="MRNPWAAGCVKIFDDRASGARADRAGLRAALDYVRDGDVLIVWKL
FT                   DRLGRSLPDLIETVTSLATRSVGFRSLTEAIDTTTPGGRLVFHLFGALGQFERDLIQER
FT                   TRAGLAAAAARGRKGGRKPVITNEKLNRARAIIASGLTVREAAARLRVGKTALYDALRR
FT                   "
FT   repeat_region   80092..80101
FT                   /rpt_type=FLANKING
FT   repeat_region   82032..82041
FT                   /rpt_type=FLANKING
FT   repeat_region   complement(82042..83269)
FT                   /note="Belongs to ISAs1 family"
FT   repeat_region   82042..82059
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 18 bp inverted repeat"
FT   CDS             complement(82048..83181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00890"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00890"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82885"
FT                   /db_xref="GOA:F0IZE6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:F0IZE6"
FT                   /protein_id="BAJ82885.1"
FT                   /translation="MSVRRLVEEFSALEDPRCGGKVEHRLIDILVIAVCAVIAGAESWE
FT                   DMALYGRSKQEWLGTFLALPNGIPSHDTFRRVFMLIDTGRFEACFEAWARSFGTTLDRE
FT                   VVAIDGKTIRGSFDRSRDQAALHVVSAWASDRGLVLGQRQVGDKSNEITAIPELLDVLD
FT                   IKGAIVTLDAMGCQRAIASKILERGADYLVTLKANQGKKHSAVQEYCATTCFSRSPVDR
FT                   PVHDEFDDGHGRLVRRRVFVCPDAVALEPLRDWPGLKSVLAVETIRGVNGSGKIEAEIR
FT                   YFLSSSDDQPEILAKAIRQHWQIENSLHWVLDVTFNEDHCRIRDRNAVQNFSLLRKIAI
FT                   NLVRRHQASKASLKGRRKMAAWDNRYMEQVLTGFFHA"
FT   repeat_region   83252..83269
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 18 bp inverted repeat"
FT   CDS             83256..83393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00900"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82886"
FT                   /db_xref="UniProtKB/TrEMBL:F0J719"
FT                   /protein_id="BAJ82886.1"
FT                   /translation="MRSPWVLKGLSVAEDTDITDAENRAGYHHYNNPYFSSRFYLEYNF
FT                   "
FT   repeat_region   83270..83279
FT                   /rpt_type=FLANKING
FT   CDS             83495..83692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00910"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82887"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:F0J720"
FT                   /protein_id="BAJ82887.1"
FT                   /translation="MWTPTTRRRDSRAGLCYGSDLTDAEWIILLPFLPPHADCGRKRAH
FT                   SMREIMDAICTCFAAPMHGG"
FT   CDS             83662..83937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00920"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82888"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:F0J721"
FT                   /protein_id="BAJ82888.1"
FT                   /translation="MLRGANAWRLMPDSFPPWRAMYRWFARFRDEGTWEIINYHLVMQD
FT                   RERVDRAANPSAAVIDSHSVMTPESTFTANWEWARLRSPQASALRG"
FT   CDS             complement(83903..85036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00930"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00930"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82889"
FT                   /db_xref="GOA:F0J722"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="UniProtKB/TrEMBL:F0J722"
FT                   /protein_id="BAJ82889.1"
FT                   /translation="MTDKPRLRICLIGSGFMGKAHAFGYTMAARVFDLPYALEFHTLVD
FT                   ISDAAAQRAADALGFAHAATDWKAAVANPEIDLVSITAPNALHKEMALAAVAAGKHVYC
FT                   EKPLAPLASDALEMAEAAEDAGARTQVGFNYLCNPMVALAREMIASGELGEILGYRGLH
FT                   AEDYMADPTGSFTFRHDPAGGGALADIGSHALATAEFLMGPAAGPIKTVMGDCVTMIRE
FT                   RPDGKGGIRKVEVDDIGRAFLRFSNGATGSIEGNWIATGRKMQHAFEVFGTRGALAFNQ
FT                   ERFNELHFYATDDPHGRQGFRRIEAGPEHAPYGLFCVAPGHQLGFNDLKAIEVAGFLEA
FT                   IAEMRPEPYNFRMGLRIQTLVETIQVSSREGRWLAVT"
FT   CDS             complement(85076..86239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00940"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00940"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82890"
FT                   /db_xref="GOA:F0J723"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="UniProtKB/TrEMBL:F0J723"
FT                   /protein_id="BAJ82890.1"
FT                   /translation="MSFDRQLRLGMVGGGEGAYIGNIHRFASRLDGVWQLVAGAFDVDP
FT                   ARGRAFALSQGITEDRSYGTYQELIAGEKDRADRVDAVAICTPNFTHYPIAKALIEAGF
FT                   DVICEKPLTATLEDGVALEALARESGRFVGVTYTYSGYPMVHDARVRVARGDIGAVRSL
FT                   QVEYPLEWMATAIEQQGNAQAAWRTDPKKNGRGGSIGDIGTHAYHLAGFVTGLKLQALS
FT                   ADLATFVQGRALDDNAHVMMRYEGGARGLLWCSQVAIGNSNGVRLRVFGETGSFQWFQE
FT                   QPNELVYTPLNGRVQLIKRGADDLSEDAKVRTRTPPGHPEGYLEAFANLYAGFGEAIRA
FT                   RHAGRDPGPLGQNLPLAYDGLKGVAFVEAVVDSAEGDLPAWVRPVAR"
FT   CDS             complement(86243..87301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00950"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82891"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:F0J724"
FT                   /protein_id="BAJ82891.1"
FT                   /translation="MKTIKGPSVYLAQFAAADAPYNSLPSLASWAAEKGFLGVQIPTWD
FT                   TRLIDMKLAAESQTYCDEIRGMLADRGLVLTELASHITGQLVAVHPAHDQIMDSFAPEH
FT                   VRGDRAARRAWAEEQLCFAARASQRFGITTHTTFPGALLWPYVYPYPQWPEGLVDEGFT
FT                   ELAARWAPILNDFDAHGVDVAYEIHPCEDLHDGHSWEYFLEKVNNHPRANIMYDPSHFV
FT                   LQALDYLAFIDHYHDRIRAFHVKDAEFRPDGKSGAYGGYQPWSKRAGRFRSPGDGQVDF
FT                   GAIFTKLSSYGFDGWATLEWECFIKNPEDGAREGAQFIRDHIIRVSDRAFDNFVKPGAN
FT                   LEANRAMLGLEQ"
FT   CDS             complement(87306..88118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_00960"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00960"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82892"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="UniProtKB/TrEMBL:F0J725"
FT                   /protein_id="BAJ82892.1"
FT                   /translation="MNRIDGKIAVVTGGTQGLGAAIARLFAEAGAAGIAIVGRGREKGV
FT                   AVAKEITDKTSVPVEMIVADLGNIEDVRRIIPAADARFGRVDILVNAAGLTDRGNMLNT
FT                   SPELFDRMTAINTRAPFFLIQDAARVMDRLGIEGRIVNIGTMSAHAGQPFLAPYAVSKG
FT                   GLTTLTRHAAFALLRNKVHVNQLDIGWMNSDHERALVLSETGDPDFIDRAAAGKPFGRI
FT                   LDPDEVARAVLWMASDDSGMMTGAVIQFDQSVWGGYDDAPVPSTKLKA"
FT   CDS             complement(88118..89014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolE"
FT                   /locus_tag="ACMV_P1_00970"
FT                   /product="inosose dehydratase"
FT                   /EC_number="4.2.1.44"
FT                   /note="protein synonym:2-keto-myo-inositol dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00970"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82893"
FT                   /db_xref="GOA:F0J726"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR030823"
FT                   /db_xref="UniProtKB/TrEMBL:F0J726"
FT                   /protein_id="BAJ82893.1"
FT                   /translation="MKAKLGIAPIAWWNDDLEELSDDVSLDECLHQASVAGFTGMETGR
FT                   RFPMNMTELGPILDRYGISVCGGWFSGLLLDGDIETEKDRIRAQMDFFVDAGAPCIVYG
FT                   ETARSIQGDRSQPLATKPKLSDDEIRVYARKMTEFGEWCADRGMPLAYHHHMAAAIETE
FT                   AELDQFMTHSGEGIPLLFDAGHMAFAGGDVLRVIDKHHARISHVHTKDVRMDVIDALDR
FT                   SRESFLDAVVKGAFTVPGDGSLDFVAITQRLAAYGYEGWFVVEAEQDPKVSHPLEMAKK
FT                   GHAELMRVMALAGYEVV"
FT   CDS             complement(89018..90889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolD"
FT                   /locus_tag="ACMV_P1_00980"
FT                   /product="3D-(3,5/4)-trihydroxycyclohexane-1,2-dione
FT                   hydrolase IolD"
FT                   /EC_number="3.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00980"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82894"
FT                   /db_xref="GOA:F0J727"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/TrEMBL:F0J727"
FT                   /protein_id="BAJ82894.1"
FT                   /translation="MSERTVRLTMAQALVRWLTHQYTEIDGERVPLFAGLFGIFGHGNV
FT                   TCLSEALEQVQDQLPTYRGQNEQSMALAAIGYAKAKRRRQIMIAATSIGPGASNMVTAA
FT                   GTAMANRLPVLLLAGDTFANRLPDPVLQQVEHFGNPTITVNDTFKPVVRYWDRISLPEQ
FT                   IITSLPQAVATMLDPADCGPAFIGLAQDTQEKAFDYPAVFFEPKVWHIPRPRPDRDAVA
FT                   KAVELLKSAKKPMIIAGGGVRYSLAEDIVAEFAAKHGIPVVETIAGKGGLTHDHPVHAG
FT                   PIGIVGSTSANALAAEADVILAVGTRLQDFTTGSWTAFAREAQFISVNAARFDAVKHRA
FT                   LSVVGDARETMTEMDTALGDWVAPDERLKVAKDLFSEWNRILDEHQAPTNSPVPSYAQV
FT                   IGVMNKVARPNDTLIGAAGGTPGEITKNWRVKDPNTFDCEFGFSCMGYEIPAGWGHAMA
FT                   QKGPGGLGGTPMVMLGDGTYLMMNSDIYSAVLTGDRMIVVVCDNGGFAVINRLQQFKGV
FT                   PGFNNLLKDCRIANPENPPHVDFAKHAEAMGAAARHVESLADLEEALKWAQGNDGPTVI
FT                   SIVSDAYAWVPGDADWDVGVPEVSNFKAVTEARKAQDAIRAKQRVGV"
FT   CDS             90991..91998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idhA"
FT                   /gene_synonym="iolG"
FT                   /locus_tag="ACMV_P1_00990"
FT                   /product="inositol 2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /note="protein synonym:myo-inositol 2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_00990"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82895"
FT                   /db_xref="GOA:F0J728"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR030827"
FT                   /db_xref="UniProtKB/TrEMBL:F0J728"
FT                   /protein_id="BAJ82895.1"
FT                   /translation="MLKIAVLGCGRIGRMHAENINSHQRATLVGVYDVVKEASRSVAQK
FT                   LGVREFESAAEIFASAEVDAVLIATSTATHADFIEQAVAAGKPILCEKPIDLSLARVRC
FT                   CAARIAGSDVPIMLGFVRRFDTGHRAVRQAIEAGQIGELHQVVITSRDPDIAPDAYIEV
FT                   SGGIFRDMTIHDFDMARFILGEEIETVTAAGARLVSPALMERCDDWDTVSVLMTTASGK
FT                   QCVIGNSRRAVYGYDQRVEAFGNEGMAISENRTESNLRLSRATFTDQAPPLQNFFIERY
FT                   AQAFASEIDAFVNAVEKGVAPEVGFDDGEKALMLAEAALLSVREGRTVRMEELG"
FT   CDS             91995..93431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="ACMV_P1_01000"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01000"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82896"
FT                   /db_xref="GOA:F0J729"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:F0J729"
FT                   /protein_id="BAJ82896.1"
FT                   /translation="MTLYASFGNFIDGAWQAGRAKLDVVSPATEKLLGTILAADTSDTQ
FT                   AALEAAARAKAPLRAMGGFGRADAMHRIADAMLARTEEAQRMIATETGKPLAQAGREWG
FT                   LACDQFRWFAEEARRIYGRIVDSRVPGGRFEVTYEPVGVVGAFTAWNFPAALPARKLAP
FT                   ALAAGCPVVLRPSSQTPGVAMIMVDCIRAGGLPNGAVNLVVGSTAATYAPIMADKRVRK
FT                   VSLTGSTRVGQQMIRDAADTVKKVSMELGGNAPLIVYDDAELQHVLDMTVPTKFANCGQ
FT                   VCVTPDRIFVHDSLHDAFVTGFVDRAKAIVLGDGLDPATTMGPLINARRLEDIDGVVQA
FT                   AVKAGAKLAHGGRRSPTHNTGHFYEPTVLTEVTDDMAVFAEENFGPVAAITRFTNEDEV
FT                   LERANACDMGLSAYAFTRSADRARRTVAALKSGMVGINSFALAASEAPFGGTNHSGMGR
FT                   EGGTEGITDYLDTKLAQVVF"
FT   CDS             93441..94259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01010"
FT                   /product="aldolase"
FT                   /EC_number="4.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01010"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82897"
FT                   /db_xref="GOA:F0J730"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="UniProtKB/TrEMBL:F0J730"
FT                   /protein_id="BAJ82897.1"
FT                   /translation="MRNKLKDIWVEGRPVLHGWLSIGNPFTAEIMAAQGYDAISIDIQH
FT                   GALDYSAVLPMFQAMRASGVVAMARVPWLDPAAIMKTLDAGAMGIICPMINSRAEAEEF
FT                   VSYLRYPPKGQRSFGPTRAGVVMPGYGLAMNDEILAFAMIETQVGMDNLEEIAATQGLD
FT                   GIYVGPADLTLGTKAGRLPPGFDRQEDEMIALIQRIATVCRAAGIKAALHCGTPEYAAK
FT                   AISWGYHMTTVSGDTRLLAGAAAASVARWRELTGAEPKAAGSTGNKGGTY"
FT   CDS             94259..95230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01020"
FT                   /product="putative 2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01020"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82898"
FT                   /db_xref="GOA:F0J731"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="UniProtKB/TrEMBL:F0J731"
FT                   /protein_id="BAJ82898.1"
FT                   /translation="MPHILAAGKLHPSGVALLEQTTHNGYTFDYIEEVSEASYIPLIYK
FT                   TDALILRTQPLTAETVAKAPKLKVVSRHGVGYDAVNLEALNARGIALTVVGDVNSVSVA
FT                   EHAMMQILALAKRALVADHAVREGPWGWRNRLEAREISGLNLLILGYGRIGRSLARMAK
FT                   GFQMEVRAYDPFLLKAGWPEGDVSPVETLAEGLAWADCISVHIPKGDKPLIGADEIAAM
FT                   KPNVILANTARGGIVAEEPLRAALASGHVFGAGMDVFDAEPPVDGGPFAALDNALLSPH
FT                   IAGLTAECAERMAVSSVQNVLDFFGGKISPDLVVNRVVASAH"
FT   CDS             complement(95336..95755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01030"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82899"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:F0J732"
FT                   /protein_id="BAJ82899.1"
FT                   /translation="MARCDFRLSTKRDVAAAKAFFRKAIKGQKGQGSGPRTVTLDGYAA
FT                   SHRAVREMKADGELAADTKLRSSKYLNNLVEQDHRGVKSRVGPTLGFKRFETAAITVAG
FT                   IELKRRIRKGQFRLGRLRLRGRPAPAVWEAVLAAH"
FT   CDS             95942..96817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01040"
FT                   /product="RpiR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01040"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82900"
FT                   /db_xref="GOA:F0J733"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="UniProtKB/TrEMBL:F0J733"
FT                   /protein_id="BAJ82900.1"
FT                   /translation="MTTSEKAPENYEDLIRLIHDRYDQMSKTYQRISVYLTQNPNDVAI
FT                   RPISTIAASCNIHASSFVRFAQWLGYTGFKDLQTLFQKRLSTAAPGFDARKRALEDELQ
FT                   LLEDHSELGFLRDLVVRDIASLQGLLDKISAADMVNATELIERADTVYLIGQLRSEPVV
FT                   NLLRYILTMLGKRCVLLDESGGLATHVARTMRPTDVLMAVTFRFYANEVVNIAEEAEQS
FT                   GVPIIAISDTTLSPLMKSARILFAVPEHEYTFSRSLAAPMCLAQALMVAVAARLQHNSV
FT                   DPRIPTVTGQ"
FT   CDS             96907..97137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01050"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82901"
FT                   /db_xref="UniProtKB/TrEMBL:F0J734"
FT                   /protein_id="BAJ82901.1"
FT                   /translation="MAQIVKDAQALFTVPEDEYSFTRTLAAPMCLVQCLAVASAAILQG
FT                   SRDELPRIPTVTEKDRSRGAAGLRRRRTEGT"
FT   CDS             97251..98162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolE"
FT                   /locus_tag="ACMV_P1_01060"
FT                   /product="inosose dehydratase"
FT                   /EC_number="4.2.1.44"
FT                   /note="protein synonym:2-keto-myo-inositol dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01060"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82902"
FT                   /db_xref="GOA:F0J735"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR030823"
FT                   /db_xref="UniProtKB/TrEMBL:F0J735"
FT                   /protein_id="BAJ82902.1"
FT                   /translation="MKAKLAIAPIAWTNDDLPELGGDTPLETCLAESRAAGFIGVENGG
FT                   KFPKDAASLRAKLDAFDLSLVGGWYSGTVLDAPDDLVAEREQAAAQLALFRELGASCLV
FT                   YGETAGTLQNRRNAPLAGRRVLAEDAFPAYGRRLTSFAEYCAEQGVPLAFHHHMATAVE
FT                   TERDINLLMAHTGEAVGLLFDAGHLRFAGGDMFRVLTKHGRRIRHVHVKDVREPVIAGL
FT                   DRTRQSFLDAVLAGAFTVPGDGSIDFGPVIQRLADFGYEGWFVVEAEQDPAKAPPARYA
FT                   KIGHDALADALRRAGYSIQETR"
FT   CDS             98159..98971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01070"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01070"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82903"
FT                   /db_xref="GOA:F0J2G0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2G0"
FT                   /protein_id="BAJ82903.1"
FT                   /translation="MMAQLSGKIAIVSGGTQGLGLAIARLFAERDAAGLVTCGRSREKG
FT                   EARAREISEATGARVIFVQADLGQVEDCRAVVAAADTAFGRVDVLVNAAAITDRGTIID
FT                   TSPDLFDRMFAVNVRGPFFLMQDAIRIMRRENTEGTIVNICSMSAKAGQPFISAYCASK
FT                   GALATLTQNTAYALLRNRIRVNGLNIGWMASDGEHRVQTEFHGASENWLADAAAQQPFG
FT                   RLIDPTEVARAVAFLSSAESGLMTGAMVNFDQSVWGAYDSSPGPAAPL"
FT   CDS             complement(99034..99183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01080"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82904"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2F9"
FT                   /protein_id="BAJ82904.1"
FT                   /translation="MGVERNQALLHFQSKIETALRRIVLAPEHRRYAPHVTLFSSHFSD
FT                   NHAV"
FT   CDS             99323..99502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01090"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82905"
FT                   /db_xref="GOA:F0J2F8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2F8"
FT                   /protein_id="BAJ82905.1"
FT                   /translation="MSHDILRRHLRDLIDAYNFAQWLKTLKGLIPNEFICKRWTSEPNG
FT                   FIITPIDQIPGLNT"
FT   CDS             complement(99499..100572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01100"
FT                   /product="LacI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01100"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82906"
FT                   /db_xref="GOA:F0J2F7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2F7"
FT                   /protein_id="BAJ82906.1"
FT                   /translation="MTGAQASRKTRPRARLADIARVAGVSIATVDRVFNERESVSDAAR
FT                   ERVIQVAREMGVRRDLPEAYRPITHLDLILPQNDSPFFVRLRAAFRDGIAMLDRGIAMH
FT                   RHILAVEDTASFVRLISETSYARKGMILAVPDRPEIRAAVQSIQAAGQKVVTIVTDLPG
FT                   LAGADYLGIDNRQAGATAAHLLGRSCRQSGRVAVLGAHHDWAGHVERMGGFQTTLSRDF
FT                   PHLHCEIIEMDTRDDPDRCARSLRAALSFGPLVGVYNTGAGSIGIMNALKGAMPRPFWI
FT                   GHELSDDHIIYLKDGTMDYAIDQNPRGQALGSLQTLLYRCGLITSTPALSHAELRIYTR
FT                   ENLPARNYEESSQLSLD"
FT   CDS             100702..101610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolH"
FT                   /locus_tag="ACMV_P1_01110"
FT                   /product="IolH protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01110"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82907"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2F6"
FT                   /protein_id="BAJ82907.1"
FT                   /translation="MKIALDPFMHRHLGLEELPFRVKEIGFDWIELSPRGDFLEWFKAP
FT                   RVFPERVRGFRRALKEAGVGIASLLPMYRWASNDDDERKAAVRHWKRAIEICLELEVDT
FT                   MNSEFGRGPHPDKGSCYCCHTGSMIEACEDSWWRSMEELVPVFEREGINLHVEPHPEDW
FT                   VETLQPAVDIIRTVNSPRVRFLYCAPHTFYFGDNTAAMLRECADVLAHVHVGDTFNHRA
FT                   SSGLRYIVNPPGSAARVHQHLDIGQGEVPWDEFFGTLAEIDFDGIMTACVFAWEERADA
FT                   SGRFMRAEMQRYIDKFWKREL"
FT   CDS             101612..102622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolG"
FT                   /locus_tag="ACMV_P1_01120"
FT                   /product="inositol 2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /note="protein synonym:myo-inositol 2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01120"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82908"
FT                   /db_xref="GOA:F0J2F5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR023794"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2F5"
FT                   /protein_id="BAJ82908.1"
FT                   /translation="MTLRIGVIGTGAIGRDHMRRINQTLSGAKVTAVSDVNIESVRTAR
FT                   ADLAPEAEVVGSGEELAASAGVDAVVVTSWGATHEQYVLAAIAAGKPVFCEKPLSTTAA
FT                   GAGRIVEAETAFGRRLVQVGFMRRYDAGYRMLKAVVENEIGRPLMVHAAHRNPSVPEQY
FT                   ITPMAIQDTLIHEIDVLRWLLDDDYVSAQVISPRRTRHAHARVEDPQIVLLETKSGIRI
FT                   DVEIFVNCRYGYDIQCQVVGEEGLASLPDPMAVVMRKDAKLQSAIMTDWKDRFIDSYDL
FT                   ELQDFIKAAARGTASGPTAWDGYVAAVSSDACVEAQSQPGSIVPISLPARPALYN"
FT   CDS             102631..103419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolI"
FT                   /locus_tag="ACMV_P1_01130"
FT                   /product="putative inosose isomerase IolI"
FT                   /note="protein synonym:2-keto-myo-inositol isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01130"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82909"
FT                   /db_xref="GOA:F0J2F4"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR014621"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2F4"
FT                   /protein_id="BAJ82909.1"
FT                   /translation="MRFALNHIATPKLSLADFLGLARRLGMPAIEIRNDLPDVVGTMPA
FT                   GAVRAAAVASGVDILSINALYPFNVWSGDVPARALALADYAQACGARALVMCPLNDGTP
FT                   VPHGDLVAALRELVPILRQHGITGLVEPLGFPVSSLRTKREAIEAIREAGAGDVCKLVH
FT                   DTFHHHLAGEREFFPEFTGLVHISGVRETDLAVNDMLDAHRALVDEMDRLNNIGQLRAL
FT                   ATGGYAGAVSIEPFAPSVHDDPDPEAALRASFAHVAQGVA"
FT   CDS             103577..104545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01140"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01140"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82910"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="UniProtKB/TrEMBL:F0J743"
FT                   /protein_id="BAJ82910.1"
FT                   /translation="MKMRTIGTGMLAGLLGGVALGCVSLAGMTGTAVAKAPEYTFAMIT
FT                   HAQPGDTFWDIIRKGAEAAAKKDHVKLVYLNNPNASGEAQLITNVTQQHVDGIAATLAF
FT                   PDAEDPALAQAEKAGIPVVGFNAGTSEWKKAGMLMYVGEDETIAGEAVGDRLNTLGAKH
FT                   VLVVDQQQGAIQLEDRGDGIKKTFKGKVSVLYVDGYDMAGAQSRIVAKLQQNRDIDYVV
FT                   TLGAPFAPTAIQAVKMANSKAKVATFDLNPQAVHLIQEGKLQFAVDQQPYVQGYEAVDF
FT                   LWLYKTNGDVVGGGKPVLTGPTFVTSKNVAAVAKFAERGTR"
FT   CDS             104626..105693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01150"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01150"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82911"
FT                   /db_xref="GOA:F0J2F2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR035568"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2F2"
FT                   /protein_id="BAJ82911.1"
FT                   /translation="MTIMTNGTMTGNDAPRTAHPQLVQQAFWRKTLKRPEAGALGGAIL
FT                   VFLLFFVVAPPFRQVDAFTTVLYQSATIGIPAVAVSLLMIGGEFDLTAGVAVTTSSLAA
FT                   SMFATKVAGNMWAGIVFALLVSLAIGALNGYLLIRTRLHSFLVTLSTFLMLQGLNIALT
FT                   KLVTGNVATGDISHVPGFASAHAIFASTFRIGGVDVSIAILYWFLFILVATWVLLRTRF
FT                   GNWIFAVGGSDESARAVGVPVRRMKIVLFMLVGFSAWFLGMHMLFEYNEVQSGAGVGNE
FT                   LLYIAAAVVGGCLMTGGYGSAIGSGFGAFIFGMTTEGVIYADWDPDWFMFFVGATLLTA
FT                   TVVNTWLRLRASGGK"
FT   CDS             105695..106498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01160"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01160"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82912"
FT                   /db_xref="GOA:F0J2F1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2F1"
FT                   /protein_id="BAJ82912.1"
FT                   /translation="MSERSAPIIQLTDIGKSYGNISALRGVSMTVRSGEVTCVLGDNGA
FT                   GKSTLISIIAGLREHSTGTYAVDGEAVTFGSPREALDRGISAVYQTLALVPLLPIWRNF
FT                   FLGSELTIGRGPFRRLDIASMWEITDRELRRMGIHVADLDQPVGTLSGGQRQVVAIARA
FT                   IHFGARVLILDEPTAALGVAQSGLVLRYIAQAAREHGTGVIFITHNPHHAYMVGDHFII
FT                   LARGEVELDAARDGLTLENLMFHMAGGAGLNALQHELNRPQPQGA"
FT   CDS             106567..108477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolC"
FT                   /locus_tag="ACMV_P1_01170"
FT                   /product="5-dehydro-2-deoxygluconokinase IolC"
FT                   /EC_number="2.7.1.92"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01170"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82913"
FT                   /db_xref="GOA:F0J2F0"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018659"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030830"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2F0"
FT                   /protein_id="BAJ82913.1"
FT                   /translation="MKALDVITIGRSSVDLYGAQVGGRLEDMRSFDKYIGGSPTNIACG
FT                   AARLGLRSAVITRVGDEHMGRFIREQLSREGVDVRGVVTDPARLTALVLLGIRDEDQFP
FT                   LIFYRENCADMALCEDDINEGLIAEARSVLATGTHLSHPRTEAAVLKALRLARAHGART
FT                   ALDIDYRPNLWGVAGHGAGESRYVESEAVTAKLQMTLELFDLIVGTEEEFHIAGGSPDT
FT                   LTALRAVRALTGATLICKRGARGAVAFAGPIPARIEDGETGPGFPIEVFNVLGAGDGFF
FT                   AGLLKGWLDDETWPKALEYANACGAFAVSRHGCTPSYPSLEELTFFLRRGVREPALRHD
FT                   AELERLHWSTTRPHGVADYRIFAFDHRAQFEEMDGYTAQKGGAFKRLCLEAALSVQAGR
FT                   HGYGILCDERIGRRALHAASGSGLWIGRPCEWPGSRPLAFEPALGSDCGGLSEWPKENI
FT                   VKVLCFCHPDDDAAMWATQEAAVRRLFEAARRNDLEFLLEIIPSKVGPVNDGTTAALIR
FT                   RFYAAGIYPDWWKLEPMASLAAWEAACTAIETHDRHTRGIVVLGLDAPEADLAASFAVA
FT                   AGFSLVKGFAVGRTIFAGVARAWLTGEMDDGTAVTEMARRFARLCAIWDDARTQAREKA
FT                   A"
FT   CDS             108474..110312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolD"
FT                   /locus_tag="ACMV_P1_01180"
FT                   /product="3D-(3,5/4)-trihydroxycyclohexane-1,2-dione
FT                   hydrolase IolD"
FT                   /EC_number="3.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01180"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82914"
FT                   /db_xref="GOA:F0J2E9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2E9"
FT                   /protein_id="BAJ82914.1"
FT                   /translation="MSNTIRLTAAQAMVRWLAVQMTEEGERFIEGVWAIFGHGNVAGLG
FT                   EALHGIGDRLPTWRGQNEQTMAHAAIAYAKTKARRRAMAVTSSIGPGATNMVTAAALAH
FT                   VNRLPVLFIPGDVFANRRPDPVLQQIEDFDDGTVSANDCFRPVSRYFDRIARPEHLLTA
FT                   LPRALRVMTDPANCGPVCLAFCQDVQAEAYDYPETFFAPRTWRIRRPEPDPREVADVAA
FT                   LLRAARRPVIVAGGGVIHSGAEERLATFAAQHNIPLVETQAGKGAVSWQDERNFGSPGV
FT                   TGSDCANRLCAEADLVLGVGTRFQDFTTGSWTVFANPARRLVSINLAGYDANKHGATGI
FT                   VGDARATLDALSLALTEHRAPDFDAEARRAWHAKVAAVTAPPAEVHRNALPTDAQVIGA
FT                   VQRATTERSIVMCAAGTMPGALQVLWQASPGGYHMEYGYSCMGYEVAGAMGVKLAAPDR
FT                   EVICFVGDGSYMMANSELATAVMRRVPFTVVLTDNRGYGCINRLQAECGGAAFNNLYED
FT                   CNVEVQPEIDFVAHAAAMGAHAEKVTDIAALEAGIAAARGRAVPTVLVIDTDPAPGTGA
FT                   GGHWWDVAVPQAGGPERLEQARARYSRNAAAQRVAD"
FT   CDS             110344..111138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolB"
FT                   /locus_tag="ACMV_P1_01190"
FT                   /product="5-deoxy-glucuronate isomerase IolB"
FT                   /EC_number="5.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01190"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82915"
FT                   /db_xref="GOA:F0J748"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/TrEMBL:F0J748"
FT                   /protein_id="BAJ82915.1"
FT                   /translation="MPDLLRKPFGTHGKVHDITPAAAGWRHVGFGLYRLRAGEFAAEAT
FT                   GGNEVILVMVEGKASIRAAGRDWGVLGERMSVFEKSPPHSLYVPNGAEWALVAETDCIV
FT                   AVCSAPGRGGHAARRIGPEGIVLTARGEGTNTRHINNIAMEAEDYCDALLVTEVFTPAG
FT                   HWSSYPSHRHDEDDDPRITYLEETYYHRLNPASGFGVQRVYTDDRALDQTMAVSDGDVV
FT                   LVPRGHHPCAAPYGIEMYYLNVMAGPLRKWRFLPDPELGIAK"
FT   repeat_region   111269..111273
FT                   /rpt_type=FLANKING
FT   repeat_region   complement(111274..113229)
FT                   /note="Belongs to IS1634 family"
FT   repeat_region   111274..111290
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 17 bp inverted repeat"
FT   CDS             complement(111373..113052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01200"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01200"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82916"
FT                   /db_xref="GOA:F0J749"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:F0J749"
FT                   /protein_id="BAJ82916.1"
FT                   /translation="MFFRIKPSGGRRYLQIVENKRVDGKVRQVVRLTIGRMDELEASGQ
FT                   LARLLASGARHCEQMMLLSAIENEATMLSMRRFGAPLLFGRLWQESGIAAVLEELLAGR
FT                   QFEFPVERAVFATVLHRIMVSGSDRACDKWLDDYDIPGTEELGLHHLYRAMAWLGEELL
FT                   DEEQGDATPFAPRTVKDLVEERLFARRHDLFTDLSVVFMDTTSLYFEGAGGETLGARGH
FT                   SKDYRPQLAQMILGVVIDQDGRPICTEMWPGNTADVSVLVPVIDRLRSRFGITRVCVVA
FT                   DRGMISAATIAALEERGLEYVLGARERTDRIVREVVLADERPYIPLCLERAGGNETQLF
FT                   IKEVKVAGKRYIVCRNEVVAIEEAETRRQVVAALDRQLTRGDKALIGNSAYRRFLRPVS
FT                   DAKPGRKSKLFEIDAGKLAEEARFDGVFVLRSNARISPLQAVLRYRDLQNVERLFRVAK
FT                   ATMRTRPIYHSSDAAIRGHVFCSFLALILHQALDEKLRRAGKRVEWADLLRDLDRLQHG
FT                   EISQNGKRWQVRTEAGAAASAAFKAARIAMSPRLQTPQQAVA"
FT   repeat_region   113213..113229
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 17 bp inverted repeat"
FT   repeat_region   113230..113234
FT                   /rpt_type=FLANKING
FT   CDS             complement(113271..113492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01210"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82917"
FT                   /db_xref="UniProtKB/TrEMBL:F0J750"
FT                   /protein_id="BAJ82917.1"
FT                   /translation="MQTNKIHHVFTIDRVARDLGEDEEWLADIANEMEPEDGLIWVYNL
FT                   SDGGVIAFTDFGIENLREIILIHRDRAK"
FT   CDS             complement(113495..115102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01220"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01220"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82918"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:F0J751"
FT                   /protein_id="BAJ82918.1"
FT                   /translation="MDLDPSTLPNDIAALKAIILGDRARRSDTEAYIAHLKLQIEKLKR
FT                   ALYGPKAERTARLLDQMELELEDLETTATEDELRAEQVAAKAKTTTVAGFTRKRPSRQP
FT                   FPEHLPRERVVLPGPTQCACCGGSRLAKLGETVTETLESIPRQYKVIQHVREKFTCRDC
FT                   EKISQEPAPFHTIPRAFAGPGLLAMIAYDKFGQHQPLNRQSERFALEGIHLSVSTLADL
FT                   IGATCVALEPVFKHIETMVFAGARLHGDDTTVPVMARGQTDTARVWAYVRDDRPFGGSG
FT                   SPCAVFYYSRDRAGVHPQTHLAGYRGIFQADAYGGYNKLYELNRSPGPIIEAACWSHAR
FT                   RKFFELADIAQNAKRKAQGKTPAFVAPMALAAVQRIDALFEIERAINGQSPAERLAVRQ
FT                   QLGAPLVAELEIWMRAERAKLSRHNDVAKAIDYMLNRWSSFARFLIDGRICLSNNAAER
FT                   ALRTLALGRKSWLFAGSDRGGQRAAMLYSLITTAKMNNVDPQAWLADILARIASHPVAS
FT                   IEKLMPWNWTPQSRALAA"
FT   repeat_region   complement(115120..116449)
FT                   /note="Belongs to IS110 family"
FT   repeat_region   115120..115149
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 30 bp inverted repeat"
FT   CDS             complement(115361..116377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01230"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01230"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82919"
FT                   /db_xref="GOA:F0J6L1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:F0J6L1"
FT                   /protein_id="BAJ82919.1"
FT                   /translation="MKFKRISMDTSKHVFTIHGVDEQERPVLRREIRRAQVEPFFVKLA
FT                   STEVVLEACAGSHHWGRVLGGMGHRVRLIPPQYVKPFVKRSKNDRNDAEAISEAASRPT
FT                   MRTVPVKSVDEQAAAIIVKHRELMVNQRTQAINALRGHAAEFGIVAAKGGANVTALLAL
FT                   LSAEEAIPAIAKAMFEQMGQHVTDLDAKIDALERQLLEQHKANAVSKLLAAIPGVGPIT
FT                   AITMALNVNPANFETGRHFAAWLGLTPREHSTGGKHRMGKISKAGNERLRQLLVVGAMA
FT                   VIRFAKPGSKSATAWLLQLLERRPRKVAAIALANKMARIIWAMMARGEAYRHQPVAA"
FT   repeat_region   116420..116449
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 30 bp inverted repeat"
FT   CDS             complement(116521..116868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01240"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01240"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82920"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:F0J753"
FT                   /protein_id="BAJ82920.1"
FT                   /translation="MIPVSAGVRIWLASGHTDMRRGMKGLALQVQEGLGREPFCGDVFF
FT                   FRGRGGLLVKAIWHDGVGMSLYSKRLDRGRFIWPQTADGVVSLTAGQIGYLLEGIDWRN
FT                   PQQTWRPQAAG"
FT   CDS             complement(116865..117290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01250"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01250"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82921"
FT                   /db_xref="GOA:F0J754"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J754"
FT                   /protein_id="BAJ82921.1"
FT                   /translation="MEIITGVERRRRWRDEDKLRIVAEAEAPGAVFALVARRHEISRGQ
FT                   LWKWRGQVRRGELVPVPMVPEFIPVRVMASAALSMPRAAGKSASVNDASVDPMSQRRAT
FT                   RSDASRIEIVLPDGTCVRVDDGVGVAALRRVMTAVRR"
FT   CDS             complement(117620..118402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01260"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01260"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82922"
FT                   /db_xref="UniProtKB/TrEMBL:F0J755"
FT                   /protein_id="BAJ82922.1"
FT                   /translation="MFTIERIDRSSSPECAAEARVRKLRTWLGRLARDITRKIAGNAEA
FT                   KATFAETLGLINRLLRQKRSDRGADKLYSLHAPEVECIGKGKARTRFEFGVKVSIATTN
FT                   AAAPGGQFVLGMQSRPGNPYEGHTLAGQIEQVERITGVAVARAYVDRGYRGHSVEAEGR
FT                   RIFISRQKRGITPTIRRELRRRTAIEPVIGHMKTDGHLGRNFLLGVDGDAINAVLAGVG
FT                   HNLRLLRRWLIRLLCALVAWLSATNRSPSLGFAHRQIT"
FT   CDS             complement(118524..119279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01270"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01270"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82923"
FT                   /db_xref="GOA:F0J756"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:F0J756"
FT                   /protein_id="BAJ82923.1"
FT                   /translation="MLIHPMVERLRGLGLTAMADAFIEMQNQSAADDLTREDWLGLLVD
FT                   REATSRDNKRLARRLSQARLRQNAVVEDTDFRTPRGLDRALFHKLAGCEWISHSQHLVI
FT                   SGPTGVGKSWLACALGHKACREGFSVLYRRAPRLFAELATARGEGRLPRMLAALERTRL
FT                   LIIDDWGPEPLTAEQRRDLLEIVDDRCEKGSLLVTSQVPVNRWHDLVGDPTLGDAILDR
FT                   VVHRAHRIELKGPSLRKRHAVTTQSDQGA"
FT   CDS             complement(119291..119773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01280"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01280"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82924"
FT                   /db_xref="UniProtKB/TrEMBL:F0J757"
FT                   /protein_id="BAJ82924.1"
FT                   /translation="MPFRLIRETVEARITAKTVEIFHRGKLVATHQRSFCQHRPTTIAD
FT                   HMPSSHRRYRDWTHERILREATAVGDDTAALVEIILRSRPHPEQGFRSCIGILGLAKRY
FT                   DPERLDAACARALALGTRSYGSVAAILKNAQGRKTTDKTEQPSLFHENIRGPGYYH"
FT   repeat_region   119527..119528
FT                   /rpt_type=FLANKING
FT   repeat_region   complement(119529..121502)
FT                   /note="Belongs to IS110 family"
FT   repeat_region   119529..119550
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 22 bp inverted repeat"
FT   CDS             complement(119820..121055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01290"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01290"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82925"
FT                   /db_xref="GOA:F0J758"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:F0J758"
FT                   /protein_id="BAJ82925.1"
FT                   /translation="MPRVIGLDIHRDFAQAVALDGGNYTQMGRVQLDRDSLTAFGRRLL
FT                   PSDEIVLEATANTFAVVRVLRPMVGKIVVANPLQVRLIADAKIKTDKIDAGVLAQLQAT
FT                   GFLPQVWIPDQETEILRRKFSRRSQLVRHRTRLKNEVHAILHSNLIVQCPFSDLFTATG
FT                   KKWLGTQNLPEGDREAVERGFRELDRLAADLAALDRDLATQAVNDVRLQRMITITGIDM
FT                   VSGLGLLAVIGDHKRFESSEKLVSYFGLNPSVRQSGNGPARHGRITKRGANLARSLLVE
FT                   AAWAASRAPGPLRSFFMRVMARRGSQIAAVATARKLAVIIWHVLHREEEYVFARPSLVG
FT                   RKRRAVELRAGRPQQRGRRGIAGRYHNPITRAEERARLEQSERAYERVVSGWQPTGPRK
FT                   PGRSPRQGDDPK"
FT   CDS             complement(121282..122346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01300"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01300"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82926"
FT                   /db_xref="GOA:F0J759"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:F0J759"
FT                   /protein_id="BAJ82926.1"
FT                   /translation="MPGERLSMRKIRDVLRLRFAQGLSQRAIAGSTGLSVGAVNSYLSR
FT                   ARLAGLNWPLPEDLGDAQLETLLYPPLPDVAPDRRPVPDWAAVHRELRRPNVTLSLLWE
FT                   EYRAGAGGLDGFSYSWFCDLYREWLGRLKPTLRQVHMAGERLFVDFAGHAMEVIDGASG
FT                   EIRRAEIFVAVLGASSFIYAEATWSQGLADWIGAHVNALTAIGGTPRQIVSDNLRAGIT
FT                   RACFYEPTVNRTYADMAAHYGTAIIPARPYKPRDKAKAEVGVQVVQRWILARLRNRRFF
FT                   SLAELNQAIRELVDQVNDRPMRGWGTNRRALYEQLDRPALQPLPPTPYEYADWKRCRVN
FT                   LDYHVEIDKHFYQA"
FT   repeat_region   121481..121502
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 22 bp inverted repeat"
FT   repeat_region   121503..121504
FT                   /rpt_type=FLANKING
FT   CDS             complement(122535..123191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01310"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01310"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82927"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J760"
FT                   /protein_id="BAJ82927.1"
FT                   /translation="MPPKLNASQDDLELFRSRLENIIDQRHPLVRLARLIDWRVFEERF
FT                   GALYAEAAGRPALPTRLMVALHLLKHMDRLSDEAVCARYLDSPYVQAFCGETHFQHTLP
FT                   LDRSSMTRWRKRIGAERMEALLAETLAAAERGGAVAEKHYERVTIDTTVQPKAVTHPTD
FT                   SKLLHSGIETLARMARRHGITLRQSYRRVARYARQEAARLHHGGKRREAEAARSG"
FT   CDS             complement(123416..124351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01320"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82928"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:F0J761"
FT                   /protein_id="BAJ82928.1"
FT                   /translation="MALPVTITCAPCCWGVDDVSNPHLPAWEKVLDEAALAGFGGLELG
FT                   PYGYMPLDVPRLGQALSERGLTIVAGTIFSDLASPGNRAMLLRQTHEICAFVCALPRPA
FT                   QLAGQRYEAPYLTVMDWGHDERDYAAGHSERAPRLDGAAWAAMMDNIRAIAELATDRYG
FT                   VRATIHPHAGGYIEFADEIERLADDIGPGVAGLCLDTGHLAYAGMDPVATIRRYADRLD
FT                   YIHFKDIDPKVQSAVMGERVRFFDACAKGLMCSIGKGSVDYRAIHSLLRELGYGGYITI
FT                   EQERDPRNASSILADLAASRAFLRETGFDN"
FT   CDS             complement(124351..124482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01330"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82929"
FT                   /db_xref="UniProtKB/TrEMBL:F0J762"
FT                   /protein_id="BAJ82929.1"
FT                   /translation="MEAWADKAAHDFHMAQKYTQAFVAFHEQFHRKMTFETINPESS"
FT   CDS             complement(124649..125677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01340"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01340"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82930"
FT                   /db_xref="GOA:F0J763"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="UniProtKB/TrEMBL:F0J763"
FT                   /protein_id="BAJ82930.1"
FT                   /translation="MIRIGLVGYGTGGQHFHAPFIAAARGVALAGIVARAPETIAKAKA
FT                   DFPDAPIYPSLQGMLSAGVDAVTITTPPQTRQDLVLEAIAAGVHVIADKPFAPSAAAGR
FT                   ALAQAAKDRGVTLGVYHNRRWDADIQTLQKLLLEGPLGKLWRLHSRMDFDDPATLEAGP
FT                   TGGLLWDLGSHVVDQAMWLIGPVVSVDAQLDTVVLPQGPTDAGFVLTLRHTSGVHSHIS
FT                   ASKVNRLNTRELRAYGSAGSYVAAGTDVQAQALFAGKRPINNPDSWGYDDEAHWGILRT
FT                   ADGATKIPSEQGRYHAYYEAFAEAVRTGGQPPVTAEEAIAVLAVLDAARISAAEGRVVS
FT                   ID"
FT   CDS             complement(125690..126631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01350"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82931"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:F0J764"
FT                   /protein_id="BAJ82931.1"
FT                   /translation="MKLSICTDVMGNYAFTEMLDKCVALGVEGIEMTGGGWSPAPHFRA
FT                   EELLADKGLLKQKLKEIEARGLQIAALNCSGNPLDPGELGRKHRKEIEETFTLAGEIGV
FT                   KKIVTMSGLPEAAPGDTVPNWLVYTKSWPVEMPERDRYQWEERAYPYWHGLVKHAGSVG
FT                   VEKIALENFSAMLVWNPETLLRLRNEVGPMVGMNLDPSHLFWMGASPIAAARALGDAIH
FT                   HVHGKDTRIERGLADVNGLLELKEVTDVANRCWNYVAVGAGHDLQWWKEFFSVVGMMGY
FT                   NDWVSLEMEDFTMSTEAGIQSSIDALQATIIR"
FT   CDS             complement(126657..127829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01360"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01360"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82932"
FT                   /db_xref="GOA:F0J765"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="UniProtKB/TrEMBL:F0J765"
FT                   /protein_id="BAJ82932.1"
FT                   /translation="MINGERTISQPLRWGMVGGGRTGQVGYKHRTGALRDSTYRLVAGA
FT                   FDLNAARGRDFGINLGVSEDRCYATYQELICGERSREDGVDVVSVATPNFTHYEITKAL
FT                   LEANIHVICEKPLFFSTAECEEIAALAERKELIVGVTYGFTGHPMVRQMAAMVARGMLG
FT                   EIRLVDMQYTHGFNAGDDADAPDAVKWRTNPKTAGATFVLGDIGTHVYYLSEIVLPHLK
FT                   VEKLLCDRKAFIPSRAPLEDHATVLMHYDNGARGRLWVSSVNAGNMGSQRYRFIGSKAS
FT                   VEWSDSHPDQLIYEVQGEPVRIMHHGMLYLEEESLAIDRMGALHTEGLGDSWANIYLWI
FT                   AQAIDAKARGDEAFLKTHHYPGIKAGTDGVRWLENCVRSADAGAAWVDFK"
FT   CDS             complement(127859..128872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolG"
FT                   /locus_tag="ACMV_P1_01370"
FT                   /product="inositol 2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /note="protein synonym:myo-inositol 2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01370"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82933"
FT                   /db_xref="GOA:F0J766"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR023794"
FT                   /db_xref="UniProtKB/TrEMBL:F0J766"
FT                   /protein_id="BAJ82933.1"
FT                   /translation="MSLQVGIIGLGMIGQDHLRRLTHTLSDVSVVAVADIDRKRAASIA
FT                   PAGAELCDTPHALIRSQKVQAVVICSWGPAHEEQLLECIAVGKPVFCEKPMVTSEEGAL
FT                   RVMDAEVAFGRRLVQVGFMRRFDADYRALKAVIDDGSLGLPLIYRSVHRNASVPEGLYT
FT                   SEMPLNDTLVHDADISRWLLNDEIAGVEVRFPRRSRQGGELRDPTIVLLHMVSGAIVDV
FT                   EISVNIEYGYDIRGEVSCETGVAALPNRPATVISDRYGIRQAIPADFRERFIEAYDQEF
FT                   REWIAAASQGTAAGPSVWDGYAATLVADAALRAAQSGRREAVSMKPKAGLYAETSR"
FT   CDS             complement(128869..129774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolH"
FT                   /locus_tag="ACMV_P1_01380"
FT                   /product="IolH protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01380"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82934"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:F0J767"
FT                   /protein_id="BAJ82934.1"
FT                   /translation="MKIALDPFMHRPLSLEQLPSKVAELGYDWIELSPRGDFLEWFKAP
FT                   RVFPDRIKTFKKALSDAKVGIATLLPMYRWASNDEDERQAAVRHWKRAIEIAVEMGVDT
FT                   MNSEFGRGLHPDKGTCYCCHTGSMIEACEDAWWRSMEELVPILEREGINLHIEPHPEDW
FT                   VEPLQPSVDLIRTVNSPRVRFLYCTPHTFYFGDDTVAMLRESADVLAHVHIADTFNHKA
FT                   SSGLRYIINPPGSTARVHQHLNMGQGEVPWDDFYRTLHEIGFDGIMTACVFAWEEKADE
FT                   SGVFMRGEMQRLIDKYWGKE"
FT   CDS             complement(129973..130794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01390"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82935"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:F0J768"
FT                   /protein_id="BAJ82935.1"
FT                   /translation="MQKLLIFQSLWGMQRLLGEAEEPSLAAKIERIAAAGFDGVTDHFY
FT                   DRAHVVPLMALLKDYGLTIEGQVFPRTVADLEPALDVAGEFGCHHITIQAMACPMTVDA
FT                   CLPILEGWQRLAEKAGVAVNIETHRGRMTNDLLFTLQLLDVFPNLRFTADLSHYVNARE
FT                   MELPIPAETEAAINRILDHAWAFHGRVAGSHQVQLPLIFPQHQPWVTQFERWWRMGFAK
FT                   WRERAAPDATFSFTCELGPAPCAITGPDGQDLTDRWAEALLLREKAHSLWT"
FT   CDS             complement(130796..132040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01400"
FT                   /product="ferredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01400"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82936"
FT                   /db_xref="GOA:F0J769"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="UniProtKB/TrEMBL:F0J769"
FT                   /protein_id="BAJ82936.1"
FT                   /translation="MPATSDPGIVIIGAGEAGVLAALTLREREYAGPITIIGAERHPPY
FT                   ERPPLSKTVLTAADLPIPTLIGGADMLTGQNILCRSGVVATGLDREARAVQLQDGTRLS
FT                   YSRLLLATGARPRTLSVPETEARNVLYLRTFNDALALRARLSRGARLVVIGGGFIGLEV
FT                   AASAVERGCDVTIVEAAPRVLGRAVPAELAAIITTRHRTAGVTIIEGAALAAIEERAVI
FT                   LAGGRALEADVIVVGIGAVPQTCLAEAAGLAIDNGIRVDEHLATDDPAIFAAGDCCSFP
FT                   HPVFGGRRLRLEAWRNAGEQGRHAANAMLGATESFASIPWFWSEQYGDTLQIAGLPDEG
FT                   DETVTRDNDGTPFLFHLKSGRIVGASAFGPIGKIARDIRLAEKLIETGACPPATALQDP
FT                   AVKLKTLLQPRANME"
FT   CDS             complement(132049..132363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01410"
FT                   /product="2Fe-2S ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01410"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82937"
FT                   /db_xref="GOA:F0J770"
FT                   /db_xref="InterPro:IPR012747"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniProtKB/TrEMBL:F0J770"
FT                   /protein_id="BAJ82937.1"
FT                   /translation="MPQWINACAANEIDEEDVIRFDHEGQSLAIYRLDDDRFFATSGFC
FT                   THENVHLSDGLVMGRIVECPKHNGRFDIPTGQAKGAPACINLRTFLVKVEDGRIFVDLG
FT                   "
FT   CDS             complement(132348..133466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01420"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01420"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82938"
FT                   /db_xref="GOA:F0J771"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:F0J771"
FT                   /protein_id="BAJ82938.1"
FT                   /translation="MEAIVMERRDYSLVGAEAHRAEERGLTSGNWYAHPIPRKQMKELM
FT                   RRKDGPAIRDTVIWLGVMLVCAILGVHFWGSWLAVPFFAVYGVLYGSASDSRWHECGHG
FT                   TAFKTAWMNNAVYQLACFMIMREPTVWRWSHTRHHTDTIIVGRDPEISFKRPPDFVGVL
FT                   LNVFALKSSFFALQKLAIHASGRLAPEEETFIPKMEQKKVFLVARIYIAILLTVAALSF
FT                   GLHSWIPAMLVGLPTLYGGALSIVYGATQHAGLCEDVLDHRLNSRTVYMNPINRFVYWN
FT                   MNYHVEHHMFPMVPYHALPTLHELIKAECPQPYPSILAAYREIIPALLKQRRDPNYHIV
FT                   RELPRATQLASVDATAQPAEKTITENMKCPNG"
FT   repeat_region   133476..133479
FT                   /rpt_type=FLANKING
FT   mobile_element  133480..135097
FT                   /mobile_element_type="insertion sequence:ISAcr4"
FT   repeat_region   133480..133498
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 19 bp inverted repeat"
FT   CDS             133577..134923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01430"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01430"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82939"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4D5"
FT                   /protein_id="BAJ82939.1"
FT                   /translation="MPATVETTPCLPGLSPVAGKPVLARFDGEMLSSDGGLLALREVEK
FT                   RLGIAAQLAACIDDPRTPERVQHGLDEIIRFRMLMIAAGYEDGNDADRLRNDPMFKLAM
FT                   ERLPEAGDLCSQATISRTENLPGPRALLRMGLAMVEHYCASFRTIPNRVVLDIDDTFDA
FT                   AHGAQQLCLFNAHHDEYGFQPIVVFDGDGRMLAAVLRPACRPKGAQIVKWLRRLIDAIR
FT                   SHWPRTAIMLRGDSHYCTPEVLRFCRARRLDYIFGVAPTTTLRKHVIALEASTTARAQQ
FT                   APGEKIRRFKEFNDGAASWDRVERIIARVEAGPLGVDTRFIVTSLKAGSPRTLYQEIYC
FT                   ARGQAENHIKAWKTHLAADRTSCSRASANQMRLFLHIGAYWLMWSLRSLMPRRSRWRGI
FT                   QFDTLRLRLIKLAVRLETLKRSIRLHLPRSMPDQAILGYALARLPRLVI"
FT   repeat_region   135079..135097
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 19 bp inverted repeat"
FT   repeat_region   135098..135101
FT                   /rpt_type=FLANKING
FT   CDS             135210..136223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01440"
FT                   /product="LacI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01440"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82940"
FT                   /db_xref="GOA:F0J773"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="UniProtKB/TrEMBL:F0J773"
FT                   /protein_id="BAJ82940.1"
FT                   /translation="MERRKIRIGLEDVAQRAGVGIATVDRVLNERGGVSAKAEQRVLEA
FT                   ARALGLRRQLPTPHARSLRIEVILARPTTPFMKRLGMAVGQVAATLDRSISILRTSIDM
FT                   TDPSRVAPRIRSSRADGIIIYCEEQLENIAAIHAATTVRRPVICVVTDVPDSPRIAYVG
FT                   IDHGKAGRTAGFFAARMGRQHGTALIISTSTGFRAHKQRIEGFRDALNLHAPGIKIAPV
FT                   MTTNDEAERAYHCVMRAMRDWSDLVAIYNTGGGNEGVGHALHDGKHGDPVIFIGHELTE
FT                   ESIGLLRDGVMTLTIDQAPELQARCAIDLMLSHLGRGTDQAMSSEIAFSLHTMENC"
FT   CDS             complement(136312..136587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01450"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82941"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:F0J774"
FT                   /protein_id="BAJ82941.1"
FT                   /translation="MVVDPLFPIEPYLLAASTSATPIRLVIDTHLHADHRSAGRALAAA
FT                   AGADYVIHEQCGSLQCLPSARRGSGCLHSEDHHGSIAAERFQSESS"
FT   repeat_region   136627..136630
FT                   /rpt_type=FLANKING
FT   mobile_element  136631..138248
FT                   /mobile_element_type="insertion sequence:ISAcr4"
FT   repeat_region   136631..136649
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 19 bp inverted repeat"
FT   CDS             136728..138074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01460"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01460"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82942"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4D5"
FT                   /protein_id="BAJ82942.1"
FT                   /translation="MPATVETTPCLPGLSPVAGKPVLARFDGEMLSSDGGLLALREVEK
FT                   RLGIAAQLAACIDDPRTPERVQHGLDEIIRFRMLMIAAGYEDGNDADRLRNDPMFKLAM
FT                   ERLPEAGDLCSQATISRTENLPGPRALLRMGLAMVEHYCASFRTIPNRVVLDIDDTFDA
FT                   AHGAQQLCLFNAHHDEYGFQPIVVFDGDGRMLAAVLRPACRPKGAQIVKWLRRLIDAIR
FT                   SHWPRTAIMLRGDSHYCTPEVLRFCRARRLDYIFGVAPTTTLRKHVIALEASTTARAQQ
FT                   APGEKIRRFKEFNDGAASWDRVERIIARVEAGPLGVDTRFIVTSLKAGSPRTLYQEIYC
FT                   ARGQAENHIKAWKTHLAADRTSCSRASANQMRLFLHIGAYWLMWSLRSLMPRRSRWRGI
FT                   QFDTLRLRLIKLAVRLETLKRSIRLHLPRSMPDQAILGYALARLPRLVI"
FT   repeat_region   138230..138248
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 19 bp inverted repeat"
FT   repeat_region   138249..138252
FT                   /rpt_type=FLANKING
FT   CDS             138557..139123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01470"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82943"
FT                   /db_xref="UniProtKB/TrEMBL:F0J776"
FT                   /protein_id="BAJ82943.1"
FT                   /translation="MNKALGIVALICKAGDKSKEKHNALLITPTYSNPLLFCSAIPERR
FT                   GFIAPHCPPGLNQPPHGVCPELNQRFIRKENLIHIAGETNLLQRDRGFDGATDELGSIL
FT                   IIAENLIQALYGRSIQPQCRCNRQSLRSCHLVTIRQPYCFQQIDVSYNFSGHLLLTFKI
FT                   PLIRMQLVLAVTRSRPCFAQEPAAC"
FT   CDS             139117..139830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB1"
FT                   /locus_tag="ACMV_P1_01480"
FT                   /product="type IV secretion system VirB1"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01480"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82944"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="UniProtKB/TrEMBL:F0J777"
FT                   /protein_id="BAJ82944.1"
FT                   /translation="MLITPAHFLVLASRCASDVAPTTLAAVAGAESGFNTLAIHDNTTR
FT                   QTVRPQGAHGAIAVATQLIAAGHSVDLGLMQIDSANLARLGLTIATAFDACASVRAAGK
FT                   LLVQDYQRPAGQGRQAALLAALSRYNTGSAWEGFQNGYVSRVVSTAKYLVPAIDPADGV
FT                   TAPRASSAKSSQPTTLSNSPVPRHAPAWDVFPNSIGPAGFASAHAVTLQASRASGPSGR
FT                   AQPSKQETHGETKAH"
FT   CDS             139811..140176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB2"
FT                   /locus_tag="ACMV_P1_01490"
FT                   /product="type IV secretion system VirB2"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01490"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82945"
FT                   /db_xref="GOA:F0J778"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:F0J778"
FT                   /protein_id="BAJ82945.1"
FT                   /translation="MKQRLTKLRDRAANFAAGTVSKIDRGAWIHPAVLVTAGLLLPAVA
FT                   HAQVVSGGTSPTTIIDNIATFILGPFGEGVAVLAVAAVGFMCWTGRMGFHAIGWLAAGL
FT                   VLVFGSSYLVTTFVGGG"
FT   CDS             140180..140512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB3"
FT                   /locus_tag="ACMV_P1_01500"
FT                   /product="type IV secretion system VirB3"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01500"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82946"
FT                   /db_xref="GOA:F0J779"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="UniProtKB/TrEMBL:F0J779"
FT                   /protein_id="BAJ82946.1"
FT                   /translation="MTERQRDPLFVAATRPALFLGLPIEMAVVIIMIGAMIVIFGHNPF
FT                   YLTLVLPLWFGARWLVRYDYNAPRVAWLWFRTKATGAGENQAWGGASPAPFPMKVQKGR
FT                   GMRDAG"
FT   CDS             140523..142895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB4"
FT                   /locus_tag="ACMV_P1_01510"
FT                   /product="type IV secretion system VirB4"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01510"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82947"
FT                   /db_xref="GOA:F0J780"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="UniProtKB/TrEMBL:F0J780"
FT                   /protein_id="BAJ82947.1"
FT                   /translation="MERSAERYLPYLGHVRPDILLMDDGSVLAMAEIPGAPYELAADAD
FT                   RAASLVTVNALCKNVADDNVTLHSAFVRGPGAGQLAHAVMPNEFAASLDRAYRERVLAG
FT                   RLYQNTWYLTVVVSPRNPLGGKAGGATASLLGGKRELQKPHATAEGIGQLEEVCQTISQ
FT                   TLAPYDVRRLGLRPAANSQFYFSEIAEALRLILTGTAAPVPLVSGPLGAALYTDRAIFG
FT                   RRAFELRGPGVSRFGAIFGYREYPSETYAGMYDGVFSLPCPVVMVHTFDFHARHTSEKR
FT                   LGLKAAQMTAANDKAKSQISDLADAQDHLASGKIAMGEHHFSLTVYADTIEELDRLSGL
FT                   TRTVIANSGGVVAQESAGLEAAYFAQLPGNRKWRTRPGTITTRNFAAFSGFEAFPRGQR
FT                   AGKWGLAMARFRTTAGTAYDYVPHVEDVGMTAIFGKIGQGKTTFMLFLLALFPQYFAAR
FT                   NGAVVFFDKDRGGELLCRAVGGRYLVVRAGRDSGLAPLKALDSTPESVAFLVQWLTALI
FT                   QQDGHGPLPPEDDARLTRGVQALLRLAPDMRSLAGLRQFLDWRNPMGAGARLERWCKGG
FT                   SLGWAFDGERDDVSLDATTVGFDLTAILDNGTVCAPAANYLLYRISQALDGRRFVLSCD
FT                   EFNFYLLNPLFAKIWADFMLTVRKSNAVVLLATQEPAPVLDSPQGDSILRQCQTLVFCP
FT                   TPGAEEHLYRKRLNFTAGEFRAVAEDMLPNSRQLLIKRHGGSAIIDFDLSALPEFVAIL
FT                   SSRKSSVGFVEQLRATHGDDPAAWLPAFMARFHEEVE"
FT   CDS             142905..143663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB5"
FT                   /locus_tag="ACMV_P1_01520"
FT                   /product="type IV secretion system VirB5"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01520"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82948"
FT                   /db_xref="InterPro:IPR014158"
FT                   /db_xref="UniProtKB/TrEMBL:F0J781"
FT                   /protein_id="BAJ82948.1"
FT                   /translation="MLKPSRRLRIASAIAIFGFASPTLAQVPVIDSASLAQIINQLNEA
FT                   KQQYSELVSQYNELKSTYNALSQNVNPNQWAQQLDQSAMQDTVPNTSILPNMLDGISPP
FT                   SSLSGNVGSLAQQYYNMNKVYIPAGSDFGSTQIQQGANETANFEAIATQNLQSLEAREQ
FT                   ELPQIQSQLNSATTIQQVASIQARLSAEQNYVQAQQAQAQNLQLLAFEENRAGQEAAAQ
FT                   ENAQGGEQTLSTLCSDAQTLGGEPSACQGQ"
FT   CDS             143893..144780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB6"
FT                   /locus_tag="ACMV_P1_01530"
FT                   /product="type IV secretion system VirB6"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01530"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82949"
FT                   /db_xref="GOA:F0J782"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:F0J782"
FT                   /protein_id="BAJ82949.1"
FT                   /translation="MSVPTTTINVFEFMYNQYSTGFLQSLNSDVGTALSAALPPLSAAL
FT                   IIWVIILGYLMMTGSLDIRYGISKVSTMAIVVGIIASTSLYDSYVQTLFMKSLPSFVAS
FT                   TFSSGNTSNIPQSLDHTFNLFWIAGQIIYHKANCATCVLEPYVLGIEIELVLVVFFIAL
FT                   ALVFAVYLISTTLTGLLVAIGPFLLIGYLFEATKGIPERWLGKLIGLAILLLLITALLS
FT                   LFTGGMTDFLNTKVSTTFTADPVQTEIIILGEIAAYTAITAFITIMLPGIAAYIGGGVD
FT                   FNISGIVNPANWFK"
FT   CDS             144959..145660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB8"
FT                   /locus_tag="ACMV_P1_01540"
FT                   /product="type IV secretion system VirB8"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01540"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82950"
FT                   /db_xref="GOA:F0J783"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="UniProtKB/TrEMBL:F0J783"
FT                   /protein_id="BAJ82950.1"
FT                   /translation="MNADMKNTALPIDNERLAAYFQDVESFQATEKRTARRWGRVGWVV
FT                   AGVSLAVNVTLAGAIVMILPLEKLVPAFITVKSDGTTSTTMNFNSLPSDEKAAMTRAAI
FT                   WQYVRARESYDFADAQYRYDVASLMSNPTVQGTYQSWFLDKGPGSTSPQVTVGKKGQIS
FT                   VEMVSLSMVRPNVALVRFRRTVTMYGSDPQTSTWTATVGFENVASLPVSARLADPSGLI
FT                   VTNYQAQKDSP"
FT   CDS             145657..146547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB9"
FT                   /locus_tag="ACMV_P1_01550"
FT                   /product="type IV secretion system VirB9"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01550"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82951"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="UniProtKB/TrEMBL:F0J784"
FT                   /protein_id="BAJ82951.1"
FT                   /translation="MTCARKLAASGFLWLGMMGTALAIQYPHPGHEDPRVRYVPYQSGN
FT                   VTDIWTAPGAALTVQFGRNEKVVSVAESDSAYLKVVPVQNYLFIKPTGILPAQPIAVLC
FT                   KTSDGKLRHYFFQFETVNKHLGAGENVDYAVVFTYPHQAYERRLAKRKAAEAKAVQKEA
FT                   RSRLDEARAVMNAATVDQYQGPRNYEYVARGDHQLAPAEVWDNGYSTVFTFPAMQRIPA
FT                   IFYVQPDGKEATANYSVNGNTVVVPGTAPEWRLRDGHTVLDIYDLKYNPTGATPGTHTI
FT                   SPDVEREMRTFNNGK"
FT   CDS             146537..147673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB10"
FT                   /locus_tag="ACMV_P1_01560"
FT                   /product="type IV secretion system VirB10"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01560"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82952"
FT                   /db_xref="GOA:F0J785"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:F0J785"
FT                   /protein_id="BAJ82952.1"
FT                   /translation="MANEDTPDRPYGPIRHTNAAPSPVEQEQSAVASQQRLSGRQIGGI
FT                   LLACALGAGVVLVVTRLTAHHEPKLAHKAAVTGGTEGRPFVNNASSGTTPSSKPAGLPL
FT                   PPKQNAGFHNPFLTNQQESPAMKALKAPIMAFNQTGGGSSAQPASNTVGQNGAPSAGSA
FT                   KPTAFANKLDADQFSAADASMIAHPNFTIAAGTIIPCTLQTAINSTLPGFVKCVLPQPV
FT                   RSMTGTVTLLDKGTQVLGEVREGLVQGQDRLFILWDRAVTPQNVAIQLASPAADPLGRA
FT                   GVSGAVNNHFLERFGAAIMMTIIGGSLQVAANAAQNSAGNTYLEYMNSSTNQIANTTLQ
FT                   HTIDIPPTLTKHQGENVSIFVARDLNFSKVYKLSVVSP"
FT   CDS             147670..147960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01570"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82953"
FT                   /db_xref="GOA:F0J786"
FT                   /db_xref="UniProtKB/TrEMBL:F0J786"
FT                   /protein_id="BAJ82953.1"
FT                   /translation="MREGWRTRLDRLTQAGQRLNRHVEKTVVKYVEWQDRRHARRRQKF
FT                   LRQGWLYSTLLGLWLVLIILELLGHQSAAVIHSSAGLGLIFLALKLKFSLV"
FT   repeat_region   147934..147939
FT                   /rpt_type=FLANKING
FT   repeat_region   complement(147940..151243)
FT                   /note="Belongs to IS110 family"
FT   repeat_region   147940..147953
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 14 bp inverted repeat"
FT   CDS             complement(148011..149744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01580"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01580"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82954"
FT                   /db_xref="GOA:F0IY18"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:F0IY18"
FT                   /protein_id="BAJ82954.1"
FT                   /translation="MFIDVVPNGRSAPAVLLRESFREGRKVHKRTIANLSQMPPELIDG
FT                   LRALLAGGAVVGGADQALEIRRSLPHGHVAAALGMMRKLEIPGLLGRRASRERDLALAL
FT                   IAGRVIAPGSKLSTLRGLNPQTATSSLGEILELGAIEEREIYAALDWLGAQQGRIERQF
FT                   ARRHLRDGTLVLYDVSSSYLEGRHCELAHHGYSRDHRPDRPQIVYGLLCDREGRPIAVE
FT                   VFEGNTADPATIAAQVEKLKRRFHLERVVLVGDRGMITTARIRETIKPAGLDWISCLRA
FT                   GQIQDLAEGPLQMSLFDERDIAAITSPDYPGERLIACRNAALATERRRKREALLVATET
FT                   ELARIRDATRRKRAPLHGEAAIGLAVGAVINQRKMAKHFDLTITASRFDFQRNAASIAR
FT                   EAALDGIYVIRTSVSADVMSETEAVSAYKDLSRVERAFRTLKSVDLAIRPVHHWLSPRV
FT                   RAHVFLCMMAYYVEWHLRDALKPLLFQDHDRPGAETERLSPVAPASTSPAADRKRGRRR
FT                   NDQNLPISSFADLMAHLATQTLNTAALPKAPNATFTTLANPTPLQTAAFALIGIDPMRV
FT                   Q"
FT   CDS             complement(150018..151058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01590"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01590"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82955"
FT                   /db_xref="GOA:F0IY11"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:F0IY11"
FT                   /protein_id="BAJ82955.1"
FT                   /translation="MDIMILGIDLGKNSCSVVGMDAAGRVVLRRRLRRGTLESFVGELG
FT                   SCIVAMEACCGAHHLGRIFAARGHEVRLMSPEYVRPYVKAQKNDDLDAEAIAEAATRPT
FT                   MRFVPVKSQDQSDLQALHRARERLVSERTALINHLRALLLERGIVVPQGRRKLEAELET
FT                   LAEDGGFAALSPRIRTLIEDLRAEWRSLDQRITGFDAEFVQLARDDVAVRRLTKIPGIG
FT                   TINATALAAAVGEAHAFKRGRDMAAWLGLVPRQMTTGGKPRLLGISKRGNRYLRKNLIH
FT                   GARAALPYLVERDTPLGRWARGLLDRAHKNVVVVALAAKLARIAWAVLAHGCDYDAQFE
FT                   AAAAAA"
FT   repeat_region   151230..151243
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 14 bp inverted repeat"
FT   repeat_region   151244..151249
FT                   /rpt_type=FLANKING
FT   CDS             151297..152364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB11"
FT                   /locus_tag="ACMV_P1_01600"
FT                   /product="type IV secretion system VirB11"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01600"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82956"
FT                   /db_xref="GOA:F0J789"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J789"
FT                   /protein_id="BAJ82956.1"
FT                   /translation="MNGTDFSDDLVAESPAAPLLRFLLAPLQPWLNDGATEELCINRPG
FT                   ECWVRQRGVFERFKVPLDRSALEDIAVLAGALRRQDVGPTSPLCSTELPGGERLQICLP
FT                   PAVPTGTVSLTIRRPGSTVAPLSSVTSRYQSDGWNSWAENRDTRNFAEALDYYDSGDLE
FT                   GFLAAAVRCRMTILLCGATGSGKTTMSKTLISAIPMAERIITIEDTAELVIPQPNHVRL
FT                   LYSKDGLSTAKIDAEALLQASLRMRPDRVLLQELRDDAAWTYVNEVVSGHPGSITTIHG
FT                   ANPAQAFKKLFSLIKGSPKGASFDDATLCDLLAAAVDLIIPFETSGTTYRIGKVWFGPD
FT                   ATRRGETAAALLRAA"
FT   CDS             152364..154184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /locus_tag="ACMV_P1_01610"
FT                   /product="putative conjugal transfer protein TraG"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01610"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82957"
FT                   /db_xref="GOA:F0J790"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J790"
FT                   /protein_id="BAJ82957.1"
FT                   /translation="MTWRGVMRLLVGLVLGLVFFSVLATMIFLIGTGLFWHFRHPFWQW
FT                   WLYLFEASGDPTVRVWLVISGVPAFAIPFLAGVVQLVRGRRVTGWSLRRDHAPTKPVDA
FT                   PIRAPTDNHGHARWMTMEEARARFPGPAPEYGGLVVGEAYEVHRDSVASMPFRPKDRST
FT                   WGQGGKAPLLIDPCEIGSTHCMMFAGSGGYKTTTAVSTLLTWTGSAIVLDPSVELGPML
FT                   RQAREDMGHKVYMLDPRTAREVGFNVLDWVDVSSPLAEIDVQAVVEWVCGDTKAGGDEN
FT                   ASFFKNSGKELVTALLAHMLWDEHLEPHEKTLRAVRAAIVTPEKELRNVLAHIHKNSQS
FT                   RLARDLAGSLKDIVDETFSGIYKNATQDTAWLSTAAYADLVSGNAFRCAELTLGKTTVF
FT                   INIPLKALDATPAVARVITGALLNAAYEADGVIEGRVLFLLDEAARLGPMKILETARDC
FT                   ARKYKITLFPFYQSIGQLRELFGQNGPAKWFESVSWYGFAGVKTKAVAEELAAAIGEYG
FT                   VLAWSEGSNTGNSAKGLEAGTRSTGQTKTYHELKRQLIRAEEIMHDMRDDEQIIFPKSG
FT                   RPLRCGRAIYFRRPEMAARVGENRFAVNAT"
FT   CDS             complement(154312..154794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01620"
FT                   /product="AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01620"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82958"
FT                   /db_xref="GOA:F0J791"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:F0J791"
FT                   /protein_id="BAJ82958.1"
FT                   /translation="METVDLDQFDRALLSKLQVNNQTSARVLADQVGLSESAVLRRLRR
FT                   LRRSGVIVADVSIVHPAVLGTPLTIHVLVSLEREGIAALDAFEAKLRGRDEVKCAWYAT
FT                   GEADFVLLLQVSGVGAYERFARDVFHNDPNVKGFQTIIALREIAGLSNRSLSVCGV"
FT   CDS             154860..155912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01630"
FT                   /product="pyridoxal-phosphate dependent enzyme family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01630"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82959"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniProtKB/TrEMBL:F0J792"
FT                   /protein_id="BAJ82959.1"
FT                   /translation="MKTGMIMVMNATTETPRTSGIASDLARLSPDYAPTPLLELPALAR
FT                   RLGVAQVLAKDEGCRMLGSFKSLGGTYAGLRALARAANTDIAALIATRPGGQPTLVCAS
FT                   DGNHGLAVAAAARFAGASARVYLHSSVPQSRAKRIEAQGAEVIWVQGTYDDAVHEAAEA
FT                   ARNEVGILVADTTDDPNDPVVRDVMAGYGVMAAEIRAQVEAAGHARPTHLFVQAGVGGL
FT                   AAVMAKGLGDWLAAPGRIIVVEPETAPAVAAALTAGTIIRVQGDLETTAEMLSCGEASA
FT                   PALETLRRHRVEAITVSEATLDEAPLLLRDCGGPATTSSGAASLAGALARPGLPADARV
FT                   LILVTEGVPA"
FT   CDS             155909..157078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01640"
FT                   /product="putative peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01640"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82960"
FT                   /db_xref="GOA:F0J793"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:F0J793"
FT                   /protein_id="BAJ82960.1"
FT                   /translation="MMTDDAFWAELRAWRRDFHAHPEFGFEERRTSRLVAERLRSFGIT
FT                   DIVEGVGGTGVVATLTRGSGNRAIALRADMDALRIEEKSDLAYRSQVPGVMHACGHDGH
FT                   TTMLLGAAKLLAAEGGFDGSVRFVFQPAEEWGKGALAMLADGLTERFPFEEIYALHNKA
FT                   GLPVGKFQARVGTTMSAEDNFEIVLRGMGGHASRPQDGREVLVAACALVVNLQTIVSRR
FT                   VAPTDSAVVSVTELLTDGTRNALPSTARILGDARSFQTVVSETIEAELRRIATGTAASY
FT                   DVGCDVTYTREFVPTVNDPVATAAALAAARTVLGEENVTLADQPGTGSEDFARFLQHAP
FT                   GCYAFIGNGEGSVPAHHPEFDFNDDALPTGTGFFVQIVRDRLATRPTQP"
FT   CDS             157075..158388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01650"
FT                   /product="N-carbamoyl-L-amino acid hydrolase"
FT                   /EC_number="3.5.1.87"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01650"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82961"
FT                   /db_xref="GOA:F0J794"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:F0J794"
FT                   /protein_id="BAJ82961.1"
FT                   /translation="MTGPRINAERLLGRLRTLGNIGRDEGRLTRLAASDSDRAGRDAVV
FT                   GWMHDAGLEVMVDRIGNLFGIWHAGDANSAPLMLGSHIDTVIDAGIYDGCYGVVGGLEV
FT                   VQTLREAGVKPDRPVVIAAFTNEEGVRYAPDMMGSLVYAGGLGVAEALATVGTDGTVLG
FT                   EELARIGYAGPHEPGFLRPHAYLELHIEQGPILDREGVAIGAVENLQGISWQRVTIDGV
FT                   ANHAGTTPMAMRRDAGQAAARVVTFLRDLISQTNAPTVATVGCMAFEPNAINVIPSRAV
FT                   FTVDLRDPDEDRLRAAEATLARYLESLADAEGVTVVVERLAQFDPVTFDPAIVAAIEAA
FT                   AAENGLRSRRMTSGAGHDAQMIARLCPAAMIFVPSLKGISHNPREHTQAADLQAGANVL
FT                   LDVIRKLTHVASGEARSFSQQNSKLGFAYDDSFTKEGI"
FT   CDS             complement(158485..159741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="umuC"
FT                   /locus_tag="ACMV_P1_01660"
FT                   /product="UmuC protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01660"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82962"
FT                   /db_xref="GOA:F0J795"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="UniProtKB/TrEMBL:F0J795"
FT                   /protein_id="BAJ82962.1"
FT                   /translation="MPTFGLIDGNSFYCSAEQAFAPELRSRPLVVLSNNDGCAIARTPE
FT                   AKALGIKMGEPWHLFRKRPESRAVEWRSSNYALYGDMSRRVYDVLTERVPQVEPYSIDE
FT                   MFLDLDGIPDLDRFCRDLRRDVRQIAKIPTCVGIGPTKTIAKLANKIAKKETALGGVCD
FT                   LRDPELRARHYERLPIAEVWGIGGQVGAKLAAAGITTIADFVRADPRAVRDMLTVTGAR
FT                   VQTELRGASCLPLSLMAPTRKGIAVSRSFGHMIDRPAELREAICTFAARAAEKLRAEGL
FT                   EAGQITVFTHTNPHNGDPWYSAQRQGKIEPTADTGLLIGEAIRLLRAVWHPGYRYFKAG
FT                   VMLQDLAPARRQAVLFASFDRDQSAAAMKAMDAINARFGRGTLRIASTATSPSWGARRQ
FT                   NLSPRYTTQAGEMLVANSF"
FT   CDS             complement(159747..160136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="umuD"
FT                   /locus_tag="ACMV_P1_01670"
FT                   /product="UmuD protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01670"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82963"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="UniProtKB/TrEMBL:F0J796"
FT                   /protein_id="BAJ82963.1"
FT                   /translation="MEVYMGSYTGGNTTGFVSPAGDSLEGPIDLSEILDLRRPSRYPVR
FT                   VAGDALTSRGIFSGDILIADAATPPAPGKVAVVMLAGDVLVAQLAWRNGQWQLLSGRAG
FT                   TEPLPVEGDDAEIWAVITGLVRTQV"
FT   CDS             160181..160891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01680"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82964"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="UniProtKB/TrEMBL:F0J797"
FT                   /protein_id="BAJ82964.1"
FT                   /translation="MCGRFAAFQPVEAIRKLFGAVNSAPADARPSWNIAPSQRALVVRR
FT                   HPETGERRIDLLSWGLVPHWTKDLKEARRPINARAETLATSPMFKPAFASRRCLVPVDA
FT                   WYEWQVTPDGKRPFAFARTDRATMAFAGLWESWVTPGTGKVLRTFTIITTSANAMAAPV
FT                   HDRMPVILDADDWPLWLGERTGEPAALLRPAPDMMIEAWPVGRSVNSPQNNGLELLSLL
FT                   AEHKDLYLTNPADG"
FT   CDS             complement(161124..161723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01690"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82965"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:F0J798"
FT                   /protein_id="BAJ82965.1"
FT                   /translation="MLKFRHIASAIVVLGLTTAGAHASLIADGITYTLSESATANPLTD
FT                   QFTLNIAGINGPSDAEGGRYGVQSFALNPPSNFASAAAPSGFTELSGGLNANGCNGKGN
FT                   FYCFAAETTPQGPALPADSSINYTFYVTLSSGLFSGYSPDFKINWVGTKNNYDLVSKPL
FT                   TPTPTPVPEPGSLLLLGTGLIGLGLVGRFKLSKRFL"
FT   repeat_region   161727..161734
FT                   /rpt_type=FLANKING
FT   mobile_element  complement(161735..162814)
FT                   /mobile_element_type="insertion sequence:ISAcr1"
FT   repeat_region   161735..161776
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   CDS             complement(161751..162767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01700"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01700"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82966"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:F0IZR7"
FT                   /protein_id="BAJ82966.1"
FT                   /translation="MDVLAREDLPFPQSLPEFQRIFPNDAACAAYLESARWNGGFACPR
FT                   CGVVGEPFRFEARPGVLRCRACRKDVSLMAGTVMERSHTPLSTWFWAAYLIASQTPGMS
FT                   AVQFQRQLGLSRYETAFGILHKLRAGMVRPERDKIGDTPQEHVEVDETWVGGRTRGDGR
FT                   GVHHKVLVACAVEVRHRKPGTKLDNRKDGRYAGRVRLAVVPDRSANSLCGFVENAVAPG
FT                   SLIVTDDWSGYAGLGRRGFDHHAIAECGDPEVAEEFLPIVHLVFTNLKTWINGIHHGVS
FT                   AKHLQAYLNEFTFRFNRRLYPFNAFRSLLGIAGRAAAPTFDELYSGEWTHPTFSGCG"
FT   repeat_region   162773..162814
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   repeat_region   162815..162822
FT                   /rpt_type=FLANKING
FT   repeat_region   163059..163066
FT                   /rpt_type=FLANKING
FT   mobile_element  complement(163067..164146)
FT                   /mobile_element_type="insertion sequence:ISAcr1"
FT   repeat_region   163067..163108
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   CDS             complement(163083..164099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01710"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01710"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82967"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:F0IZR7"
FT                   /protein_id="BAJ82967.1"
FT                   /translation="MDVLAREDLPFPQSLPEFQRIFPNDAACAAYLESARWNGGFACPR
FT                   CGVVGEPFRFEARPGVLRCRACRKDVSLMAGTVMERSHTPLSTWFWAAYLIASQTPGMS
FT                   AVQFQRQLGLSRYETAFGILHKLRAGMVRPERDKIGDTPQEHVEVDETWVGGRTRGDGR
FT                   GVHHKVLVACAVEVRHRKPGTKLDNRKDGRYAGRVRLAVVPDRSANSLCGFVENAVAPG
FT                   SLIVTDDWSGYAGLGRRGFDHHAIAECGDPEVAEEFLPIVHLVFTNLKTWINGIHHGVS
FT                   AKHLQAYLNEFTFRFNRRLYPFNAFRSLLGIAGRAAAPTFDELYSGEWTHPTFSGCG"
FT   repeat_region   164105..164146
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   repeat_region   164147..164154
FT                   /rpt_type=FLANKING
FT   CDS             164492..165166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01720"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82968"
FT                   /db_xref="GOA:F0J7A1"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7A1"
FT                   /protein_id="BAJ82968.1"
FT                   /translation="MSLKFATIAACAVGGLMMGSGVAHATPSLDFSVQAWTAQTPNSGS
FT                   ASSNQQALPSNPIISATNAFFTGNFLGLPNWQDNSQNTNTLNDFTNNLTGFSNVKYYNG
FT                   NSGTTVLSTGGFGSATLFDLTFTLNHTLSATVTHDDGFSLWNATNTGNALFNYAHPTSA
FT                   VPDSISVGPGTYNLWYLEANGAPAQLTFSNVKVPEPGSLLLLGTGLVGLGLILRRRRSR
FT                   TA"
FT   CDS             complement(165394..167589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01730"
FT                   /product="putative exodeoxyribonuclease V alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01730"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82969"
FT                   /db_xref="GOA:F0J7A2"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7A2"
FT                   /protein_id="BAJ82969.1"
FT                   /translation="MGNHFIATAPAQTPDREVLAGLVERVTFHNVENGFCVLRVKARGH
FT                   RDLVTVIGHAATISAGEWLTASGEWVNDRVHGQQFRARFLRTSAPTTAEGIERYLASGM
FT                   IRGIGPVYAKKLIRAFGETVFDVIEAKPERLREVPGIGAVRAGRIVNAWAEQKVVREIM
FT                   VFLHSHGVSTARAVRIFKTYGADAVQVMSENPYRLARDIRGIGFRTADAIAEKLGIARD
FT                   AMIRVRAGIGHALATAMDDGHCGLPAGELVSLAETLLEVPAPLIGTALDLELAEGTVIA
FT                   DQVAGTDCVFLAGLYRAEQGIAERLRIVASGATPWPSIDADKAIGWVESHLGMNLATSQ
FT                   SEAVRLALTAKLLVITGGPGVGKTTIVRAILRILAAKSVRILLAAPTGRAAKRLAETTG
FT                   GEAKTIHRLLEVDPASGSFRRGVDHPLECDLLVIDETSMVDVPLMHALTRAIPDEAALL
FT                   VVGDVDQLPSVGPGQVLADLIGSGAVPVVRLTEIFRQASASRIITVAHSVNRGEIPDLG
FT                   RADPESDFHFVAADEPETAVERIVELVKTRIPHRFGLDPIRDIQVLCPMARGGVGARSL
FT                   NITLQAALNGAAEPRVERFGWTYAPGDKVMQIENDYDREVYNGDIGFIARVDAEAGEVG
FT                   VGFDGREVVYGLGELDGLVPAYAATIHKSQGSEYPAVVIPVLTQHYVMLQRNLLYTGIT
FT                   RGRRLVVLVGSRRAVAIAVRNVSGRRRWSKLREWLSG"
FT   CDS             complement(167923..173028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01740"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82970"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7A3"
FT                   /protein_id="BAJ82970.1"
FT                   /translation="MLTFRAGAASTSSGAAGKMADHLMTMTLPGFEQDMAAYYQRGMTV
FT                   EGGLWQPGTAAAEDNAAATATDAARPGTIPEPRRDMHPTVAAALGIDTSRPLTRDEIAE
FT                   LLAGNRADGEKIAGKQYQRAVTPLAEVFGLDPMRLPTRAELENLLAGKRADGFDLPAAP
FT                   VEAAPAITPQTAAPEAVEAHEAEDRDAALAAEAAALGELGSAADGPPPWPEDFVPPPME
FT                   EVAGYDRDAALAADWQADIARGGEPAVPPRGPAAEDRPAEPRAIDVAAALDAAGVPYRT
FT                   SGGRLRLQATWRGVESWTVSVNATTGQWTDFAASEGGRFESLVRRLGVKAEAVELDPEA
FT                   AKAARTAEIRRNVFRKSIAGKLWDEAIPGTGELHAPSLHGSAGQKLQQRTAHAARVDEA
FT                   AALRASARAYLSGRGLDDDWLMSHVRLVRPHPNYDAAEVAAGAAVVMLTPMFGQDEDGR
FT                   VRLTGVQRTYLTEGGAKIGRRMLGASGAWLLHPPAGAAVPIGGHDQARVAGEGFETVAS
FT                   VVQATRQAGVVGYNAGGLVAWAGQFSGSTPVVLLADRDNARLHNGRDVGEAGQKAAAKA
FT                   AALIEANGGEAVYLEPPADVAGGAKGADWADALRESGAAGLRRALATAEASSAADRARI
FT                   EAKLSSASPGAAPDGPSAQETEQGQPAPHPELVRLYKALEAKDGRGLSETERANILEGK
FT                   RADGTALDAADWRNAVNRSKTPIGYVDFTFSADKSVSLAWAFAPTEAERNQLAQAHKDA
FT                   VAATMAEIEQVIGQARKGKGGKEGTEQGRIGWITFDHYTARPTIEIARQTADGRTETEI
FT                   VSVKVAGDPQLHTHVAVPNVIVTESGRVVSLNTLQMHGRIHEWGAIYQAHLAQNLRRAG
FT                   ASIELDRTTGAARLSAVPEEIRAAFSKRTRDALSDAKAYAASLGADWDRMTGDERIKLL
FT                   KGGAFASRSAKADDLSDFASWRRQAEARGYQHKSVLQNAAPAEKMTEAARLDRAYEAAS
FT                   RVLGEQFARRAVIKAEDERVAAARGLVAAGIKDGGDVDQVIARLRARGVVETGGAGGNG
FT                   ESARTQIIAVETERDDPENPDVTITTTRLTTRAHVEQESALVELAGQAGRDRRGTLNPV
FT                   QIKRGIEASGLSFTGAHGAAQRRMIDHLGMGGRFSVGIGAAGAGKTTLLKPLVTAWREQ
FT                   GADIHGISLGWRQARELREAGLNTDTDTEAGGRDTIAAVSVFINRVESGRLDLSSRSVV
FT                   VIDELGTIGTRQMLDLLRLQERHGFRMVAIGDPKQCQSIEAGQVIGLLEKGLGKVPSIE
FT                   SSVRQTNERAREIAGLLRKGGAEAVGKALDMKRQDGTAEIIAGGHGEVIARAAALWDER
FT                   RKANVDRPRFTISISTPTNQDARAIGEAIRQRLLASGELGQSRMTLAAIDKNTGEHYAL
FT                   PIATGEKIRLFARTNAAMLDGGKGAIGDNGSILEITSIRDEGLVLRNDHGREGFVKWDT
FT                   LADKETGRMRLAYGYAMTTNTAQGITTTEHIFVTPGGSQTTDGFKTYVSGSRHRERDYW
FT                   LTSEGAERQEIAGRRPLGDPRPIREHDIWTNWTRNIARQPEKTNALDLVKIGEEARRNA
FT                   ARAFLKGLAADEKREAAGLPSDLSQRFARTQARAGTQSRLTETMARAVEDKGQALARIE
FT                   RAAPAVRAAVAAGWERARPLIEAAHRSARARLQKALEGHRRQAQRQAEERPVEQESRKR
FT                   GRGR"
FT   CDS             complement(173022..173360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01750"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82971"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7A4"
FT                   /protein_id="BAJ82971.1"
FT                   /translation="MPEPEAAPSPRKDDRLDAVIQAMRLMIETQNTHSQMLARLIELAT
FT                   PSEESPLEEALAGIAGALRDQTTALLQIGTTLDGLGAEVEAGVMRGLATALEPDDDGSQ
FT                   SEAGGETC"
FT   CDS             173576..174178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01760"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82972"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7A5"
FT                   /protein_id="BAJ82972.1"
FT                   /translation="MLRSIDVRRLKSVGFAMPAPDLDIEKLGAAMASGLRRRSPLMVWF
FT                   IEHHDEFAALLDKHGAHWKGLAEHFAAAGLVSRTGQPLTPRTVENYWLRARRLVAKRRA
FT                   EGHPVTAAPAGAPAPEPKFEFVRLRNEGRGVSAAERHALGDPTAPADQAAQPAPKFQRS
FT                   WMRNEGRGVSAAERRALGDPTAPADPDDPKWRGDKSR"
FT   CDS             174188..175078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01770"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82973"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7A6"
FT                   /protein_id="BAJ82973.1"
FT                   /translation="MTEAPSSEKKPNGAHKPATPVFRPDSAVAGLKPAEIKPLLTSEQS
FT                   STEPVAQGLDLADRPKIILTAGRGKTGKTTFLRWIAEMAQRDGKAPLLADIDPTNATFS
FT                   TYFGGVARPDTFNQAAVRDWLQDFMEFAIAEKQTAIVDLGGGDTILRTIAGEMPGFDAM
FT                   IEEAGMAVVMFYLAGPHPEDLTPAATLGALGFKPRARGFVLNEGMAQAGQSRDQAFSRV
FT                   TSSNVYRDETADGALTLWMPRLHAAEAVEARTASFIAARDGQTEPPLGVFNRSRVGHWL
FT                   KAMDEQFAGVKSWMP"
FT   CDS             175294..175779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01780"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82974"
FT                   /db_xref="GOA:F0J7A7"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7A7"
FT                   /protein_id="BAJ82974.1"
FT                   /translation="MRQARDGLAQTIDQAFQAAKAQAEAAHADLSRQFVASFAKEAEQR
FT                   LKSMSRWVWWRTIASGAALAIVILALGFGLGYWRGNAAGYSRAAGTIQAAGAVEQSVLA
FT                   SQGPAGLAQWHQLMRDNAILDTMKSNCSGKNVAHQDGRTACHLWLWTTPNVASAAHG"
FT   CDS             175784..176188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01790"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82975"
FT                   /db_xref="GOA:F0J7A8"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7A8"
FT                   /protein_id="BAJ82975.1"
FT                   /translation="MDERFTPTADGSARSADFTSQLGRVLLGLLRGALRCMLAAVLDVV
FT                   ILAVRFVLWFRRILFWLGFFSALSCILNYEVHRLRLAAFALGAGILMMALSRASLLLND
FT                   RLRFWQLQLHAWAQGWPVKRYAFTVLPSRR"
FT   CDS             176778..177353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01800"
FT                   /product="putative response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01800"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82976"
FT                   /db_xref="GOA:F0J7A9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7A9"
FT                   /protein_id="BAJ82976.1"
FT                   /translation="MYILIADTDRTRAEALAARLGAQTAGYVVQVAPSNLSLSTAVAEL
FT                   RPDVVIVDMARPDRDSLEQVRSATAQPAPVMLFVDEDDPNFMEEAIGAGVASYHVDIAT
FT                   IADIKPILRSAIALFRRGAERERRLAEAESALAERRLVDAAKRLLMQRDMMTEPAAHRF
FT                   LQRRAMERQVRVAEVARALLGDDEEKMP"
FT   CDS             177350..177955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01810"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82977"
FT                   /db_xref="GOA:F0J7B0"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7B0"
FT                   /protein_id="BAJ82977.1"
FT                   /translation="MSSIPIRIGVLRLIDCSPPIVAREYGFFADAGLEADIAVEPSWAN
FT                   IADKLAYGILDAAVILGPLAIAMGLGLRGRRTALALVAMLSREGNAVVLRHGAERWLEE
FT                   ARFAAVHAYSNHDLLLRRYLAEAGIDLARTKIGGRPPAEMVASLAAGEIDGFCAGAPWG
FT                   ALAVRTGFGTVVADSATLAPGHPETYGPPRLQVVFSMN"
FT   repeat_region   177915..177916
FT                   /rpt_type=FLANKING
FT   repeat_region   complement(177917..179280)
FT                   /note="Belongs to IS110 family"
FT   repeat_region   177917..177940
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 24 bp inverted repeat"
FT   CDS             complement(178166..179215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01820"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01820"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82978"
FT                   /db_xref="GOA:F0J047"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:F0J047"
FT                   /protein_id="BAJ82978.1"
FT                   /translation="MKTEIAVLGIDLGKNSCSLAGLDGTGAVIKRRRMRPETVVTFTKE
FT                   LPPCVIAMEACCGAHHLARLLAAQGHDVRLMSPEYVRPYVKAQKNDDRDAEAIAEAATR
FT                   PTMRFVSMKTEEQLDMQTLHRARDRLVGERTALINQLRAILLERGVTVPQGRSKLERSL
FT                   IEMFDGDEAEPPATLTPRLRALIADMRAEWRELDRRITAFEDEFVARTREDEAARRLIS
FT                   IPGIGVMNATALIAAIGNGETFSRGRDLAAWLGLVPRQITTGGRPRLVGISKRGNKYLR
FT                   KLLIHGARAALPSLLTSSTPLGGWLRGLTARVHKNAVVVALANKLARIAWAVLRNGGTF
FT                   DARSASGMA"
FT   repeat_region   179257..179280
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 24 bp inverted repeat"
FT   repeat_region   179281..179282
FT                   /rpt_type=FLANKING
FT   CDS             179295..179618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01830"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82979"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7B2"
FT                   /protein_id="BAJ82979.1"
FT                   /translation="MVLRADFAAIQPAAAALRAALGAATALCRAPDGAPSLARLLAAPA
FT                   HLDLPEGMVRDALIPRTGNPIFMTGASLLPDKADIAWTIARMVEAGHLDPAGEDPSLAI
FT                   ITP"
FT   CDS             179884..181110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01840"
FT                   /product="putative nitrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01840"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82980"
FT                   /db_xref="GOA:F0J7B3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7B3"
FT                   /protein_id="BAJ82980.1"
FT                   /translation="MHTTTEKSFLISGHLPTLFAAFLYFDASFMVWVLLGPLGVQIGRT
FT                   LHLDPAHKGLMVAVPVLAGALLRIPNGLSVDRFGGRRTAIVAQFIVITGLLLAWATGLP
FT                   SYGSVLALGLVLGLAGASFAVALPLASRWYPKEHQGTALGIAGAGNSGTVLAALFAPAL
FT                   GLAFGYASVFGMAAAIMVVVLCVFSILAKDSPAHPAPQSLGAYLRVLRLHDTWWFMLFY
FT                   SVTFGGFVGLAASLTIYFHTQYGLAAVNAGYATAACVFVGSSVRPLGGWLADRIGGIAA
FT                   LSIFYVVAAATLALVSIGLPDLALALAAFVLAMLALGMGNGAVFQLVPIRFGREIGVMT
FT                   GLVGMAGGVGGFYLASSLGFSKQFTGSYQDGFLVFAALALVAFAGLMTVRRRWRADFTS
FT                   PPGNGTVRI"
FT   CDS             181125..183569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasD"
FT                   /locus_tag="ACMV_P1_01850"
FT                   /product="nitrite reductase large subunit"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01850"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82981"
FT                   /db_xref="GOA:F0J7B4"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7B4"
FT                   /protein_id="BAJ82981.1"
FT                   /translation="MHGTTLSRPRLVVVGNGMAGMRTVEEILAIAPGIFDITVFGAEPH
FT                   PNYDRIMLSPLLAGEKRFEDIVLNDYDWYASNGIRLIAGEHVDWIDRARRIVRGAAGTE
FT                   APYDLLLLATGSSPFVLPIPGAELDGVQTFRSVADVGDMLATARPGAKAVVIGGGLLGL
FT                   EAAHGLDLRSAEVTVIHLMPTLMERQLDASAAHLLKQTLEARGMTILTGTETAAFIGDD
FT                   RVRAVRLKDGREIPTDLVVMAVGIRPNAGLARATGLECNRGVIVDDFLRTSDPAIFAIG
FT                   ECVEHDGKVFGLVAPIWEMARVAARAMTGTPGIGFTPAASVTRLKVSGVEMASAGAFLG
FT                   DSGTEDIVLRDGARGTYRRLVLRENRIVGLVAIGDASDAAWHFQLLKDGTDIGEIRDSV
FT                   IFGPLADGPADPDAAVMALPDGAEICGCNGVCKGTITRAIKAFGLASVDDVRARTKASS
FT                   SCGSCTGQVEALLRAALGTEYAPATVKPVCKCTGLDHGEVRRRIVGGKLKSIPAVMQAL
FT                   EWKTPDGCHVCRPALNFYLLCAWPGEYVDDAQSRFVNERMHANIQKDGTFSVVPRMWGG
FT                   VTNARELRAIADVVDKFDIPEVKITGGQRIDMLGVKREDLPTVWRDLNAAGLVSGHAYG
FT                   KALRTVKTCVGSEWCRFGTQNSTRMGIALEKMSWGSWHPHKVKMAVSGCPRNCAEASIK
FT                   DFGVIATEAGWDLLVGGNGGIRLRGTDLLCKVTTEAEVLEYCAAFLQLYREEAHYLERT
FT                   APWIERVGLDYVKQAVVEDEDNREALAARFLHAQTFAQADPWAMQSAAAAGAKFTHVAE
FT                   LT"
FT   CDS             183569..183919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasE"
FT                   /locus_tag="ACMV_P1_01860"
FT                   /product="nitrite reductase small subunit"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01860"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82982"
FT                   /db_xref="GOA:F0J7B5"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7B5"
FT                   /protein_id="BAJ82982.1"
FT                   /translation="MDAIMTDTGFVDVAALDDIPQRGARTVATAHGDVAIFRTGDDAVF
FT                   ALRDSCPHRGGKISHGIVHGHGVTCPLHNWVIALATGAAEGEAAASCVPRFPVRVTEGR
FT                   VLLDVSAPLAPA"
FT   CDS             183916..186501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01870"
FT                   /product="nitrate reductase"
FT                   /EC_number="1.7.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01870"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82983"
FT                   /db_xref="GOA:F0J7B6"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7B6"
FT                   /protein_id="BAJ82983.1"
FT                   /translation="MNTTCPYCGVGCGLIAGEGTIAGDPAHPANRGRLCVKGAKLAATL
FT                   DDRERLRTPMVGGRETSWSAALDAAADGFARAIAAHGPDSVAFYVSGQFLTEDYYVANK
FT                   LMKGFIGSANIDTNSRLCMASAVAAHRRCFGEDLVPGIYEDFDEAELIIFAGSNAAWCH
FT                   PVLFQRALAARATRGTRIVVIDPRRSATAEFADLHLAVRPRGDLALFCALLAACADRGA
FT                   LDRDYIARHTAGFGAALAAARQAEHGIDPAAFETLAGWVAATPRMVTAFSQGVNQSETA
FT                   TDAIGAILNLHLATGRIGRPGAGPFSLTGQPNAMGGREAGGLANQLAAHLGFDDPDDHA
FT                   TLSEFWGAPNLVRRPGLKAVDLFRAVADGKIRALWIAGTNPAESLPASLDVRDALSRCP
FT                   HLVVADCWPTATTAHAHVLLPAAGWSEKDGTVTNSERMISRQRAFRPAPGAARPDWWMF
FT                   AELARRLGHGAAFAWDVPAAIFREHAALSAFRNFGRRRFNIGGLAAIPDDDYDAMRPLR
FT                   WPLAGDRLFAEGNFPTPDGRARFVAVSPLRHARTDFTLNTGRLRDQWHTMTRTGRVAEL
FT                   MAHQDAATLELAPTDAARLGVLPGDLVAAGSEGARIVFPAAISPGQCEGSVFAAIHWTA
FT                   AQGSAGSVNRLTVPATDPISGQPAFKHSPVRLAAVPTLWRAIAIGRAASCAMAAGKQAV
FT                   WSQALRPGGLALSRFTGFAPLAARSAVDAARWLLELPEGAEFLDYADPTRGVFRLAVLD
FT                   RAGVQLLLHVAPAELALPDPEALEALFAAPQAGADPTLLLGQPARATATRGRQVCVCNA
FT                   VAEPAIRAAIRAGCRSVEAIGAATGAGTGCGSCHSELKGFLRHDLVAAE"
FT   CDS             186479..187264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01880"
FT                   /product="uroporphyrinogen-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01880"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82984"
FT                   /db_xref="GOA:F0J7B7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7B7"
FT                   /protein_id="BAJ82984.1"
FT                   /translation="MTSLPPNSKAHPVILAGTGPGDPDLLTLRAVRAIGAAEIILHDAL
FT                   VDARILVLAAPDAVLIHVGKRCGRHAMSQTEINRRLVECARTGARVLRLKGGDPMIFGR
FT                   AGEEIAALRAAGIAVEVIPGITAASAAAASACVSLTARGRARAVTLVTGHTADGGVPPQ
FT                   DWAALARLDSTLVFYMGSRHARAIADRLIEAGLDPATPAMLLTNVSRPNETRRLDRLID
FT                   LADGIAAADLAAPALILIGAALDAAVPVATIRADARELS"
FT   CDS             complement(187233..187817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01890"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82985"
FT                   /db_xref="GOA:F0J7B8"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7B8"
FT                   /protein_id="BAJ82985.1"
FT                   /translation="MIPIVLDPSYCRLSVCGNGPMSLRRLRALREGGADAALLFSDDPD
FT                   AATIAEAGAALCRRMPTGDDLARLHALWIVDVPDVVRAGLVAAARAARVLVNVEDRLPD
FT                   CDFHSVAQVRRGDLLLTVSTGGQAAGLSSVLRRHLEVEFGADWAARLSEIAVLRERWRA
FT                   EGMSMPETARRIADHVEARGWLTTARGRPPE"
FT   CDS             complement(188247..188534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01900"
FT                   /product="putative antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01900"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82986"
FT                   /db_xref="GOA:F0J7B9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7B9"
FT                   /protein_id="BAJ82986.1"
FT                   /translation="MMHNPPHPGELLREDVISDLGLSVTEAAQRLAMSRAALSRVLNAR
FT                   AAISPDLAIRLEQAGVSTAQAWLGMQANYDLWLARQHKQPPVRRFQANVA"
FT   CDS             complement(188546..188830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01910"
FT                   /product="putative toxin"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01910"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82987"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7C0"
FT                   /protein_id="BAJ82987.1"
FT                   /translation="MPEIFMRSPWGLEAFYRTGSMRGIQAAQAGKLKRILGLLDVAQTP
FT                   KDMNIPAFKLHPLKGDLAGHWSVWVNGNWRVTFRFVEAGVELVNYQDYH"
FT   repeat_region   188792..188801
FT                   /rpt_type=FLANKING
FT   repeat_region   188802..190029
FT                   /note="Belongs to ISAs1 family"
FT   repeat_region   188802..188819
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 18 bp inverted repeat"
FT   CDS             188890..190023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01920"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01920"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82988"
FT                   /db_xref="GOA:F0IZE6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:F0IZE6"
FT                   /protein_id="BAJ82988.1"
FT                   /translation="MSVRRLVEEFSALEDPRCGGKVEHRLIDILVIAVCAVIAGAESWE
FT                   DMALYGRSKQEWLGTFLALPNGIPSHDTFRRVFMLIDTGRFEACFEAWARSFGTTLDRE
FT                   VVAIDGKTIRGSFDRSRDQAALHVVSAWASDRGLVLGQRQVGDKSNEITAIPELLDVLD
FT                   IKGAIVTLDAMGCQRAIASKILERGADYLVTLKANQGKKHSAVQEYCATTCFSRSPVDR
FT                   PVHDEFDDGHGRLVRRRVFVCPDAVALEPLRDWPGLKSVLAVETIRGVNGSGKIEAEIR
FT                   YFLSSSDDQPEILAKAIRQHWQIENSLHWVLDVTFNEDHCRIRDRNAVQNFSLLRKIAI
FT                   NLVRRHQASKASLKGRRKMAAWDNRYMEQVLTGFFHA"
FT   repeat_region   190012..190029
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 18 bp inverted repeat"
FT   repeat_region   190030..190039
FT                   /rpt_type=FLANKING
FT   CDS             190229..190798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01930"
FT                   /product="putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01930"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82989"
FT                   /db_xref="GOA:F0J7C2"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7C2"
FT                   /protein_id="BAJ82989.1"
FT                   /translation="MSRVFLYARVSTVEQTAENQIAEAKAAGFAIRPNRIITETISGSI
FT                   AARQRPEFRRLLDRLEDGDVLVVTKLDRLGRSALDVRATVDALAGLGVRLHCLALGGVD
FT                   LTSSAGRMTMQVIAAVAEFERDLLIERTQAGVQRARASGKAIGRPASLTEEQKAAVRAE
FT                   RDSGASISFLARSYKVSRQTIGRVCE"
FT   CDS             190808..191089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01940"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82990"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7C3"
FT                   /protein_id="BAJ82990.1"
FT                   /translation="MRVRVADGPPQRIRDMGAQHMPGEEIWLIGERRANGECKYYLVTR
FT                   EKSNFADLGAMFWWLAILGFAGSGRAEGKNLAKPLERCAVVAIVILSL"
FT   repeat_region   190928..190933
FT                   /rpt_type=FLANKING
FT   repeat_region   190934..192503
FT                   /note="Belongs to IS5 family"
FT   repeat_region   190934..190945
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 12 bp inverted repeat"
FT   CDS             191124..192491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01950"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01950"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82991"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:F0IZU1"
FT                   /protein_id="BAJ82991.1"
FT                   /translation="MPPKLNASQDDLELFRSRLENIIDQRHPLVRLARLIDWRVFEERF
FT                   GSLYAEAAGRPALPTRLMVALHLLKHMDGLSDEAICARYLDSPYVQAFCGETHFQHTLP
FT                   LDRSSMTRWRKRIGPERMEALLAETLAAAERGGAVAEKHYKRVTIDTTVQPKAVTHPTD
FT                   SKLLHSGIETLARMARKHGITLRQSYRRVARYARQEAARLHHGGKRREAEARVRKLRTW
FT                   LGRLARDITRKIAGNAEAKATFAETLGLINRLLRQKRSDRGADKLYSLHAPEVECIGKG
FT                   KARTRFEFGVKVSIATTNAAAPGGQFVLGMQSQPGNPYDGHTLAGQIEQVERITGVAVA
FT                   RAYVDRGYRGHGVEAEGRRIFISRQKRGITPTIRRELRRRTAIEPVIGHMKTDGHLGRN
FT                   FLLGFDGDAINAILAGAGHNLRLLRRWLIRLLCAIFTWLSAARPSPDLRLPNYHIA"
FT   repeat_region   192492..192503
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 12 bp inverted repeat"
FT   repeat_region   192504..192509
FT                   /rpt_type=FLANKING
FT   CDS             192761..195517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01960"
FT                   /product="putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01960"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82992"
FT                   /db_xref="GOA:F0J7C5"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022138"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7C5"
FT                   /protein_id="BAJ82992.1"
FT                   /translation="MIPTTSRKEGLHRGALPGSPAIKQAGLRLTPSGHLVFEPENPAIE
FT                   PAVAARLAQAFAHGSGPGLLQLSAAEVVPDLPLALGWWRSFGQRYITVLRLQTTEQAYI
FT                   VKSNSQPSVPSPDEAELTTLVLTAPIMPGAEFLTQDILRTLWSEIDRALIEELETRQID
FT                   LQSYLHALNPTWNLLGRVHFNLAENKGDPEAPFAFMATYTTRLSAQAKVQHLPLGQALR
FT                   EYAGAANRRQLLSLLMPVQRAAESCAWLKPMIEGGEIYHPLRWTPGEAARFLASAAELE
FT                   AAGIVLRMPANWQTNRPTRPRVSAVIGSVAPSKLGLDGLMDFQMEVSLDGEALSPGEIE
FT                   RLLAGTEQLVLLRGKWVEVDRARLERVMARFREAETLAAKGSLDFAEAMRLLAGVDESE
FT                   AAEVADQEWSQVRAGLWLEETLQTLRSPGSLTEDTPPGLRGTLRPYQKAGVQWLRLLSA
FT                   LRLGACLADDMGLGKTIQVLALLLAEKSRRAVRQPSILVAPASLLANWSGEIDRFAPDL
FT                   RARIVHSSTSSATEIKTFTAEDAAAFDLVITSYGTLLRLPALTEILWRFAILDEAQAIK
FT                   NPAAKQTRAAKALRAEARIALTGTPVENALGDLWSIFDFINPGLLGNARKFARYTKSLA
FT                   NQRQNPYGPLRDLVRPYILRRMKTDKAIIADLPDKIEMNAHCLLSRKQAALYSEAVGDL
FT                   ARSLEEAEGMARRGLVLASLVRLKQICNHPAHWLNDGNWDEAGSGKFRRLREIAEAVAA
FT                   RQDKMLVFTQFREMVAPLAALLASVFGRDGLELHGGTPVRQRRTLVQRFQEDEEVPFFV
FT                   LSLKAGGTGLTLTAASHVVHFDRWWNPAVEAQATDRAFRIGQKSNVLVHKFICRGTVEE
FT                   RIDAMIEAKQSLSTELLSGENELDLTEMDDSALIDLVSLDINAVVED"
FT   CDS             195517..196542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01970"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82993"
FT                   /db_xref="GOA:F0J7C6"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7C6"
FT                   /protein_id="BAJ82993.1"
FT                   /translation="MSWHSRNWAPYVPVAQRRRQGAREVARLRKAGQMVSPVEVAGRAI
FT                   ATTPWGKAWCDHLESLHDYENRLPRGRTYVRNGSVIDLQIAPRVVTALVSGSDIYRVTV
FT                   TIGPVPKMVWQTICSDCAGQIDSLVELLQGRLSKAVMARLCRREQGLFPKRSEIRFSCS
FT                   CPDYAALCKHAAAVLYGVGARLDTRPELLFRLRDVDEAALITNAGTTLPESAATIPGRI
FT                   LEDGDVAALFGIDIAASAVENAKPPTSQVPVSGKRKASRPTCRTTGDKVASTQESAAKP
FT                   VGRAAKAPKEAKAKRPAAPASQTAPAKPKLQAADKPVKWWLKPKVANPPKRGIRSKPKI
FT                   G"
FT   CDS             complement(196588..196872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01980"
FT                   /product="Xre family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01980"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82994"
FT                   /db_xref="GOA:F0J7C7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7C7"
FT                   /protein_id="BAJ82994.1"
FT                   /translation="MIKKNPHWGTTLDEFLGEEGIREAAKAEALTRVVAWQLSQEMERQ
FT                   GITKAALAERMHTSRAQVDRILKAKGNITIETLQRAAALVGRELRLELV"
FT   CDS             complement(196869..197222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_01990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_01990"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82995"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7C8"
FT                   /protein_id="BAJ82995.1"
FT                   /translation="MNPARLTEIPVVFYRTAGGAEPVLDWLRRLPAEDRRIIGTDLATV
FT                   QFGWPIGMPLCRSLGRGLWEVRSSLPSRRIARVLFFIEDDRIGVVHGLIKKTQKTPADD
FT                   LDLARRRMKEMQV"
FT   CDS             197535..197987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02000"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02000"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82996"
FT                   /db_xref="GOA:F0J7C9"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7C9"
FT                   /protein_id="BAJ82996.1"
FT                   /translation="MARRRAPAIPDELLDQLLAGGDAAAALNSGDLVNALKKALAERAL
FT                   SAEMDYHLSDEAEAENSRNGYGRKSVSTGTGKIEIAIPRDRAGSFDPQLIAKYQRRFPA
FT                   RRPSGSAPATTCRRQQGGPEKHGPPKAELLRRAAEKAAKLGDRMHV"
FT   CDS             complement(198610..199314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02010"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82997"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7D0"
FT                   /protein_id="BAJ82997.1"
FT                   /translation="MVIIFANKHGNYDFIVQTSIAFALAKLNFSEPLDESVVAFSPGLN
FT                   MHDAEKIALVGHGSPGSIEGVSAESIGNAMADPVRGVGRNLRRLIVTSCYAGVRPDPSR
FT                   PTSTVEVLASKLRGRGLGGLEIVGYNGPSIKNAELGFFASVVNDPTPGAAVDSPQLDKA
FT                   FAQSNTSIMNTKKDTGDLSLLKVNQTTNIGNLGKKAAVSSKSFYANFIEELSRQQLLLQ
FT                   GDDVARVAVVLD"
FT   CDS             199315..199635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02020"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02020"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82998"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7D1"
FT                   /protein_id="BAJ82998.1"
FT                   /translation="MDAPRSRLQLAERQRCRVSRGESSLFAAVDHNHSVSTLADQVGAA
FT                   CHALVPLYRLIETDVHAAARLHSGDTTVPVMARDKTDTARFTLGNLHTARRVTPISGKH
FT                   LV"
FT   CDS             complement(199632..200225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02030"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ82999"
FT                   /db_xref="GOA:F0J7D2"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7D2"
FT                   /protein_id="BAJ82999.1"
FT                   /translation="MIAGTAMVVATLAFLTVRSQIATESLRLAHAGFTPLLGGVAWVHS
FT                   LAGGGLTVIQPEPYALRPQMAALGFVAVGLIALAMTMDWARHSPQIRRFLGALSLVGLL
FT                   AGGGSMFRPCSETLVLSPQAGTIRSSRTPGKTIPIRNIAGVVIEIPRWDTRNRGYRVAV
FT                   DLRNGGSHVVLGATNARAARGLAALLSAALGRAR"
FT   CDS             complement(200344..201651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02040"
FT                   /product="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02040"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83000"
FT                   /db_xref="GOA:F0J7D3"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7D3"
FT                   /protein_id="BAJ83000.1"
FT                   /translation="MSVSWLNTGDNAWQLTAATVVGLQSVPGLVVMYAGIVKKKWAINS
FT                   AFMAFYAFAAVLIAWLLWAYNMGFGAQLFPFVGIPHPIASMADELNQAVIPAAKASANF
FT                   PMSTMVYFQFVFAAITLIIMAGAFIGRMNFTAWMIFVPLWLTFSYTIGAFSLWGGGFLA
FT                   QMGVIDYSGGYVIHLAAGVAGFVGAAVIGERSPRDRENFQPNNVLLMLVGAGILWLGWN
FT                   GFNGGDPYAASRDAGAAVLNTNVATAMSLLVWTALDIKYFGKPAVIGAVQGMITGLVAI
FT                   TPAAGVVNGYGALIIGIVSGVVPWYTMNVLGKRLAIFRKVDDTLGVVHTHAIAGLLGGI
FT                   MVGLLATKAGCAAFGLSTPGGAIDGNWHQVLLQIYGAAFIIVLNVVMTYLLLKVIGVFV
FT                   PLRMPETMLEIGDDAVHGEEAYAFYGDGQRRPILGD"
FT   CDS             complement(202326..202688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02050"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02050"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83001"
FT                   /db_xref="GOA:F0J7D4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7D4"
FT                   /protein_id="BAJ83001.1"
FT                   /translation="MKSVLAVETIRGVNGSGKIEAEIRYFLSSSDDQPEILAKAIRQHW
FT                   QIENSLHWVLDVTFNEDHCRIRDRNAVLNFSLLRKIAINLVRRHHASKASLKGRRKMAA
FT                   WDNRYIEQVLTGIFYA"
FT   CDS             202978..203151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02060"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83002"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7D5"
FT                   /protein_id="BAJ83002.1"
FT                   /translation="MIRTVPQIDLELEAERRLLEAAVAEARADLRPAVPHEQVRADLLR
FT                   EIKRLNLAIAGL"
FT   CDS             203154..203432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02070"
FT                   /product="plasmid stabilisation system family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02070"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83003"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7D6"
FT                   /protein_id="BAJ83003.1"
FT                   /translation="MQVEWHPLALEDRDVIVAYLELLNPNAASSVLRGLVLAGDSLALF
FT                   PTRGRVGLATGTRELVAVWPYLIVYEVDMSSDTARILRIWHVAQDRP"
FT   CDS             203540..204475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02080"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02080"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83004"
FT                   /db_xref="GOA:F0J7D7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7D7"
FT                   /protein_id="BAJ83004.1"
FT                   /translation="MAQRRIGQERLAMAEQPRVASSLDALSELIDWQPISDLLAPLYPA
FT                   RKGEPGWPPLAMVKALLLAMWHDLSDVKLAEALDDRASFRRFCGFAQLEATPERTAFVR
FT                   FRRLLVAHRLDGGLFEAITAQLKAKAITVKTGTLVDATIIASASKDDGEGRWVKHKGRP
FT                   AIHGFKAHVGADTSTALVERVSVTPANVNDGRAGDAALPDDPGEVFADSAYRGACFRAA
FT                   VRTNGGTPRVILTAMWGRDEQETLARLDAWNRAIHRIRGRIEKIFGMWKRSYGLHRMRW
FT                   RGLAKAAVQVHFTAIAYNLKRTLNILGTAA"
FT   CDS             204794..204958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02090"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83005"
FT                   /db_xref="GOA:F0J7D8"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7D8"
FT                   /protein_id="BAJ83005.1"
FT                   /translation="MVSLRQRFIRVVDCISAKSVILYDRPIASFAVLMISVIAVMDIAF
FT                   YLHGHHRAQ"
FT   CDS             205705..206343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02100"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83006"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7D9"
FT                   /protein_id="BAJ83006.1"
FT                   /translation="MSVNASLSKGTFMLKFRHVASAVVILGLTTAGARASLIADGLTYT
FT                   LTESATANPLTDQFTLNIAGINGPSDTEGGRYGVQSFAFNQPSNFASALAPSGFTESIG
FT                   GLNSSGCNGSGNFYCFMAETTPTGPVLPANTSINYVFNVTLSSGTFSGYSPDFKINWDG
FT                   TKNNYDLISETLTPTPGTPVPEPGSLLLLGTGLVGLGLVGRRKRSKRYL"
FT   CDS             206498..207112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02110"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83007"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7E0"
FT                   /protein_id="BAJ83007.1"
FT                   /translation="MAAQITQLKAAGCVNEAEAKKDREDRQAIIDGLQAQLKKGDKALV
FT                   GNSAYRRYLRSRGNAFEIDPGKLAEEARFDGLSVLRTNARVTPLQAVIRYRDLLEVEAL
FT                   FRAAKASFDTRPIFHQADAAIRGHVFCSFLALTLAKELNRLCGASGFQPEWQKLLNDLD
FT                   RLQQATIEKGGKVITTRTHVTGQVGNVFKAVSIALPHNISE"
FT   repeat_region   207241..207248
FT                   /rpt_type=FLANKING
FT   mobile_element  complement(207249..208328)
FT                   /mobile_element_type="insertion sequence:ISAcr1"
FT   repeat_region   207249..207290
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   CDS             complement(207265..208281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02120"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02120"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83008"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:F0IZR7"
FT                   /protein_id="BAJ83008.1"
FT                   /translation="MDVLAREDLPFPQSLPEFQRIFPNDAACAAYLESARWNGGFACPR
FT                   CGVVGEPFRFEARPGVLRCRACRKDVSLMAGTVMERSHTPLSTWFWAAYLIASQTPGMS
FT                   AVQFQRQLGLSRYETAFGILHKLRAGMVRPERDKIGDTPQEHVEVDETWVGGRTRGDGR
FT                   GVHHKVLVACAVEVRHRKPGTKLDNRKDGRYAGRVRLAVVPDRSANSLCGFVENAVAPG
FT                   SLIVTDDWSGYAGLGRRGFDHHAIAECGDPEVAEEFLPIVHLVFTNLKTWINGIHHGVS
FT                   AKHLQAYLNEFTFRFNRRLYPFNAFRSLLGIAGRAAAPTFDELYSGEWTHPTFSGCG"
FT   repeat_region   208287..208328
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   repeat_region   208329..208336
FT                   /rpt_type=FLANKING
FT   CDS             208442..209131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02130"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83009"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7E2"
FT                   /protein_id="BAJ83009.1"
FT                   /translation="MNMSSVRKYLLHGAVVLLGLTGIARADIYNPTWLVTAWTTTTGKI
FT                   GGTNFINAASQPAPSAVDALASFTYSGQLSFDNTNKQGQSNTYADFFTNTANISNFSGT
FT                   GGEAAFLGTTMSSPGSSNYSYLEFSLQGPAANIAAGTYVTITHDDGASSYANGNNVTYS
FT                   PGETQAVSDTGTLPVGSMTSFAVDYVEANGAPAVLKVDVPEPGSVLLLGTGLLVLGLVV
FT                   RRRQKAL"
FT   CDS             complement(209590..209970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02140"
FT                   /product="death-on-curing family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02140"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83010"
FT                   /db_xref="GOA:F0J7E3"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7E3"
FT                   /protein_id="BAJ83010.1"
FT                   /translation="MTDYLTVIEVLAIHADQIDRYGGAHGVRDPGQLEAALYRPQTGYY
FT                   ADLIDEAAALWESLAQNHPFFDGNKRTAFAATYAFLVINGAGVQADPDETYDFIVSLYE
FT                   ADGFSFEPLVAWLRRVVVPPDA"
FT   CDS             complement(209967..210197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02150"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83011"
FT                   /db_xref="GOA:F0J7E4"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7E4"
FT                   /protein_id="BAJ83011.1"
FT                   /translation="MAAQTREKFATQVNSEILSAVRRLAQSEGRQLQALVDEALADLIE
FT                   KRKQGRPRANVMAAYQASHEKFGTLYKKLAE"
FT   CDS             210424..211812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02160"
FT                   /product="putative two-component sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02160"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83012"
FT                   /db_xref="GOA:F0J7E5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7E5"
FT                   /protein_id="BAJ83012.1"
FT                   /translation="MRSLRARLALLWSISLIAAIIAGGLIIGLFHQSATASLARDRQVA
FT                   ARACDSIARAYGFYSAGLGSAPQDEAFRKGLRGVAAFGLWPFPDVAGGIVSGSTALASI
FT                   GVDTPHDAGISTATAAALDADHLVLRQRGGFGDRAVIAACPLGSPAEDLAGFTIVRLDL
FT                   LRTPFSKLAAGGLAVLLLFLMVSAWFLTRLVLGFSRRLAAVEAGLATDPEAKLPLTGEP
FT                   DFDRLIAALNGATARLGRARARIAEQEKLASLGRMAAGLAHEIRNPLGAIRLRAESGLA
FT                   GDAARRGAALDRILAESARLEKLTGKLLGFAAAPAPQTEEASLAHLFGEARAPLEEYAA
FT                   AKGVTIETNDRGLSWTLDPALTLRALDNLLRNAIDACGEDDTVRLTAARDADGLTILIE
FT                   DTGPGIAPGIAAHLFEPFVTGRPEGNGLGLAIAREMIRAQGGTLVHDPSEHGARFRIRF
FT                   RGVS"
FT   CDS             211812..213182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02170"
FT                   /product="putative two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02170"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83013"
FT                   /db_xref="GOA:F0J7E6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7E6"
FT                   /protein_id="BAJ83013.1"
FT                   /translation="MARIAVIDDDAGFRASLAEALDDFGHDVAEFASADLALTALATDP
FT                   AALVFLDLRMPGMDGIAALEALKSRDRALPVVVLTAYATGENTIAAMRLGAFDHLTKPV
FT                   GRADLEALRDRVLTGTATTSAPADSVAPGEIIGTSPAIREVQKRIGLAASGQATVLILG
FT                   ETGVGKELVARAIHRFSDRASRPFAAVNCAAIPADLLESELFGHERGAFTGAIGARRGR
FT                   FREAEGGTILLDEIGDMAPATQAKILRVLEEREVVPLGGAPVAIDVRMIAATHRDLAER
FT                   VEEGRFRADLYYRLAVLPIVVPPLRERVADIEAIARHLLARIRPASPPTLSKAALDSLS
FT                   AWPWHGNVRELRNVLERAASLAPGRVIDAADLALAPSPRQTTSLPPPRRLAETVADAEI
FT                   VAIRAALIRARGNRTEAARELGISRAALYDRLNRYGLTTLSENPTETVGGSDESSVV"
FT   CDS             213268..214029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02180"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83014"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7E7"
FT                   /protein_id="BAJ83014.1"
FT                   /translation="MEIRMTQLKLMLAAATATTMLATGAASAATHGNRAALKDLPTYSG
FT                   TVAHFTITPRGAIDGMILSNGTEILFPPYLSTEIAYAVKQGDQVTVRGLKAAGEPVIRG
FT                   VTINDATTHQRVVDNGPPAGFGPHHHDRATRMMADGKVAQVLYDPGGRRNGLLLENGTV
FT                   LHLPPPEFGNQKIAALLKPGATVAAVGAGTANALGKAVMVRAIGPSFDALTRIAPPHRP
FT                   HRFKPRGPMAGPGAWHHAEWQPRPSQPAPAK"
FT   CDS             214203..214388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02190"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83015"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7E8"
FT                   /protein_id="BAJ83015.1"
FT                   /translation="MVYRAIRTRGHFPSDEAAAKLLYLILNRSEKERVMPPREWAMAKA
FT                   QFAVIFGDRFVRALAA"
FT   CDS             214560..216122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02200"
FT                   /product="putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02200"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83016"
FT                   /db_xref="GOA:F0J7E9"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7E9"
FT                   /protein_id="BAJ83016.1"
FT                   /translation="MAKTLSEDLRGRVVADRRVQEAITLVFDKVAELGSARQALLWFLE
FT                   HSLDLPARRANGDVVWRRPTYATIHRMIENPVYGGAYAYGKTRVAPRHDAIVPRSGSRR
FT                   KRRGDWLALKPGAHEGYVSWERAEAIRTMVSDNIPASRHHGAPKHGDALLAGLLRCRRC
FT                   GRKLTVRYTGTNHNIPRYSCWRGLLDNGEPRCIAFGGLRVDDAIEEALLRVVEPGAIAA
FT                   AAAEAQAAGRRDQVREALVRDLEAARYQAARAFRQYDAADPANRLVAAELETRWNRALA
FT                   QAAEVEARIAEHDAAAPKSSSLAVLDAARLGTNLRAVWAAPTTDSRLKKRIVRTVIHEM
FT                   VADIDDTASEIVLLVHWIGGAHTELRLPTRRRGQRNSTASEIIAAVRHLALIASDDLIA
FT                   GILNRNRLLTGHGNRWTRERVTALRSHHKIPVFRPAPDGIEPQLNLTDAARLLGVAPKA
FT                   LRLAAEAGVIEGDHPLPDGPWIFRRSELAKPAAAQITHRARQNPKHPAGSHTDQKNLSL
FT                   SIT"
FT   CDS             216409..216999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02210"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83017"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7F0"
FT                   /protein_id="BAJ83017.1"
FT                   /translation="MQVVSTMNNWGGQWTAERYDRVAGQFTKFRFRESGLQYFKKGKAV
FT                   TMPTRVGKGSGALHTVEVSQGAVDLGIRFLPWKADTVTYMRLDPAARTFFTGPINGCSV
FT                   YLGQVGADWWAFHANRNNAGVHNPAVKAAMTDNVNMRLPVPVRIVHAAIYQRDYNDLGF
FT                   VCGQVKHGQWQFYVVDMSLVQVGKYAQTVRRLP"
FT   CDS             complement(217553..218206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02220"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83018"
FT                   /db_xref="GOA:F0J7F1"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7F1"
FT                   /protein_id="BAJ83018.1"
FT                   /translation="MQNLSFNLTPTIGDNVAGFSHTSAGFMIWLKARSLVWRVGLYQGD
FT                   PVQTFDQPFDRGAIGFLEVDRTWRNAAREITVKAGVWHYWQHRRLRSTLGPSVGGVYGI
FT                   AEWRNIPIKRYRLGFFAQVAGNPESQGPISSYLGFGGKLSGFWAQHRRDALTFGIARAW
FT                   FSTARTMAETTEEVAFVAHLPDRMIIEPDLQWIIHANGGPRNALVATLGAGVAF"
FT   CDS             complement(218282..219136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02230"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02230"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83019"
FT                   /db_xref="GOA:F0J7F2"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7F2"
FT                   /protein_id="BAJ83019.1"
FT                   /translation="MQAMGLTGISKSTVSKLCKDIDERVNAFLDRPLAGEWPYLWLDAT
FT                   YLKQREGGRIVSVAAIIAVAVNTDGRREIVGLHIGPSEAETFWSTFLKSLVRRGLREVK
FT                   LVISDAHEGLKAAIRRVMGASWQRCRVHWMRNALSYVPKGQQSMVSAALRQAFIQPDRV
FT                   SASQTLRHVADQLRGKWPKLGAFIDDSETDVLAHMDFPAQHRTKIHSTNPLERLNKEVK
FT                   RRADVVGIFPNEGSIIRLIGAVLLEANDEWQTQNRYMQIEGMVELMAPAIDADTPRIST
FT                   VAA"
FT   CDS             complement(219145..219489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02240"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02240"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83020"
FT                   /db_xref="GOA:F0J7F3"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7F3"
FT                   /protein_id="BAJ83020.1"
FT                   /translation="MTEDRLPLAELLAKAGDGDFLRSVAEAVVQLLMETDVDGLIGASR
FT                   YERSGERATYRNGYRERALDTRLGSLQLRIPKLRQGSYFPPFLEARRTWRRRWPRSSRK
FT                   PGLAASRPGG"
FT   repeat_region   219619..219624
FT                   /rpt_type=FLANKING
FT   repeat_region   complement(219625..222261)
FT                   /note="Belongs to IS21 family"
FT   repeat_region   219625..219671
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 47 bp inverted repeat"
FT   CDS             complement(219767..220576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02250"
FT                   /product="putative transposase-associated ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02250"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83021"
FT                   /db_xref="GOA:F0J7F4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7F4"
FT                   /protein_id="BAJ83021.1"
FT                   /translation="MSKTPAADAARLAFLLNELRLPSIKQLWPDLAAQADKEAWPAARF
FT                   LAALAEHELADRERRRIERHLLEAHLPIGKTLDNFDFNAVPVISKAHITALASGNAWIE
FT                   HGANCLVFGPPGVGKSHLASGLGRALIEAGFRVLFARTTDLVQRLQVARQDLALEAAIT
FT                   KLDRYHLLILDDISYVTKDQAETSVLFELISRRYEHRSIMITANQAFGEWNKIFPDQAM
FT                   TLAAVDRLVHHATIIEMNVESYRRRTAIARKRAAGRPPARQTPNSET"
FT   CDS             complement(220573..222090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02260"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02260"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83022"
FT                   /db_xref="GOA:F0J7F5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7F5"
FT                   /protein_id="BAJ83022.1"
FT                   /translation="MPGRPITVQQKRLFMRFRTEGDTPQQAAAKAGFSTATAYRLEAGA
FT                   DHPSLPVAPRGRRRPDPLIAVWDSEIVPMLAAAPGLRAVAILEELGRRHPEIGVGVRRT
FT                   LERRIKLWRGLHGPAQDVIFRQAHPPGELGLSDFTDLTPLGVIIAGHPLDHRLYHFRLA
FT                   HSGFEHGHVILGGESYPALAEGLQNALFALGGAPLKHRTDSLSAAFRNLDRATIDDLTT
FT                   RYAALCAHFGMEPTRNNTGIAHENGVIESAHGHAKKAIEDALLLRGSPAFTDLPAYRRF
FT                   IDEIFARHNARRGKLIAIERNALQALPEARAVDYEETLVQVTSSSGFVLRKVFYSVPAR
FT                   LIGQRLRIRLYDDRLECFLGGSPVLNLVRGRADHATGKHGHVIDYRHVIHALRRKPMAL
FT                   RNLVYRDKLFPRPAYARAWQALTARRADKTACKITVELLALAHEAGCEAELAAVLDAEL
FT                   DAGRLPNLDTLRERFRPTSAAVPKITIQSVPLNLYSQLGTISRGDAA"
FT   repeat_region   222215..222261
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 47 bp inverted repeat"
FT   repeat_region   222262..222267
FT                   /rpt_type=FLANKING
FT   CDS             complement(222488..222688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02270"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83023"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7F6"
FT                   /protein_id="BAJ83023.1"
FT                   /translation="MADDTPPHGYTYPNTSDDPDQQDVLRNRFGYRTHSQLRIDEYRIT
FT                   SERLVEIELGMAQRAALTLTT"
FT   CDS             complement(222712..222921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02280"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83024"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7F7"
FT                   /protein_id="BAJ83024.1"
FT                   /translation="MDQVVAKPLISDAEVERRRRAVERARAANIRQGYVHDPVLEAIND
FT                   RFVRGELDLAGFRQAIGEIVGTGR"
FT   CDS             complement(223074..223820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02290"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83025"
FT                   /db_xref="GOA:F0J7F8"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7F8"
FT                   /protein_id="BAJ83025.1"
FT                   /translation="MRHDRRAPCCWSDEDYAEWDWCDHTANRALPSRCGIIRISALCPL
FT                   CRCRHKGHATGHPSRLNRPDLGTPFGSEAYAREELRAEIASLMIADKLGIGHDPGQHAA
FT                   YVGSCYAQQWTLKKPDGAAQSVYNPLMQNETHRDVIRRVAQVPVRPLVILAGHVRLAGG
FT                   PVPGMVPLTSAVMEMTRAGAASGRALAALETLARFRGQARQAALSDAHRRRMRRQKPTR
FT                   TRQLWSLALGAALVFLVLAAEQSIFG"
FT   CDS             223812..225023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02300"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02300"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83026"
FT                   /db_xref="GOA:F0J2V5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2V5"
FT                   /protein_id="BAJ83026.1"
FT                   /translation="MPQYLQTCIEPYLDSFAESFAAENYTAGTVKTYQSILRKVGHAMD
FT                   VEGISPSALTLDMAEHLGRKVPRKKTGSVWPYRLARRFAQHLLDIGVTQPVPLTEAQQA
FT                   RATLLANFETYLVKHRGLSPRTIYHTLRFANRFLDHRFGDAIVDPGRLRPADVISFIEH
FT                   VLAGARRDKTVATHVRIFLQYLFGSGATATNLALSVPRAAKRWGARLPRHLSPEGVEAV
FT                   LACVRDSPRHGARDYAMLLIMARLGLRAAEVIAIQLDDIDWRAGELLVRGKGKLHDRVP
FT                   ISAEVGEALCRYLREERGPASCRTMFVTHRAPYRPFKDSQIVNAVLKDALKATGQKPVT
FT                   PYVGSHLLRHSLATQLVNSGASLDEVGDVLRHRSRTSTMIYARLDIDGLRSVAMPWPVA
FT                   GGAQ"
FT   CDS             225020..225961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02310"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02310"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83027"
FT                   /db_xref="GOA:F0J2V6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2V6"
FT                   /protein_id="BAJ83027.1"
FT                   /translation="MSLTFQLDRYLAVRRRLGYDLSTSERILRRFTRFADSERVTHIDT
FT                   ALFLRWHATLGEANGMTRAARLTAVRLFAQWLSSFDPAHEPPPRGLLPDTVMRSRPHIY
FT                   SNAEVASIIAAAKALPSICGLRGLTCSTLFALIAVTGLRISEALALDGNDLDADNGVLR
FT                   VRQGKNGKERLLPLDPSTVERLLNYRIERDRLIGHPAVPLFVTDKATRLTDCTARYNFA
FT                   QACQQIGLRSEQQYHRHGRGPRIHDLRHTFAVRTMIDWYRTGKDPAREMIRLTTYLGHS
FT                   SPSRTYWYLEAVPELLDLAIARATASGGEMAQ"
FT   CDS             225958..226950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02320"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02320"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83028"
FT                   /db_xref="GOA:F0J2V7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2V7"
FT                   /protein_id="BAJ83028.1"
FT                   /translation="MNAVTLPALIQRFFTDRLCTQLEASRHTVAGYRDTFRLLLRYASA
FT                   RRKKPPVNLTVEDIDADLVADFLAHTETARGNSARSRNTRLAAIRSFFRFVAMTDPTWL
FT                   LHCQRILAMPNKRYVKRAVTFLDAEEMAALLAAPDRTTWAGRRDHALLLLAVQTGLRAS
FT                   ELVGLTRGDVVLGTGAHIRCMGKGRKERATPLRRETAKLLATWIGNDKDEGKPLFPSIR
FT                   GERLSRDALEHLVRKHCLTASRACPSIGTKQVTPHTLRHSTAMDLLHHGVDPAVIALWL
FT                   GHENVETTQIYIHADMRMKEKALARVAAPATPSGRFRPDDQLLAFLEGL"
FT   CDS             complement(227202..227483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02330"
FT                   /product="putative toxin"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02330"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83029"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7G2"
FT                   /protein_id="BAJ83029.1"
FT                   /translation="MRTPDYTGQFKRDYKREKKGRHRATLDADLHAVLSALLADLPLEP
FT                   RHRDHALSGDWKDHRDCHVRPDLVLIYQLPDAGTLRLVRLGSHSELDL"
FT   CDS             complement(227470..227733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02340"
FT                   /product="putative antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02340"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83030"
FT                   /db_xref="GOA:F0J7G3"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7G3"
FT                   /protein_id="BAJ83030.1"
FT                   /translation="MAANQLVQTRIDGAIKEEAATVLAAMGLTVSDAVRLLLTKVAQDK
FT                   ALPFEPLIPNATTIQAMKDARAGRVTKAADLDTLFHDLNADA"
FT   CDS             complement(228272..229159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02350"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02350"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83031"
FT                   /db_xref="GOA:F0J7G4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7G4"
FT                   /protein_id="BAJ83031.1"
FT                   /translation="MDLTAIEVFLKLATELHFGRTAERLGLPQPRVSRIVRGLENEVGG
FT                   ALFERTSRRVRLTPLGTLLRDSLSQPYADLKTAFNEARDKARGVDGVLRVGALATTTGP
FT                   VLTRLMEAFARRVPNCRLMLSEVESFDPYRALRAGEVDVLVTWLAIDEPDLVAGPVLDL
FT                   LPRVVIVAARHPLAKRSSVSIEDIADYGVPWAEAPFPAALMDVLNPQVTPSGKSIQRIL
FT                   PVKSMIEIAQAVASGTVVHITLDSLALFQRPDIVSIPLRDMPLLPLGLVWRQADENQRI
FT                   RALAKAAAIVGSRN"
FT   repeat_region   229185..229189
FT                   /rpt_type=FLANKING
FT   repeat_region   complement(229190..231145)
FT                   /note="Belongs to IS1634 family"
FT   repeat_region   229190..229206
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 17 bp inverted repeat"
FT   CDS             complement(229289..230968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02360"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02360"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83032"
FT                   /db_xref="GOA:F0J5U5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:F0J5U5"
FT                   /protein_id="BAJ83032.1"
FT                   /translation="MFFRIKPSGGRRYLQIVENKRVDGKVRQVVRLTIGRMDELEASGQ
FT                   LARLLASGARHCEQMMLLSAMENEATTLSMRRFGAPLLFGRLWQESGIAAVFEELLAGR
FT                   QFEFPVERAVFATVLHRIMVSGSDRACDKWLDDYDIPSTEELGLHHLYRAMAWLGEELP
FT                   EAEQADATPFAPRTVKDLVEERLFARRHDLFTDLSVVFMDTTSLYFEGAGGETLGAWGH
FT                   SKDYRPQLAQMILGVVIDQDGRPICTEMWPGNTADVSVLVPVIDRLRSRFGITRVCVVA
FT                   DRGMISAATIAALEERGLEYVLGARERTDRIVREVVLADERPYIPLCLERASGDETQLF
FT                   IKEVKVAGKRYIVCRNEAVAIEEAETRRQVVAALDRQLKRGDKALIGNSAYRRFLRPVS
FT                   DAKPGRKSKLFEIDAGKLAEEARFDGVFVLRSNARISPLQAVLRYRDLQNVERLFRVAK
FT                   ATMRTRPIYHSSDAAIRGHVFCSFLALILHQALDEKLRRAGKRVEWADLLRDLDRLQHG
FT                   EISQNGKRWQLRTEAGVAAATAFKAARIALPPRLQTPQQAVT"
FT   repeat_region   231129..231145
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 17 bp inverted repeat"
FT   repeat_region   231146..231150
FT                   /rpt_type=FLANKING
FT   CDS             231353..232114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02370"
FT                   /product="putative enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02370"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83033"
FT                   /db_xref="GOA:F0J7G6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7G6"
FT                   /protein_id="BAJ83033.1"
FT                   /translation="MSAAHFPIAIEDNVAILKLNRATCLDVAGKHALTEALDILKGRED
FT                   LRALVIAGEHPQAFLVNVAELADMSAQSARNFSASGHALAAALEALPFPAVAVVEGPAL
FT                   GGGCEVVLACDIAFAGRGASFGQIEALGGVMPAFGGSWRLARRVGYARALEMMFTAAVI
FT                   DAETAKAYGLVLETAERGGALDAAKAFARRLSPTRAASVAAIKAAAIFGWNRSPADINR
FT                   FEEDRFATLFGPEQSQRMHAFLARQQEPAKP"
FT   CDS             232111..233316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02380"
FT                   /product="putative epoxide hydrolase"
FT                   /EC_number="3.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02380"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83034"
FT                   /db_xref="GOA:F0J7G7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7G7"
FT                   /protein_id="BAJ83034.1"
FT                   /translation="MTDMLFYNVWRTETPENQARLIEAMREEAPKLAAKPGFLSMTVLE
FT                   SQDGRVLVEGRWASREAFDAAVSHSDDAQASRRSLEAFGTAEPGVFTEAFRIGPVEAPP
FT                   ADYPSPTFWDRFARREVVANGLKLSVVEGGQGEPVLLVPGMLETWAIWSRVMPRLADRY
FT                   RVIAPDLRGFGESEGTGAGYNKVTLAADLLALLDALSVGRVHVVGHDFGGQVAYALAAE
FT                   HRDRVATLSAIEALLPGIAVAPRGDEGKFWLFPFHMAPDVPEMLTAGREREYVRALWDL
FT                   FVEPDSEVSVEDRAEVERVFAQRGALTSGFGLYRATPKDIADLTPHYANKLTIPVLALG
FT                   GEHCFERRTLETFQQVATDVTGGVIEGAAHFAPLERNEATARPLLEFLAAHPIETDGRS
FT                   QV"
FT   CDS             233341..233649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02390"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83035"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7G8"
FT                   /protein_id="BAJ83035.1"
FT                   /translation="MSVVRISLARFDASQYDTIRQMLDEAQATLAPAIRALKGNLAFYA
FT                   GIDRENCAMHNVSVWETLDDAKQMDTLQVMLDLGPPFVAAGVRFERPITNHETLWAL"
FT   CDS             complement(234061..234630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02400"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02400"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83036"
FT                   /db_xref="GOA:F0J7G9"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7G9"
FT                   /protein_id="BAJ83036.1"
FT                   /translation="MCLIRAHWSDLLRIATSIRTGTVSASVILRQLAAYPRQNAVAAAL
FT                   RELGRLERTLFTLDWLEDPGLRRESSHELNKGEARNSLARAVFIHRLGEIRDRTFENQT
FT                   HRASGLNLLVTAIILWNTRYLAQAIQALRQVEDVPGTLLRHLSPIGWEHVNLTGDYIWS
FT                   ANQKSTENHAGLRPLRPIPDTTTHAA"
FT   CDS             234809..235321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02410"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02410"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83037"
FT                   /db_xref="GOA:F0J7H0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7H0"
FT                   /protein_id="BAJ83037.1"
FT                   /translation="MSAYATAQGVSLLRATSISGRRVARELTGLIRRRGKPDIIVSDHG
FT                   TEFTSNAILAWSKDYRVDWHYIAPAKPMQNGYVESFNGRMRDEFLNESLFFDLDHARGA
FT                   IADWVKDFNTARPHSSLGYQTPAAYAEVLTATGSSAALRNGSAPPPVAHPAPNGVTKSV
FT                   EAPITAG"
FT   CDS             complement(235809..236378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02420"
FT                   /product="putative transporter"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02420"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83038"
FT                   /db_xref="GOA:F0J7H1"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7H1"
FT                   /protein_id="BAJ83038.1"
FT                   /translation="MPNGYTAGLGLLALRMPIKRVPSLLVIALFTLAIRVAVMLLGDFV
FT                   GAYENFLAYMSYWIAPWAAIVVVDYFLRRGHYDSDGMMQWKESAYWYRNGIFWPGIVSF
FT                   IAGICACILFSNSSTLASPLMTGILHLGDCSFEAGIVVAGLCYYVLAGTYVSKSESRTT
FT                   RGEIDMPDIRPDLTAAFCSSVKDDHD"
FT   repeat_region   236423..236430
FT                   /rpt_type=FLANKING
FT   mobile_element  236431..237510
FT                   /mobile_element_type="insertion sequence:ISAcr1"
FT   repeat_region   236431..236472
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   CDS             236478..237494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02430"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02430"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83039"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:F0IZR7"
FT                   /protein_id="BAJ83039.1"
FT                   /translation="MDVLAREDLPFPQSLPEFQRIFPNDAACAAYLESARWNGGFACPR
FT                   CGVVGEPFRFEARPGVLRCRACRKDVSLMAGTVMERSHTPLSTWFWAAYLIASQTPGMS
FT                   AVQFQRQLGLSRYETAFGILHKLRAGMVRPERDKIGDTPQEHVEVDETWVGGRTRGDGR
FT                   GVHHKVLVACAVEVRHRKPGTKLDNRKDGRYAGRVRLAVVPDRSANSLCGFVENAVAPG
FT                   SLIVTDDWSGYAGLGRRGFDHHAIAECGDPEVAEEFLPIVHLVFTNLKTWINGIHHGVS
FT                   AKHLQAYLNEFTFRFNRRLYPFNAFRSLLGIAGRAAAPTFDELYSGEWTHPTFSGCG"
FT   CDS             complement(237449..238417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02440"
FT                   /product="putative transporter"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02440"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83040"
FT                   /db_xref="GOA:F0J7H3"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7H3"
FT                   /protein_id="BAJ83040.1"
FT                   /translation="MIGRSEMSSSPSSIKADATWHVEVHGIDPIPQNIRHGNAFELFKL
FT                   WVGANTNYVVVVTGGFILSFGLSLTSAITAILVGNALGCIIVGMASIMGPRTGTAGIVT
FT                   SRTSFGQLGSFFPKILSVITALSWFSINAILATEAINKLFAMAGVTGVIVPWIGLAIIL
FT                   VLEVVIAIYGHATIIFMESYIAILLAVIFAVLAYFVILGMPVGHIVAQQQTVFSMVHWL
FT                   SAMSLAFSFPVGWSNYASDYSRYFPETLSWKKVALAAGLGQFVAVVLCEILGVLVAILV
FT                   GGGLSANPVAQLANILPVWFVACLSGCYPHPLNVGCVHSPE"
FT   repeat_region   237469..237510
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   repeat_region   237511..237518
FT                   /rpt_type=FLANKING
FT   CDS             complement(238447..238764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02450"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83041"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7H4"
FT                   /protein_id="BAJ83041.1"
FT                   /translation="MFYEIRTYRLRPGTVQAYLHLVEDEGIAIQKSYLGALVGYFYTEI
FT                   GSLNEIIHIWAYESLDERERRRAALAADPGWQAFMPKIQELIDTMESRIARAAPFSPLA
FT                   P"
FT   CDS             complement(238774..240246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02460"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02460"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83042"
FT                   /db_xref="GOA:F0J7H5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7H5"
FT                   /protein_id="BAJ83042.1"
FT                   /translation="MMRRFRQYIDGEFVDAARSFESIDPATGDAWSLMPEADAADVDRA
FT                   VTAAHRALHDLSWSGLTPTARGRLLYRLGDLLEEQAQALAELETRDTGKVIRETSAQVA
FT                   YIAEYYRYFGGLADKIEGAHLAVDKPDMEVYLRREPIGVVAAVVPWNSQLFLAAVKIGP
FT                   ALAAGCTVVVKASEDGPAPLLEFAQLVDQAGFPPGVVNIITGFGDPCGQRLTSHPLVSR
FT                   IAFTGGPETARHVVRNSAENLSHVTLELGGKSPVLVFDDADLDNACNAIIAGIFAASGQ
FT                   SCVAGSRLLVQNSIHDTLVSMLSERVGKIKIGDPSDPATEMGPLATARQHRKAVEVIQS
FT                   SVKAGAVLTAGGKVPPGHERGFYLEPTILQCPNNDIPCSREELFAPVLSVMRFDTEADG
FT                   IAFANDTCFALAAGIFTNDLRRAHRLIRSVKAGVVWVNTYRAISPVVPFGGFGWSGLGR
FT                   EGGRESVMEYTRPKAVWINSSTCPFPDPFIMR"
FT   CDS             complement(240243..241064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02470"
FT                   /product="luciferase-like monooxygenase family protein"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02470"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83043"
FT                   /db_xref="GOA:F0J7H6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7H6"
FT                   /protein_id="BAJ83043.1"
FT                   /translation="MEQDHPDSVQTHTIILRDSHPIRHLQMTGPLPHLMPGLDAWNAGQ
FT                   RMRELIPAVEKLWSGDYAHDGEFWRFPKSTSVPKPLQQPAPPIWVAARDPNSHEFAVSN
FT                   GWNVQVTPLASGDTEVDTLIARFGAACTAHQNLPRPKIMLLMHTYVGQNEADVTRAAED
FT                   LSRFYCYFGSWFLNKRPVREGFIAELDDDEIKAMTNYAPETMRRNLVIGTADEVTERLR
FT                   HYEALGYDQYSFWIDSGMPFDRKKASLLRFIHEVMPRFATSTPTRAEEPAL"
FT   repeat_region   240957..242397
FT                   /note="Belongs to IS110 family"
FT   repeat_region   240957..240980
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 24 bp inverted repeat"
FT   CDS             241084..242118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02480"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02480"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83044"
FT                   /db_xref="GOA:F0J216"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:F0J216"
FT                   /protein_id="BAJ83044.1"
FT                   /translation="MEHYAGIDVSLESSAVCVIDATGRVVCEGKVATEPETLIDWLRQS
FT                   DVAFARIGLEAGPLSQWLYAGLREAGFPIELLETRHVRAAFRTMPVKTDRKDARGIAQL
FT                   MRLGWFRPVHCKSMAAQELRAILTARKLVQGKLHDVEMSLRGILRGFGLKVGPTTRRTF
FT                   ADRVRELVAGHPTLQMIAEALLSASDELGRQLGQFEAQVRSLARRNPKARLLMSTPGVG
FT                   AVVALTYVAAIDDPARFRSSRTVGAHFGLTPRKYQSGETDVTGRISKIGDVGVRTALYE
FT                   AANVILTRPVKGSTLKSWAMRVAARAGMRKAKVALARKLAVVLHRMLAGGTAFDATMAA
FT                   APRA"
FT   repeat_region   242374..242397
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 24 bp inverted repeat"
FT   CDS             complement(242386..242745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02490"
FT                   /product="luciferase-like monooxygenase family protein"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02490"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83045"
FT                   /db_xref="GOA:F0J7H8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7H8"
FT                   /protein_id="BAJ83045.1"
FT                   /translation="MKFSLFVHMERFDRNQTHAGLFRELEELVRIAEQGGMETAWIGEH
FT                   HAMEFTIAPNPFVNLAYLAARTERIRLGTGTVIAPFWHPIKLAGEAAMLDIASGGRLDL
FT                   GIARGAYSFEYERLL"
FT   CDS             complement(242742..243677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02500"
FT                   /product="putative flavin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02500"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83046"
FT                   /db_xref="GOA:F0J7H9"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7H9"
FT                   /protein_id="BAJ83046.1"
FT                   /translation="MGATMFDSRDFRRALGAFPTGVTVVTTREPDGTPRGFTANSFTSV
FT                   SLEPPMVLVCIAKAAASRGVFEAAEGFAVTILKNTQKPISALFASKDADKFARVAWRSG
FT                   AAGLPVIEGGAAWFSCARERAIDAGDHVILLGRVLDYGHAPEEPLGYCRGTYVDFALSQ
FT                   SAVSALGREIRVEAILERDDRVLLLRSLDGCLALPGGATLGPRSSPTSLYGFLETFGLR
FT                   AQLDFLFAVFENPDMAAMRIVYRGTASGGIAGANVEPHPLTAIPFERVADPASRSMLAR
FT                   YVRERTDGFGVYVGTASEGVVHTIDEEAIA"
FT   CDS             complement(243677..244501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02510"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02510"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83047"
FT                   /db_xref="GOA:F0J7I0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7I0"
FT                   /protein_id="BAJ83047.1"
FT                   /translation="MAEQGLSAGWHKGTHYIRAGAGEVLLLIHGVGMNCGFWAPQINAF
FT                   SPEWDVIAYDTLGHGGSPLPSDPATLAEYAAQAIDLLDGLGVGRVKVVGHSMGALIALD
FT                   LALRHPDRIGAVVAMNAVYRRSPEQRAAVERRVRLLDDDHPADWQQSAMDRWFGARISP
FT                   QCMPAAVWVRAALGCLRPEGYRRAYRLFATADAAHTGRLGRLRLPALFLTGELDGNSSP
FT                   AMARQMAAEAPDARALILSGERHMMSLASPVTVNAALRDFLEEDATLPLVAG"
FT   CDS             complement(244494..245081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02520"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83048"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7I1"
FT                   /protein_id="BAJ83048.1"
FT                   /translation="MPLELRKLVTHTEVLWTEGGRAVPKMSRLMAVAAVLRNPWAGSGF
FT                   VEDLASEIREVAPELGHLLTEEILKLAGGGGAVEGYGKSAVTGSNGEIEHGSALIHTLR
FT                   FGNHYRRAVGAKSYLAFTNTRGAPGASIQIPLMHKHDEGMRSHYETVQFSIDDAPGPDE
FT                   IVVALGASIGGRPHHRIGDRYKDLQEMGDLHG"
FT   CDS             245228..245938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02530"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02530"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83049"
FT                   /db_xref="GOA:F0J7I2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7I2"
FT                   /protein_id="BAJ83049.1"
FT                   /translation="MPELGDDTMLVNRATKTLRQLTLEKVRSAILTLQFRPGERLVERK
FT                   LCERLGVSRSVVREVLRNLESEGLVEVIPGHGPAVASPDTAKVRQIYELRSMLESLAAR
FT                   HCAEHATAEDVEALARGLDRIRDGYAAHNPAAVLQATTEFYEIMFHAAGRSVAWDVVSA
FT                   LNGRITHLRATTIATKGRSKSGVAEVERIYSAIVRHDADEAEAASIEHINSALRIALEQ
FT                   LQISKLVGHQGSQS"
FT   repeat_region   246049..246054
FT                   /rpt_type=FLANKING
FT   repeat_region   246055..247609
FT                   /note="Belongs to IS5 family"
FT   repeat_region   246055..246070
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 16 bp inverted repeat"
FT   CDS             246245..247597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02540"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02540"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83050"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7I3"
FT                   /protein_id="BAJ83050.1"
FT                   /translation="MPPKLNASQDDLELFRSRLENIIDQRHPLTRLARLIDWRVFEERF
FT                   GALYAEAAGRPALPTRLMVALHLLKHMDRLSDEAICARYLDSPYVQAFCGETHFQHTLP
FT                   LDRSSMTRWRKRIGAERMEALLAETLAAAERGGAVAEKHYERVTIDTTVQPKAVTHPTD
FT                   SKLLHRGIETLARMARRHGITLRQSYRRVARYARQEAARLHHGGKRHEAEARVRKLRTW
FT                   LGRLARDITRKIAGNAEAKAAFAETLGVINRLLRQKRSDRGADKLYSLHAPEVECIGKG
FT                   KARTRFEFGVKVSIATTNAAAPGGQFVLGMQSQPGNPYDGHTLAGQIEQVERITGVAVA
FT                   RAYRGHGVEAEGRRIFISRQKRGITPTIRRELRRRTAIEPVIGHMKTNGHLGRNFLLGV
FT                   DGDAINAVLAGAGHNLRLLRRWLIRLLCALVAWLSAPNRSPSPGFTHRQIT"
FT   repeat_region   247594..247609
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 16 bp inverted repeat"
FT   repeat_region   247610..247615
FT                   /rpt_type=FLANKING
FT   CDS             247628..248311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02550"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02550"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83051"
FT                   /db_xref="GOA:F0J7I4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7I4"
FT                   /protein_id="BAJ83051.1"
FT                   /translation="MIEFKGVHYPKSVILYAGFFYLRYAVSYRDLEEILGERGVTVDHA
FT                   TLNRWVVKFAPLIAAQAQARKRPTATSWRMDETYIKVKGKWTYLYRAVDRDGQTLDFML
FT                   SERRNLAAARRFFKRAIAANGVPDRVVIDKSGANLAGLQAVNVILKFTGDGRTIEVRQV
FT                   KFLNNILEQDHRFIKQITGPMMGFKAFHSAAATIAGIEAAHVIRKGQIPANGTSAFQTF
FT                   AELAA"
FT   CDS             complement(248555..248755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02560"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83052"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7I5"
FT                   /protein_id="BAJ83052.1"
FT                   /translation="MQQVFGVWPEIIAHGRITAATGIAIIGVVPTLIAPERWLNAGVPA
FT                   IKRPVYCLPVERFRNGLTGPQ"
FT   CDS             complement(248814..248948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02570"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83053"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7I6"
FT                   /protein_id="BAJ83053.1"
FT                   /translation="MDSGAGGTGRGAIQTGMIEAIAALHAVPYRAVGLEGFGLPDRFV"
FT   CDS             complement(249089..249643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02580"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83054"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7I7"
FT                   /protein_id="BAJ83054.1"
FT                   /translation="MGLTVKQLSKVQKHPNFCWLRERADRGELLPAATVETKLRIAIDE
FT                   TFPKDGRATQEAIAQLAKSAGVDWGQFWKPETVATGTVAVSGATEIRGTDRLMAQAVRM
FT                   AIGANVGRSAPGTSGINHIHVGGNAHKNLLFVAETGKLLGVVDFHMDGDMTGGQRNQVE
FT                   KVGKRISEATSPVTVRGDTVS"
FT   CDS             complement(249679..249939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02590"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83055"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7I8"
FT                   /protein_id="BAJ83055.1"
FT                   /translation="MAIRWSLGFEDLAFLNAKPAGTWLGFAAQLMMYRATGRFGRAASE
FT                   FPDAAIAYLAEQTGALTADLAAYNWFGSLCRERIDREGEPD"
FT   CDS             complement(250104..250586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02600"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02600"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83056"
FT                   /db_xref="GOA:F0J7I9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7I9"
FT                   /protein_id="BAJ83056.1"
FT                   /translation="MVVRIRRFDEKDAQALADLMIEMAGFYGATISSDLVVAEDVLRRA
FT                   RQVDIIVAHDDVRLLGFATFTSLYPVAGLLTFTYVQQVYVGHAARRRGVAQKLMAGIAQ
FT                   AAKAAGSTRIEWSTSRENVAARSLYDGLGANGSDKIYYVLEGSALDQLAARGQQDA"
FT   CDS             250860..251384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02610"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83057"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7J0"
FT                   /protein_id="BAJ83057.1"
FT                   /translation="MLGGRKIQLAEECLYSAHDFAVQVKLLRLVSPNNLDTEKKIEELR
FT                   KTLWQFQRSFLIINYYLKSPISEEIPKAFIDFFASLDTNFRILKQSDFQQPPLVVQGAS
FT                   LLAAAAASSSRQHYDNALDIFYGNRQNDPIEATYGERVNELHGILQPILTPNRGCLGWL
FT                   IDKAAAAVQQS"
FT   CDS             complement(252138..252428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02620"
FT                   /product="plasmid stabilisation system family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02620"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83058"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7J1"
FT                   /protein_id="BAJ83058.1"
FT                   /translation="MRVEWHPLALADRDSIVTYLEPLNPHAAANLLRSLVLAGDSLALF
FT                   PNRGRLGLVAGTRELVAVWPYLIVYEIDMNADFVRILRIWHGARDRSDALP"
FT   CDS             complement(252431..252604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02630"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83059"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7J2"
FT                   /protein_id="BAJ83059.1"
FT                   /translation="MNQTVPQIDPELEAERRLLEAAIAEARADPRPGVPHEEVRADLLR
FT                   EIERLNRKISGH"
FT   CDS             complement(252742..252960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02640"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83060"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7J3"
FT                   /protein_id="BAJ83060.1"
FT                   /translation="MILSDAKSTRPEKMVMVSGLSQAKPKPREKMAARPLVPAGAFVVV
FT                   QVDSCPDISAYSRHRLSLSAGCPPHTI"
FT   CDS             complement(253396..253935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02650"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83061"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7J4"
FT                   /protein_id="BAJ83061.1"
FT                   /translation="MPNSRMANAGLSGLQRRPCGIIRIAALCPLCRHRHNGHATGHPSR
FT                   LNRPDLGTPFGSEAYAREELRAEIASLMIADKLGIGHDPGQHAAYVGSWIKALQQDARE
FT                   IFRAAADAEKISGYLMALRAEQKAGQITGRADSQTGEQARGYWQRAAESGAEIRRAERA
FT                   EQPEQERQARRATAGR"
FT   CDS             complement(253938..254930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02660"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02660"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83062"
FT                   /db_xref="GOA:F0J2V7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2V7"
FT                   /protein_id="BAJ83062.1"
FT                   /translation="MNAVTLPALIQRFFTDRLCTQLEASRHTVAGYRDTFRLLLRYASA
FT                   RRKKPPVNLTVEDIDADLVADFLAHTETARGNSARSRNTRLAAIRSFFRFVAMTDPTWL
FT                   LHCQRILAMPNKRYVKRAVTFLDAEEMAALLAAPDRTTWAGRRDHALLLLAVQTGLRAS
FT                   ELVGLTRGDVVLGTGAHIRCMGKGRKERATPLRRETAKLLATWIGNDKDEGKPLFPSIR
FT                   GERLSRDALEHLVRKHCLTASRACPSIGTKQVTPHTLRHSTAMDLLHHGVDPAVIALWL
FT                   GHENVETTQIYIHADMRMKEKALARVAAPATPSGRFRPDDQLLAFLEGL"
FT   CDS             complement(254927..255868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02670"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02670"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83063"
FT                   /db_xref="GOA:F0J2V6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2V6"
FT                   /protein_id="BAJ83063.1"
FT                   /translation="MSLTFQLDRYLAVRRRLGYDLSTSERILRRFTRFADSERVTHIDT
FT                   ALFLRWHATLGEANGMTRAARLTAVRLFAQWLSSFDPAHEPPPRGLLPDTVMRSRPHIY
FT                   SNAEVASIIAAAKALPSICGLRGLTCSTLFALIAVTGLRISEALALDGNDLDADNGVLR
FT                   VRQGKNGKERLLPLDPSTVERLLNYRIERDRLIGHPAVPLFVTDKATRLTDCTARYNFA
FT                   QACQQIGLRSEQQYHRHGRGPRIHDLRHTFAVRTMIDWYRTGKDPAREMIRLTTYLGHS
FT                   SPSRTYWYLEAVPELLDLAIARATASGGEMAQ"
FT   CDS             complement(255865..257076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02680"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02680"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83064"
FT                   /db_xref="GOA:F0J2V5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2V5"
FT                   /protein_id="BAJ83064.1"
FT                   /translation="MPQYLQTCIEPYLDSFAESFAAENYTAGTVKTYQSILRKVGHAMD
FT                   VEGISPSALTLDMAEHLGRKVPRKKTGSVWPYRLARRFAQHLLDIGVTQPVPLTEAQQA
FT                   RATLLANFETYLVKHRGLSPRTIYHTLRFANRFLDHRFGDAIVDPGRLRPADVISFIEH
FT                   VLAGARRDKTVATHVRIFLQYLFGSGATATNLALSVPRAAKRWGARLPRHLSPEGVEAV
FT                   LACVRDSPRHGARDYAMLLIMARLGLRAAEVIAIQLDDIDWRAGELLVRGKGKLHDRVP
FT                   ISAEVGEALCRYLREERGPASCRTMFVTHRAPYRPFKDSQIVNAVLKDALKATGQKPVT
FT                   PYVGSHLLRHSLATQLVNSGASLDEVGDVLRHRSRTSTMIYARLDIDGLRSVAMPWPVA
FT                   GGAQ"
FT   CDS             complement(257136..257828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02690"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83065"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7J8"
FT                   /protein_id="BAJ83065.1"
FT                   /translation="MAGDYAQTVAASIVKQLEDGTAPWVKPWEPSGLRFIPYNAITGKD
FT                   YQGGNAIWLMAVAEMKGYSDPRWTTYKQAQSLDAQVMKGEKGTLIQYFKKFDRVPVKDE
FT                   QGRPVKDAEGNQVYRSVELERPRVFSAVVFNAEQIAGMPKIEARPALAEWERHAAAEQI
FT                   MSNSGVPIIYRPGDRAFYTLAQDRVTMPERDQFKTADRFYSTALHELGHNAEIRIMPHL
FT                   LGRARLAV"
FT   CDS             complement(257818..258006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02700"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83066"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7J9"
FT                   /protein_id="BAJ83066.1"
FT                   /translation="MDPKPPIISRDLADLMRPGVMVEIDPAEVEQLGLVEETALDEADA
FT                   WESNADVENTNEATHGR"
FT   CDS             complement(258221..258424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02710"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83067"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7K0"
FT                   /protein_id="BAJ83067.1"
FT                   /translation="MDRLVSKISESEMMQRWRAIEQAHAANNRQGYVHHPELEAVNERC
FT                   IRGEIDMAGLDRRMIAAIRAGR"
FT   repeat_region   258458..258462
FT                   /rpt_type=FLANKING
FT   repeat_region   complement(258463..262250)
FT                   /note="Belongs to Tn3 family"
FT   repeat_region   258463..258502
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 40 bp inverted repeat"
FT   CDS             complement(258496..261462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02720"
FT                   /product="putative Tn3 family transposase for insertion
FT                   sequence element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02720"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83068"
FT                   /db_xref="GOA:F0J7K1"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7K1"
FT                   /protein_id="BAJ83068.1"
FT                   /translation="MPLRVLLSAEQRARLFSIPTDMASMSRHYVLDAADLAMVRVRRRA
FT                   SNRLGFAVQLCVLRFPGRTLDPSEYPPAPALAFVAEQIGVDPLLFAEYARRAETRREHL
FT                   VELQKFTGLRSFGLDDWRACLHAGADTAWATDRGEPIIQAMLVHLRESRVLLPSATVLE
FT                   RIGLAARVRARKKTFEVLAAGMADAERSALTELLTVDPELRRSRFAWLRDYSESPAPSN
FT                   IVSLLDRLEYVRAMGIDPARAGRIHAARLVRLTDEGALMTVQHIADLEPARRTAILIAQ
FT                   IASLETRLTDATLAMFEKYVGTLFSRARNRDERRFQATRRDVAKALLLFRRTIAALRQA
FT                   KEAGEDGITAIEREIGMNQLEDVLPIIGAVADVADQDILVTAAERYTVLRRFSPRFLAA
FT                   FDFRSNMPNDPVLAAIELLRALNRGAIRSLPKRPPSTFLPPQWRKLIFAGGTADRRLYE
FT                   TAVLAVLRDKLRGSNIWVAGSRDYQAFETYLLPAGAGAATGIDGEADPDRYVASRAEML
FT                   RERLTFVAARAAQGDLDGVEIEDGKLFIARTPPTVPDAARDLALRLNSMLPRVRITEVL
FT                   SEVDAWTGFTDRFVHLRTGNPVTDKAALLAAVLADGTNLGLARMADASRGLSYHHLVNV
FT                   AQWHISDDNYVAARAAIINAHHAHPMAAIWDDGTSSSSDGQYFRAAGRAGAGGSVNAKY
FT                   GIEPGAVIYTHVSGQYGPFHTRVISATMSEAPYVLDGLLHHVHQTDLRIAEHYTDTAGA
FT                   TDHVFGLCHLLGYRFAPRIKDLRDRKLYTIEKPGTWPLLVPLIGDAVETTAILGQWPEL
FT                   MRLKASINAGTVLPSVILRKLAAAGGGNTLSRALRAVGRIERTLFTLQWLSDPALRQRS
FT                   HAGLNKGEASNALRRAVFFHRQGEIRDRTFENQSFRASGLSLITAAIVHWNTIYLDQAV
FT                   QHLRAQGTAVPDDLLAHVAPLGWEHIALTGDYVWNPANPNASFRPLRDVRAPFIPRAA"
FT   CDS             261636..262217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02730"
FT                   /product="putative resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02730"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83069"
FT                   /db_xref="GOA:F0J7K2"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7K2"
FT                   /protein_id="BAJ83069.1"
FT                   /translation="MAHTLIGYARCSTDRQDLAAQRAELEQLGVKPDRIYTDHGLTGTN
FT                   RARPGLAQALAAVRKGDTLVVPKLDRLARSVPDARAIADELITRGVKLALGAAVYDPTD
FT                   PMGKMFFNILATFAEFEADLIRLRTREGMAIARAKGKLRGKRPTLSERQQKELRRMYDT
FT                   GNYSITDLADLFSVSRPTIYRTLARQPANA"
FT   repeat_region   262211..262250
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 40 bp inverted repeat"
FT   repeat_region   262251..262255
FT                   /rpt_type=FLANKING
FT   CDS             complement(262283..262693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02740"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83070"
FT                   /db_xref="GOA:F0J7K3"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7K3"
FT                   /protein_id="BAJ83070.1"
FT                   /translation="MIFIDASALIAMIAGEEDADMLADLLAQERTRLVSPVAMWEATAG
FT                   LCRSFGLSMDGARQKVKSFMSALEIEVISLGEREYDLAIQAYADFGKGRHPAALNIGDC
FT                   FAYGAAKSYRAALLFKGDDFSKTDIRRAEMNL"
FT   CDS             complement(262690..263010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02750"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83071"
FT                   /db_xref="GOA:F0J7K4"
FT                   /db_xref="InterPro:IPR011660"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7K4"
FT                   /protein_id="BAJ83071.1"
FT                   /translation="MFWWISLLQAEYRDIFNQIFEYLEAPMPLYIRDDATAELVAKLAK
FT                   ERGLTKQDAVRLAVQAELDRTREAKPLRERLREWREANPLPPPTGLKADKAFFDDLSGE
FT                   GE"
FT   CDS             complement(263125..263646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02760"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02760"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83072"
FT                   /db_xref="GOA:F0J7K5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7K5"
FT                   /protein_id="BAJ83072.1"
FT                   /translation="MSYLPLSEPEPLTAAHDVSEFSCGKSPLDHWLKSRALSNQQKGFT
FT                   AVVVVHEAGRVVGYYGLAPTAIVPTVLPRSIRTGQPPNPVPCMLLGQLAIDTRWAGLGI
FT                   GTGLVKHALQRCVQAASLIGGRALMVNAVDKEAAEFWQRRGFEQSRDDPLVLLRSISDI
FT                   AASLGVGGGN"
FT   CDS             complement(263643..263942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02770"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83073"
FT                   /db_xref="GOA:F0J7K6"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7K6"
FT                   /protein_id="BAJ83073.1"
FT                   /translation="MATVAERKEYPISMRLPEADVAMIDRAASLRGRSRTDFVRDAAVR
FT                   AAEEVVMEQGLIRMSAEGFAEFMDVLARPAAPVPEMVEVLKRPAPWEPGYVAKR"
FT   CDS             264335..264601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02780"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83074"
FT                   /db_xref="InterPro:IPR008893"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7K7"
FT                   /protein_id="BAJ83074.1"
FT                   /translation="MQLALFPEQIRLIRVRPEHNEKRYYQIEIVTDLFGAVGLARTWGR
FT                   IGRSTHSRFDPLPDLGTAIDALRRLARAKRRRGYQDYPSTGWF"
FT   CDS             complement(264715..266115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02790"
FT                   /product="replication protein C"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02790"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83075"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7K8"
FT                   /protein_id="BAJ83075.1"
FT                   /translation="MENFRPESGPGPKRRGVRGARRLTLGMVATERLADDFGTVSEGGQ
FT                   VDPGRVLAAFKAAAPYLRFGPRVTQAIDWLFRFTQVQDWQEGARPIVWPSAAMQMEALC
FT                   LSEAQVKRLNRLLAHLGLITMRDSPNGKRYGRRDPRGRIVEAYGFDLSPIAVRQAEFRE
FT                   IAERGRARFEALKQLRRRATIAVRGIQQIVETATELGIAEGWARQADEARRLVARIRRI
FT                   EELDEVTLGVTTLENRQADLRGRLEAAIDTLKEAALGGVESTNMNPKGLTDEPHITYTN
FT                   QTLDPADHVSALRKRSSTSGGAGTSAGGSTRTGRSGDGKEAGHRPTGSRAIKPEIPPDG
FT                   TVFRMTPDELVRLAPRLRAYLAKSSPGWPEIVEAADWLRHDLGVSKPLWGDACLAMGRE
FT                   QAAVALAIVSTKPSDHFRGSPGGYFHGMVARARAGELNLARSIWGIRAASGMPRPPRSH
FT                   ACDASRSI"
FT   CDS             complement(266303..266515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02800"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83076"
FT                   /db_xref="GOA:F0J7K9"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7K9"
FT                   /protein_id="BAJ83076.1"
FT                   /translation="MPNTRTAGDDASARYRRRQRARGATGVLVHLPNETISLIDTIKER
FT                   KGLRSRGQALQQLIEEWRAASPRTL"
FT   CDS             266983..267396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02810"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83077"
FT                   /db_xref="InterPro:IPR020358"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7L0"
FT                   /protein_id="BAJ83077.1"
FT                   /translation="MKFATVQPLTARPDIPVITDEEATALARATVNLFRAWSLTDQEAR
FT                   VLLGEMAQRTWARWKAGDVGRIDRDLRARMAILMGIHKALRYLFTDPARGYAWIRKPND
FT                   AFEGRSGLDLMLRGEITDLMDLRKYLDAERGAW"
FT   CDS             267390..268082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02820"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83078"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7L1"
FT                   /protein_id="BAJ83078.1"
FT                   /translation="MVNVPIRRVIWPRTIRIIRSIYPPIDLFEDIADPADWDALVSAEA
FT                   KFNPRIRDSIGDLSKVPVARRVTGPGASWVMAPFVHCSPLRPSRFSDGSFGLYYAGDRT
FT                   EVAIAETIHHHARFMRATNEDPGWTSQFRELVGTIEVDLDDATGRADLLHPNEYVASQT
FT                   FGAERRAAGSNGIIWPSIRYPDGQCIAVFWPDVIPIPIQGAHYAYHWNGSAVDYIKRLD
FT                   DGVVWEVA"
FT   CDS             complement(269078..270001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="ACMV_P1_02830"
FT                   /product="putative replication protein RepA"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02830"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83079"
FT                   /db_xref="InterPro:IPR006881"
FT                   /db_xref="UniProtKB/TrEMBL:F0J7L2"
FT                   /protein_id="BAJ83079.1"
FT                   /translation="MGEIHNLIEARGRAGALDAGIERSFVEAAAQYMGDEDTTLSFAYS
FT                   GWAQCALPHRRLADDQPWEISIERTRLVVEPGRKPRSEEGPLDFVGVPFGAHARLILLY
FT                   LQTEAIRTGSREIELGRSLRDWLSRIGVSVGGKTAKLVKDQAERISRCRLTFHIQGGKS
FT                   VGLINQSIMDGALFVEDTEEGSGKPMLSMARLSEGFFEQLQKHPVPLEEAAIKAINNNP
FT                   GALDCYLWLAYRLHALPAAKLVTWKALKAQFGCGYREVYHFKARWPSALKLALAVYPDA
FT                   QVDIVDEGVILKSSRPPVRPRVQSIR"
FT   repeat_region   270003..270010
FT                   /rpt_type=FLANKING
FT   mobile_element  270011..271090
FT                   /mobile_element_type="insertion sequence:ISAcr1"
FT   repeat_region   270011..270052
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   CDS             270058..271074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_P1_02840"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_P1_02840"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ83080"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:F0IZR7"
FT                   /protein_id="BAJ83080.1"
FT                   /translation="MDVLAREDLPFPQSLPEFQRIFPNDAACAAYLESARWNGGFACPR
FT                   CGVVGEPFRFEARPGVLRCRACRKDVSLMAGTVMERSHTPLSTWFWAAYLIASQTPGMS
FT                   AVQFQRQLGLSRYETAFGILHKLRAGMVRPERDKIGDTPQEHVEVDETWVGGRTRGDGR
FT                   GVHHKVLVACAVEVRHRKPGTKLDNRKDGRYAGRVRLAVVPDRSANSLCGFVENAVAPG
FT                   SLIVTDDWSGYAGLGRRGFDHHAIAECGDPEVAEEFLPIVHLVFTNLKTWINGIHHGVS
FT                   AKHLQAYLNEFTFRFNRRLYPFNAFRSLLGIAGRAAAPTFDELYSGEWTHPTFSGCG"
FT   repeat_region   271049..271090
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 42 bp inverted repeat"
FT   repeat_region   271091..271098
FT                   /rpt_type=FLANKING
XX
SQ   Sequence 271573 BP; 50663 A; 86930 C; 83998 G; 49982 T; 0 other;
     atggaccaga tcgagtcgcc gcctgacaaa atcgtccgac atgcgacact tttgtccaat        60
     caacttcatg tattgcgaca gcgcatgtat ccaccggagg cacagaaatc cctcaggccg       120
     tttgcaacgc atgaagtctc gtcactgacg tctatccccg aatcgacgct gcggacgatg       180
     tcgattgagg gtaagggccc gatcccttcg cggcgtgaaa acaaccaccg gacttatacg       240
     cttgagcagg tcaacgagct caggcagttc ttcgccgcac agaagccgaa cgatgctctc       300
     cgctacctac ctcgccggcg cgctggcgaa cacctccaga tcctcggagt cgtgaatttc       360
     aagggcggtt cggccaagac cacctcaagc gcgcatctct gccactacct ggcgctgcag       420
     ggttatcggg tgctggcgat cgatctcgat ccccaggcca gcctttccgc aatgttcggt       480
     gcccagcccg aacttgatgt cggtgccaac gagacgattt tcgcatctct gcgaagcggc       540
     gaagacaggc gcccgatgcg cgagatcgtg cgcaagacat actttaccgg gatcgatctc       600
     attcctggca atatcgaagt catggagtac gagcacgaga ccccccgcct tctcgctgag       660
     agcaacggcg gcgaagcggc tctgttcttc gagcgtctca ggatgtcgat tgccgaggtt       720
     gaagacgact atgacatcgt cattctcgac acgccgccat cactgggctt cctgactctt       780
     ggcgccatct gtgcggccac cgggctaatt gttacggttc atccggcgat gctcgatatg       840
     atgtcaatgt cccagttcct tttgatgatg ggggatctga tcagtgtgat cggtagtgct       900
     ggcgcagccc tgcagcagga cttcctcaag tacctgatca cgcgacatga ccctaacgac       960
     cagccgcaga cgcaaatcgt ctcgttgatg cgccaccttt tcgccgatga cgtctttatt      1020
     ccgaccgcga tcgaaagcac tgcggtagag agtgccgggc tacacaaaaa gagcgtctac      1080
     gaactggcac ccggtgatgt cggtcgtgac acgtaccggc gtgcgcggga ttccatggat      1140
     gccgtcaatt tcgcgatcct cgagatgatc aacagggcct gggggcgcaa atgagcaaga      1200
     agccatcacg atcgatcgtc ggcagcttca acctgctttc cgaatccctg cgccccgaca      1260
     aggaaccggt cgaaccaaac aatccgtctt tctcccccgc atctcaccac acacccagga      1320
     tgccggccgg cgttgtcgcg gccaccgagc ggtcgatctc ccaactccgc gaggagcgtg      1380
     accagctcag ggccaggctt tcgaatatgg cccccgatga gttggacccg gccatcttgg      1440
     agccctcccc gatccctgat cgtctgccgg atgatgatca ggaaggcttt aatgccctgg      1500
     tggattcaat ttctgccgag ggacagaagc ttccgattca agtccgcccc cacccgtcca      1560
     agcccggtcg ctaccagatc gtctatggcc accgtcgctg gagagccgcc cagcatctgg      1620
     gtgtcaaagt cagggcgttc gttgtcgacc tggacgaccg ggaactgatc atcacgcaag      1680
     gactggaaaa cgagtcccga caggatctga gctggattga gcgtgcgtcg ttcgccagga      1740
     agatggaaga cggcaggata gatccacgcg acatcaaagg cgcgctgagt attgatgacg      1800
     ccgaactctc gaagatgcgg atggtgaccc gcgtgatttc gcgcgagctc atcgagacca      1860
     tcggtcgtgc acccaagatc ggtcgtcccc ggtggctcaa ccttgccaaa gcgctggaat      1920
     ccgatccatc ccgggaagcg gacgttcgcc aaaccttgtc aggtgacaag gccccgacct      1980
     cgtcgaacga gcgctttagc ctcgccatgg cgacgcttca ggcagagcat ttgaagtcgt      2040
     ctgacgagat cgatcttctg acctcgaaag atgttcgaat tggcacggca agtttttccg      2100
     gatccagcgt caccattcgg tttagcaagg atcatgctgc gccgcttcgg gaatttattc      2160
     gaagcgcact cgcagaactc gctgatgcct atgagcggca agttgcgtcc aaccggtcca      2220
     aaaaaggctg atccaacccc tgaccgagtc agaccaacgg cgcgcccatt gtttccaatg      2280
     ttcgtcagct ggtgttatcg caccggataa accttgtcag atgacaaggc gcttgaggga      2340
     gcgcggcacc atgcctccgg tccgataaac aaaatcagga aaattgtgta tttgcgcagc      2400
     ccgtgcccac cttccagaac ggatagagtc actcctcgcc gcgaacttgt cagctgacaa      2460
     ggctacactc gcgataagat aatgagacat caagacggat gtccgtcaaa ggggagggga      2520
     ggaatatacg gagatgtccg ccttctaagg cgtccttgcc ttatcggcac tctcgtaggc      2580
     gacaataagc tgattgcact ggcggcctca agaacgcccc gggagctccg tctatgtgcc      2640
     tagcgatggt tcgctctcca tcggcagtcc ctgcgcatac gcagcccgcc gtgcctgctc      2700
     gagaaccatc gcaacagcct gccggtcgcc gtgttcaatc gaaacccggg cgaacgagat      2760
     cctgaactag ttcaggatcc cgatgatccg ctcatcgatc tgctcgacct ggtcacgtac      2820
     gtggacgcgg ctatagtccc tgtatcactc cgaccggtgg acgaagaggt tcagtgacga      2880
     gtacgcgaaa tgcgcttcga gtgccgctag ctcgatgcca gggctggtct ggtaggcgca      2940
     gcacagcagg caagggcact ttgcgcctgc aggtgatccg gattggcctg aaactgagtc      3000
     cgatggacct agagcacccc atccagcggg tgtccgtcaa acaggtcgcc gaactccagg      3060
     tactccccga gcacgtcata gctcttgtgg cggccgagcc gcttcaggcg cgccggatgc      3120
     acgccgcgct ccatcccggt ggtgagtgcc ccgcgcttga ggctgtgtcc gcccaggtcg      3180
     cgccggccga acccggccgc catggcccgg cgctggatga tcagggccac gctttgcggg      3240
     gtgagggcct gctcgccaat gaccggccca ggcggcgcgg tccgctcgcg ccctttgcgg      3300
     ccggatggcg gtgaccagat ccggcggaac aacgggcccc gctgcagccc cgcggcgacc      3360
     cgccagcgct caagggcatg caccggacaa agttcggtat cgccgtaggg cagggcgacg      3420
     gtgaccgcct cggcctggct tcctttggtc tgcggcaggg tcaggcggag cccccgctct      3480
     gacggtgtca ggtgctcgat cctgatgccg gcgagttccg agcgccgcag cgcgccggcg      3540
     aagccgacca ggatcagcgc gcggtcgcgc aggtcagtca gctcggtatc gccgatcgcc      3600
     gccagaagtc ggcggatcac cgtcgctgtc gccgccacct tcttgcggcg gatctcgcca      3660
     cgggaggcgg cgtcacgctg gatgcccgcc atggtctcgg cgacgcaggc atcatcggtg      3720
     ggcaccgggc agccggcgag gcgatgcagg tagcggatcg cggcgcgccg gagcttgagg      3780
     gtttcggtcg agacgccgcg gccgcgctca tcggcgagga aggcggcgac atcagcaccg      3840
     gaggcgggga ggggcgtcag cccgtggcgg tcgcaccaga ggcaccagac gcgcacggcc      3900
     gcgcggtagg cccgcctggt gttgtccgcc ttggcccggc gggcataggc gctggcggcg      3960
     ctgcgggcgc cggcgagcgt gccatcggcc accgggaccg gttcgtcctc gatctcgctg      4020
     aaccagcgcc ggaccgcgtg cccgtctccg gccagcggag gaggggaggg caccaggctg      4080
     ccggccgatg gcgcgtcggg gcggtcttgc ggtgcgaatt cggtgttgtc gggcacttgg      4140
     ggcctctcct gagcgcggtt cggtcggttc tgcgcccgga atcctatgaa atttctgtag      4200
     tagcgacaac catgtttatc aggaaaccag tcaaaaaatc ccgatcgccc gctgaaaaag      4260
     acggttgttt cgtgctataa ggtaactgga gcaaacttat ggatcaggat attgattttc      4320
     cgttcgagga ttttcctagc gttccgccca acccaggccc gattcctttc ctccatcagg      4380
     ggccggagca aaatcggcgt gcccgcggcg gttcggggtt ttgctccatg gccactcgtc      4440
     gggcggtccg gtcgagacga tcggcacaag gtggccggcg tgccgcgcct gtcaggtcgg      4500
     ggcggtgatg gcgaggtcgc gcatggacgg cagacggtcg accatgtccg cgaaatgctg      4560
     acgctccctc accatcagcc cggccgggac ggcggggcca aggcacttca tggctccccc      4620
     tgaaatgccg gcccagcagc ttctgatgat cgccctcgag cgggcggccg gagcgtttgc      4680
     ccggctcgac caggccctct cgatgcaccc gctccgcggc gccttcctct accggtttcg      4740
     cctcgatgcg gtgcgccgcc aggcgatggt agatgggcag atgatcgagc cgtggcatct      4800
     cgcggccctg ctcgaggggg ttcggctccg tatggaccca tggttgagcc tcgccgagcg      4860
     gggtgacatc ttcgatgcgg cccgccacgc gttctcgatg caccagtgga tcgtcgagcc      4920
     cgattttgat caggagggtg agatccaggt ggcgatgaag gcgatcgagc gcgatgtcgc      4980
     gcgcgcctcc ccgctgctcg gcgcggcgca cgcggcccat gcctggctgg ccgggggcgg      5040
     gagacgagct ccattgcggg gcgcactgat ccgcttctgg cgtcagagcg ggctgctgca      5100
     ccttccggtg ccgatcaccg gaccgcaggc cctcggcggc gaccttccct ttgaccggga      5160
     gagctggatc ccgcttctgc tccatgcact ggcgaacgag gccgcggcag cccaggacct      5220
     catccgcgat ctcgatcggg cctggcaggt cgcacgcgct tcgatcggca agcggcgcaa      5280
     gaacagccgg gccgccatgg cgatcgatat cctggcggca accccgatca tctccgcgaa      5340
     atcgctcgcc gaacggctcg gcatgaacgt ggcgaacgcc cacaccctgc tcggcgagct      5400
     gctcgaagcc gggctggtcg tcgagctgac ccaccgcagc aagcgacggc tcttcggcct      5460
     gtcgggcatg ggccggatgc gcgactacgt ggcgccgccg cgccggccgc agccggggcg      5520
     gggaaggggg cggccccgga tcgaacccga aatgccgcag cccgcgccgc ccgccgagct      5580
     tccgccggcg ccctccggtg gcgtcctgcc ccggctcgcg ttcgacttca gcgatctgga      5640
     agaggccatg gcggcagccg atgccgcgat ccgcgagacc aggatcagcc tcgatcggat      5700
     ccgtcaggca ggcaggccgg agtagggact acctcgaccg gtggtgcgcc ctggggagca      5760
     gctgaaacct atacggttca gcggaatgac ccggcgttcg tctcgaacaa cgccgcggag      5820
     gacgtcgctg tcagtcggca gccgccttca tctgctcgca gccatgtcgg tagagcgcct      5880
     gggcagcggc gacgcctgcg ccgaggcgga tgtcgaggcc gagatcggcc atgcacatct      5940
     cggcaacggc aaggccagag agcgccatcg catcggtgag catgccgaga tgaccgatgc      6000
     ggaagacctg gccggcgaca tcgccgagcc cagcaccgaa tgccatgccg tagcgctcgg      6060
     cggcgtgggt gacgatgcgc gcggggtcga acccgtgtgg gacgcgaatg gcggtgaccg      6120
     agttcgaata gagctcggat gctgcggcgc acggtgccag gccccaagcg gcgaccgcag      6180
     cacgcacgcc attggcgatc cgggcgtggc gggcgaagac gttgtctagc ccttcatcga      6240
     gcagcatccg gctcgacagc gcgagcccgt tcaaaagtcc gaccagcggc gtgtagggat      6300
     acccgttcgc gacgttggtg gcccgcatgt cgtcgatatt gaagaaatta cgcgggagtt      6360
     tagcatcccg gctggccgcg agggccttct cgctgaaggc ggtgatggcg aggccagggg      6420
     gcagcatgaa gcccttctgc gagccggtca ccgcgacgtc gacgcgccag tcatcaaatt      6480
     cgaacggcat cgagccgatc gagctgacac catcgacgag gagcagcgca tcatggctgg      6540
     cctcatccac cacccggcgc aggccggcaa tgtcggagac cacgccggtc gcggtttcgt      6600
     tatgggtggc gagcacggcc ttgatccggc ccgctttgtc ctcgtgcagg agctcggcga      6660
     agcggggaag tggaatcccc tcgccccatg tcacgtcgat ctggatgact tcgaggccga      6720
     agcgccggca catcttgatc cagcggtcgc tgaacattcc gttgcgggcg gcgaggacgg      6780
     tgtcgccggc gctgagcgtg ttggagatcg cggtttccca cccgccggtt cccgtcgagg      6840
     ggaagatgaa gatttcgcca cgctccgcct tcatcacgcc gcggcagccg gcgagcgccg      6900
     ctttcaggat cggcgcaaaa gccggcgaca ggtgatccac ggtcggcatg tcgcacgcct      6960
     tgcggatcac ttcgggaata ttcgtcggcc cggggatgaa gacagggttt tgcaggctca      7020
     ttgggcggat ccttcgtcgg ttgcgcgaga tatagagagc cgcccgacag cgcgcaattt      7080
     tatggaatgg cccgcccctt cccccttgta gagtaatctg ctgggggcca acggaagaaa      7140
     gggaggcagg caatgaagac agagatcgcg gttttaggga ttgatctggg caagaacagc      7200
     tgcagccttg cgggactgga tgggactggt gcggtgatca aacggcggcg gatgcgaccg      7260
     gagaccgtgg tgacgttcac gaaggagttg ccgccttgcg tgatagcgat ggaggcgtgc      7320
     tgggcccgtg ttcgcggtca tgaggcagat ttggctgtgt gtggcttggg caagtggttg      7380
     aattgattgg attgaatgat cgtggagtgg gcggaatctg cgccaacaca tagacacacg      7440
     actctcggcc ttatgtcttt tataacctga cgagatacgc tattcgatag gcatgtatct      7500
     gcgtgtcacc cagcgccgga accgcgacgg ctccacggtc cgctactatg ggctcgcgga      7560
     gaacgtctgg aacaccgaca gcaagcggtc ggagacccag gtgatccaca gtttcggccg      7620
     tgcggatcaa ctcgatcgcg ccgctctcga gcggctggtg cgcagcatca accgtgtgct      7680
     gggcgatgac gagcaggtcg gtgatggcgc gccggcaggc accgcgccgc ccgatatcga      7740
     gatcgacgcc gccttcgagt tcggcattcc gttgacagcg cggcatctgt gggaggaact      7800
     cggcatcggc ccgccggtca gggattgcct gagcaaggcc gaactcaccg ccccgcatga      7860
     ggcagcgttg ttcgcgatgg cggcgaaccg gctcgatgat ccgggctcga agcgtgcctg      7920
     cgcggagcgg tggctcaccg acactgcctg gctgccggag gcgactggtt tgacggtcga      7980
     ccacctctac cgcgccctcg atgttctggc ggtctgggcc gacgcgatcg agcgggcggt      8040
     gttcctgcgg gccgccgacc tgttccgcct cgatgtcgat ctgatcttct atgacaccac      8100
     gacggcctat ttcgagatcg acgaggccga cgagaccgag caagtctggg ccgggcggct      8160
     gttcgccccg ctgcgccggc gcggccacag caaggaggga cgcgacaatc agccgcaggt      8220
     gatcatcgcc atggcggtga cacgggacgg catgccggtt cgctcctggg tgctgccggg      8280
     cgacaccgcc gatgtcgcga cggtggcgcg gatcaaggag gatctgcgcg cctggaacct      8340
     tgggcgctgc ctgttcgtcg gcgacgctgg catgtattcg gcggacaatc tgatggcgct      8400
     gagcaagggg ctcggccgct acatcctggc ggtgccgatg cgccggctgc gcgatgtgga      8460
     tgaggcggtt ctgacccgac cggggcgcta tcggaaggtt gccgacaatc ttcaggccaa      8520
     ggaggtcgtg gtcggcgacg gtgagcggcg caagcgttac gttctttgcc tgaaccctga      8580
     ggaagccgag cggcagcgcc agcatcgcga cgaggttctg gccggcctgc gcgccgaact      8640
     ggcgttgctc gccgcccgag atgccgagca tcccaaggcc gcctgcgcgc tgctcacctc      8700
     gcgccgctac ggccgctacc tgagcacgga tgcggccggc aggccgcatc tggattccgg      8760
     aaagatcgcc catgccgccc gcttcgacgg caagttcgtc gtgatcacca acgacgacac      8820
     gctgtccacc gaggacgtcg ccctcggcta caaaggcgga accatcatcg aagcctgctt      8880
     ccggcggatg aagcagaccg ggctcgaggt ccggccgatg tatcactgga gcccgcgccg      8940
     gatcgaggcg catgtcaggc tctgcgtcct tgccctgcag atacagcgct cggcggagtt      9000
     gcgctgcggc cttccctggg cgcggatcgc ccacatcctg gccggcctca aggcggtccg      9060
     ctatcagatc gccggccgga ctattgttca gcgcacgaaa atcagccccg aagctgccga      9120
     gaccctcaaa aaccttggaa tatcaaagcc aaagaagctg ctcacagtca tcgagccgcc      9180
     gcaggccaac gccacctcat agatacacgc cccgattccg tatcgaaaat ccatcggaaa      9240
     atagacagac tttcctcacg tctgcctcat gaccgcgaac ccgggctatg tcgaccgcgg      9300
     ctatcgcggc cacagcgtcg aagccgaggg cagaaggatc ttcatctccc gccagaaacg      9360
     cggcatcacc cccaccatcc gccgcgagtt gcgccgacgc acagccatcg aacccgtcat      9420
     cggccaaatg aagaccgatg gccatctggg gcgaaacttc ctgctcggcg tcgacggtga      9480
     tgccatcaac gccgtcctcg ccggcgtcgg ccacaacctc cgcctcctcc gcagatggct      9540
     gatcaggctt ctttgtgccc tcgtcgcatg gctctctgcc acaaaccgct caccaagcct      9600
     cggcttcgcc caccgccaga tcacatagtt cacaggcgac taggtaacca taaatcaagt      9660
     atttcgtgcg atagggatcg aatgctgggc atcattcctc atacgatcga tcagtatctc      9720
     aggacccgcg ttccgcctga ggccagggcg ggaattctcg ggcgcgcggg atttccggac      9780
     gggcagacct tccggctcga tacggaatat gacgacgagg cctgttgcgc gctggtcgat      9840
     gcgatcgccg cggaaaccgg cacgacaacc gaggccgtat tcgatgagat ctcggcgttc      9900
     ttcctcgact gggcggaacg caccttctcg ggatttttca aggttgcgcc ggatacgcgc      9960
     ggctttctcc tgctgcaacc ggagatccat agcagccttg cctgtgggct gcgggccagc     10020
     gggcagcgaa aggtggccga caagttcagg gtcgaggcgc tgccggacgg ggtgcggatg     10080
     cattaccgct cgtcgaaccg gctcggctat ttctactgcg cgctcgcccg ctgcctcgcc     10140
     gcccgcaggg gcgaggtggc cgagatcagc tttctcgacg gcgatgtcga ctcggccgcc     10200
     gcgatcatcg aggtgaggct aaaaccggcg ctggcggcct gacgcgcatg gatcaggccg     10260
     aaacgctcga tcgcgccgcg gtcgaggccc tgtgcgaggc gatgtgtggc gttgtctccg     10320
     gcgacctgtc ggtgcggctg cggacggcga gcgcggacct gacggtccag aaactgtcgc     10380
     tgctcgcgaa tttcatgctg gagaccgccc agcgcgcggt ggagcgcagc cgggcctatg     10440
     ccggggcact cgacaacgtg cagcgcatcg cacggctttc ggcctggcaa ctggtgttgc     10500
     ccgaccaaga ggtcgtgccg gtcggcaccg cggcgggcct gccggatgcg gcggccgcgc     10560
     cgctgcgggg gaccgcgtgg ttcctcgacc gcgtgggccc cggctgtcgc gccgcgatgg     10620
     ccgccctgtt ccagggcgat ggcgggacgc tcgaatggct ggcggcggat ggcgaggcct     10680
     ggttccgcac cgaggtcgcc gccctgcgcg acgagggcgg gctctcgggg tatctcgtga     10740
     tcacccagga cgtctccgag cgccggcggg cgaccgagcg cattcgctat ctcgccgagc     10800
     acgacccgct gaccgggctc gccaaccgga gacggctgca cgagcaactc gaaggggaac     10860
     tcgaggccgg ccgccggcag ggtacgaaat tcgcggtcca tgtcatcgat gtcgaccgat     10920
     tcaagacggt gaacgacctg ttcggccatg ccgcgggcga ccggctgctg gtcgatctcg     10980
     ccacctgcct gcggcaggaa gcgcgggaaa gcgacatgat cgcccgcatc ggcggcgacg     11040
     aattcgtcgt cctgcagacc gggatcggcg atgcgcggga cgccggggcg ctggccgggc     11100
     ggctggtcgg ggcggtgagc gcgcggctcg ccgagaccgg cgcgcgcgcg ctggcggcga     11160
     cggtctcgat cggcatcgcg ctggcgccag atgacggcac gaccgccgag gccctgctct     11220
     cgcatgccga catggcgctc taccaggtga agtcgaccgg acggaacggc ttcgccttct     11280
     tcaacaccga gatcaacgag gcccagctcg cccgtcggcg gatggaggcg gaactgcgcg     11340
     gcgcctgcga gcgaggcgaa atggcggtgc actaccagcc cctgttcgag atcgcgtccg     11400
     accgggtcgt cgggttcgag gcgctggtac gctggcggtg gaacggcgag gagatctcgc     11460
     cggccacgtt catcccgatc gccgaggagt cgggcagtat catcgagatc ggccgcttcg     11520
     tgctgcgcga ggcgtgccgc gaggcggcgg gctggccggc gaagctgcgc gtcgccgtca     11580
     atatctcggc gctgcagatc caggacggcg ggctgcccga tcttgtcgcc accgtgctgg     11640
     aggagaccgg tctggaggcc gggcggctcg aactcgaggt gaccgagtcg ctgctgctcg     11700
     ccaatgccga ggcggcgacc gaggtgctcg cgcggatccg ggcgctcggg gtgacgatct     11760
     cgctcgacga tttcggcacc ggctattcct cgctggcgac gctgcggatg ttccccttcg     11820
     acaagatcaa gctcgaccgc tccttcgtca atgatctcgg acggctcggc gaggcggaag     11880
     cgatcgtgat ggcggtgctc gggctcggcc gcgcgctcga cgtctcggtg gtcgcggaag     11940
     gggtggaaac caaggaacag gccgccatgc tgcgagaggc aggatgctcg ctgctgcagg     12000
     gctacctgat cggccgaccg gcaccgatcg cccggttcag cgcggaggtc ggccgcgacg     12060
     ttacgagcag gatgacgaaa acaccgatac ctgcggattc gcctggttag gcaacccggg     12120
     ccagctagtg tcctgattct gtagtttctc cgatttggct tgagcgctgg cagaagcgct     12180
     ggatagcggc gaggatgttg tcggcggact tggtccagcg gaagggcttt gggatcggcg     12240
     ttatgagcgt cgatgaaggc gcggatatcg ctttccagct gctgggttga gcggtggacg     12300
     ccgcgtctga tctgcttttc ggtcaccaag gcgaagaagc gctcgacttg gttactccag     12360
     gatgctccgg tgggggtgaa gtggacatgc cagcgcgggc gcttggcgag ccaatcgcgg     12420
     atcggtttgg tcttgtgggt ggcgtagttg tccatcacca gatggacgtc gaggttgctc     12480
     ggcacgttgg cctcgatctg gtcgaggaac ttcctgaact cgctggaacg gtgcttgggg     12540
     tagcagcggc cgatgaccgc accggtggcg atgtcgagcg cggcgaacag cgaggttcgg     12600
     catgccgggt gtagtcgtgg gttcggcgct cgatctggcc ggggcgcatc ggcagcagtg     12660
     gttgcgtacg gtcaagcgcc tggatctgcg atttctcgtc gacacacagc accagcgccc     12720
     gttcaggcgg cgccatgtag aggccgacaa tgtcacggac cttctcgacg aagaggggat     12780
     cgttggagag cttgaacgtc tcgctccggt ggggttgcag gccgaaagcg caccagatgc     12840
     gatggatggt ggatggcacg tagccgaccg ccctggccat caaacggagc gaccagtgcg     12900
     tcgccccggg cggcgttgtc tccagcgtca ggcggatcgt ctcggcgatc tcgtcgtcac     12960
     cgatcggacc aacaaaaacg cgccataatt catgtgcaaa ctgcccctct tgcaggggga     13020
     tgaaaatcat gaaagccaag cacattggac tcattgtcag cctcttcacc ctagccatcg     13080
     ctggttctac atcgatcgcg atagcaggac cgccaccatg ggccggcggt cctcatggtc     13140
     ctccacctcc aggctggggc cacgcacccg gaccaccgcc ctgggcgcac ggcccgcaca     13200
     ggccttgggg atggtggtat ccaggccccc cccctccacc gcctgttgtg tattatgctc     13260
     ccccgccagt catatatgtg ccgccgccgc caccgcctcc tcctccgccg ccgccggtgg     13320
     tatatgcgcc accacctgta tacttcgggc cgccttcact atcctttggt gtaaccttcc     13380
     ctctccatta ggaaagtatc gacacggaca agatcagaac ataaaacgaa caaaggagtt     13440
     gctccctgaa gttccaggat aggtgatcac actatcgtta tgaaccggac cgttctccag     13500
     atcgatcttg aactcgatgc cgagcggcgg ctcctcgatg ccgccgtcgc tgaagcccgg     13560
     gccgatctcc ggccggctgt gccgcatgag caggtgcgag ccgatctcct gcgcgagatc     13620
     aagcggctga atctggcgat cgctggtcac tgagcatgca ggtcgaatgg catcagcttg     13680
     ccctggaaga tcgtgatgtc attgttgctt atctcgaact gctcaacccg aacgcagcct     13740
     caagcgttct gcgtggactg gtgctcgccg gcgacagcct ggcactgttt cccgcccggg     13800
     gccgcttggg cttggccgcc ggcacccggg aactggtggc ggtgtggccg tatctgatcg     13860
     tgtatgaggt cgatacgtca tccgatacgg tgcggattct ccgtatctgg tacgaagccc     13920
     aggatcgacc gtgatgaatg ccaaaaagaa aatggcggcc tttaaggccg ccaagttaag     13980
     agattgggag cgaacctcag cggagatcgc tttccgcttc acggtccgat atggcccggt     14040
     ttggcggggc tgcaatatgc atgttttgag aggtgatgtg gggcggcggc cagtctgccg     14100
     ccatgacacg agagcgtaat atcgccttga aatcagggct ggaaaacgca tgtcaaactc     14160
     cggacaaggc ttttgggttg cctttccaat cgtctcagcg tttagcgatc tgccactcag     14220
     cgaccccggc ccatggggtc gccattttct cgtctgcacc acaccagacg cgacactccc     14280
     cgcggcgaaa ggcgaccagg ggcagccagc aatcatgcga ctggtgaaag agccgagaga     14340
     aaggattcgt gcctgccatc ctggcgagct tgtggcgcgt tgatttgaca gtctatgggg     14400
     cgggctctgg agttcgccgg cggcctgtgc ggtgtctatg tgacgacttc gcggcgactt     14460
     gccaggaagt tccataatgc cgaatctggg acgcaatcat tccttcgaga cacgctccag     14520
     gtagatcgca ggaccatcag ccgtagattt tcgatttcat gacaagatat tttacatatc     14580
     atgaatattt tcatataaag atgatagata agttcgtccc tgacgtaagc gcaggcgtca     14640
     aaagcatctt tacgataggg catagtcgat gttgacatgg acaaggattg ggctccccca     14700
     acgggtcgcc attgtggccg tcatcagctt tggggctgcc acttttgcac aagctcactc     14760
     atttccgacg caaccccaaa ctgtttcagt gccgggcaca gtattggagt gccaccatca     14820
     gtatggtgca tcatatatgc atttttgtgt aaatcccacc aaagcaaatt ctccggaaaa     14880
     gagggatgct tgcctatccg gttgactccc atacctacta gatctagtgt tgggcatgga     14940
     tgtcctggcc cgtgaagacc tgccgttccc gcagtctctg ccggaattcc agcgtatttt     15000
     cccgaacgac gcggcctgtg ccgcctatct cgaaagcgcc cgctggaatg gagggttcgc     15060
     ctgcccaagg tgcggcgtcg ttggcgagcc gttccgtttc gaggcgcgcc cgggcgttct     15120
     gcgctgccgg gcctgtcgca aagacgtaag cctgatggct gggaccgtta tggaacgcag     15180
     tcacacgccg ctgtcgactt ggttctgggc ggcttacttg atcgccagcc agacgcccgg     15240
     aatgtcggcc gtccaatttc agcggcaact cggcctgtcg cgctacgaga ccgccttcgg     15300
     catccttcat aagctgcgcg ccgggatggt gcgccccgag cgcgacaaga ttggcgacac     15360
     gccgcaagaa cacgtcgaag tggatgaaac gtgggttgga ggacgaaccc gaggcgatgg     15420
     acggggtgtc catcacaagg ttctcgtcgc ctgtgccgtg gaggtgcgcc accggaaacc     15480
     gggaaccaag ctcgacaatc ggaaagacgg tcgctacgcg ggacgcgttc gtctcgctgt     15540
     tgtccccgac cgtagcgcca attcgctctg cggattcgtc gaaaacgccg ttgctcccgg     15600
     atcgctgatc gttaccgacg actggagcgg ctatgccggt ctcggaaggc gcgggttcga     15660
     ccaccatgca atcgccgaat gcggcgaccc ggaggtggca gaagaattcc tgccgatcgt     15720
     ccacttggtc tttaccaacc tgaagacctg gatcaacggc atccatcacg gggtcagcgc     15780
     caaacatcta caagcctacc tcaatgaatt cacgtttcgg ttcaaccggc gcctctatcc     15840
     cttcaacgcg ttccgctcgc tgctcggaat cgcgggtagg gcagccgcac caacctttga     15900
     cgagctttat tccggggaat ggacacaccc tacatttagt gggtgtgggt aacaaccgga     15960
     taggcaagga gggatgatta taaaaatgaa aaatccaaaa taaaaggatt ttttattgta     16020
     attggtccgg cgacacctct tgttggatct tgaaaaacat aaataaaaat ttccacaaac     16080
     ttattaaaca aatattcgag tgagaaaact caaagatgaa aaatgatttc aatatatata     16140
     aaaataaaaa atatgatcat caatatttaa tattcgtcat atcgtatgac caaaacataa     16200
     tagagaaatt taaatacaaa aagatttatc ttgcgccttt tttagttgga gacgacgaaa     16260
     ccatatttag tttattgttt gaaaaaaaag aaggcgaaat aaatttcgat atttgcatat     16320
     tttattcaga aaattattct tataatataa ttaaaatcat tccagagata aaattgataa     16380
     ctgacatccc gattttagct atatcaggat catatgatga gttatttgtt gtggatttac     16440
     ttaggatagg agcagacgac tgtgtcgtct cagcaatagg agcaatagat ctaaatctac     16500
     ggattgagaa actaattgaa aaaaatagaa gttctgcaga tcaccaaaac cataatattc     16560
     aaaacaatcc aataaacaaa aacaataata ataataataa taataaaatc tttgtttttg     16620
     aaaagtttta taaatatttt actccaagtg aggataaaat actaagcgaa ctcatagaaa     16680
     ataaggggaa agtcgttagc agggaatctc tgtctcttca tacaagagat tcatataaaa     16740
     acacatcaaa aagaacagtt gataatatca tttgtaggat tagaaaaaaa ttcgacatgc     16800
     tatccattaa caattacgtc ataaagactt atagctcttt aggatattcc ttcataggag     16860
     atccagataa attcttttat gatttagcaa ttaatattga aaaatatgaa aaaaccctgc     16920
     cagaaaatcg taattgatat agtttatgcg gagggaacgc acagtaaaca tcggatgcgt     16980
     ctgaatcttg gtgtgagttc agcaggcgca ggacagcgcc cgccgggcgc tggaatagag     17040
     gccccagagc atgagggcga tcgccacccc gtagattgca ccttcatggg tggcaatgaa     17100
     gccctggatc ggcagaccga gctgcccgac agccggtagt acagaggcga tggttgcaat     17160
     cgccagtggc aggatcgggg tacagcagag cagtgcaggc aaggttgcca gcaccgcgcc     17220
     cagcacggtg ccagtcggcc ccacccgtgc cccctgtcgg atgccgtaaa cgccgagcgt     17280
     caccgtcagc gcgagaagaa cggccatgat cagcgccaga acaaactggc ctggtgtcag     17340
     gaagcgaagc gagaccaatc cgacgacacc gcccgtgctg gtggcgggca gcagcatcgc     17400
     atagaacccg agcgccgcga caaacaggac catcgtcccg atcacggccc ggcgggagcc     17460
     cagggcgaat tgcaaggcgc gcggcaccat ctccacgcgc tgataaaagg cggcaatcat     17520
     gatccggtct ttggcttgat gaagcttgcg atcttgccga aggtggcgga gggcgtcgag     17580
     gaaaccacgg cgacgtgccc gtccggcgcg atcacctggt agacatcgac aaatttgtgc     17640
     ggattgtaga ggtcgaacaa cgccttcgtg tcgtctccga tcacgaaatg cgggtcgttc     17700
     agcagcttcg gtgccgcctg ctcgacaaac tggtgcatgc tcgggccaga atagccgcca     17760
     ttcttgtcgt cgcgcagcac gaggatcgtc atgtcagact tgtcgatctc cgcctgatgc     17820
     tgtgcgaagg tcctgagccc ggccttgcag cttggacacc aggtggtgac ctgccagacc     17880
     acgagcggat ggcccatata ggttttcaac tcgacgctct ttccgtcaac gatgaacggc     17940
     gcgttgggcg cagtcatgtc ctgcggcgcc ggcgcgctgg ttggccccat cttgcctgtg     18000
     gggccggcaa atgcggtcgc tgaagcaagg ccggtgaacg ccagtgcagc caatagcggt     18060
     ttcccgagcc gcaggaaccg agagtgaaag aggttgttgg tttttgtcat gcgcattctc     18120
     ctttcgtggt catgaatcca tcctcgttct gccgtgcctg actgttgcat cgcgttcacc     18180
     cggcgcagca ggagagttgc ttcacgtcct tggtaaaggt ctgtgccgca agcttgatcc     18240
     cctcgctcat caccagatag gggaacagcg tgtcgcccag ctcctgcacc gtcatccgat     18300
     gacggatggc gagtgccgca gtctggatca tttctccagc attgtgagcg aggatctgtg     18360
     cgccgatcag ccggttggtg ccggcttcgg caacgagctt cacgaagcct cgcgtgtcga     18420
     aattcgcgag tgctctgggc acgttttcca gatcgaggcg ccgcacgata gcttcgatgc     18480
     ctgccgttct cgcctgcccc tcgtccagtc cgaccgtcgc gaccgaaggg tcggtgaaga     18540
     tcaccgcggg gaccaccgag aggtcgaggc tggcgtcgcc gcccgtcatg ttgatcgcag     18600
     cccgcgttcc ggccgccgcg gcgacataga cgagctgcgg catcgtgctg caatcgcctg     18660
     ccgcgtagat attcgcggct gatgtccgca gatggtcgtc gaccacgatg gcgccgttgc     18720
     gatcggtagt gacaccggcc tgctcaaggc caagtcctcc agtcgtgggc cagcgtccgg     18780
     tagccaccag tagccgctcg gcttcgatgc gcccggtgcc aaacgccact atgaaacgac     18840
     cagcctcata ggcgacgttc tgaacccggg tctcgttgag aacacggatg ccctcggctt     18900
     caaacgcctc ctgtagcgcc gcgccaagtt cgggatcgtc gcgcgtgagc agggtgctgc     18960
     gggcgagcac ggtcacgtcg acgccgagac ggcgatatgc ctgggccagt tcgagagcca     19020
     cgaaggacga tccgatcacc gcgatgctgg tgggaagctc gtcagcaaac agggattcag     19080
     tcgaggtcca gtacggggtc tccgcgagcc ccgggaccgg cgggatcatc ggcgcggcac     19140
     cggtcgcgat gaggatgcga tccggagtct gccgcgttac ctttccagtg tgctcagtga     19200
     tcgtgagcgt gcgcgcatcc gcgaagcgtg cttcgccacg cagcagcgtg atccccggat     19260
     tgtcatcgat gatcttctgg tatttcgcac cacgcagcgc gtccacccgc ccgcgcaact     19320
     gggcaagcaa cacccgccgg tccaccggtt cttcgctgcg ggcgataccg tcgaacggat     19380
     ggtgcccacg ctcatgccgg atttcggcgg cccggagagt gatttttgag gacacgcatc     19440
     cagcattgac gcaggtgccg ccgatgacct cgcctcgctc gatcatggtc acccgggcgc     19500
     cggcatcaac cgcccggatg gcggccgcaa aggcagcgcc gccactgccg atgatggcga     19560
     tatgcagccc accgccgtgc ggggccgtcg tgccgcgcgt ggtgtcgtcg ttcagcgtct     19620
     ccatcccata gccatgcggc gcaagcgcag ctcgcagcgc cgcgaggtca agaccatcgg     19680
     cgccgtcgat ccgcgcggtc cggcgatcgt agttgacatc cgcccggacg tccggaaggc     19740
     tgttgagggc tttctcggct atgcgagcgc agtgctcgca ggtcatgccc gtcacgctca     19800
     gagtaagaga ggtcatgcca ggtctccgat ggttccggtg caattgatat tgtgtgcttc     19860
     caatgactgc tgatcctggt gtctgacgac caccgcagcg gcaggtgacg gcattgggtc     19920
     atccttgcgg gttatggccg caccgtgtct ggatggcggt gttactggct ggcgcaacat     19980
     ctgactccga tcggcgcaca gacccagcgc gcagagtcca agggcgcatg tgaccgcgca     20040
     gggcaggatc gtcaggatga taggcgcaac gccggccgcc accagccaac tccagcctcc     20100
     ggcggcaaga ccaccagcca cggcgagagt aaggccaccg atgatcgtca cgcgactggt     20160
     caataggcgc cgccagttga cccggacgcc ggtatccgaa cgattacaac atgcagccat     20220
     ggcccgaact ccttctgcag ccctggtgcg agccatagcg cgaatatccg cagcattccg     20280
     ataccaagac tgccccagga cacttttggc caccggcagg atcatcgccg gcccacccat     20340
     ggctgcgcgg ggcgcggaaa atatcacctg gtcggaaacg catgacccct ccaaatttat     20400
     ctcacgatgg tctagatagg ttctggagta actccagaat caagggcatg tcgtgggtaa     20460
     tgtgaatgac cgccaaattc gtgcctcggc tgctaggctg gatggtccgt tggagccgat     20520
     cggcaaggtt gcgcggcaaa tcggctgtgg catcgacacg atccgcttct atgaaaaaat     20580
     cggagttcta cgtcagccgc gacgcaccgg gagtggccgt cgggtttacg gccccgccga     20640
     aatcgcacgc ctcgccttca tctgccgggc acgggaactc ggcttctctc ttgacgaggt     20700
     gcgcggactg ctcgacctcg cggaggagaa agagcggccc tgcgaggatg ttaagcaggc     20760
     cgctgtccgt catcgccagg acgtacgacg caagatctcc gacttgcggg cggtcgaagc     20820
     cacgctcggc accctgatcc agcagtgcga agccgacggg ccagcggaat gcccgttgat     20880
     cgaggcatta tcgcagccga gcatcgtcgt gccccgtctt tgaaagcgtc acccggaaaa     20940
     tccattcaca accccaagcc aagcaacgcc acagaactga accacgccgg gatatgccgc     21000
     tggcgtggcc ggccgcggcc cgcggtcggg aagatcagcg ccacgtcagc cggatagacc     21060
     ttctgcttga acggaatccc cacggcccac cgcaaattgc gggcactcag cgcctggcga     21120
     aacggcgcac tcaggccata gccggtgtca gcgagcacac agccgaaccg cgcgccgccc     21180
     accctgatcc ggtcgatctg tcaatcgcga tctccgtctt cctacgaaat ccctggcgat     21240
     ccggcggcac tcgcgccttg ctcatgcgga ttggatcgct tgtccagctc tccggcagga     21300
     acaggcgcaa tccccggtgt cggtgtagcg cgacaatctg gggtgagaat acgccatcac     21360
     cgtccgggaa catattctcg tgaggcaata cgattctcac gctgattgtc gcgcggcagt     21420
     cgggccaatt acctcgatta ccatggccct gtctgcggta aacccggcaa atttcgagag     21480
     tggccgccac ttcgctgcgt ggctgggact gacgccacga gaacattcga caggtggaaa     21540
     acatcgcctt ggccggatca gcaatgcggg caatgagcgg ttgcgttagt tactggtcgt     21600
     cggcgcgatg ggggtgtttc gatacgccaa gccgggcagc aaatcagcaa atacctggct     21660
     gttgcaattg caggagcgcc ggccgcgcaa gatcgcggtg atcgctctgg ccaacaagat     21720
     cgcccggatc atctgggcga tgatggcgcg cggcgaggca taccggcggc agccggcagc     21780
     agcctgaccg cggccggtgc cagggaggca agagcgacag aagaagatgg tgattggtcg     21840
     aaccgacgaa tggcggcaat ccagcggggg tcaacggcag gtcgatgccg cagatttgtt     21900
     tggatgccat tcgcggaacc catctgggct ggcggtcatg aggccgcgcc aaaaagccgg     21960
     acacatgacc gcattcgtgc cgccgccaaa ttctcgcacc gtcgatcttg aatcccgggc     22020
     cgttccacac atgaccccct cgattgagag gagggacaga tggcgagcgg cgctgcctta     22080
     tcttgtcgaa cgcgatacgc cgttgggccg ctgggcgcgg ggattgctcg accgagcgca     22140
     taagaacgtg ggcgtagtcg cgctggccgc gaagctggct cggatcgcat gggctgtttt     22200
     ggcgcacggt tgcgattacg gcgcccaatt cgaagcggcg gctgcggcag catgacggaa     22260
     tcgcccgaac agcgctcgca gttgggcgcg aaagggcagt cgatgtctgc gtgaggtgaa     22320
     aggaagatgg cctgacagtc gaatggcggc ttgaaaccct gacccattga acggcctccg     22380
     aggccggtgt gattataagg atcaggccgc gcggatctcc atcttggccg ggttcgaagc     22440
     ccgagaccgg atacgttgaa gcagactgat tagagccaga tgaaattcac cccttgcgga     22500
     cggggcgggc catacgttca gttcgtttgc gaagacgaac ggagatacga tggactggag     22560
     gtcaaccggg cgagcgacaa tacgccgagt tactgcatct tcgtaggccg ggcggattat     22620
     gcgaagcgcc ggataatgcg gagtgtcggc cgctgaacgc cggcattcca tgctgctgcg     22680
     cctaatgctg cccgtcgatc cgccgagcca cgcgtcgccc gccttaaggt cgtgctccct     22740
     ttggtctatg ttgtctcttg gtctatgggt gagagcaacg actttggcgg acgagaacga     22800
     cctctcggcg gacatcgcgc gcgttcggcg tcggttgacc gatctcgatg ccgagcgcac     22860
     gaggctcaag gccgagttgg agacgctgga aaagaggcgg gcgtctgatc gccgaccggc     22920
     cgagcagccg ttccctggtg atgccgcggt caccaaccac tcgtcgtcgc tcgagaaggt     22980
     cgatttgttc cggcggttgt ttgccgggcg ccccgatgtc tttccggttc gatgggacaa     23040
     tagaaagacc gggcgttcag gatattcgcc ggcctgctcg aatgagtggg caaaggggat     23100
     ttgcggcaag ccggcggtga agtgcggaga gtgcccacat caggccttca tcgcaccctc     23160
     cgaggacgtg atcgaaagac acctgcgcgg cggtggcacc tccaccagcg gctttgtcgc     23220
     cggggtgtat ccattgctgc aggacgaaac ctgctggttc ctggccgcag acttcgacaa     23280
     ggaaagctgg gcggacgatg ccagggcatt gcaggacacc tgccacgcga aaggaattgc     23340
     cgccgctttg gaacggtcgc ggtcggggaa tggtggccat gtttggatct tcttctccga     23400
     gcctgtgccg gcaagggccg ccaggcagtt gggctcggcg ttgataacgg agacgatgga     23460
     aagccgcccc gagatcggtt tctcctccta cgatcggttc tttcccaacc aggacacgat     23520
     gcccatcggt ggctttggca atttgatcgc gttgccgctg caaagaaagg ctcgcgaatg     23580
     cggcaacagc gtgtttgtcg acaaggatct acagccttac gacgaccagt gggcgtacct     23640
     gtcatccctg cctagagtgc cggcagccac cgtcttccgg atcgcggacg aggcggaatc     23700
     gtcgggtcgt gtcctgggtg ttcgcatgcc ggtcgaagac aaatatgcgg aagagccatg     23760
     gaagatgtcg ccggcgcggc gcagcgagcc gcggcgcatc gaggctgcga taccgaaaac     23820
     cgtcaggatc gtggtcggcg atcaggttta catcgaccgg acggagcttc cgccggccct     23880
     gatcacgcag ttcattcgac tggcggcgtt ccagaacccg gaattctatc gtgcgcaggc     23940
     catgcggctg ccgacattcg gcaagccgcg gatcgtctcc tgtgccgagc tttatccgag     24000
     acatgtcgct ttgccccgcg gctgtctcga ggaggtgatc gatctcgcca agagccacgg     24060
     ggccgtcacc gagttggagg accgccgcga gagcggcacg ccacttcccg cgggcgtcgt     24120
     cttccagggc gagttgcagc ggccgcagtc gagggccttc gaggccctcg tcgcccacga     24180
     cgccggggtg cttgcggcaa cgaccgcctt tggcaagact gttgtcgcgg cggcgctcat     24240
     cgcccatcgc agccggaaca cgctgatcct cgtccaccgg cgcgaactgc tgaagcaatg     24300
     ggtggagcgt ctgcggactt tcttgaatat aggccgcaat cagatcggcg taatcggtgg     24360
     cggaaaacgg aagccgaccg gcatcatcga cgttgcgctc atccagagcc tggtccgcaa     24420
     cggggaagtt gcggacacag ttgccgatta tggccatctg atcgtcgatg aatgccatca     24480
     cctgtcggcg gcaagcttcg agcttgtcgc tcggcgatcg aaggcgcggt atgtggtggg     24540
     cttgtccgcg actgtggccc gcaaggacgg ccaccacccg atcatcttca tgcaatgcgg     24600
     ccccgtccgt catcgggtcg atgctagagt tcaagccgcc gaaggcggca tccgccaccg     24660
     ggtgcgcgat cgctcgacga cattcgagct gccgccgtcc ctggcgtcag tcgagcgtcc     24720
     gtcgatccct gcgatctacg cggcattggc tcaggacggc tcgcggaacg atctcatctt     24780
     cggcgacgtg ctgaagtcgc tcgaggcgaa gcgctcgcct gtcgttctga cggagcggaa     24840
     agatcatctt gatcggcttc ggcagcggtt ctcgccgttc gtgaagaacc tcgtcgtgct     24900
     gcgcggcggc atgtctgcgg gcgatcgcaa aatggccgaa gccgcaatgc gggtcccgga     24960
     cgatcaggag cgcctgatcc tcgcgaccgg ccgttacatc ggcgaaggct tcgacgacgc     25020
     ccgcctcgac acgttgttct tgacgatgcc gatcgcctgg aaggggacat tagcgcaata     25080
     tgtcggccgt ctccatcgcc agcatgctgg aaagcgggac gtccttgtcg tggactatgt     25140
     cgatcatgct gtgccggttc tcgctcggat ggccgtgaaa cgccgcgccg gctatcgcgc     25200
     cttgggctac atcatagagt agctgcgcct cgcggggatg cgagacgccg catggcggtc     25260
     agcgcgacca gataagttgg acacccgcaa gaaccccttc ggcttgggac actcatgcgg     25320
     gtttgaccag gctcgtccat cttgaaataa tgttcactac atcttacact aaatcagata     25380
     gtgtaaaagt tagtgagcaa tatgagcgcc aaacccgaag ccacattgcc aatcccggtg     25440
     cgccgtgccc tcaggaagct gggtgcggac atccgtgatg cgcgtcgccg tcggagaatt     25500
     ccgacgacga ccatggcgga gcgctcgctc atcagccgcg tgacgctcac caaggtcgag     25560
     aagggcgatc ccagcgtcag ctttggcatc tacgccactg tgctcttcgt cctcggcatg     25620
     accgagcgcc tggctgaact ggctgacccc aagcacgaca ccattggcct cagcctggag     25680
     gacgacctgc tgccgcagcg catccgcagc ccgaacaagc ccaagggaac cggctgatgg     25740
     accgcgagat ttttgtctac atagacctgc acggtgaacc cattctcgtc ggccgcctgt     25800
     ggtcgcgcgt gcgcaagggg cgggaaagcg cgtcgtttga gtacgacccg gcgtggcttg     25860
     cgcacccgga acgctttgcg ctggagccag ccttgacgct tgcgccgggg ccgttccaca     25920
     ctccgcccga aaaggcgcta tttggcgcga ttggtgattc cgcacccagg ggttacgcat     25980
     gaaagaagcc ggtgagcact tgctccatgt aacggttatc ccaggcggcc attttgcggc     26040
     gccccttgag actggccttt gatgcctgat ggcggcgaac gaggttgatt gcgatcttgc     26100
     gaagcaggga gaagttctgg acggcgttgc gatcccggat ccggcagtga tcttcgttga     26160
     aggtgacgtc gagcacccag tgtaggctgt tctcgatctg ccaatgttga cggatcgctt     26220
     tcgccaggat ttcgggttga tcgtcgctgc tggacaggaa gtagcggatt tcggcttcga     26280
     tcttgccgga tccgttgacg ccgcggatgg tttccacggc cagaacgctc ttcaaccccg     26340
     gccagtcgcg cagcggttcc agcgctacgg cgtccggaca gacgaacacc cggcgccgaa     26400
     caagacgacc atgaccatca tcgaattcgt catgcaccgg ccgatcaacg ggtgagcggc     26460
     tgaagcaggt ggttgcgcaa tactcctgca cggcgctgtg tttcttcccc tggtttgctt     26520
     tgagggtgac gagataatca gcaccccgct cgagaatttt ggacgcgatg gctcgctggc     26580
     accccatcgc gtccagcgtg acaatggcgc ccttgatgtc cagcacatcc agcaattccg     26640
     ggatcgcggt gatctcgttc gatttgtcgc cgacctgacg ctggccgagc accagccccc     26700
     gatcactcgc ccatgcactc acaacgtgaa gcgccgcctg gtcccggctg cgatcaaacg     26760
     agccgcggat cgttttcccg tcaatcgcca ccacttcccg gtccaaagtc gtcccgaatg     26820
     agcgcgccca cgcttcgaaa catgcctcga aacgcccggt atcgatcagc atgaacacac     26880
     gccggaaggt gtcgtgcgat ggaatgccgt tcggcagcgc caaaaacgtg cccagccatt     26940
     cctgcttgct acggccatac agtgccatat cctcccagct ttccgccccg gcaatcaccg     27000
     cgcacaccgc aatcaccaga atatcaatta gccggtgctc aaccttgccg ccgcagcggg     27060
     ggtcttccaa cgccgaaaat tcctccacaa gccgcctcac cgacatgcac gtctcccaat     27120
     ctcaaggaga ctccccgaat cacacccgat tccatgccgt caactatgcc cgaaattttc     27180
     atgcgtagcc cctgattccg cacccgaccg ttggggccgt gtgctcatgc gccgggctga     27240
     acgccgccgc gccgagcggg agaggcaggc accgcgcacg ctgtttgagg ctgacttttt     27300
     gctcctggtg gacgacgtgg cgcgtcaggg ggccttgcgg ttcagggccg agccggatgg     27360
     tcctttcctt gcgccggaag acagcatgcg gattccgccc ttgatagagt tgccccgtct     27420
     gctgtccgcc gtcgagcggg tttcgaacga ggaagaggac gacgaagacc tgcgcgtctt     27480
     gatcgttccc ggttcttcct taggcggagc gcgccccaag gcgtctgtgc gcgaccatga     27540
     cggccatctg gcactggcca agttcccgca caagcaggac gacatcaacg tcgtcctttg     27600
     ggagggggtt gccctgtctt tggcagagaa agctgggatt ggtgtgcccg aatggcgcat     27660
     cgagacgata ggcgagaagc ctgtcattct catccgccgc ttcgaccgca aaggggggct     27720
     gcgcgtcccg tttctgtccg ccatgagcat gttgggcgcg aacgacaacg aacaacattc     27780
     ctatctggag attgccgacg cgctgcggca gttcggggcc gcgacgaagg acgatctggc     27840
     ccaactctgg cgacggatcg tcttcagcgt cctcatatca aataccgacg accacctgcg     27900
     gaaccacggt ttcctgtacg gtagccacaa aggttggcga ctatcgcctg cctacgacct     27960
     caatcccgtc cccgtggaca ttcgcccgcg agtcctctcc acagcaatcg acatggatga     28020
     tcctacggct tccatcgagt tggcgctgga gatggccaac tactacggcc tgaaaccggt     28080
     agacgcaaag gccatcgccc agcaggtggc gcttgccgtc gccaaatggc gcggtgatgc     28140
     cgcgaagctg ggcatatcag cacgcgagat cgagcgcatg gcgtcagcct tcgagcatga     28200
     ggacgccagg aaggcgcaga cgccttcctg ctgacgccgg gacaggcata cgtcagggcc     28260
     acaatccggt ggagacaaag ggtcaatccg aagcggaaat caacaggcgg gccgtttcct     28320
     ggcgaaaact cccatctcac tccgccgccc ttctttcagc tcggcctgca gcccgtcgat     28380
     gatcgcctgc cggtcttccc tgtccttttc cgcctcggca ccctcattga ccgggacgat     28440
     gtagcgctgg gccgccttgc ccttgccaat ccagacctct tttacccaga gctgggtatc     28500
     gccatgctgg cgatcgagca ctagcgggac gatcgacacc aaatcctgtg gggagtgact     28560
     cacgatagtg cttccgcgac tcggacgctg tgattatggg atggctggct cacccctctc     28620
     gtggcgatcg ggtagtatcg ccgctggttt ggagagagga gcaggccgat ggatatcgtg     28680
     attctcggca tcgatcttgg caagaactct tgcagcatgg tgcgcatgga cgccgccggc     28740
     cggtcgttgc ggtcgaattc gcgcaagcct tcgcccggct gggcagccag gtaacgatcc     28800
     tggcgcgtca cacgctgctt ttccatgacg attcactgat cggcgagacc attgccgctg     28860
     ccttccgcgc cgaggggatc gaagtcctcg aacataccga ggccagccgg gttgactacc     28920
     ggaataacga attcatcctt gcgatcggga agggtgaacg actacctcac ctatgattct     28980
     gatgatgtcc accgactgag gttcatcagg cgggggcgcg cgctcggcta cctgatcgcg     29040
     acaatctgtc agcttctcgc actctggggt gacaccaacc ggccgagcgc ggatgtcaag     29100
     cggattgctc tggctcatcc ggaatccatg cgccgcaaga ttgccgaact cgtttctatg     29160
     gacagagcga tcgaacacct tgcagatttt tgcacgagcg atcatcagcg agattgtccg     29220
     atcctcgatg atctcaccag cgcatctctt ctacctgacg atggtgaacc ggggttatct     29280
     gatcgacgca atcattgctg gcttcggcgc cgtgccccac atccgcaacg cgaccgtcgc     29340
     acttgcgcat atttccttga attacacgac gatcttcaac atcctgttcc tggcggtatc     29400
     atcactcctt gcgcaacatg tccggtgcac cggacatgtt gcgcatgatg gtggcgctat     29460
     ccgaaggcca ggatcatcac catgaccata tctgaaccac ccaccgcctc cccccgcatg     29520
     caggaagcct tcgatcctgc gcccagacgc cctatgccgg acagcgacaa tcaaagagga     29580
     tactgggcgt ctccggcctg aagccggcga acgctacagt tatggtgcaa ggcaacaaac     29640
     ccaatccggc gcgagtgagg atcactctgg ccttcggcgc actcgggctg ttcgccgtgg     29700
     tcggcatcgc cgcgttcgcc gccggcttgt ccttccatgg gctgaccgcc tcgccggacg     29760
     caatcgtccg catcatccgc tcctggggcg catggggcgc gctcgccgcg atcgccctga     29820
     tgatcgcgca ttccttcctg ccgctgccag ccgaggtgat cgcggttgca aacggcataa     29880
     tcttcgggcc cgtctgggga accgtgatca cctggaccgg cgcgatgctc ggggcctggg     29940
     ccgccttcgg cctcgcgcgc ctcttcggcc gccccctcgt cgagacattc gtccccgcac     30000
     gatatcggca cacgctcgat gactgggcgg aaacgcgggg cgcgatgccg ctcctcatcc     30060
     tccgcctgat tccgatcgtc gcgttcaacc tgatcaacta cgcggtcggc ctcgcgcgta     30120
     tctcgtggtg gaccttcacc tggacgaccg gccttggaat cctccccatg accctgttga     30180
     tggtggtatt cggagatcgt ctggccagcg tttccggcga agcggggctg gtcgtcctcg     30240
     ccggtgtgct gctggcctgg ctcgcggtca agctactgcg gaagcgtctc ccactgcacc     30300
     ggccgggccg gagatcgccg gcccgcccac gctctggatc atgaagcttc ccgatgtatt     30360
     ggctcgccag taatgaacgc cgcaaagcgg gggcaattgg gttcgactgc acccgcgccc     30420
     gatatcgccg cgattattcc ccgccaggca aagtttggag tagttcatgg ggccggcgat     30480
     gaccacaaaa acggagcctt cgggatttgc tgggtcacct ctctgacacg atcgttcatg     30540
     cagcccggac gcacgcgcta ctggcgtatg gtctcgcctt cgtgctgacc gcggcggaag     30600
     cgtttcccgt catcggcgcg ctggtacctg gaaccgccat tattgtcgga ttgggcgctc     30660
     tcgtgccgac gggtgccctg catttctggc ctctggtggc ctggtccacg ggaggcgcca     30720
     tcctgggcga cgggctgccc ttctggtttg gctcccggtt ccggaaccag gcgacagggc     30780
     tctggccact gagcctgcat ccggatctgc tgccgcgagg caaggcattc ttcgagcgcc     30840
     atggcgggtc cgccgtcatc atcgcacgct tcacgccagg cgtgcgggcc gttgtgccca     30900
     ttgtggccgg agtcagcggg atgcgttcgc tccgctttta tgtgctcgac gtcgtttcag     30960
     cggtcatctg ggcgcccgcg catgtcggcg ccggggttct cgttggcgcc tcgttggcca     31020
     ttctgggcgt catggcaggc aggctcgagg ccctgctcat cggcttgatc gtcagcctcg     31080
     tgctcctgct ctggctggtt ccacggcttc tccgctttgt gattatggga tggcccgccc     31140
     ctctcgcggc gatcgggtag tatcgccgct ggtttggaga gaggagcaga ccgatggata     31200
     tcgtgattgt cggcatcgat cttggcaaga actcttgcag cgtggtgggc atggacgccg     31260
     ccggccgggt tgttttgagg cggagacttc ggcggggaac gttggaaagt ttcgttggcg     31320
     agcttgggtc gtgcattgtg gcaatggaag catgttgcgg cgctcatcac ctcgggcgga     31380
     ttttcgccgc gcggggccac gaggtgcggc tgatgtcgcc ggaatatgtc cgtccgtacg     31440
     tgaaggcgca gaagaacgat gatctcgacg cggaggcgat cgcagaggct gcgacgcggc     31500
     caacgatgcg tttcgtgccg gtgaagagcc aggaccaatc tgatctccag gctttgcacc     31560
     gagcccggga gcgcctggtc tcggaacgga cggcgctgat caatcacttg cgggcgttgc     31620
     tgctggagcg agggatcgtc gttccgcaag gccggaggaa actggaagcc gagcttgaga     31680
     cattggccga agatggcggt tttgccgcgt tgagcccgcg catccggacg ttgatcgaag     31740
     atcttcgggc ggaatggcgt tcactcgacc agaggatcac cggcttcgac gccgagttcg     31800
     ttcagttggc tcgtgacgac gtggctgtgc gacgtttgac caaaatccca ggaatgggaa     31860
     cgataaacgc tacggcgctg gcggcggcgg tcggcgaggc gcaggcattc aaacgtgggc     31920
     gggacatggc ggcgtggctg gggctcgttc cacggcaaat gacaacgggt ggaaaaccgc     31980
     gcctgctcgg catcagcaaa cgcggcaatc gttatttgcg gaagaacttg atccatggcg     32040
     cacgagcggc gctgccttat cttgtcgaac gcgatacacc gttgggccgc tgggcgcggg     32100
     gattgctcga tcgagcgcat aagaacgtgg tcgtagtcgc gctggccgcg aagctggctc     32160
     ggatcgcatg ggccgttttg gcgcacggtt gcgattacga cgcccaattc gaagcggcgg     32220
     ctgcggccgc atgacggaat cgcccgaaca gcgctcatag ttgggcgcga aagggcagtc     32280
     gatgtctgcg tgaggtgaaa ggaagatggc ctgacagtcg aacggcggct tgaaaacctg     32340
     acccagtgaa cggcctccga ggccggtgtg attatgagga tcaggccgcg cggatctcca     32400
     tcttggccgg gttcgaagcc cgagaccgga tacgttgaag cagactgatt agagccagat     32460
     gaaaatcacc ccttgcggac ggggcgggcc atacgttagc tggttggaaa gcaagcgcgg     32520
     gccagcgctt gcctgggccc acgccggcaa aggcaggatc cgcagtaatg tggcttccat     32580
     cctcgatccg gcacgggcgg aactgtccgg cctgatcacc ctcgccgggg ctcttgcggg     32640
     cagcctctgg cttttgctcg gcgttctgca ggatctgatc gccggagatc cgctggttta     32700
     tgccgatcac gcgatcctgc atttccttga gccctatcga agcggcatac cgatggaagc     32760
     ggcgatggca ttctctcggc ttggcagcgg cgcggtcacg gttgctgtcg cagcggtcgt     32820
     gctcgtctgg ctcgaccggc agagcgcgtg gcgtggtgcg gcctatggta ttgccgctgt     32880
     gattggtgcc tccctgttca ccgcggggct cgatcttgcc ctgcatcgcg cgccaccgtc     32940
     gccgattgcg cccggctgga gccttattcc gtttcccggc ggcgatcttg caacctcatg     33000
     cgcggtttat ggcatcctga ccgtcatcgc cggccgacgg ctcggcgcgc gcccacgtat     33060
     tgggctgatc acggcgacgg tccttttcgc tgcactgcag ctcggcagtc gggtctatct     33120
     cgggctggac tggttttcat ccgaactggc tgcgctgggc ttcgggttcg cgtgggctgc     33180
     cggtctcggc ctcgcctatg ttgcgcgtcc ggtcgaaccc gtggcaccct ggcgcctcgt     33240
     cgccattacg gcggctacgc tcgccaccgc cggtacggcg gcggtcgccc taaatcgcaa     33300
     tgccgatctg gcgcgccatg acgtggggcg catgagcacg acgatgacgt gccctgactg     33360
     gcttcaacac ggctggcaaa acctgccaac acgcagcctc ggcatgctcg gcagtttttc     33420
     cggctcactg acgatccagt ggattggccc ggccgacggg cttcggcacg ctctcgccca     33480
     gctcggctgg cgctcgtccg cgccctggac atttcgcaat gctcttgaat ttctagcccc     33540
     gcacgcaagc ccagccgaga tcccggcgct gccgcgctgg gatgacggcc gacgcgcaga     33600
     cctgataatg gttttcgtcg gacacggcct tgccgccgat caacggctgg tgctgcgcct     33660
     ctggaagacg agtgtatctg taaccatgcc gacaggatcg gtacggacgc tcaggatagg     33720
     ggagatcgag atgcagaggc tgcgaaggat ggtctcaacc ctgacaatcc ctgtctcgga     33780
     aggttccgct tataccgtcc tgcctcgaat cgcggcggca ttacctgcct cgcggctggt     33840
     gacgcgtgcc gccgatggcg ccaccgtcct gctcgccggt gatcgtgccg tggatacgga     33900
     gggatgcctg acgcagcacc gaggggacgg tgcgcaatga gggttcttat cgtcgaggac     33960
     gaggcgaaga ccgcagccta tctccgaaag ggtctcgaag agaacggctt cacgacggat     34020
     gtggctactg atggagagac ggggctccaa ttcgcccgcc acggcggcta cgatgccatt     34080
     atcctcgaca tcatgctgcc acggcgcgac ggcttcgaaa tcctcgccga aatccggcgg     34140
     cgcgacagcc ataccgccgt gcttctactc accgcgcggg accaggtgac agatcgcgtc     34200
     gccgggctgg aggccggggc cgacgattac ctcgtcaagc ccttcgcgtt ttccgagctg     34260
     cttgcccgtg tgcgcaccat cctgcggcga gggcacgcgc ggcaaccggc gctgatccag     34320
     atcgccgatc tcgagattga cctctcggga caccgggcaa cgcgagcggg tcaggcgctc     34380
     gatctgacgc cgaaggagtt ccgcctgctt tcgttgttgg cccgccgcgc gggcgatgtc     34440
     atctcgcgaa cggtcattgc cgaacaggtc tgggacatca atttcgattc tggcacgaac     34500
     gtcgtcgacg tccacatgta ccgcctccgc gccaagctgg acgacccgtt ctcccgccgc     34560
     ctgatccaca ccgttcgtgg tgtgggttac gtgctcgaag accgtggcgg ctgatcctga     34620
     agcgccgagc gctggcggat cgatgtccct gcggatgacc gcgtggtacg cagggacggc     34680
     gttcctgctc gtcctgctgg ccactagtct cctgacctgg tcgttcggcg cgcgcatcgc     34740
     caggcaggaa gaccgcacgc tgcacgtgct cgcacggatc gcccgcccgc tgggcggcgc     34800
     tgccgatccg tccgcgtcgc tggccattgc atcggcgctt gagcgagcgg gcaacacccg     34860
     cgagatccag ttccgcgtca tcggcccgca cggtcggatc acaatccagt caaatggcaa     34920
     tcatctgcct ctgccaccat cggtcggctt gccgaacgtt gccacgcttg atagcggcgg     34980
     gatggcgttt cgtgttctca cccagcccct gccgaacggc ttcatgctgc agatcgccat     35040
     cgccagcccc ggctcgcagg ccctcctgct ccgttaccgc gaaaccctta ccctggttct     35100
     tgcggtgtcg atcatcctct gcgccgtgct cggatatctc atcgcccgtt cgggcatgcg     35160
     cccgatcgag cgcattgccg aaacggccga aaatatccgc ctttcgaccc tccatgaacg     35220
     tctcgacgtc gcagggcttc ccgccgaact cgccgcgctc gccaacacgt tcaacctgat     35280
     gctggaccgg cttgagcaat ccttcctcca gctctcccaa ttctcggctg acctcgcgca     35340
     cgagctgcgc acgccgatca gcaatctgcg cggcgagctg gaagttgcgt tatcgaggcc     35400
     ccgctctgac gatacttatc gggaagtcct cggctccgca ctcgaggaat gcactcgcat     35460
     cagccgggtc atccagagcc tcctgttcct tgcccgcgcc gagatggtcg gggctccacc     35520
     cgccgttgaa gctcttgatc ttgccaccga gatcgcaacg gttctcgaat tctaccagcc     35580
     gatggcggcg gaggcggggc tgtcgctgac cgcccgcgtc cgcccgggac taccgatcag     35640
     gttcgaccgc attctcctcc agcaggcgct cggcaatctg gtggccaatg caatcgccca     35700
     taccggcacc ggcgggcaga tcaccatcga ggttgcggag gtgctggaac agctctccat     35760
     ccgcataaag gataccgggc aggggatcgc acccgagcat ctgccgcatg tgttcgaccg     35820
     gttctatcgc gccgatcccg cgcgttcgca tgtcggcggc aatctcgggc tcggcctcgc     35880
     cgtggttcgc gcgatcatgg acctgcacgg aggccgggtt tccattgaaa gcacgcaggg     35940
     tcagggcacc accgtatcgc tactggtggc agcgaccgcg cgttaatccc gaaacggtga     36000
     gcccaaactg acgaaatcgt cattctggcg tggtggaaac gtcattctcg ccggctaaag     36060
     cgcgaactca tttccgcttg aagccatgaa gaaaacgtcc cgacacctcc gtttcagacc     36120
     caaccgcgtc ggtgctcttg cgcttgcgac actgcttgcc ggctgtgcgc ggtatcagcc     36180
     ggcgccgttg catcccggta cttcggccac ggcactgctc ggccgccgtc tcgacgagcc     36240
     ggcgcttggc caattcctcg cggctatggg cgtgcatccg cgcggacact ggggattgcg     36300
     ggctctgacg ctcgttgccg tctatgagcg gccagatctg cgaatcagcg tcgccgccta     36360
     tgacgccgcg aaggcggcag tgacgacggc ccagcagatc ccgaacccca cgctttccct     36420
     cgcgcccagc ttcaacgcga ctcaagcctt cccgtcgcca atcaagatcg ggccggtcat     36480
     cagttttctc gtctccaatc tcggcgctcg cgaagctggc atcgccgccg cgcgggatcg     36540
     ccagcaagcc gcgcgaatac tcatcgctgc cgcggcatgg cgggaacgca gcaacgtccg     36600
     caacgcgctg ctcacactct ggctcgatga acggatcgcc aggatcaagg cgcgcgtcgc     36660
     cagctatgcc gcgacagcgt cccgcctcgt agcacagcgc gttacctctg gaatgcttgc     36720
     tgataccgtg ctcgccagca caaccgaggc ggcgaacaag gcaagctttg gcaccgctga     36780
     agcgcgggtc cagatcggaa tggaccgggc ccacttggcc gctgcgatcg gaatgccggc     36840
     ggcggcgctt cgaggtaagc acctttcatt caccgccttt gagcatccgt tgccgccggc     36900
     caatctcgcc gctcttacgc gcacggcgct ggtaaccagt ccatcagtcg tcgcggccta     36960
     caagaattat cgcgcggccg acgcttctct ccgcaaagcg atcgaccagc agtttccagg     37020
     ctttcgtatt ggccccgggt atcactacga tcagggcgcc agcaagttca tactcgccct     37080
     ctcgctgccg ctgccaattc tcaaccagaa tcaggacccg atcgccgagg cgcgtgcaag     37140
     gcgccagctt gcggcggccc tgttcgatcg ggcgcaggtg cgcgttctcc acgagatcga     37200
     cgcggccaag gccgctctgc aaggcagcgt aagcgttgcg cgcgcggcac ggcttcttct     37260
     cgcaaccgcc cgcgagcgcg aacgccaggc tattgaagct taccgcgccg gtgcgaccgg     37320
     ccagctgcgc atggtcgagg ccgaacagca ggcaactttg gtccgcgaac aggagctgac     37380
     cacggatgct cagcgattac gcgccctcgc agccgtggcc gacgcgctcc atcaccccat     37440
     tttccgggag agccactgat gaagcggcat ctgcaggcca tcgcggcaag cctgtcactt     37500
     gtttgcgccg cagctgtcgc gcatgccgcg gccctgcgca gcgtgacgat caatgcggcc     37560
     acgatgagca gcggcctcat caagacgagc gtcctgcgcc ttgagactaa acatcccagc     37620
     tccgcggctt acggcctggt gatcgatcct tccccgatta tcaccttgcg gcaccggatc     37680
     gtctcggcac acgcaaagct gacgctggac gatgcaaatc tcgcccgcgc ccagaagctt     37740
     tatcgctctg gaggtaacgt ctccaaggcc agcctgcagc agatccaggc taaaaccgcc     37800
     attgcgcaag cgcgtgtcga ggaattgctg gcccaggcga aaatgcgcta tggcgccgcc     37860
     ctcggaacgg caatcgccga taatggcccc tcgttcagga caatcaacgg cggaggttcg     37920
     cttgtctcgg ttgtgcaggc aggtgccaca cttgtatccc cgccggccgc atccgccaga     37980
     gcgccggatg gatctcgcgt catgctgcgc cctgtcggat ctgccggccg gatcccgaaa     38040
     ggcttgctgg ggcagacctt tttctacact ggccccgcac tgcccatcgg cgtaccgctc     38100
     gccatcacgc tccgcgcgcc cggcgttgtt accggctacg ccgtgcccgc ggccgcgctg     38160
     atctggcaca acaatggccc cttcatcttc gtccggatcg gcgccagccg tttcgcgatg     38220
     taccgtgtga ccagatcgca cccgctgtac cgttcgggca cgatctcggg cttcttcgtg     38280
     cccggcgcag acctgcctgc ccacccggcg atcgtgacgt cgggcgttgg attgctgaac     38340
     tcggcgctgg ccggcggtgg cgcatccgcc gcgaacaacg actgagacaa tcacatgctg     38400
     tctccgatcg tccgtgccgc cctgcgctac cgcctcgtcg tcgtgcttct ggtcgcgggc     38460
     ttcgcggccc tacaactcgc ccgcctgccc accgcccgct acgatgtctt ccccacattc     38520
     actgccccaa cagtcgtgat ccagacagcg gcgcctggct tcagtgcgct gcagaccgag     38580
     caggtggtca ccgatcgcct cgaacgcacc ctcaccggcc tgcccgggct cgcgaagatg     38640
     cgctcgtcct cggaatcggg cctgtctgtc atccatctcg tctttcacgg cggcaccgat     38700
     ccctatcaag acaggcagcg cgtcgccggg cgtctgagcg agcttggcgg ggtgctcccg     38760
     gccgggatcc tgccccgcct tgcgccgatg cagtcctcca ctggcaccgc cctcgaaatt     38820
     gggctctacg cccggcgcgg catgtccctc gaacgtctga ccgctatcgc cgaagccgga     38880
     ctacggcccg ccctgcaagc ggtgcccggc gttgcgaatg tcgtgatctt cggcgcacgc     38940
     ccgccacagc tgaatgtcga ggtccagccc cgatcgctca tcgccaccgg cttcaccatg     39000
     caggatgtgg cgcgtgccgc aaggcacggc agcgccgtgc tcggcgccgg cttcatcgac     39060
     aacggcaacc agcggttggt gctcgcccct cacggtcagg cacgcaccgc tgccgtcctc     39120
     gcgaagacct ggctcggcac aagcgacggc gcgccaatca gcctcggcga tgtggcaagc     39180
     gtccggttat cggcgccgcc ccgctacggc gcggcgctga tccacggtca ccccggcctg     39240
     ctgatgatcg tctcctcgct ctatggcgcg aacacgcttg cggtggccga ccaggcagcc     39300
     cgaacggtcg cgcggctgac gccgggcctt gaggcgcaag ggatcgagat tgatcccaga     39360
     gccttcacgc cggctacgtt cattcatgtc gcactggccg atctcggcca tgtgctgctg     39420
     atcggcgcgg cgctcatcct gcttgtcctg ctcatcgcgc tgcgcgactg gcgggcctca     39480
     gtcatctctt ttgtggctat cccggtctcg ctgcttgccg ccactgcgat catcacggcc     39540
     ctcgggatca cgctgaacac gatggcgctc gcggggcttg cgatcgcact cggcgaactc     39600
     gtcgatgatg cggtcgtcga tgtcgaaaac atcacccgcc gcctgcgcga gaaccgcatc     39660
     gccggcagcc cggaaccacc gctccgcgtc atcttcaggg catcgttgga agtgcgcagt     39720
     gctatcattt tcgccagcgc cgccgtcgcc atcgccttca ccccggtgat cgcactcggc     39780
     ggtgtcgcag gccggctctt cgcccccctc gggattgcct acattgctgc gatcggcgcg     39840
     tcactcgtcg tcgcgctggt ccttactccg gccctcgccg cgctgctcct ggttcggccc     39900
     accgcggcgg cggaccacac gccgccgatc gcactgctgc gcccggctta tcgccgcgct     39960
     ctcggcaggc tggaacatca cggacgtgcc ttcatcgccg ccgcgctcgc cctgatcctg     40020
     ctggccggta tcagtgtccc gctgctgcaa attcgattcc tgccgcgctt tcgagaaaac     40080
     gacgtcatcg tccattatct cgccgcacct ggcacgtcga tcgacgcgat gctcgccatt     40140
     ggcaggctcg cgatccacac gctcgagaac ctcccctcgg tcggggatgt cgtgatgcat     40200
     atcggccgcg cttcgatgag caacggccat gccggggtga acaaggccga gatcgacatc     40260
     acgctcagcg agaccggcaa ccgccacgtc gaacgatcga cgcggcagat cctggcgtcg     40320
     gtcgaccata tcgacggcct gtcctggtgg tcgcgcacat ttcttagcga gcgtgtcgat     40380
     gaaagccttt ccggcgtcac cgccccggta tccgtttcgg tatttggccc ctccctcgat     40440
     gcgatcgaca tcgcagcggc gcggatcgtg gcggcgtcac acggggtgcc tggcgtgcgc     40500
     gcagcaagca tggcggcagt ccagcaggtg cccgccctcg cgatcgacct gaaccgcgcg     40560
     gcgatgctgc gatacggcat tacccccggc gcggcgctcg aggcgatgaa gatcgcttat     40620
     tcaggcgcca ccgtcggcca tgtctatcgc ggtactctcg ttgagccgat cgttgtcacg     40680
     ctgcccgcag aactccgcca tcaaccggct gcaatcggcg acctcccggt cgcggcggca     40740
     ggcggcatga tcgtgcccct cgaccgtatc gcgacaattc gccagacacg ggttccggcg     40800
     cagatcctgc ataacgacgg ccgccgcgtt caggtcgtca ccgtccaggt cgcgcatggc     40860
     catgctgtcc cggtgatccg cagcctgcgc cagcggcttg ccaggcttcg gctgggcacg     40920
     ggggtttacg tccgctacgg cggcacggca gtcgccggcg gtaccgcgcg gcgcgagctt     40980
     gccatccacg ccgccatcgc gcttgccggc atcctgatcc tgatcgcgct cgccctgcgc     41040
     gaggcgcggg ccgttgtgct catgatggcg attatgccgg ttgccttctc cggtggcatc     41100
     acggcgacct gggccttcct tggtggccat ctcgaacttg gcgccatggt cggtctagca     41160
     acgctgttcg gcctcacgtt gcgcaacggc ctgctgctcc tgatccacat gcgccgactc     41220
     atggagggca gcggcaaacc atggtcagca gatgtcgcgc gacaggccgc ggccgaccgg     41280
     cttccggcga tcctgatcac cgcctgtgtg accgccctcg gcctgcttcc gctcgcactc     41340
     gctaccggct cccccggcga cgccattgag gggccgatgg ccatcgtcat cctcggcggc     41400
     ctcgcaaccg caacgatcct gacgctgttc gtccttccga tccttgcgcc gcgcgttctt     41460
     cgtctcgccg ccccgaagcc cgacggcctc ggttgacaag acctcaccgc gaaggtggga     41520
     gccgaacaac ctcgctcccc ttatcgtgga catgagccgc gacctgcgct ggcctagacc     41580
     tcgataccgt cgtagcggac ctccgtcatc atgcccgtca tcatgtgata gaggttgtgg     41640
     caatgcagcg cccagcgccc ggggttgtcg gcgtcgaagg cgatccgcac actgcccatc     41700
     atcggcgtca ccagcacggt gtcccgcacc gcaccattca acggccgacc gttcaccgcg     41760
     acgaccggga acgcatggcc atgcaggtgc atcgggtgag ccatcatcga atggtttacc     41820
     atctcgattt ccacgcgctg gcccttccgg agcatcagcg gcgtgatgtt cggccagaac     41880
     tccccattca gtgaccacga atagggcttc atgccgcccc cgaggacaat tcggtgcacg     41940
     aggtcgggct tgcgggcggc cagcggcgcg cgggcgacca gcctggtttc cagcgaattg     42000
     tcgaccggca gcatctggtc gagcccggtg tcctggatcc gtactacccg cgagcccggc     42060
     gttgccagca cgacaccggt ccgccggcgc gacccctcca gccgcgcgag aacggggaac     42120
     gctccggccc ccggcagatc gaccacgatg tccagccgct gcgcaatagc cagcggaaag     42180
     cggcgtccga caaccggcac caccggatgc ccgtcgaccg caaccacccg gccggtcaac     42240
     gcgccgagat cgatccagaa ctggctcgac gatgccgcgt taatgatcct gagccgcaca     42300
     cgtcccgacc gctcaacctg aatggtttca gggtcgtgca gggtacggtc atttgccagg     42360
     aacgcgtcgt agttgatgtc gttcaggtcc atcgacatcc cactcatcga catgccgctc     42420
     atcgacatgc cgctcatcga catgccgctc atcgacatcc ccatcccctt gccggcggcc     42480
     gtatgggcca ttccctgcat cggtcccatg cgattgccga cagtcatcgg ggccggcgca     42540
     gcattctccg tcgagcgggc catcgcgtga atcgccgagg gcgtctgccc ggtcaggccg     42600
     gctagcagcg cgtcgggcgc ggtgaagctg aaatcatgca gcatcaccac cacctcctgc     42660
     cggccctcgg ccagaacggc agcatcctgg acgatcagcg gggccgtcat gagactctgc     42720
     tcctgcaaac cctggtgcga atgcatccag taggtcccgg ggatcggcac gtaatcgtaa     42780
     gcgcgcgtcg ccgccggcgc gagtggcggg gtctgcggcc atggaaagcc gtcctgtgtc     42840
     cagggcggca actggccgtg ccagtgaatt atggtgtgat cggcggtccg gttcaaaagt     42900
     ttgacccgaa actgctcgcc cggcgccaag gtaagcccgg ggcggccggc ctgatcggtc     42960
     agacggaaga cccgcgccgc gcggggctat ggctgaaaat aggtgatgag gtttgagaag     43020
     gcggcgtatc gtggcgggtg tccaagcctg ccagaacctc cctgaggagc gatacgccta     43080
     tgaacgagaa tagcacgatc acctcctttc atcagcctgg ttcgatcatg gacccgttga     43140
     cggacattgc ccgtgagggc gcgcggcaga tgctgatggc agccctgaag gccgaggcgg     43200
     caagtttcgt cgcccagttc agcgaggaac tcttgcccga cggccggcag cgtgttgtcc     43260
     ggcacggcgc cggaccggaa cgggcggtgc agaccgggat cggaccggtc ccggtgcagc     43320
     ggccgaaggt gcgtgaccgc gcgccgggcg tgtcggcgga gacgaggatc cgcttcacct     43380
     cggcgatcct gccgcgctgg gcacgccgct cgaaaagcct cgatgccctg ttgcccgtgc     43440
     tgtatctgcg cggcgtctcc accggcgatt tccaggaggc gctgacggcg ttgctcgggg     43500
     cggacgcgcc gaacctgtcg ccggcggtga tttcccgcct cacggcaggc tggcaggagg     43560
     agtatgatcg ttggcagcgc cgcgatctct cggcgcgccg ctatgtctat gtctgggccg     43620
     acggcgtcta cctgcaggcc aggatggagc cgcaggccga gtgcatgctg gtgatcatcg     43680
     gggcgacacc ggaaggccgg aaggagcttc tgggctttca ggtcggcttc cgcgagagcg     43740
     cgcagagctg gcgcgaactg ctggtcgatc tcaaggcccg agggcttgcc gtgccgcccg     43800
     aactggccgt cggcgacggc gcccttgggt tctggaaggc gctggacgag gtgttccccg     43860
     gcacccgcca tcagcgctgc tggttccaca agatcgccaa cgtgctcaac cactttccga     43920
     aatccatgca gccagcggtg gcagccgacc tgcgcgaaat ctcgcacgct gaaacccgcg     43980
     ccgccgccct ggcggcgatc gacaccttca aggcgaaata tgccgccaag tatcagcgcg     44040
     gtgtcgcctg tctgaccaag gacaccgagg ttctgctggc cttctatgac tacccggccg     44100
     aacattggga gcatctgcgt acctcgaacc cgatcgagag cgtcttcgcc accgttcgtc     44160
     accgcacggt gcggaccaaa ggcgcgttat cgcagaagac cgccaagcta atggtcttca     44220
     ctttgattcg ggccgcttcg aagaaatggc gcaagctcaa cggcaccagc cagttgccac     44280
     gcgtcatcga aggcgtcaga ttcaacgacg gcgtcgcaca atccgacgcc acccagagcc     44340
     gcgccgcctg atcacgccgc gtcacccaaa ttccgccata gctccgccgc gcgcccgttc     44400
     acctcgaggc tacgcgttcc ggcaacgagg cgctgcccag cccgagcagc cgttgcggcc     44460
     cgggcaacag ccatgtcggc agcactcagg gtcagacttg cggccataag tccccgacgg     44520
     gttatcattg gcatttttgc atccttttct cgttgcggca gtgacaggcc gaaacagctc     44580
     gtggcgggcc ggagcaaaga cggtggttgg gaagacgtcg tcgcgatgcg ccggcaatcc     44640
     ccggattttc gggtcggaca tgatggcggt gaggcgccct ttgtgaacgc cggatcctaa     44700
     cgccacgcga tcgggcggcc ttgacgctcc agcgatgcgg gtgagcgctc tctacgttca     44760
     gcactcgatg ggacaacctg ccgccttcca ctcgggatac ccatcttcca gtcgtatcgc     44820
     ctcaatccca caggcgcgaa gcttcgccac cgcctcgaac gaaagaacgc agtaaggccc     44880
     ccggcaatag gcaacaaccg gcgaccgggc gacaagactg tccagcatcg cgtcaagctg     44940
     atcgagcgga atattgagcg cccccggcag atgcccgtga gcaaattcct ccgttggacg     45000
     gacatcgagg agtgtcacgc tgccgtcccg gaggcgttca agcagggtca agcgcgatac     45060
     gggctcgaga gaatcccgcg cccggaaata cgcctgcatc acctggtcga tttccgcgat     45120
     gttccgctcg cccactcgcc ccaggctggc cagcaacgtg accacctcgg tctcggagac     45180
     caggctgtag aacacgttct tgccctccct ccgcggcgcc gcaaggcggg cacggcgcaa     45240
     gacctgcagg tggcgggacg tgttcgagag cgacaggccg atccgttcgg caagatcctc     45300
     cacgctacgc tcgccctggg cgatcagttc gagaatttcg atcctgtgcg gatgtgcaag     45360
     tgccgcggcg atctcggcga gatggctgaa aatctgttgc tttggaccac tgcttgactt     45420
     catcaccgac tcattcaatc aatatcgcga atgataatgt gacagcgcgc tggcgacaag     45480
     atcgccgcgt cagccgggag ccaaacccat gatcctccga cagttcctgc acaccgaccc     45540
     cacggcggcc tcctatctgc tcggctgcgt cggcaagggc gccggcgtgg ttgtcgaccc     45600
     gctgtttccg atcgaacctt atctgcacgc cgcatcggcc tcggcgacgc cgatccgcct     45660
     tgtgatcgac acgcatctgc atgccgatca tcgctccgcc ggccgcgcgc tggccgaagc     45720
     ggccggtgcc gaatacgcca tccacgaatc agccgaggtg ggctatgctt gccgccgtct     45780
     tgtagacggc gaacggctcg aactcggcaa tgtcgtgctc gaggtgttgc acacgcccgg     45840
     ccacacgccg gagcatctct gcctcacggt gaccgaccgc acccgcgcgg atgagccatg     45900
     gagcgtgctc ggcggccaca cgctcatggt gggcgatgtc ggccggaccg agcttgcgac     45960
     cgacgccgcg cgcggcgcgc gcgacctgtt caccagtctc gtcaggctca aggcgttacc     46020
     cgaccatatc gaggtgctgc ccggtgctct ggccggctcg gtctgcggcc gcggtctctc     46080
     cggcaagccg gtatccacca tcggtttcga acggcgacac aaccccgcct ttcgcatcgg     46140
     cgatgccgac cgcttcgtcg ccttcatgct cgagaacatt ccgcccgcgc ccgagggggc     46200
     ggccgaactg cgcgcctgga atgcgggctt caccgcgtga ccatggtggc aaacgcctcg     46260
     gatcatatcc gcggcatcac ggccaatcgc ggccagttta ccctgcaggc gctgcaggtc     46320
     ttcttcgtcg gtcttgtcat cggtatggag cgagcggtcc tgccgaccct cgcgcacgag     46380
     ttcggcgtcg ctcccggtgc ctttcttttt ctcgcgagct tcgttctctc cttcggcctg     46440
     gtgaagggcg cgctcaacct tgtcgccggc gggcttgccg accggttcgg ccgcaaacct     46500
     gtcctcatcg ccggctggat cgccgccatt cccatcccgc tgctgatctg ggcggcaccc     46560
     aactggtggt ggatcgtgat cgcgaacgtg tttctcggta tcagccaggg cttcacctgg     46620
     acgatgacgg tgaccagcca gattgacctc gccggcagcc accagcgcgg gcttgccgtc     46680
     ggcatcaacg aagccacggg gtatgtggcc gtcggcctcg ccggtgcttg tgctgccttg     46740
     ctggccgagg cggtcggcgc gcgtgatgcc ctgctgattt tcggcatggc cacgattggt     46800
     ctggccttcg ccacgatcac ccgtgtgcgc gacacgcttg cctgggtgaa ggccgaacat     46860
     gccgaggccg gtgccggtgc ctcgcaggat catacgctca cgctgcgcgc gatcttcgtc     46920
     cgcatctctt tccgcgatcg ggtcgggcgg gcgatctgtc agggcggcat cgtcaacaag     46980
     atcgccgaca cactggtctg ggtgatgttc ccgctgttct tcaaggcaca tggtgcaagg     47040
     ctggtcgaaa tcggctggct gaccggcacc tacgccatgg tctggggcgt ctcgcagctc     47100
     tggactggcc atctgggtga ccgggtcggc cgccgcgccc cagtgatcgc cgggtttttt     47160
     ctcctcgccg ccggcatcgc gatcacggcg gccgggcgcg atgcgtcgct atggctgccg     47220
     ggggcgatcg tcatgggcgt tggcatggcg ctgctctacc cgaacctcat cgctgcgatg     47280
     tcggaccagg cagcgccgtt gatccgcggc aaggccctcg gcacttaccg ctactggcgc     47340
     gacaccggct acgcgctcgg cgccgtcgcg ctcggcctca tcgcgcagtt cgcccacgca     47400
     accctgccgg cgttgtggat cacggcggcc ctcgtggccg gctcgggcct ttggctcgcg     47460
     cgggatatgc cgcgcgccgc agaatagcgc cgcctcgctc agcgctcacg cgccgccggg     47520
     gcgacgacac gcaccgtcgc ggtcatgccg gcggcgagga gcatgctcgg cggcacatgg     47580
     tcgagcgtca cataaaccgg aatccgctga gacagccgca cccatgaata caccggatcg     47640
     acgcgcggca ggccgctgcg tgcatcctgc atgttggcat ctgcaacccc gcgtccgatc     47700
     ccctgcacat ggccatccag cacccggccg gggtcggaca tcagctcgat ccgggccggc     47760
     gcgcccggcc tgatctggtc gagctcggtc tcctcgaaat acgcggtcac ccagagttcg     47820
     ccagtatcga ccatcgtgat cgcgccgctg ccggcatggg cataatcgcc tgcatgggcg     47880
     gtgagattgg tgatcgtgcc gctcaccggc gcgcggacca ccgtgcgcgc gagatcgagc     47940
     gcagcctgcg caacccccgc ctcgtccgcc tgcacgcgtg cggcggcggc ccgtgcggcg     48000
     gcggcattgc cccgcgtctc cgccgaaacc gcgatcgagg gcagtcgcgc gcgccgcgcc     48060
     gcatccgccg ccttcatccc cgcgatcgcc cgatcggcgg cgagtgttgc cctcgccaca     48120
     gcgagacgat tggcgaaatc cgcaggatcg atcctgaaca ggacctgccc cttgcgcacg     48180
     cgttcattgt catgaaccgc aaccgcgacg atccggcccg aaatctccgg cgccaccgtc     48240
     acggcgaagg cgcggactcg cgcatcccgc gtccggggcg tggcgtcgta gcgatgtcag     48300
     gtggcaaagc cgagccagaa ccggcggtcg agctccacca tcgcaaaata aggcgatgcc     48360
     ttacgcagga tctcattcgc ctggcgtagc tcccggacct ctcgttccag agacttgatc     48420
     cgcttctggt cagcactcgt cggaccgggc cgtagcccct gatcgcgctc cgcccggcga     48480
     acccaccccc tcagcgccat ggatcaagtt cttgcgcaaa taacggcacg ccggccacgg     48540
     aatgcataga ccgcaccatc aaacgggttc ccgccaaaga cctgctggac catcatcgcc     48600
     agcccgtcca gccccttcct cgtgtccgtc cggccgcagg caagatagac ccggacaccc     48660
     gcacccggcg cgatcatgcg cccctcagca ccgccagcac ccggctcaat gccgcctggc     48720
     tcaccccggc gccgaaacgc aataccaccc cgtccggcag cgcgatctcg attgtctcca     48780
     tcgccgtcgg cgccgccaag cccaacgccg gcgcagtccc gcttaccacc gcccgcgcaa     48840
     agcccggcac caacggcgcc gcttcagcca gatccccctc gcctgagccg cgattgtccc     48900
     gcgcgcgggc tcaactgccc gtgcggcgga gcaggtagat atccatgatc cagccatgct     48960
     gcgcccgcgc ctcggcacgg cgggcaagga tgcgggggcc ggtctctgca aggaggccgg     49020
     cctcggtgag ctcttctgcc ataccgacat aggcgcccca ccagatcgag aggccttccg     49080
     gagcaaggtc ctggaacgcg caatcgccgt cgagcatgac aaggattgtg tcgacgccct     49140
     ctggccagcc accgtcacgc agccgccggc cggtggtgac agtgaaggga gtaccgatct     49200
     cgctcagcgg gataacatgg gccgcggcga gcgcctggat cgaggttatg ccggggatca     49260
     cctccgtccg cagcccaagc cgagcggcaa tgcgcaaggt gctgtcgtaa agcgaaggat     49320
     caccccagac gagcagcgcc acccttccat cgccgcccgg cagctccttg gtgatggccg     49380
     ctcgccaggc cttggcaatg gcgtcgtgcc aatcatccac ccgtctgcgg tagtcgggag     49440
     tagcggggtc gcgcaccggc tggttgaact ccaccatacg ggtcgcggga ttggtgatga     49500
     actcggcgca gatcgtgcgg cgcagttcgg cgaggtcggc cttgctctcc cccttgcagg     49560
     gaatgaggac gacatcggcc gcgttgagcg cgcggatcgc ctgaagtgtc agatgctccg     49620
     ggttgccggt gccgatcccg atcagcgaaa gagcgatcat gcctccgccg cctctgcaag     49680
     cggcccatag aggatcagcg ccggcgccgt tcccggatcg cccgacagcc gttcggccag     49740
     ttccgcaacg gtggtgcgga ccagctgctg ctcggcccgg cccacggcct cggccagaag     49800
     ggcgggggtg ccaggcggca atcctgcgcc ggtgagcatg gtgaggaacg ccgggaaggt     49860
     gcgcttgccc atgaagacca ccgtggtggc catcggatca gcgagcgccg cgaggttcag     49920
     atcctctgcc agcccgccgg tcacgtcatg tccggtgacg aattgcaccc gccgcgctgt     49980
     tatccgccgc gtcagcggta ttccggcggc agcggcggcg gcgcaggccg agggcacgcc     50040
     ggggatgatc tcgaacccga tcccagcgtc gcggagcgcg gtggtctcct cctccagtcg     50100
     cccgaagagc ccagcgtcgc cggatttcag ccgcacgacc ctggcgccgg tcttcgcata     50160
     atcgaccaga agccggctta cttgatcctg cttcggcgag gcgcgacccg cccgcttgcc     50220
     aactccgacc aggtccgcat cggcccgcgc atgggcaagg gcgggcccgg aggagagatc     50280
     gtcgaaaagg attgcatccg cagccgcgat acgcgccgcg gccttcagtg tcaggagctc     50340
     gggatcgccc ggtccagagg agacgaaaga aacgaaacca ttcatgacgt ccccccgatc     50400
     aggtggaaga aagagccgga gacattgccg cgccgcgacc cggtctctgc caccgtctgg     50460
     cccgccgcat cggcaaccgc cgccatcggc gcatcgggct gctcgacaac ccctgcgtag     50520
     tggaactcat gcccggcaat aacggcaccc ccgggcaggc caaggcaggg gccggcaagc     50580
     cgcgcccgcc tgtaacccag atgcatctgc cgcttggcga agctggtgac gaggcccaga     50640
     agccccgcca tctcgtgccg cgtgccctcg gcatcaacca gtcccgcgcc gagcgccatg     50700
     tagcccccgc attcgccatg aaccggccgg gtctccgcga aggctcgcag cgccgcccgg     50760
     aaccgcgcgg cggcagcaag gcggccggcg tgcagttcgg ggtatccgcc cggcagccag     50820
     caggcgtcgg caccagggtc aggcgcctca tcggcgagcg gagagaacgg caggatctcc     50880
     gccccctcag cgcgccagtc gtcaaggaga tgcggatagg tgaaggaaaa agctgcgtcc     50940
     cgggcgagcg cgatgcgctg gccgggcggc gggaggcgtg ttgcgacggg cgcgggcagg     51000
     acgcgcgcgg cggcggcgat atggatcgcc tccaagtcgc aatgttcggt gaccagcgcc     51060
     gccgcggcct ctatcagcgc ctcgagagcc ggatgctcgc cggcctggac gaggccgaga     51120
     tgccgctccg gcatggttat ggtcgcgacg cggggcaggg cgccgaggac gggcagcccc     51180
     gcctcggcca tgcccgcgcg gatcagggcc tcgtgccgcg ggcttgccac gcggttcagg     51240
     atcacgcctg cgatcggcag atccggccgg aaccgcgcga ggccgagcgc cacggcggct     51300
     gcggtctgtg cctgcccctt cgggtcgatc accatcagca ccggccagcc cgccagcgtc     51360
     gcgatatccg cgctcgcccc ggtccccgcc aagcccggct tcgcgacccc gtcgaaaagc     51420
     cccatggagc cctcggcaag gatcagatcc gcccccttgg cgcgcccaac ctccgccgcg     51480
     atccgccccg gcggcatcgc ccagctgtcg aggttgaccg aagcgcgccc cgctgctgcg     51540
     ctatggaagg ccggatcgat gtaatccgga ccggatttga acggctgaac cgccagcccc     51600
     gcgttggcaa aggcccgtgc cagccccagc atcaacgtcg tcttgccact gcccgacgct     51660
     ggggccgaga tcataagccc cggcaccggc cctgccacgg tggcgcgcgc gccactcact     51720
     cccgcccctc cgggaagcgc ggctcggatc cgacggggcg gtagcggcgg tcgtaatccc     51780
     cggcgtagag gcggctctcc gcgaagccct cggcggcgag tgtgcggccg acgaggatca     51840
     gcgcggtgcg gtcgatctcg gcggccatct gcgcctcgat ggtcgcaaga ctgcctcgca     51900
     gcacccgctc gtccggccaa gaagcgcgcc aaaccaccgc aacagggcaa tctgcgccgt     51960
     aatgcggggt cagttcctcc acgaccttcg aaaggacgtg gatcgacagg tggatggcca     52020
     gcgttgcgcc ggttacggcg aaggccgcga gcgtctcgcc tcccggcatc ggcgtcgccc     52080
     taccagaagt gcgggtgagc accacagact gcgccacgcc cggcagtgtg agctccgtcg     52140
     ccagcgtcgc ggcggcggct gcgaaggcag gcacgcccgg ggtcacgtcg aagggaatcg     52200
     caagcgcgcg caggcggcga agctgctccc ccatcgccga ccagacggag agatcgccgg     52260
     aatggaggcg tgccacgtcc tgccccgccg catgggcggc ggtgatctcg gctatgatct     52320
     cgtcgagcga gagtggcgcg gtgttcacga tccacgcgcc ttcagggcaa tgcgccaaca     52380
     ccacgggcgg caccagcgat ccagcataga gacagaccgg agaggccgcg atcaggtcgc     52440
     ggccgcggag cgtcaagagg tctggagcgc cggggccgac gcctatgaaa tgaacagtca     52500
     tactttggcc tcggtagtgg cgatggcggc ggttgcggtc ccgtctgcgg aagtcgcgcg     52560
     ggggccgaga aggcgggcgc cggggccggc agcggcgagc gccgcagcct ctgccaggct     52620
     tcctgtgccg tagcgggcgg cgacgcgggg ggatcgcgtg agcgtttcgg tgttcgcgag     52680
     cgtggcaagc ggcaccagcg tcaccgccag ccccagctcg gcggccagca caagaagtgg     52740
     cggcgcctcg gccttgtcgg cggcggtggc aaggctgctc agcgccccgc cgcccgctgc     52800
     agcgatggcc tcggccagcg ctgcgggcgt cgtcccgtcc cggaagccga gccccgccac     52860
     cctcatttca caacgctcca ttgcaccacc ggccgtgccg cgctccaccc ccgctttcgg     52920
     ccaaggggtt gcgcctcggc aagctcaatc cgcagcaggc tgccaccctt cgcggcggac     52980
     cattgggcca gcagcgcttc ggtttcaagc gttaccccgt tggcgacaag ccgtgcgcct     53040
     tcgggcagcc tcggccagag cgccgcaagc agcgtctccg tcgctccgcc gccgatgaag     53100
     acggcatcgg gcggcgcgag cccgtccagt ccttccggcg cgcgcgcctc ggtgacgcca     53160
     agccgcgcgc ccagcccgaa agactcggcg ttggcccggg cgcgagcggc gcgggttgga     53220
     tcggcctcca gccccgaggc gcgggtgccc ggcgcggcga gcagccattc gatggagatc     53280
     gagccggagc cgaggccgat atcccagaga tgctcgcccg gctttggcgc cagcgccgag     53340
     agtgtaagcg cgcggaccgg gcgcttggtg atctggccgt catgggcgaa aagcgcgtct     53400
     ggcaggcccg acgcgcgggg gagggcggga ccgcccgccg cctccagcgc caccgcgacc     53460
     ggcggcccgc ccggggcggc cgacgggacg gggcgggcgg cgagagcgtc ggccgtcatc     53520
     acctcgatcc gctcgcgcgg gccgccgagc gctttcagcc gccagagccg cgaggccccg     53580
     aaaccctgcg aggcgagcca ttgggcaaaa gccggtgccg ccgccccgtc gcgcagcagg     53640
     cacagaagcc gtgccccggg ggcgagatgc cgccgcgcct ccgcgaatag ggcagcgtgg     53700
     agggcgagag ttgtgacctc ctcctgccgc cagccgagcc tggcggtcac gagcgcgagt     53760
     gtcgaaggcg ccggaaaggc ccgccagtct ccgggggaga ggtggcgcga aaggctccct     53820
     ccggccccat gccagaacgg gtcgcccgag gcgagcaccg ccacccgccg cccggcatgc     53880
     gccagaacgg gagccacgga gaagggcacc ggccatgcct gaccgcgctc gtccacgccc     53940
     tctgccaccc cggcaagtgc gaggtgacgc ggcccaccaa agaccacttc ggccgcctcc     54000
     agagccgcca gcgcggcggg aaccagcccc tcgcgcccgt cctcaccgat gccgatgatc     54060
     gaaagccagg gttcagccat gcacgccccc gcttgcgatg cgcgcgcgtt cacgacagga     54120
     gagggggaag acggaaggag acaggcgatg cgggtcctgc tgctcggtgg caccagcgag     54180
     gcgagcgcgc tcgcccgcgc cctggcggag gccggggtgg atgcggtctt ctcctatgcc     54240
     ggccgcaccg gggcaccggt agcccagccg ctgccacagc gcatcggtgg cttcggcggc     54300
     gttgcggggc tggtgaactg gctgacggcg gagcgcatca cccacatgat cgatgccacc     54360
     catcccttcg cggcacagat gagcgcccat gccgtcgctg ctgcggccga gaccggcgtg     54420
     gcgcttctgg ccttcgaacg cccgccctgg cgcgcgggcg cggaagaccg ctggacccat     54480
     gtgccggaca ccgctgccgc catcgccgcg ttgccgtggg ccccgaggcg gatcttcgtc     54540
     gccattggca ggcagggcct ttccgccttc gccgcggccc cgcaacacca ttatctcctg     54600
     cgcctcgtgg atccgcccga ggtgcccttg cccctgccgg atgccgaggc cgtcgtcgcc     54660
     cgtggcccct tctccgcggc gggcgaccgg gcgctgctgg agtctcatcg catcgaactg     54720
     atcctcgcaa agaacgccgg cggcagcggc gcgcgcgcca aactcgacgc cgcccgggcg     54780
     ctcggtcttc cggtaatcct gatcgaccgc ccggaagttc ccgaccggcc agtcgccgtg     54840
     agcatcgccg aggtgatggc ctggatcttt cattccacct gccctgaacc ctgagcgcgc     54900
     gcgctttcgg acggcgaacc ggtgcccgct tcgccaggga acatgcgcgg cgtatagacg     54960
     aaccgcccca cccgccgcgt ggcggaattg cccatcagga ctaccgtccg catgtcggcc     55020
     atctccggcg ttgcctctac cagggttacc gtgttgatcc gctcctcgag ggtgctcacg     55080
     gcccgggcga aggtgatcag ctgatgggcc ccgcattcct cgcgcaggat ctcaagcgcg     55140
     cgggcgaagc cttcgggcct gcctctggaa cgggggttgt agaaggccat ggcgaaatcc     55200
     gcctgtgctg cgagccgcag acgccgctcg atcaccaccc acggcttgag gttgtccgac     55260
     aggttgatcg cgcagaaatc atgccccagc ggcgccccgg cacgggcagc agcggccagc     55320
     atcgcggtga tcccgggaag cacgcggatg tcaagctcct gccactccgg cgcgccttcc     55380
     agcgcctgga acacggccga ggccatggcg aagacccccg gatcgccgga ggagaccacg     55440
     acgacgcgcg cgcccgcagc tgccatctcc agcgcatggc gggcccggtc gagctctacc     55500
     cggttgtcgg acggatgcag cgtcagcccc gcgcgcggcg cgacgcgagc gatataaggg     55560
     atgtagccca ccacatgggt cgcctctgcc agcgcggcct ctacctctgg cgtcaccagc     55620
     gcggcgtccc cgggaccgag cccggcgatg gcgagccaac cactcatgcg tcgatctccg     55680
     gtcgccggcc ctggccgtgg acgaggacga tagcgaaata ggggtagtcg ccctccggaa     55740
     gatcggcgag gcgggcgacg cgctcgtcgg ccatcgtgcc gcgctccaca agccaggcat     55800
     ccgccagccg cccggcctct gccagcgcac ggcgaacctt cggcagattg cggccggtct     55860
     tcatcaccac aagcgcctcc gcctcccgca tctgcgccac aagccgtgcc tcgggcaagg     55920
     ttccgggcaa gacgcagagg atatcgtcgc cccaggtgat cggcacgccg gttgccgtcc     55980
     agcagcccga catgccggtg atgccgggga tgacctccac cggcacccgg cccttcaggc     56040
     gagtatagag atgcatgaag gagccgtaga agaatgggtc gccctcacag aggaccacga     56100
     cctcctcggt ctcggccagc tgggcaaggt ggtcggccca gaggtcgtag aaccgtgcca     56160
     gcgtctcggt gtattccagg ctgtcgaagg cgatctcagt cgtgaccggg tattccatcg     56220
     catgttcgat tgagccaggg gcgagcatcc cctcgacgat gcggcgcgcc tgcccggcgt     56280
     ggccggcctt gcggaagaag gctatgtgac gggcaccgcg gatcgcacgg tcggccttaa     56340
     cgctcatcag ttccgggtcg ccggggccaa gcccggcgca gagaatgcgg cccatgctca     56400
     ttctttccgg ctggcaagcg cgttgatcgc ggcgacggtg acggcggacc cgccgagccg     56460
     ccccatgacg gccatcgacg acaccggcgg cgcctccatc agtgcggcct tcgactcggc     56520
     ggcaccgaca aatcccaccg ggcaaccgat tatcgcggcc gggcgcgggc agccgggatc     56580
     ttccagcatg ttcagcaggt ggaaaagcgc cgtcggcgca ttgccgatag ccaccaccgc     56640
     gcccgcgagc cgtggccgcc aaagctccag cgcggcggcg gagcgcgtgg tggaaaggtg     56700
     ctgcgccagt gccggcacct tagggtcgtg gagcgtgcag aggatctcgt tctccgccgg     56760
     cagccgcgac cgggtgatcc cctcgctgac catacgcgca tcgcagagga tcggcgcacc     56820
     ggccatgagg gcggtccggg cggcctcggc caggcccggg gtgaaggcga cgctcgcctc     56880
     cagcccgacg aaaccgagcg catggatcat gcgcacaacg accggttcct cctccggcgt     56940
     gaagcgggcg aggtcggcct cggtgcggat ggtggcgaag gactgccggt atatcgcggc     57000
     gccgtcggtc tcgtaggcgt ggggcatcag ggggcaccga atgggtaagg ggtggcgaga     57060
     agtgccgcgg gcgagagagc ggggcgaagg ggcggggcac cggcggaggc gtcgcgggca     57120
     agatcgaagc ccttgggcgt ggcggtcaga accaggccgc agggcccggg atgggcgcag     57180
     cccttggcgc agccagagac atggaggctc tgcccggccg ccagcttggg cgcaagagcc     57240
     cgggcgagcg ctcgggtctc ggcgagcgcc tgcggacagc cgagccgccc ggtgcaggca     57300
     tggacgcgca gcaacggatc ctcaggatag gccagaatcc cggaaagcgc aggcagcgcc     57360
     cgcaggccgg gcataaatac gccccgccag ggcgtcagcc gaatctcggc gctcaggtcc     57420
     gcgagggccg agagcgtctg tgcaggcatc agcccgaatg ctacgatggc gagttgcccg     57480
     tcgccgaccg gccctggttt tggcagcgca gcaggtaggg caggggcaac gttgcaaccc     57540
     cctggcaggt cgtgcttgcc aataagatgc ttgcgcatcc ggccgcggcc gttccggaca     57600
     cctccagtct ccaggaacca gccgatcagc ttcgtcagaa tagccggtag cgtctcggcc     57660
     gtcacaggcc agcccgtggc cgagccatcg gggcgcagca ctagccgacc gtccgccgcc     57720
     cgttccagcc ggagatcggc ggcggtcccc gccagcaccg gcgcagagcc gatatcgagc     57780
     gttgcgccga atttcgaggg caggggcgcg gcgcggagcg cctcggtcag gatgttcgcc     57840
     aggctcgtaa tctctgccgc ctctcgatag aaaggcgcga tggcgatggc gcgcgcgcgc     57900
     tcggtttccg ggtcggggtc gaccagcccg tgggccgcca gctccgccag cagtgccgcg     57960
     tggtccgcct cggccacgcc acggatctgt aggttggcgc gcgaggtcag ctccacttcc     58020
     cccgatccga atcgtaccgc cgccgctgct accgcccgcg cctgtgccga gctgaggcgg     58080
     cccagcggcg ggcgcaaccg caccacaagc ccatcggccg aggccatcgg cgtcagcgca     58140
     ccagggcacc agccgcggat ttcgggctcg ctcatgcccg accctccagc gccgcggcga     58200
     tggagttgcg ctgggtgatc cagagtcccg catcacggag tgcggcgaat gtctcgttca     58260
     tccgggccag cgccgccggg ttttcccggg ctaggaactc agccacctcg atccgcccca     58320
     gcgtcgcctc gtgatagagg tcgaagagat gcggcgggac ggcgcgggca agatgggcga     58380
     aggcagcgag gtggtcgagc gtcgctgcga tctccgcccc gccgcggaag ccgtggcgca     58440
     tcatcccctc ggcccaggct gggttggcgg cgcgggcccg catgacgcgc gcgatctctt     58500
     ccgaaagcgc cctcgcgcgc ggcgcctccg ggttggtcgc gtcgaggtgg tagagcgccg     58560
     gggccggccg gccgagccgc gcggcggcgg cggcgattcc ggcttcatgg gcagcaaaat     58620
     cctcggccag cagcaggtcc gtctccggca gatcctggga gtggacgaag gcatcggcgg     58680
     tacccacgcg ggcctccagc gccgaacggg cctcgcggct tgccccatcc gcgccgatcg     58740
     cccaggcgga agctgccagc catgcctcac ccgccgccgc acgcgcggca tcgctaaaat     58800
     cgatgggatc tgcggcgatg ccgaggccat aggccccggg cttcggcccg aagacgcgag     58860
     ggctgagtgc ggcatatggg ttttcagccg gatcctcctc gcgatccgcc agcgccgcgg     58920
     cgcccgcctc gaagagctgg gcgaggccgg ggaatatgtc gcggaagagg cccgagacgc     58980
     ggagcgttac gtcgatccgc gggcgaccga gcagcgctgg cgggatcacc tcgaatcccg     59040
     agacgcgagt ggagccttcg tcccagaccg gcgcaaggcc ggcaagatgc agcgccatgg     59100
     cgaaatcctc gcccgccgtc cgcatcgtgg cagaccccca gaggtctacg atcagccccc     59160
     gcggccagtc gccctggtcc tgcaaatggc ggcggatcag ctcctcggcg agcttcacgc     59220
     cctgcgcatg ggcggcccgc gtcggcactg cgcgcggatc gacggcgaag aggttgcgcc     59280
     cggtgggcag cacatccgac cgcccacgtg caggagagcc ggagggccct gacgctaccc     59340
     ggcggccgtc gagcgcggca agaagcccgg tgcgctcctc gatcccgcag gcgccgcgcc     59400
     cgaagacgtg gagcccctcg ccgaaccggc tttccttcag atcacagacg aaacggtcga     59460
     tccgggtgat cgcctccgct gcactggcgc cgggcggtag cgctaggtca tcctcaaccc     59520
     cctgcgcgcg cgcttcctct cgaatcgcgg cgaccagccg gctccgcctc gccgggtcga     59580
     gcccttcggc ggtggaatat tcgtcgagca ggctctccag ccgtgcgagc ccctcaggca     59640
     gtgtggatcc gacgagtggc ggcggaaggt ggcccaaggt caccgcgccg agccgccgct     59700
     tggcctgcgc cgcctcgccg gggtcattga cgatgaacgg gtaaattaca ggcatcgcgc     59760
     cggtaagcgc ctctggccag caatcggccg agagcgcgac cgacttgccc ggcagccatt     59820
     ccagcgtccc gtgagcgccg atatgcacga gcgccgccag ccgccgggcg cgcagccaca     59880
     gatagaaagc gacataggcg tgccgcggtg tggaggcgag gtcgtggtag ctcgcctccc     59940
     gcccggcgcg gtgcccacgc tcgggttgca gtgcgacgag catgcggcca agcgcgaagg     60000
     ctgcgaagtg gaagacgccg tcgcgcaccg ccggatcctc ttccggagcg ccccaggcct     60060
     cgttgagttg ctcgcgcaac gcctcgggca gggtggtaag cgcgacgcgg taatcggcga     60120
     gcggccaggc cagcgtctcg gcccccagcc gcgctgccag cccggcctcg gggccagtca     60180
     cgtagcccgc cgcagcgaga tcggagagga tcgcctcggc cgaggccaag gcatcgagcc     60240
     cgacggcatg ggccatctga tgcgcccggc cggggtaggt ggagaggatc aacgccagct     60300
     cccgctccgc tgccggggtg gcggccagcc gctgccagcc ccctacccgg gcggcggcgc     60360
     gggccacctg ctcgggctcg gcccgatgta cgaagcgcga atattgcagc gcgtcatcgc     60420
     gcggtgtcgc cgccttgaag ctgacggccc ctgcgaagag ccgtccgtcc acctccggca     60480
     acaccacatg catggcgagg tcggccggcg acagcccgcg atccgaacct gcccagtcac     60540
     gccgctgcgc ggtcgagagt gcgacctgga ataccggcgc ccccggcccg tcgagcggcg     60600
     agcgcccctc cgccccctgc gccgagaagg ccgtcgcatt gacgatgaca gcgggcggat     60660
     gcgcggccag cagctcggaa acgagcggcg cggcgctcgg ggccttcagc gagggcgcga     60720
     aaaggccgta agcggcaaag ccttccgcct ccagagcccc gatcagcgca tcgatcgcac     60780
     cgagatccgc cgccgtcaga taggcgcggt agaacgtgac cgccgccgct ggccgcggat     60840
     cctccggcag tgcggccacg acaccccgcc cgggcaggta tagcccgacc tccggcatcg     60900
     tcttcgcgcc tgcgaccggc ccggcataga gtccggcggc aagcgagagc tgcgccagtg     60960
     ccgcctgcgc ggcaaccgcc cctccggcat cgcacagggc cgaaagccgg cgcagggtgg     61020
     agacgggcag cgtcgaatag gcatcgagtg ccggatcctc gcgcccgtcg gcgggcagca     61080
     cggcgagcgc caacccctgc cgttgggaaa ggtcgcgcag ggtcgagagg ccataactcc     61140
     agtaggcctc gccgccgatg agccggacca gcatcgcctt ggcgccggcc agggtacgct     61200
     cggcataggt gtcaaccgac aacggatggc gcagcgccac taggttggcg agtcgtagcg     61260
     tgggaagggt gctacccgcc tcccgcgcgc ggtgccagcc cgccgcgaag gcgccaaggt     61320
     cactgtcgga aaacgagagc accacaagat cggccggatc ctggccgaga tcttgcgggg     61380
     tctcggtctc ctctagtcca tgactctcgc ggaagatgac atgcacggcg cgcgcacgcc     61440
     ctcaagcgcc gagcgcggtt cggatgcgcg cggcatcgac atcgccgcgc tccgcgatca     61500
     ccaccagttg ggagccacgg ggcaggctgc cccagggccg gtcgaactgg ctgcgcaccc     61560
     gcgcacctac cgcttgaacc agaagccgca tgggcttgtc ggccagcgcg acatagcctt     61620
     tcacgcgcag gatattctgc tcggctgcca gcttttcgat cgcgacctcc agcgcctcct     61680
     ggcttgcctg ttccggcaga tcgacgacga tcgtatcgaa gtcgttatgc tcgtgatcgt     61740
     ccgccccatc gtgatgcgag gggcgggcgg cgaggtcgtc ctccgcagcc gcattgagac     61800
     cgaggatgac ggccgggtcg accttgccat cgcgcaccgt gaccatcggg atgcggcgcg     61860
     gcgcctcggc ttcgatcgcg gcgcgggcga cggcgatgcc ggcttcgccg gcgagatcgg     61920
     ccttggtcag caggatcagg tcggcgcagg cgatctggtc ctcgaagacc tcgcccagcg     61980
     gcgtgtcgtg atcgaggctg tcgtcggcct cgcgctgggc cagcaccgca ttcgggtccg     62040
     gcgcgaagcg gccggcggcc acggcctcgg cgtcggccag cgcgataacg ccgtccacgg     62100
     tgatgcgcga gcggatggcg ggccagtcga aggccttcaa aagcggcttc ggcagggcga     62160
     gaccggaagt ctcaatcagt atatggtcgg gccgcttcgg tagggcgagg atcgcctcca     62220
     tcgtcggcag gaactcgtcg gcgacggtgc agcagatgca gccatttgcg agttccacga     62280
     tgttctccac tgggcagctc tcattggcgc agcttttcag aatctcgccg tccaccccct     62340
     ggctgccgaa ttcgttgacc agcacggcga ggcgacggcc acccggattg gccataaggt     62400
     ggcgaatcag cgtggtcttg ccggcgccga gaaagccggt gacgacggtg acgggtatct     62460
     tggcgaggtc gttcatggcg cgggttcctg cggggggatt cttgcgatgg attgcttgcg     62520
     gaagatcacg ggccgctcgc gccagggtac gaggccgttc ggcgcgcggg cataggctgc     62580
     ggcgcccccg aggatgtcgg gcgcatcctc gggggccagc cggccgtaga tataactcca     62640
     ccgccctggg gcggagagcg cgacggcggc gccggtattg caggcagaca ggcactcgac     62700
     cgggcggatc gtgacgccct cggggcagtc cccggcctga agcgcggcta gcaggcgcgc     62760
     gccgaggcag ggcatcccct ccaccggctc ttgcccggcg cggcaggtga tgcagacatg     62820
     gagcgtcgtg cccatcgggt cctctcggtt ggcggcggcc ctgggggcat gcgagacgag     62880
     gacgggccag aatgccacac caccgtcggt cgcagcgcac cccggccgcc cggtcagttt     62940
     tgctgctggc aggtctcccg gctaacggat ataagcctct cggccctgcg gacgcccgcc     63000
     ttcccggtcc gcggaccagt ggcatcgggc gacctctccg gtcacggtcg cgggggcggc     63060
     tgcgctcggg gttccccctg tcgcattccc tcttaggccc gacgcaagcc gggcaccagc     63120
     atggcgtcag gtgtggcagg atgcagcctg ttgtcaagaa caaggagcga cgcaatgggc     63180
     cgcaaacccg tcagcgagga agagcacgcc gccaagaagg ccaagatcaa ggccgcgcgc     63240
     gaccggatga tggcggagaa gatcggcgag aagggcctga tcatcgtcca caccggcccc     63300
     ggcaagggca agtcctcctc cgggttcggg atgatcctgc gctgcatcgc ccatggcatg     63360
     ccctgcgcgg tcgtccagtt tataaagggg gcctgggaca cgggtgagcg acggctcctg     63420
     accgagcatt tcggggatct ctgccagttc cacgccatgg gcgagggctt cacttgggaa     63480
     acccagaacc gcgcccgcga catcgctgcc gccgaggccg gctgggaaaa ggccaaggag     63540
     ttgatccgtg acccctcgat ccgtatggtc cttcttgacg agatcaacat cgcgctgcgc     63600
     tacgaatacc tcgacatcga ggccgtgatc gccttcctgc gcgaggagaa gcccgagatg     63660
     acccatgtcg tcctcaccgg ccgtaacgcc gccgaggggc tgatcgaggc tgccgacctt     63720
     gtgaccgaga tgacgctggt caagcacccg ttccgcgccg gaatcaaggc gcaggcgggg     63780
     gtggagtact gaacgtcaga gggcactgcg ccgggaaatt tgggccacga gcaagacgaa     63840
     cttgataaac ggggtgggga gcgcgcgatg ccggcgctga tgatccaggg ttgcggctcg     63900
     aatgtgggca agtcgatgct ggtcgcgggg ctgtgccgcg cggcgcggcg gcgcaggctg     63960
     acggtggcgc cgttcaagcc gcagaatatg tcgaacaacg cagccgtgac cgccgacggg     64020
     ggggagatcg gccgcgccca ggcgcttcag gcgcttgcct cggggttgga gccggtgacc     64080
     gatatgaacc cggtcctgct caaacccgaa accgacctcg gcgctcaggt gatcgttcag     64140
     ggccgccgca tcggcaccat gcgggcgcgg gactattccc ggcgcaagcc cgagctgatg     64200
     gcgccggtgc tcgaatcctt caaccgcctc aaggcggccc acgatctcgt actcgtcgaa     64260
     ggcgcgggca gcccggcaga ggtgaacctg cgcgcgggcg acattgccaa catgggcttc     64320
     gcgcgcgccg ccgacgtgcc ggtggtgctg gctggagaca tcgaccgcgg cggggtgatc     64380
     gcccaggtcg tcggcaccca gaccgtgctc gacgcggagg atgcggcgct tgtcgtgggc     64440
     tttctgatca acaagttccg cggcgatccc cagctcttcg aggctgggta ccgcctgatc     64500
     gagggcagga ccggctggcg cggctacggc gtgctgccgt ggttccccgg cgcctcgcgc     64560
     ctgccggcgg aggacgcgct cgacctcggg cgcgtcgcca aaggcggacc gttccgggtg     64620
     gtctgcctcg cgctttcgcg catcgccaat ttcgacgatc tcgacccgct ctctgccgag     64680
     ccagccgtca gcgtcaccat gctgcgcgcg ggcgaggccc tgccgggcga caccgacctc     64740
     gtgatcctgc caggcagcaa atcgacacgc ggcgacctca cttttctgcg cgcgcaaggc     64800
     tgggacatcg acctcgccgc gcatcgccgt cggggtggcg cggtgcttgg catctgcggc     64860
     ggcttccaaa tgctcgggac gcggatcgcc gacccggaag gcatcgaggg gccagcgggc     64920
     gagagcccag gcctaggtct tttggacgtc gagaccatca tgggcgggga caagacgctg     64980
     acccgcatct ctgcccgcca caccgccacc ggggcggagt tcgatggcta cgagatccac     65040
     attgggcgca ctcggggacc cgactgtgcc cggcccttcg ccgaggtcgc aggccagcca     65100
     gagggtgccg tgtccggcga cgggcgggtg atggggagtt accttcacgg catgttctcg     65160
     gtcgacggct tccgccgcga tttcctcgac cggctcggtg cgcagggttc cggcctcgac     65220
     taccgggcgg gtgtggagaa gacgctcgac cagctcgccg cgcatctcga ggcgcatctc     65280
     gatctcgacg gcctcttcgc gctcgcgcgg tgacggctgg cgcggctcag cggatctccc     65340
     agtcagtcgc gcagttctgt tgccagccat tgcggtgcaa aagcggtgtg tcgtcgctga     65400
     aagcgggcca gccgaggcag aggtaggcgg cgaactccca gccctctggt acctcgaaca     65460
     gctcctctat ccgcttcggc tcgacgatcg agaccatgcc gagcccgagg ttctcggccc     65520
     gcgcagcgag ccaaagcgta tgtatcgcca tcgcggttga ctgccgcagc gtttccggca     65580
     tggtctggcg gccgaggccg tgccctgcgt ccggatcggt cacggtgaag acggcgaatt     65640
     gtaccggcgc ggcctcaagg cccgcgagct tgagcttggc gtaggtccgc gcctgatcgc     65700
     ccgaatagag cgaagctgcc gctccgttgc agcgggcaaa ttccacacgc acggccgagc     65760
     gcagcccagc atcctccacc cggaagatcc gccagggccg ggcgttgccg accgagggcg     65820
     cgctgtcgac cgccacgcgc agccgccgca gcacctcatc aggcaccgga tcgcggcgga     65880
     agtggcgaac gtcgcggcgc cagtggagga gacgcgaaag caccgccgcc tcttcggtgc     65940
     cgaatgtctt cgggcccttg agcgccgctt ccatgcgctt ccattcttcc tcgctccccg     66000
     gcaggccgag gcgcaaccag tccggccggg ccggaaaaat ccgcgaccag atccgatggc     66060
     gggcgagccg cgcctgcgcc gccgtccctt cgggcgtgcg gtaaaggcgg aaaagcccgg     66120
     tgccgccgat caactcccac cccgcgcgtg cgaccagcgc gtcgagccgc agggcgttct     66180
     cggcgaggcg ctggcgcgtg gcctccgccc aggcggtgtc aagaagcgcg cgccggccga     66240
     tctccagtgc cgggcctgag acggcccagg gaccggcgcg ctcggctaag gccgcgatat     66300
     cggcggccgg gccgatggcg aagccgaggc gcacgcccgc cagcccccag aacttgccga     66360
     acgaccggag cactatcagc ccgggccggc cacagcccgc ggcgagggaa agcgccggat     66420
     cggggtcgcc gaagctttcg tccaccacca accgcccaac ctgcggcagt agcgcgagaa     66480
     gcgcctcggg ctcgatccgc cggccgtcgg ggttgttggg gttgaccagc acggcgaggt     66540
     ccgcacccgc cagctcctcc agccgcgaga cctctttcac cgcccatccg gcagcgcgca     66600
     gcgcagcggc atgttcgtta taggtcggcg ccagcaccct tgcgcggccc gggggggcta     66660
     gatgcggaat caactgtatc gccgcctgcg cgccggccag cgccaccata ggcgcctcgg     66720
     tgccccagac cccgcgcgcc gcctcgatca gcgcggcaag tgcgcgcttg gtgggaagcg     66780
     ccgtccaggc ctctggcggc agtggtggca ccggccaagg ctggcggttg atgccggtcg     66840
     acaggtcgat ccagtccgcg gccgtgccgc cgaaccccgc cattgcctcg tccagattgc     66900
     cgccgtggtc gcgcatcatc ccctcacaga gccgccgcaa gcagcaggag cgcagccaga     66960
     gccgccagcg ctcggcggta aagcgcaaga gccgccgaaa tgctagccga attcggatcg     67020
     ccgccgccag cgttcaccca aggctcgtcc gaaagccggt ccccgtagac ccgggggcct     67080
     gagaggcgaa tgccgagtcc ccccgccatc gccgcctccg gccagcccgc gttgggcgag     67140
     cggtggtggc ccgcgtcccg ccacatcgtc gcgcacgatg cgcgggggag ggccgagacc     67200
     gcggcgaaga tcagcccgca aagccgtgcc gggatcaggt tcgtcacatc atcgatccgc     67260
     gccgcggccc agccgaaggc ctcgtgccgg ggtgtgcggt gcccgatcat cgaatctagc     67320
     gtattaatcg ccttgtaccc agcgatcccg ggcaggccaa agatcgctcc ccagaagagc     67380
     ggcgccacga tcccgtcgga ggcgttttcg gccaagctct cgatcgccgc tcgggcgacg     67440
     cctgccgagt cgagccgctc cgtgtcccgc cccacgatca tcgcgaccgc gcgccgcgcg     67500
     ccgggcaggt cgccccggcc gagcggctcg gccacgcgcg ccacgtgatc gtcgagcgag     67560
     cgtgccgcga ccagtggcca tgcgagaacg cccgtcagca ccagccctgc ccagccgccg     67620
     ggctgcagcg ccgcgattat agcggcgaag gcgacggtca ccgcaatgac cagaagcgcc     67680
     gccgcgaccc ccaacagccg gtcccgcccc ggccgcgcgc ctgccgtgtt ccagtcccga     67740
     tccaagcgcc caatcaaatc accgatccag gtcacgggat ggccgatacg acgatagagc     67800
     ggatcgggcc agccgagccc ccaatctact ccaagcgcca ccgccattgc cgccgccatg     67860
     ctcatcttcc gccccgaatc cggaagcgca ggatatggcg gaagcctgag gcgcgaaggg     67920
     cggcgggcgt cgtttcgggc accgttcccg gcgcgaagat cagcccgccc gccgccccgg     67980
     tatgggcgat gacgaacccg agcgcgcctt tcgcggcggc cagtgtttcg gtcggatcgt     68040
     ccgccgggcc gcgcaggcgg atcgtgcgcc gagccgactc ggaggcaagc gcggccactc     68100
     cggcgaggtc gccgcaagcg gcgggccagg cgtcggagtg gtcggcgatg tccgggaaag     68160
     ccgcgtcccg aggatcggtc cgccgcatcg gcccgaagaa gcggccgacg atctccattc     68220
     gcgacggcgc tggcggtcgg gcaagcacgc ggcctgcgcg cgaggcccag agaagcccct     68280
     cgggatcatc caacatcaat ggatcgaccg ccccctcgga gccgaggcag gccagcacga     68340
     tggtcttcgg gtccgtgacc cctgccgccc gtgccagggc cacccgcgcc ggcatgtcga     68400
     gccgcaggct gaaccgcccc tcgggccgga ccccgaggct tctcagcagt ccggccgcgc     68460
     ctgccttgct cagcacccgc gcgcccggct ggtgcagtgc gaagggcccg ggaaggcgca     68520
     gggcacggtg accagcgcca ctggcccgcc ggggccaatg cgtccctgca ggaactctcc     68580
     gaaatggccg aggacggcga tctcaatgcc gttcatgcca gcgcccggtt ggtgaagccg     68640
     atcgaccaga caccgcccag ctgtgcccgc agatgcgtgg ccgacagcgg cgcgatctcg     68700
     aagccgagtc ccgccggggc ttcccccagt gcgagcccga gcgctgcgcg gatcgtcccg     68760
     gcatgggcaa cgacaacgac catgccgccc tgcgtcagcc cctccagcgc gggtgtcacc     68820
     cgggcccaga ggtcaaggaa actctcgccc cccggcgcgc ggtgcgcagc gatctccacc     68880
     cgcccgagcg ggcccagatc ggggagttcc tcgggcaaca gcccctccca ggcgccgaaa     68940
     tcctgctccc agagccgggg gtccagcgcc gcctcccgac ctggaaggag cgctgccacg     69000
     gtctcccggc agcgccgggc ggggctcgtc accagccgcg cctccgccgc gccgagcgca     69060
     gccagcgcag cccgcgcgcg cgtcaacgcc tcggtgccgg gcagccgcgc agcagggtcg     69120
     ctgcgcccgg caagccgccc gcccgcgtcc gagggcgcat gacggatcag aatcaggctg     69180
     gtcgtctccg tccccgacac agtcggcttt ctcccttttc cttcggccaa aatgatgttt     69240
     tctgctgcct cgaaaggaga ggcagcatga tcctactcat taccggtggc gcgcgctcgg     69300
     gcaagagcag ctatgcggaa gggcgggtgg ctgcgctgcc ggggcggccc tgctatatcg     69360
     cgacgtcaga gatccgcgac gccgagatgg ctgagcgcat tgcccaccac cgcgcccgcc     69420
     gcggccctga atggcgcgag cgcgaggcga ctttcgacct cgtcgcggcc cttaccgaga     69480
     ccgacggtga cggcccccgc ctcgtcgatt gcgtcacgct gtggctgacg aacctcgtgc     69540
     tgaccgatcg cgactggcag gcggagctga acgcccttct ggcggcgctg ccggcgcagc     69600
     aaagcccggt gatcttcgtc accaacgagg tcggcctcgg catcgtcccc gaaaacgcgc     69660
     tcgcgcgcgc cttccgcgat gcggcggggc tggtgaacca ggccctcgcg gctgcggcag     69720
     acgaggtgca attcgtcgtc tccgggctgc ccctgaaggt gaaatgatgc aagctccgct     69780
     tttccccgcc gcctcctttg gcgatctccg cgcccggctg gcggatctgc ccgccgccga     69840
     cccgaccagc atcgccgcgg cccgggtgcg ccaagacaac ctgacgaaac cccctggcgc     69900
     gcttggccgg ctggaggagc tagcgatttt tatggccggc tggcagggcc gcgcgcgccc     69960
     agtgctggac cgtgcgcagg tggtggtctt cgccggcaac catggcatct gccggcaggg     70020
     cgtaaacccc ttcccgcagg aggttaccgc ccagatggtg gcgaacttca cgcgcggcgg     70080
     cgctgcgatc aaccaacttt gccgggtgag tggcgcggat ctctcgatcg tggcgctcga     70140
     ccttgaccgc ccgaccggcg atttcaccga aggtcctgcg atgaccgaag ccgaggtgct     70200
     tgacgccatg gtccgcgggg ctgcggcggt cgacaccggc gcgaatgtcc ttttgctagg     70260
     tgagatgggg atcggcaact cgaccgtggc ggccgcacag gcccgcgcct ccttcggcgg     70320
     cacggcctgg gactgggtcg gtcccggcac cggcgcggat gccgacaaga tcgcgatcaa     70380
     ggctcatgtc atcgaggcgg ggatggagcg ccacgctgcc gccctcagcg acccgcttgc     70440
     cacactcgcg gccttcggcg ggcgcgagca ggcggcgatc tgcggggcgg ttctcgccgc     70500
     gcgggcagcg cggatcccag tgatgctcga cggcttcatc tgcactgccg ccgcggccgt     70560
     gcttgcgccg cttggcatcg gcgcgctcga ccactgcatg gtcggccacg ccagcgccga     70620
     gccggggcac cgaaagctac tttcggccat cggcaagaag gccgtccttg atctcgggat     70680
     gcgcctcggc gaggggtcgg gcgcggcggt ggcgctgggc gtgctgcggg cggcgctcgc     70740
     cgtgcatgac ggcatggcga ccttcgccga agccggcatt tcggccggat gagcggatcc     70800
     tggatccagt cccggacgga cgaggcgcgg ctggcgctga tgctgctgac gcgcatgccg     70860
     atgggccggc tcgacgcggc gccgacgctc gctgcagccg cctgggccta cccgctcgcc     70920
     ggcgctgcgg ttggggcggt cgcggggctg gtctatctgc tggccgcggg actcggcctc     70980
     gcgtcccttc catcggcgtt gctagcagtg gcggcgggcg tggtcgcgac cggtggtatg     71040
     catgaggacg ggctcgccga tcttgccgac ggcttcggcg gcggcggcga ccgcacccgg     71100
     aagctggaga tcatgcggga cagccgtgtc ggcagctacg gggtgatcgc gctctgcctt     71160
     gcgcttctcc tccgcgtggt gctgttggcc gaagtcctgc cgggccatgc gccgctgttc     71220
     gttctcctcg ggctcggcgc gctcagtcgg gcgccgctgc cggtcctgat gcggcttctc     71280
     cccgccgcgc gtgccgaagg gctcggccac tccgcggcgc tgcgcatagg tgcagggcag     71340
     gcggccgccg cggccctaac cggcttcgtc ctcgccgcgc tcttcctgcc gttgcttctc     71400
     tgccccgtcc tcgcggcggc ggcggcagcc gctctgaccg gccttcttgc tcgccgccag     71460
     atcggcggtt tcaccggaga cgtcctcgga gccgcgcaga tcgccgccga actcgcggcc     71520
     ctgctggcgc tcgccgccgc ctgagggtcg gattttgcgt tgacggcttg gcgtgccggc     71580
     ttctatgcag gtctcgatgg ttcccctcgg ggatgaaaag ggatcgcggt gaggattcag     71640
     gtccgatgcc gcggctgccc ccgcaactgt tagtggcggg ccctctccag aagccactgg     71700
     cccagcgggc tgggaaggcg gtgggggcaa gtgctacggg ccaggaaacc cgctaccacg     71760
     cagcgctgtt caatgctttg ggatagtaat gagtgcgaga ggggtgtttg agtccggcga     71820
     gagctgcgcg gtagcggtct tggctgagtg cgctggcgct gactttgctg gtcatcagga     71880
     tgttgaaagc gaagctgcgc aatcgggcga tgacgccagg gttggttcgg atccagggct     71940
     gttcaatact gatttctgag ttgtggtgat gatccgcaac atcgaggaga gaattgattt     72000
     ttcggggagc gcggggattc ccgaccggcg ggatttggga ttcttgggaa ggcaaccgat     72060
     tcggaggttg tcatggccgc gttcagctcg ttgctgaata tactggcaga ggtctccgat     72120
     ccgcggcgcg cggaaggcaa gcactgcaag ctgccgcatt gttcgtggat gacgtagtcg     72180
     gcgccggccg ccgcggcgag cgcgcggccg gcggagcggt gatcggcatg cagatgcgtg     72240
     tcgatcacga gacggatcgg cgtcgccgag gtcgatgcgg ccagcaaata gggctcgatc     72300
     gggaatagcg ggtcgacgac cacgccggcc ccttgccgac acagtcgagc agataggagg     72360
     tcctagtgtc agcccgatca tcgccgggac ggtaaatgtg tacgcggcgg tggaaaagct     72420
     aggcctgcgc ggatcacatc tcgctgaaaa tcaacaccga ttctttattg caagagtgaa     72480
     actcgaagga ttcaataatc ccgtcgatag aatgctgcgg atcgcaagtg tcatcaacgt     72540
     gtaatacgat agcttcttgc aacccaaact tgcggcacct taaatcttca cctgtttggg     72600
     catttcctaa acgcagacca gtgagcaggt tgcggctccc gccataggac ggtgaattct     72660
     aaacgacgga tgaataaagc actcggcatt gttgcactga tctgcaaagc cggagataag     72720
     tccgaggcaa aaattgaggc gactatcagc gcggagcgga tgattttcta cgcccgcgag     72780
     gccgaggcag aggccggcac cgggccaggc gcttccagag agcgcgaaga ggcggaagac     72840
     ctcatgagcc gggccatcgc gggcagtcag gagatccgtt ccgaggccag tgacgctctt     72900
     gcggcaggcc gaaacggcaa cgccgaggaa gcggccttca tccgcgaagg catcgcgaga     72960
     gagatcggaa ccatgcatga ccagatccgt gatgaacggg aagccgtgca ggagacgcca     73020
     cctcaccacc aggttgaaga cgacgggtac gaattcgaac cgggcttctg atcacaacac     73080
     ccagccggga aactggctgg gtttttttgg agagtttcaa aatgactacg ctcgaagccg     73140
     ccgccccggt tcaccgaggc aacgcttgtc aaggagatgg agaggttggg gatcggcagg     73200
     ccgtcaacct acgcctcgat cctcgaaaac atcacgtcca ggtcatacgt catcgagggc     73260
     aaaaaagggt tcctctcgcc cgcaccaatc ggtgagaaga tccgagatgc cttggtttcg     73320
     cgcttcgact ttgccgagct tgcatacacc aagggacttg aggatcagct agacgagatc     73380
     gcggagggcc gggccgtcta tgaggacgtt gtgcgggggg cgtggaacgc gctggatggc     73440
     ggtctaagca agctcgacac actgaccatc accccggcgc atccgtgccc agagtgcggc     73500
     aaagccctca cgaggcggaa aggccagcac ggctttttct ggtcctgcac cggctggccg     73560
     gactgcaaag tgactttgcc agacgagaag ggacaacccg gcaagaagaa ggcaccagca     73620
     ccgccgaccg gcatcatgtg cccgtcatgc ggcaaggaac tggcgaggcg gcaggggaca     73680
     tcaaagccaa agatgaaggg catgaagccg aggccctacg acttctatag ctgcacaggt     73740
     ttcccgaaat gtgaggccaa gtttcagact ggcgcagacg ggaagccggt attcgaaaac     73800
     cagaccaagc aagcggcgga gtagggaaaa tgaaccgttt tactttcatg ggatgggcaa     73860
     cagagaagcc agaattaaaa acctatggca aaacgaccat tgctcgtatc cgtctaatac     73920
     ggaatgactt tataggaatg gatgaagacg gcaaaaagaa agagatggaa acctcaataa     73980
     cctttacagc cttcgggaat ctcgcgaagg ttttgtgtaa gacagtaatg acaggtgacc     74040
     aaatccttgt ggaggcccgc gttcggaaca acgactatga agcagacggc aggaagctat     74100
     atggattcaa tttcgaaatt ttaaattttg aatatggggc gccggggaga gccaagcggg     74160
     agcgatacgc cgatgaaggg ccagggaagg ccaatcggga gcgaaacgcc catgaggggc     74220
     cagggaaagc caagcgggag cgttacgccg aacagttcgc ggtgcgggcc ttgaaaaaaa     74280
     ggtctgatta cctccaaaac tatctaaaca ccgtcgaaat ctacgccccc ggcaccgttg     74340
     agaggtgggt ggccgaaggt gagtatgaag ccgtgaaggc gattgttgga cgcggtcaaa     74400
     accctgaaca tttttcccgc gagattctat tggcgggcga gaaagcagcg atcgacgcgg     74460
     ctcggcggga ggcagacgcc aatggtggag gcctctcgcc ctgaaatcga tggtatcgat     74520
     agattatctc ccgttatgga tatagtctat tcatggataa atggagatgg tcatgccgaa     74580
     tgcatcatgc gccgcacgac agcctgatcc cgagagatcg gatcatctcg atcagagccg     74640
     attttcgcca cagaaccgga gacgcctgag tgcgcccggc atgcgggcgt tcctggccat     74700
     cgcggatcta tggggcctcg acgaggagca gcggctcctg atcctgggat gtcctacccg     74760
     atcgacattc tacagatggg ccaaaatcgc acgcgagcat ggcgagatga ccctcgatgt     74820
     cgacaccttg acccgtatat cggccgtgct cggcattcat caggcccttg gtatcctgca     74880
     cctaagcgag aaagaaggtg tcgcctggct caagacgccg cacggagcca ccgtattcgg     74940
     cggcaggccg ccactggctc tcgtgacaag cggcacccag gacgggctca tgacagttcg     75000
     gcgcttcctg gatgcagtgc ggggcggcat ctacatggaa cccttcgggg gactggaccg     75060
     taacttcgtt ccctgcctat ccggttagga cacacaacca ccatatctag ggtgccgccg     75120
     ttctccggag tagagcgctc cataggttgg tgccgcggtc ccgccggcaa ttcccaacaa     75180
     cgatcggaag gcattcatcg gatagaagcg cctgttgaac cgaaacgtga actcgttgag     75240
     atacgcttgt aggtgcttct cgctgacgcc atgatgaatg ccgttcagcc atgtcttcag     75300
     gttcgaaaac acgagatgga tgagcggcag gaattcgtcc gctatctcgg ggtcaccgca     75360
     agccgcaatg ggatgatggt cgtagccggc cttttgcaac tcgccgtagc cgctccagtc     75420
     gtctgtgacg atgagtgccc ctggagtgac cgcagcttcc acaaatccac ccagcgacct     75480
     gctgctgcga tcagtgacca cagacagccg cacgcggccc gcgtagcggc cgacccgtcg     75540
     atggttctgg acggcgcccg gcttgcggtg ccgcacctcc acggcacagg cgaccagcgt     75600
     cttgtgatgg acgccacgcc cttcgccgcg tgttctgaca cccacgaacg tctcatcgac     75660
     ctcgacatgg gttcccggca gaccaccgat gcgatcctgg tcaggccgca ccattccggc     75720
     ccgcagttta tggaggatgc cgaaggccgt ctcatagcgc gataggccga gctgccgctg     75780
     aaactggacg gctgagatgc caggtgtctg actggcaacg agataggccg cccagaacca     75840
     aaccgaaagg ggggtgtgac tgcgctccat gactgtgccg acggtgaggc cgatctgccg     75900
     ccgacatgag cggcaagtca gaatgccagg gcgcgtagcg atccgaaacg gatcgccgac     75960
     aacgccgcaa cgcggacagg tgaacccgcc gggccagcgc gttcgctcca ggtaagtcgc     76020
     acaggcagca tcgtccggga acaggcgttg gaactcaggg agtgacctag ggaacggcat     76080
     atcatgacgt tcctgcacag ccacgtccgt cattcaaaac tccggacggg catcggtggg     76140
     gctggttgcc taccggcaac gaccagattc caatacgacc aagaacacgg atcgatgatg     76200
     cctgggggcg cggtgtcgag agcgacaatg aaatccctat cggagacgta ttggcgaatt     76260
     ttagccatat cttcagctgt cgctcgcgtc atcgcgtaag ccaggaacct taccggatca     76320
     gcaagagatc gttccggtgg ctcaaaccag acaatccgac tggcgatctt ggccagatcg     76380
     tctgtgacag ggaaggccct cacgttccca cgccgccggg gctatgtccg ccaccgtttg     76440
     gatgatgcgt gtgttttgtc ggcaatattg aaggcaatcg ctgtaaatcg accctgcgga     76500
     cagcgtccag gatcaagttc ctgctttttg taggtaattc ctgaagattc ccgtcgccaa     76560
     agtaggacaa agccttcaag ctgatcagcg gattgaattg gcttccatag atcacctgcc     76620
     cggcgctcaa agccatcggt agcgtgatac ggccatccac aaggagcgca gctatatcga     76680
     gatagtcctt catctcactt cgtttttgga ctactgagac cttcgtcccc gcaatatcca     76740
     gtaacgaggc aacctggata tgattgtccg gacaagtcac cgtagggaga atgcgcttaa     76800
     agccaggaag gccgaaaaat gacaccttta tggcgccgcc ccgatcgacg ctgacatcaa     76860
     gcgtgttctc cgcctttcgt agaacttgtg cgccatgcag gaacggcatc acattcaaca     76920
     gatgatccgg gtcaaccccc tcgctgctga aaaagtcgaa gtcgattgac tctcggtggc     76980
     caagatggag tgccaaggcc gttccgccat agagcgcaaa atggcccggt acctgatcga     77040
     gatcacgcca tagggcaatc tgcggggccg gcaatacatc gactcgtgga acaaagacat     77100
     ttgacattcg cacgcctctt tcccaatgca ccagcgctcg ctctaggcat aaatctacat     77160
     ctatggcgtg tatgcgtcaa gcggataggc atgcttcgtt ccataccggg acctggtgaa     77220
     ggagttgaaa ctatgagaaa tgaacggttc aacagcatat gggatgccat tgaggatacg     77280
     cctgccgagg cggagaacat gaagctccgt tctacactga tgatggcgct caaggatcac     77340
     atcgcccgtg ctggtttgag tcagggccag gccgccaagc tgttcggcgt cacgcagccg     77400
     cgcatctccg atctgctgcg cggtaagatc aatctctttg gcttggatac cctggtcaat     77460
     atggcggtcg cggccggtct gcacgtcgag ttgcgcgtaa tggaagcggc atgaccaatg     77520
     gagacgccgt cgtgttgagc cgctatccac agctcaggtt catagcttca cagctcacgg     77580
     aaacgacgat cctaaccgag gctgaagccc tcgcgcttta tgagcgcaac tggcggttcc     77640
     tcgaccttga aacaatggat gacgaagagc gccgcttcct tgattcgctc gttcgtgggg     77700
     tcggaaaggg tgtcttgaac atctgaaatc cggaccggct gtatttcgat ggccggacag     77760
     tgctcatgac cagaccaggc tcaacgccga tgtcaccggc agatagaggg tgcgcggtcg     77820
     ccggaccaaa ggtgtaaagc cgaaggccat atagaaggct gccgcactgt catcgatagc     77880
     gtcggcaaag attgcatgcg caccgatggg cgccgtcgcc acggtcttga tggcgtcgaa     77940
     cagcagggcg tctccaagcc cctgtccagc ataatcgcga tgtcgcgcaa gccagccgat     78000
     cagcacggcc gggacagtcg gatagcgcgg cagcttcttc gccagcggct cgggaacctc     78060
     gttcaagggg acgttgctcg acgacagggt gtagaagccc gccaccctgt ctgtcgcaat     78120
     ctccctagcg acgaagcagg tggcgtattt gcgcttcaag tcctgcgaga cggtctcgcg     78180
     gaaatagctg tcgatccgat cgttgccgca ggtgaaatcc accctcttgt gcgctttcgc     78240
     cagcggctcg atggcgaagc ggacactcac cgacgttcga tcagctcggc atgacgcttc     78300
     gcggcgcgga ccagccgctc attcgggttg ggtggattga tcagcgcctc ggcgaagcgg     78360
     atttgatcct cacgagcgag gcgcatgatc tcggcatctt cgacgacgcg cctggcgtct     78420
     tctcccgcag tcgcaatgag atagccggtc agggtcaggc cgcgtaggcg agcggcgcgc     78480
     tgcatctggt cgtagacttg gattggaata cgagcctcca accgtgcggt ctcagtttcg     78540
     acttgtggct tgggcatagc ggcctccttc tctccataat atacggcaat ttgccgtatc     78600
     gatcaaggat cgaaccacca gcaagccccc cctggccagg ctgaccgtgt ggtctggtga     78660
     acggctaagc gtttgcccaa caaacgaccg ttgaacggtc aacgccggaa tgtccggaaa     78720
     ccctggacct ttgacgagaa gtcggacaag gtgattgacg gacggaaaaa cggacatctg     78780
     ccatggcgaa tatcggctac gcacgcgtca gcacgatcga ccaggaccca gcgctccagc     78840
     tcgacgcgct cgcggcggcc gggcaggggc tacgcatgaa aatttcgggc atagttgacg     78900
     gcatggaatc gggtgtgatt cggggagtct ccttgagatt gggagacgtg catgtcggtg     78960
     aggcggcttg tggaggaatt ttcggcgttg gaagaccccc gctgcggcgg caaggttgag     79020
     caccggctaa ttgatattct ggtgattgcg gtgtgcgcgg tgattgccgg ggcggaaagc     79080
     tgggaggata tggcactgta tggccgtagc aagcaggaat ggctgggcac gtttttggcg     79140
     ctgccgaacg gcattccatc gcacgacacc ttccggcgtg tgttcatgct gatcgatacc     79200
     gggcgtttcg aggcatgttt cgaagcgtgg gcgcgctcat tcgggacgac tttggaccgg     79260
     gaagtggtgg cgattgacgg gaaaacgatc cgcggctcgt ttgatcgcag ccgggaccag     79320
     gcggcgcttc acgttgtgag tgcatgggcg agtgatcggg ggctggtgct cggccagcgt     79380
     caggtcggcg acaaatcgaa cgagatcacc gcgatcccgg aattgctgga tgtgctggac     79440
     atcaagggcg ccattgtcac gctggacgcg atggggtgcc agcgagccat cgcgtccaaa     79500
     attctcgagc ggggtgctga ttatctcgtc accctcaaag caaaccaggg gaagaaacac     79560
     agcgccgtgc aggagtattg cgcaaccacc tgcttcagcc gctcacccgt tgatcggccg     79620
     gtgcatgacg aattcgatga tggtcatggt cgtcttgttc ggcgccgggt gttcgtctgt     79680
     ccggacgccg tagcgctgga accgctgcgc gactggccgg ggttgaagag cgttctggcc     79740
     gtggaaacca tccgcggcgt caacggatcc ggcaagatcg aagccgaaat ccgctacttc     79800
     ctgtccagca gcgacgatca acccgaaatc ctggcgaaag cgatccgtca acattggcag     79860
     atcgagaaca gcctacactg ggtgctcgac gtcaccttca acgaagatca ctgccggatc     79920
     cgggatcgca acgccgtcca gaacttctcc ctgcttcgca agatcgcaat caacctcgtt     79980
     cgccgccatc aggcatcaaa ggccagtctc aaggggcgcc gcaaaatggc cgcctgggat     80040
     aaccgttaca tggagcaagt gctcaccggc ttctttcatg cgtaacccct gggcggccgg     80100
     gtgtgtgaaa atcttcgacg atcgcgcttc aggagcgcgg gccgatcggg ccgggctgcg     80160
     cgccgcactc gactatgtac gcgacggcga cgtgctgatc gtctggaaac tcgaccgcct     80220
     gggccgctcg ctaccggatt tgatcgagac cgtgacgtcg ctggcaacac gcagtgtcgg     80280
     attccggtca ctcaccgagg cgatcgatac gaccacgccg ggcggtcgcc tggtcttcca     80340
     tctgttcggc gccttggggc agttcgagcg cgacctgatc caggagcgca ctcgcgccgg     80400
     cctggccgcg gcggcagccc gcggtcgcaa aggtggccgc aagccggtca tcaccaacga     80460
     aaagctcaac cgcgcgcggg ccatcatcgc cagcggattg accgtacgcg aggccgcagc     80520
     ccggctcaga gtcggcaaga ccgcactcta tgatgcccta cgccgctgat tgagaggcca     80580
     cacagcagcc tccgccagca acgttcactg aaagttcgcc cttagcgttg ttcagatgac     80640
     agccgacgct ctgccctcag taaaacgttg aagtctaatc agaatagcca acaggaggaa     80700
     gtaatgaaga gtaacacaaa tgggctgata ttcgtcgaaa tctgttccaa aactcgcatg     80760
     gcgtgcgcag cgggcgtgat cagccttttc ggtcttgctc cgcttgcgca cgcgcagagc     80820
     ctgagcgacg cgctgcggca gacgaccttc cagggcatgg tcggcgcaat ccacttcgac     80880
     tatggcaata acggccatac gagcaagagc acgcactcct tcgcgatcgg cggccatctg     80940
     atcgcccata ccggctcgtt cgacgggttc agcgtcggcc tcggtggata caccgcgcag     81000
     tcgctcggcc tgtacagcaa gaacaacgct ggcgaccagg ttcattatga cggcgaactc     81060
     accggctcgc actacgggat ccagtcgttc cggcaggcct atctgcagta tcagacaccg     81120
     aaagtagaaa tccgcttcgg ccgtcagctg atccagacgc cgtatgccaa ccaggattac     81180
     tacaccttca acccgcgcgc cttcatgggc gttgccggtg tggtgaacgt gcttggcaat     81240
     ggaagcaaca aggttgatgc cggtgcgctg agcctcgatg gtaatccagc agcgttcagc     81300
     gtcttcatga cgcgaatgtt cacctatgaa agccgctatt ccagctcctt cgttaccaac     81360
     aaccgctact ccggcaccaa gccaaccaac ggcttgatcg cgatcggcgc acggtatcat     81420
     ggtaatctcg gctcgacaca gctgacagca caggcgtggt attacgactt ctatcagtat     81480
     gcgcaactcg tctatgggca ggtcgatctc gtccagccgc tcgccaacgg ccaagctatt     81540
     ttcggctcgg tgcaggcgct gaccgaaggc aactcggccg gcaatgccgc gaacatccag     81600
     gcgttcacca acaatacttc cagctcggtc aatgcgcata tctatggcgc caaactaggc     81660
     tattcgttcg gcgacggcag cattgcgctg atcggcgact atgccccgac ggaatacaat     81720
     tcgttccatc acggtggcgt gttgcacccg tataacgaca ataccgggac cacgtttacc     81780
     gatacgatgc agaacggctt ggccaatctc gggccgggct atgcctacgg catcacgacg     81840
     aactacgact tcctcaacaa gaagctgaag gtcggcgtca cctatgtccg ttacctcgtc     81900
     cgttacggct ttggcggcga tgcgcggaac tactccagct atgcctatac cgggagcttc     81960
     ccgagcaaca actacatacc caaccagcag ctctgggcgc tggacgcaaa tgcttcctac     82020
     gacctctcct cggtgctgaa gcaggggtta cgcatgaaag aagccggtga gcacttgctc     82080
     catgtaacgg ttatcccagg cggccatttt gcggcgcccc ttgagactgg cctttgatgc     82140
     ctgatggcgg cgaacgaggt tgattgcgat cttgcgaagc agggagaagt tctggacggc     82200
     gttgcgatcc cggatccggc agtgatcttc gttgaaggtg acgtcgagca cccagtgtag     82260
     gctgttctcg atctgccaat gttgacggat cgctttcgcc aggatttcgg gttgatcgtc     82320
     gctgctggac aggaagtagc ggatttcggc ttcgatcttg ccggatccgt tgacgccgcg     82380
     gatggtttcc acggccagaa cgctcttcaa ccccggccag tcgcgcagcg gttccagcgc     82440
     tacggcgtcc ggacagacga acacccggcg ccgaacaaga cgaccatgac catcatcgaa     82500
     ttcgtcatgc accggccgat caacgggtga gcggctgaag caggtggttg cgcaatactc     82560
     ctgcacggcg ctgtgtttct tcccctggtt tgctttgagg gtgacgagat aatcagcacc     82620
     ccgctcgaga attttggacg cgatggctcg ctggcacccc atcgcgtcca gcgtgacaat     82680
     ggcgcccttg atgtccagca catccagcaa ttccgggatc gcggtgatct cgttcgattt     82740
     gtcgccgacc tgacgctggc cgagcaccag cccccgatca ctcgcccatg cactcacaac     82800
     gtgaagcgcc gcctggtccc ggctgcgatc aaacgagccg cggatcgttt tcccgtcaat     82860
     cgccaccact tcccggtcca aagtcgtccc gaatgagcgc gcccacgctt cgaaacatgc     82920
     ctcgaaacgc ccggtatcga tcagcatgaa cacacgccgg aaggtgtcgt gcgatggaat     82980
     gccgttcggc agcgccaaaa acgtgcccag ccattcctgc ttgctacggc catacagtgc     83040
     catatcctcc cagctttccg ccccggcaat caccgcgcac accgcaatca ccagaatatc     83100
     aattagccgg tgctcaacct tgccgccgca gcgggggtct tccaacgccg aaaattcctc     83160
     cacaagccgc ctcaccgaca tgcacgtctc ccaatctcaa ggagactccc cgaatcacac     83220
     ccgattccat gccgtcaact atgcccgaaa ttttcatgcg tagcccctgg gtgctgaagg     83280
     gtctctccgt tgccgaggat acggatatca ccgatgcaga gaatcgcgcc ggttaccacc     83340
     actacaacaa cccgtatttc agcagccgtt tctacctcga atacaatttc tgagaggctg     83400
     tctcgaaact cattcgagat gattgggtta tgggctgggc ggttgggccg gatcttgatt     83460
     cgtcgaggtt ataaacacac tggacgagac ctcgatgtgg accccgacca cccggcggcg     83520
     agatagccgc gcagggctat gctatgggag cgatctgacc gatgccgaat ggatcattct     83580
     attgccgttc ctgccgcctc atgccgattg tggccgaaaa cgagcgcatt ccatgcggga     83640
     gatcatggac gccatctgca catgcttcgc ggcgccaatg catggcggct gatgccggac     83700
     agcttcccgc cgtggcgagc gatgtatcgc tggttcgccc gttttcgtga cgagggaacg     83760
     tgggaaatca taaactacca cctcgtcatg caggaccggg aacgggtgga ccgcgcggcg     83820
     aacccgtccg cggctgtcat cgacagccac agcgtcatga cacctgagag caccttcacg     83880
     gccaactggg aatgggcccg cctcaggtca ccgcaagcca gcgcccttcg cggctagaga     83940
     cctgaattgt ctcgactagc gtctgtatcc gcaggcccat gcggaagttg tagggctctg     84000
     gccgcatttc ggctatcgct tcaaggaagc ctgccacctc gatcgcctta aggtcattga     84060
     agccaagctg atggcccggg gcgacacaga aaaggccata gggcgcgtgc tcgggccccg     84120
     cctcgatccg gcggaagcct tggcggccat ggggatcgtc ggtcgcgtag aagtgcaact     84180
     cgttgaaccg ctcctggttg aacgccagcg cgcccctggt gccaaagact tcgaaggcat     84240
     gctgcatctt gcgccccgtt gcgatccagt ttccctcgat cgacccggtt gcaccgttgg     84300
     aaaagcgcag gaaggcacgg ccgatgtcat ctacctcaac cttgcggata ccccccttgc     84360
     cgtccggacg ctctcggatc atcgtcacgc agtcgcccat caccgttttg atcggtcccg     84420
     ctgcgggacc catgaggaac tccgccgtgg ccaaggcatg gctgccgata tcggccagcg     84480
     ccccgccacc cgccggatca tggcggaagg tgaacgagcc agtgggatcg gccatgtaat     84540
     cctcggcatg caggccgcga tagccaagga tctctcccag ttcgcccgac gcgatcatct     84600
     cgcgcgcgag cgcgaccatc gggttgcaga ggtagttgaa accgacctgc gtgcgcgcgc     84660
     ccgcatcctc tgccgcctct gccatctcaa gcgcgtctga ggccagcggc gcaagcggct     84720
     tctcgcaata gacatgcttg cctgcggcga cggcagccag cgccatctcc ttgtgcaagg     84780
     catttggcgc ggtgatgctg accaagtcga tctctggatt ggccacggcg gccttccagt     84840
     cggtcgcggc atgggcgaag ccaagtgcat cggctgcccg ttgcgcagcg gcatcgctga     84900
     tatcgaccag cgtgtggaat tcgagcgcat agggcaggtc gaagacccgg gccgccatgg     84960
     tgtagccgaa ggcgtgcgcc ttgcccataa agccactgcc gatcaggcag atgcgcagcc     85020
     gcggtttgtc ggtcatgtca tttctccggg aagtcgtaaa aagcctgatt gcagatcagc     85080
     gagctaccgg ccttacccat gccggcaaat cgccctccgc gctgtccacg accgcctcga     85140
     caaaggcgac gcctttcagc ccgtcgtagg ccagcggcag gttttgcccc agtggccccg     85200
     gatcgcgccc cgcatgccgg gcgcggatcg cctcgccgaa gcctgcgtaa aggttggcga     85260
     aggcttcaag ataaccctcc ggatgaccag gcggagtgcg ggtgcggacc ttcgcatcct     85320
     cggacaggtc gtcagccccg cgcttgatga gctgcacacg accgttcagc ggggtgtaga     85380
     ccagctcatt cggctgttcc tgaaaccact ggaacgatcc cgtctcgccg aagacgcgca     85440
     ggcgcacacc gttggaattg ccgatggcca cctgcgagca ccacagaagt ccccgggccc     85500
     caccttcgta ccgcatcatc acatgagcgt tgtcatccaa cgcccgtccc tggacgaatg     85560
     tggccagatc ggccgagagc gcctgcagct tcagccccgt cacgaagccg gcaaggtgat     85620
     acgcgtgggt gccgatgtcg ccgatagaac caccccgtcc gttctttttc ggatcggtgc     85680
     gccatgcggc ctgcgcattt ccctgctgtt cgattgcggt cgccatccat tccagcggat     85740
     attccacctg caggctgcgg acagcgccga tatcgccccg cgcgacacgc acgcgggcat     85800
     catgcaccat cgggtaaccg gaataggtgt aggtcacgcc gacgaaacgc ccgctctcac     85860
     gcgcgagcgc ctccagcgct acaccatcct ccagcgtcgc ggtcaggggc ttttcgcaga     85920
     tcacatcgaa acccgcctcg atcagcgcct tggcgatcgg gtaatgtgtg aagttcggcg     85980
     tgcagatcgc gaccgcgtct acccggtcag cgcggtcctt ttcgcccgcg atcagctctt     86040
     gataggtgcc gtagctgcga tcctctgtaa tgccttgcga cagcgcaaag gcacgcccgc     86100
     gggctgggtc cacatcgaaa gcccccgcga ccaactgcca gaccccatcg agccgcgagg     86160
     cgaagcgatg gatgttgccg atataggcgc cttcgccgcc gccgaccatg ccgaggcgca     86220
     attgacgatc aaagctcatg tcttattgct ccagcccgag cattgcccgg ttcgcttcca     86280
     ggttcgcacc cggtttgaca aagttgtcaa aggcgcggtc cgagacgcgg atgatgtgat     86340
     cacggatgaa ctgtgcccct tcgcgggcgc catcctcggg gttcttgatg aaacattccc     86400
     attccagcgt cgcccatccg tcgaagccgt agctggaaag ctttgtgaag atcgcgccga     86460
     aatccacctg cccatcaccc gggctgcgaa agcggcccgc ccgcttcgac caaggctggt     86520
     agccaccata ggcaccggat ttgccatcgg gccgaaactc ggcgtccttc acatgaaaag     86580
     cgcggatgcg atcgtgatag tggtcgataa aggcgagata gtcgagcgct tgcagcacga     86640
     aatggctggg atcgtacatg atgttggcgc gggggtggtt gttcactttc tcaaggaaat     86700
     actcccacga atgcccgtca tgaagatcct cacaggggtg gatctcgtag gcaacgtcta     86760
     cgccatgagc gtcgaaatcg ttcaggatcg gggcccatcg ggcggccagt tcggtgaagc     86820
     cctcgtccac tagaccctcg ggccattgcg gatacggata aacatagggc cacagcagag     86880
     cgccgggaaa ggtcgtatgc gttgtgatgc cgaagcgctg cgaggcgcgg gcagcaaagc     86940
     acagctgttc ctcggcccag gcgcggcgcg cggcgcggtc tccgcgaaca tgctccggcg     87000
     cgaagctatc cataatctgg tcgtgcgcag gatgcactgc aaccagctgc ccggtgatat     87060
     gcgaggcaag ctcggtcaga accagcccgc gatcggccag catgccccgg atctcgtcgc     87120
     aataggtctg gctttctgcg gccagcttca tgtcaataag ccgcgtgtcc caggtcggga     87180
     tctgcacgcc cagaaagccc ttctccgccg cccatgaggc aagcgacggc agagagttat     87240
     agggcgcgtc ggcggcggca aattgcgcaa ggtagaccga cggtcctttg atcgtcttca     87300
     tgggctcagg ccttcaattt cgtagatgga acaggcgcgt cgtcatagcc gccccaaact     87360
     gactgatcga actggataac tgccccggtc atcattccgc tgtcgtcgga ggccatccac     87420
     agaaccgcgc gggccacttc gtccggatcg aggatgcgtc cgaagggttt gcccgccgca     87480
     gcgcgatcga tgaagtctgg gtcgcctgtc tccgaaagaa ccagcgcccg ttcgtggtcc     87540
     gaattcatcc agccaatatc cagctgattg acgtggactt tgttgcgcag aagcgcgaaa     87600
     gccgcgtggc gcgtcagagt tgttagtcca cccttcgaca cggcatacgg ggcgaggaac     87660
     ggctgaccgg catgggcaga catggttccg atgttgacga tccggccttc aattcccagc     87720
     cgatccatga cccgcgccgc atcctgaatg aggaagaacg gcgcacgggt attgatagcc     87780
     gtcattctgt caaacagctc aggcgaagta tttagcatgt ttccacggtc ggtaaggccg     87840
     gcagcattca ccaggatatc cacccgaccg aagcgcgcat ccgccgcagg gatgatccgt     87900
     cgtacatctt cgatgttgcc aaggtcggcc acgatcatct caaccggcac gctggttttg     87960
     tcggtgatct ccttggccac ggcgacaccc ttctcgcgcc cgcgcccgac gatggcgatg     88020
     cccgccgccc cggcctcggc aaagagccgc gcgatggcgg cgccaaggcc ctgcgtgccg     88080
     cccgtgacaa ctgcgatctt tccgtcgatc cggttcatta caccacctcg tatcctgcca     88140
     gcgccatcac gcgcatcagt tcggcatgcc ccttcttcgc catttctagc gggtgcgaga     88200
     ccttcgggtc ctgttctgcc tcgacgacga accagccctc gtaaccataa gccgccagcc     88260
     gttgcgtgat ggcgacgaaa tccagcgagc catcgcccgg cacggtgaag gcccccttta     88320
     ctacggcgtc gaggaagctt tcccggcttc ggtccagtgc gtcgatcacg tccatgcgca     88380
     cgtccttggt gtggacatgg ctgattcgcg catgatgttt gtcgatcact cgcagcacgt     88440
     cgccgccggc gaaggccatg tggcccgcgt cgaagagaag cggtatgccc tcgcccgaat     88500
     gggtcatgaa ctgatccagc tcagcctcgg tctcgatcgc ggcggccatg tgatgatggt     88560
     aggccagcgg catgccccga tcggcgcacc attcgccgaa ctcggtcatc ttgcgggcgt     88620
     agacgcggat ctcgtcgtcc gaaagcttcg gcttcgtcgc cagcggctgc gaccggtccc     88680
     cctggatcga gcgggcggtc tcaccataga cgatgcaggg cgcaccggca tctacgaaga     88740
     aatccatctg tgcgcggatg cggtccttct cggtctcgat atcgccatca agcaagagac     88800
     ccgagaacca gcccccgcag accgagatgc cgtagcgatc gaggattggg ccaagctcag     88860
     tcatgttcat cggaaagcgg cggccggttt ccatcccggt gaagcctgcg acgctggcct     88920
     ggtgcaggca ttcgtcgagg ctgacgtcgt ccgacagctc ctcgaggtcg tcattccacc     88980
     acgcgatggg ggcgatgcca agtttcgctt tcatggttca gactcctacg cgttgcttgg     89040
     cgcggatcgc gtcctgggcc ttccgggctt cggtgacggc tttgaaattg gacacctccg     89100
     gcacacccac gtcccagtcg gcgtcgcccg gcacccaagc gtatgcgtcc gacacgatgc     89160
     tgatgactgt cggtccgtca ttgccctgcg cccatttcaa cgcctcttcg aggtctgcga     89220
     ggctttcgac atggcgcgcg gcggcaccca tcgcctcggc atgcttggca aaatcaacat     89280
     gcggcgggtt ttccggattg gcgatcctgc aatccttcag caggttgttg aagcccggca     89340
     cgcccttgaa ctgctgcagg cggttgatga cggcgaagcc gccattgtcg cagaccacga     89400
     cgatcattct gtcgccggtc aacactgcgg aatagatgtc cgagttcatc atcaggtaag     89460
     tgccgtctcc cagcatgacc atcggcgtgc cgccaagccc acccggcccc ttctgggcca     89520
     tggcatggcc ccagccggcg gggatctcgt aacccatgca agaaaagccg aattcgcaat     89580
     cgaaggtgtt ggggtctttc actcgccagt tcttggtgat ctcgcccggt gtgccgcccg     89640
     cggcaccgat cagcgtgtca ttgggccgcg cgaccttgtt catcacgccg atgacctgcg     89700
     cataggaggg caccggggaa ttggttggcg cctgatgctc gtcaaggatc cggttccact     89760
     cggaaaagag atcttttgcg accttcaacc gttcatccgg cgcgacccag tcgccgaggg     89820
     cggtgtccat ctcggtcatc gtctcgcgcg catcgcccac gaccgacaag gcgcggtgct     89880
     tcactgcgtc gaaccgtgcg gcgttgacgg agatgaactg cgcctctcgc gcgaacgcgg     89940
     tccaagagcc ggtggtgaaa tcctgaagcc gcgtgccgac ggcaaggatc acgtcagcct     90000
     cggccgccag cgcattggcc gaggtggagc cgacgatgcc gatcggaccc gcatggactg     90060
     gatgatcatg cgtcaacccg cccttgccgg cgatcgtctc aaccaccgga atgccgtgtt     90120
     tcgcggcgaa ttccgccacg atatcctccg ccagcgaata acgtacgccc cccccggcga     90180
     tgatcatcgg cttcttcgct gactttagta gctccaccgc cttggccacc gcatcgcggt     90240
     ccgggcgcgg ccgggggatg tgccagacct tgggttcaaa aaacaccgcc gggtagtcga     90300
     aggccttttc ctgcgtgtcc tgcgccagcc cgatgaaggc cgggccgcaa tccgccgggt     90360
     ccagcatcgt cgccacggcc tgcggcagcg aggtaatgat ctgctcgggc agcgagatgc     90420
     ggtcccagta gcgcaccacc ggcttgaacg tgtcgttcac cgtgatcgtc ggattgccga     90480
     aatgctccac ttgctgcagc accgggtcag gcaggcgatt ggcgaaggtg tcgcctgcca     90540
     gcagcagcac cggcaggcgg tttgccatcg cggtgccggc ggcggtgacc atgttggagg     90600
     cccccggtcc gatggaggtc gccgcgatca tgatctggcg gcggcgcttc gccttggcat     90660
     agccgatggc ggcgagcgcc atgctctgct cgttctgacc acggtaggtt ggcagctgat     90720
     cttgcacctg ctccagcgcc tcggacaggc aggtcacgtt gccgtgcccg aagatgccga     90780
     agagaccggc aaacagcggc acgcgttcgc catcgatctc tgtgtactga tgggtgagcc     90840
     agcgcacgag cgcctgggcc atggtcagac ggaccgttct ctcggacatt tcgcctcctc     90900
     ccgcagatgg aatcttgtta tcgaggaaat gtatattgac atattaaaga taatgcaaca     90960
     aatattgtta tcgagttcag ggaggttttc atgctcaaga ttgcggtgct cggctgcggt     91020
     cgaattggcc ggatgcatgc cgaaaatatc aattcgcatc aacgcgctac gctggtcggg     91080
     gtttatgacg tcgtcaagga ggcctcgcgc tccgtcgcgc agaaacttgg cgtacgcgag     91140
     ttcgagtcgg ccgcagaaat cttcgcgtca gccgaggtcg acgcagtgtt gattgcaacc     91200
     tcgacagcaa cccatgccga tttcatcgaa caggccgtgg cggcgggcaa gccaatcctg     91260
     tgcgagaagc cgatcgacct gtcgctagcc cgcgtgcgct gctgcgcggc gaggatcgcg     91320
     ggtagcgacg tgccgatcat gctgggcttc gtgcgccgct tcgacaccgg ccatcgcgcc     91380
     gtgcgtcaag ccatcgaggc cggtcaaatc ggcgagttgc atcaggttgt tatcacctcg     91440
     cgcgatcccg acatcgcgcc ggatgcctat atagaggtct cgggcgggat cttccgcgac     91500
     atgacgatcc acgatttcga catggcacgc ttcatccttg gcgaagagat cgaaaccgtc     91560
     acagccgccg gcgcgcgcct cgtttcgccc gcactgatgg agcgttgcga cgactgggat     91620
     accgtcagtg tgctgatgac cacagcaagc ggcaaacaat gcgtcatcgg caattcgcgc     91680
     cgcgcagtct acggttatga ccagcgggtt gaggcctttg gaaacgaagg tatggcgatc     91740
     tcggaaaacc gcacggaaag taatctccgt ctttcacgcg ccacctttac cgatcaggct     91800
     ccaccgctac agaatttctt tatcgaacgc tacgcgcaag cgtttgcatc ggaaattgac     91860
     gccttcgtaa atgctgtcga gaagggtgtc gcgccggagg tcggcttcga tgatggcgaa     91920
     aaagccctca tgctggcaga agccgcgctg ctttcggtgc gcgaaggccg taccgttcgg     91980
     atggaggaac tgggatgacc ctctacgcgt cattcggcaa tttcatcgac ggtgcatggc     92040
     aggcgggacg agcgaaactt gatgtcgttt cgccagcgac ggaaaagctg ctgggcacca     92100
     tccttgccgc cgataccagc gacacgcagg ctgcgctgga ggccgccgcc cgtgcgaagg     92160
     cgccactgcg ggccatgggc ggcttcggcc gcgccgatgc gatgcaccgt atcgccgatg     92220
     cgatgctggc ccgcaccgaa gaggcgcagc gcatgatcgc gaccgagacc ggcaagccgc     92280
     tggcccaggc gggccgagaa tggggccttg cctgcgacca gttccgctgg ttcgccgaag     92340
     aggcccgccg catctacggc cgtatcgtgg acagccgcgt tcccggcggc cggttcgaag     92400
     tgacgtacga gccagtgggc gtggtcggcg ccttcacggc ctggaacttt ccagccgccc     92460
     tgcccgctcg caagctggcc ccggcgctcg ccgctggctg cccggtcgtg ctgcgcccct     92520
     cgtctcagac gcccggcgta gcgatgatca tggtggattg catccgcgcg ggcggcctgc     92580
     ccaatggcgc ggttaacctt gtcgtgggca gtacggccgc gacctatgca ccaatcatgg     92640
     cggacaaaag ggtccgcaag gtctcgctga ccgggtcgac gcgggtgggt cagcaaatga     92700
     tccgcgatgc agccgacacc gttaagaagg tgtcgatgga actcggcggc aacgcgccgc     92760
     ttatcgtcta cgacgacgcc gagttgcagc atgtgctgga tatgacggtg ccaacgaaat     92820
     tcgccaattg cgggcaggtt tgcgtaacgc ccgaccggat cttcgtccac gacagcctgc     92880
     atgatgcctt cgtcacgggc ttcgtggacc gtgccaaggc catcgtgctg ggcgacgggc     92940
     tagatccagc gactacaatg ggcccgctca tcaacgcccg ccgtctggaa gacatcgacg     93000
     gcgtagtgca ggcggcggtg aaggccgggg cgaagctcgc acatggcggc cgccgctcgc     93060
     ctacccacaa caccggccat ttctacgaac cgaccgtgct gaccgaggtc accgacgaca     93120
     tggccgtctt cgccgaagag aacttcggcc ctgtcgctgc catcacccgc ttcaccaacg     93180
     aggacgaggt gctggagcgc gccaatgcat gcgacatggg gctgtcggcc tatgccttca     93240
     ctcgctcggc cgaccgggcg cggcgcacgg tggcggcgct taaatcgggg atggtcggga     93300
     tcaactcctt cgcccttgcg gcctccgagg caccgttcgg cggcaccaac cattccggta     93360
     tgggccgcga gggcgggacc gaggggatca ccgactacct cgacacgaag ctggcacaag     93420
     tcgttttctg aggggggatc atgcgcaaca agctcaagga tatctgggtt gagggccggc     93480
     ccgtgctgca cggctggctt tcgataggca atcccttcac cgccgagatc atggcggcgc     93540
     agggctatga cgcgatctcg atcgacattc agcacggggc gctggactat tccgcggtcc     93600
     tgccgatgtt ccaggcgatg cgggcctcgg gcgtggtggc gatggcgcgg gtgccctggc     93660
     tcgacccggc ggcgatcatg aagacgctcg acgcgggtgc gatggggatc atctgcccga     93720
     tgatcaactc gcgcgccgag gcagaggaat tcgtctccta cctgcgctat ccgccgaagg     93780
     gtcagcgcag cttcggcccg acccgcgcgg gcgtcgtcat gccgggctac gggcttgcaa     93840
     tgaacgacga gatcctcgcc tttgcgatga tagagacaca ggtcggcatg gacaatctgg     93900
     aagagattgc tgcgacgcaa gggctggatg gcatctacgt cggccccgcc gatctgacgc     93960
     tgggcacgaa ggcgggccgc ctgcccccgg gcttcgaccg gcaggaggac gagatgatcg     94020
     cactcatcca gcgcatcgcc accgtctgcc gcgcggcggg catcaaggct gcgctgcatt     94080
     gcgggacgcc cgaatacgct gccaaggcga tcagctgggg ctatcatatg accacggtct     94140
     cgggcgacac gcggctgctg gcgggtgctg cggccgcctc ggtcgcacgc tggcgcgaat     94200
     taaccggcgc tgagcccaag gcagctgggt ccacgggcaa caagggggga acctactgat     94260
     gccgcatatt ctggccgccg ggaaactgca tccctccggg gtggctttgc tcgaacagac     94320
     gacccataac ggctacacct tcgattatat cgaggaggtg tccgaggcct cctatatccc     94380
     gctgatctac aagaccgacg cgctcattct gcgcacccag cctctgacgg ccgagacggt     94440
     ggcgaaggct cccaagctca aggtcgtttc gcgccatggc gtgggttacg acgcggtcaa     94500
     tctggaggcg ctgaacgcgc ggggaatcgc gctgacggtg gtcggcgacg taaactccgt     94560
     ctcggtcgcc gaacatgcga tgatgcagat ccttgccctg gccaagcgcg ctttggtggc     94620
     ggaccacgcc gtgcgcgagg ggccctgggg ctggcgcaac cggctggagg cgcgcgagat     94680
     cagcgggctg aacttgctga tcctcggcta tggccgcatc ggccgcagcc ttgcacgcat     94740
     ggcgaagggc ttccagatgg aggtgcgcgc ctacgacccg ttcctactta aggcaggctg     94800
     gccggaaggt gatgtttccc ctgtcgaaac gctagctgag gggctggcct gggccgattg     94860
     catctcggtc cacatcccga agggcgacaa gcccctgatc ggcgcagatg aaatcgcggc     94920
     gatgaagccc aacgtaatcc ttgccaacac cgcgcgcggc ggcatcgtgg ccgaggagcc     94980
     gctgcgcgcg gcgctggctt cgggccatgt cttcggcgcg ggcatggatg tcttcgacgc     95040
     ggagccgccg gtggatggcg gcccctttgc cgcgctggac aatgccctcc tctcgcccca     95100
     catcgccggc ctaaccgcgg aatgtgccga gcggatggcc gtttcgtccg tgcagaatgt     95160
     gctggatttc ttcggcggga aaatctcgcc cgatctcgtg gtcaacagag tcgtggcttc     95220
     cgcgcactga ccacaaccgt ttaaatgttc ggggtggggt agtatcatca acggctctgg     95280
     tgcgaatagc ctgacgagcc aaaggttgtg gcggcgaggc tgcgatgttg tcgctttaat     95340
     gggcggcgag gacggcctcc cagacggcag gcgcaggtcg accccgaaga cgtagccgac     95400
     cgaggcggaa ttgccccttg cggatccgtc gcttcaattc gatcccggct accgtgatcg     95460
     cggcggtctc gaaccgcttg aagccgagcg ttggaccgac ccgcgacttc acgccccgat     95520
     ggtcctgctc aacaaggtta ttcagatact tcgacgatcg cagcttcgtg tcagcagcca     95580
     gttcaccgtc agccttcatc tcgcgcaccg cgcggtgcga tgcggcatag ccgtccagcg     95640
     tgacggtccg cggacccgag ccctgaccct tctgaccctt gatcgccttg cggaagaacg     95700
     ccttggccgc ggcaacgtca cgcttggtgc tgaggcggaa gtcacacctg gccattgcgc     95760
     cgccctcaaa gtcaccaaat ggctagtacg atatcgcggc cagccgtttg caccagagcc     95820
     tcatcaagaa cgggcgccgc aacatacatt gcagcgcctt atcttattca atacacttgt     95880
     gtttcagggg taatgggcag cctgagcttc gggggccgcc gaactatgaa gggacaaagc     95940
     cgtgacaacc agcgaaaagg caccggagaa ctacgaggat ctcattcggc tcattcatga     96000
     tcggtatgac cagatgagca agacctatca gcggatctca gtctacctca cccaaaaccc     96060
     aaatgacgtt gcaattcgcc ctataagcac gatcgccgca agctgcaaca tccatgcgtc     96120
     aagctttgtc cgctttgcac aatggcttgg ctatacgggc tttaaggacc tgcaaaccct     96180
     cttccagaaa cgcctgtcga cggccgcccc tggctttgac gcccggaaga gggctttgga     96240
     agacgaactc cagctgctcg aggaccactc tgaactcggc tttctgaggg acttggtagt     96300
     tcgcgatatc gcttctctgc aaggtctgtt ggacaagatc agtgccgcgg acatggtaaa     96360
     cgcgacagag ctgattgagc gtgccgatac ggtctacctg atcgggcagc tcaggtcgga     96420
     accggtagtc aaccttctgc gctacatcct gaccatgctg ggcaagcgct gcgtcctact     96480
     ggatgaaagc ggcggtcttg cgacgcatgt ggcgcgcacc atgcgaccga ccgacgtgct     96540
     tatggccgtt accttccgct tctatgcgaa tgaagtcgtg aacatcgcgg aagaagccga     96600
     acaatccggt gtgccgatca tcgcgatctc cgatacgacg ctctcgccac tcatgaagtc     96660
     agcaagaatc ctcttcgcgg tgcccgagca tgaatataca ttctcgcgct cgctagcagc     96720
     accgatgtgc ctcgcacagg cactgatggt cgccgtggcg gcccggctgc agcacaacag     96780
     cgtcgatcca aggatcccaa cggtcaccgg ccaatagcga aagagttctt caaaacggga     96840
     attcctgtgg cgcggcgttc aggatgaaaa aagtgatcgc gactttggtg tccgtcgtca     96900
     ggatatttgg cgcagattgt caaggatgca caggcgctat tcacggttcc ggaggatgaa     96960
     tactcgttca cgcgcacgct cgcggcgccg atgtgcctcg tgcaatgcct tgcggtggcg     97020
     agtgcggcga tccttcaggg cagccgagac gaattgccac gtatccccac cgtcaccgag     97080
     aaggatcgca gccgcggtgc cgccggcctt cgtcgccggc gcactgaagg aacatgacgc     97140
     ttccggcggc ggtattattg caataaagct tgcaataaac cactattggc aataaaagtt     97200
     ctaaagcggc gcggatcgca tgccagagcc gcagtatggg aggactctga atgaaagcca     97260
     agctggccat tgccccgatc gcctggacga atgatgacct gccagaactc ggcggtgaca     97320
     cgccgctcga aacctgcctc gccgaaagcc gcgccgctgg cttcatcggc gtcgagaatg     97380
     gcggcaagtt tccaaaagat gctgcgtcgc tgcgggcaaa gctggacgct ttcgatcttt     97440
     ccctcgtcgg cggctggtat tccggaacgg tgctggacgc gccggacgat ctcgtggccg     97500
     agcgcgaaca ggccgccgcg caactcgccc tgtttcgcga actcggtgct tcctgcctcg     97560
     tctacggcga aactgccggc acgctgcaga accgccgcaa cgccccgctc gccggccgcc     97620
     gtgtgttagc ggaggatgcg tttcccgcct atgggcggcg cctgacgagc tttgccgaat     97680
     actgtgcgga acaaggcgtt ccgctcgcct ttcaccatca catggccacc gcggtcgaga     97740
     ccgagcgcga catcaacctg ctgatggccc ataccggcga ggccgtcggc ctgcttttcg     97800
     atgccgggca tctccgcttt gccggcggcg acatgttccg cgtgctgacg aaacatggca     97860
     ggcgaatccg ccatgttcac gttaaggatg tgcgagagcc agtgatcgcg gggctcgacc     97920
     gtacgcggca gtcctttctg gatgcggtcc tcgctggcgc cttcaccgtg ccgggcgacg     97980
     gctccatcga tttcggaccg gtcatccagc gtcttgccga tttcggttac gaaggctggt     98040
     tcgtcgtcga ggccgagcaa gacccggcca aggcaccgcc ggcgcgctat gcgaaaatcg     98100
     gccacgacgc tctcgccgat gcgctgcgtc gcgccggcta ttctattcag gagacccgat     98160
     gatggctcaa ttgtcgggaa aaatcgcgat tgtttccggc ggcacccaag ggcttggctt     98220
     ggcgatcgcc cggctattcg ccgagcgcga tgccgccggg ttggtcacct gtggccgctc     98280
     gcgtgaaaag ggtgaggcgc gggcaaggga aatatctgaa gccactggcg ctcgggtaat     98340
     cttcgtgcaa gccgatctcg ggcaggtcga ggattgccga gcggtcgtcg ccgcggccga     98400
     caccgctttc ggtcgggtcg atgtccttgt caacgccgct gcgatcaccg accgcggcac     98460
     catcatcgat acctccccgg atctgtttga ccgcatgttc gccgtcaacg tccgcggacc     98520
     gttctttctc atgcaggatg caatccggat catgcggcga gagaataccg aaggcacgat     98580
     cgtcaatatc tgctcgatgt cggcgaaggc tgggcagccc ttcatttccg cctactgcgc     98640
     ctcgaaaggc gcgctggcga ccctgacgca gaacaccgcc tatgcactcc tgcgcaaccg     98700
     aatccgcgtc aacggcctga atatcggctg gatggcgagc gatggcgaac accgggttca     98760
     gaccgaattc cacggcgcca gcgagaactg gctggccgac gccgcagcgc agcaaccctt     98820
     cggccggctg atcgacccga ccgaggtcgc gcgcgcggtt gccttcctct ccagcgccga     98880
     atccggattg atgacggggg cgatggtcaa cttcgaccag tcggtctggg gtgcctacga     98940
     ctcgtctccg ggacccgcgg caccgctctg acggtggcga ctttcgtcag ggcgcgggtg     99000
     ccgggcaccg agttagtatt cgacctccaa agtctagacc gcatggttgt cgctaaagtg     99060
     cgaactgaat agtgtcacgt gaggcgcgta gcggcggtgt tccggcgcca gcacgatccg     99120
     ccgcagcgca gtctcgatct tcgactgaaa atgcagcaag gcctgattgc gttccacgcc     99180
     catccacagc gaagtgaccc ggccaacctt cgcgaagcag cccgcgcaga caaggatgaa     99240
     cggaagcccc ggcgcgtgga ttgcggcgag cgcgtggtcg atgtcccagg cctgaagcgg     99300
     taggcttcgc cgatgacgcg cagtgtcaca tgatattttg cgccgccacc ttcgcgactt     99360
     gatcgacgcc tacaactttg cccaatggct caagacccta aagggtctca taccaaacga     99420
     attcatctgc aaacgatgga cgtcagagcc aaacgggttc atcatcaccc caatcgacca     99480
     aattccggga ctaaacacct agtccaacga caactgacta gattcctcat aattgcgggc     99540
     gggcagattc tcccgggtgt aaattcgcag ttcggcatgc gacagtgccg gggtggaggt     99600
     gatcagaccg cagcggtaaa gaagggtctg caagctacct agggcctggc cacgcggatt     99660
     ctgatcaatc gcgtaatcca ttgtgccgtc cttgagatag atgatgtgat cgtcggataa     99720
     ctcgtgtccg atccagaatg gacgcggcat agcccctttc agcgcattca tgatgccgat     99780
     cgagccggcg ccggtattgt agacgccgac aagcggcccg aacgacaatg ccgctcgcag     99840
     agaacgcgca caacgatcag ggtcgtcgcg cgtatccatt tcgatgatct cgcaatgcag     99900
     gtgggggaaa tcgcgcgata gcgtcgtctg gaagcctccc atgcgctcga catgaccagc     99960
     ccagtcgtga tgggcaccga gaacggcgac ccggccactc tgccggcagc tgcgcccgag    100020
     aagatgggcg gcagtggcgc ctgcctgacg attatcaatg ccaagataat cagctccggc    100080
     gagacccggc agatcggtca cgatcgttac caccttctgg ccggcggcct ggatggattg    100140
     gaccgcggca cggatctccg gtcggtccgg gacggcgagg atcattcctt ttcgtgcgta    100200
     cgacgtctcg gaaatgaggc gcacgaagct tgcggtatcc tccacggcaa ggatgtgccg    100260
     gtgcatggcg atgccacgat ccagcatggc gataccgtcg cggaaagccg cccgaaggcg    100320
     gacgaaaaat ggtgagtcgt tctgcggcag gatcaggtca agatgcgtga tcggcctgta    100380
     ggcttctggc agatcccggc gcacacccat ctcgcgcgcg acctggatca cccgttcgcg    100440
     cgcggcatct gaaactgact cacgctcgtt gaagacccgg tccactgtgg caatgcttac    100500
     acccgccacc cgcgcaatgt cggcaaggcg ggcgcgcggc cgtgtcttgc gggaagcttg    100560
     ggctccagtc atgcgcgaga gtgcgccgct gacgaaaaat cgtcaacagc gcacgcggcg    100620
     tgcccgttcc agagcgcgta agaagagatg ccggaccgcg cggcaggact tgccgaagcg    100680
     ctgccgcagg gaggacatac gatgaagatc gcacttgatc cgttcatgca ccgtcatctt    100740
     ggcctggagg aactaccctt cagagtgaag gaaatcggct tcgactggat cgaactttcc    100800
     ccgcggggag attttctgga atggttcaag gcgccgcggg tgtttccgga acgggtgcgg    100860
     ggcttcaggc gggcgctgaa agaggccggt gtggggatcg cctcgctgct gccgatgtat    100920
     cgctgggcgt cgaatgacga cgacgagcgc aaggcagcgg tgcggcactg gaagcgcgcc    100980
     atcgagatct gcctcgaact ggaagtcgac acgatgaact cggaattcgg ccgtggccca    101040
     caccccgaca aggggtcctg ctattgttgc cataccggct cgatgatcga ggcctgtgaa    101100
     gactcctggt ggcgttcgat ggaggaactt gtgccagtgt tcgagcggga gggtatcaac    101160
     cttcatgtcg agccgcatcc ggaggactgg gtggaaaccc ttcagccggc agtggacatc    101220
     atccgcacgg tcaattcgcc gcgggtgcga tttctttact gtgcgccgca caccttctac    101280
     tttggcgaca atacagcggc aatgctgcgc gaatgcgcgg atgtgctggc acatgtgcat    101340
     gtcggcgata cattcaatca ccgggccagt tcgggcctgc gctacatcgt caaccctccc    101400
     ggttcggctg cgcgggtgca ccagcacctc gatatcggtc agggagaggt gccatgggac    101460
     gagttcttcg gcacgctcgc ggaaattgat ttcgacggca tcatgaccgc ctgcgtcttc    101520
     gcctgggagg agcgggccga tgcctctggt cgcttcatgc gcgccgaaat gcagcgctac    101580
     atcgacaaat tctggaaacg ggagctctga aatgacccta cggattggtg ttatcgggac    101640
     cggcgcgatc gggcgcgacc acatgcggcg gatcaaccaa accttgtctg gcgccaaagt    101700
     gacggccgtg tcggatgtca atatcgaaag cgtccgcacc gcgcgggcgg atcttgcgcc    101760
     cgaggctgag gtcgttggct ccggcgagga actggctgca tctgctggcg tcgatgccgt    101820
     ggtggtaacg tcgtggggcg cgacccatga acaatacgtc ctggccgcca ttgcggcggg    101880
     caagccggtc ttctgtgaga agccactgtc gaccacggcg gcgggcgccg ggcgtatcgt    101940
     cgaggccgaa accgccttcg gccgccgcct cgtgcaggtg ggcttcatgc gccgctacga    102000
     tgcgggctac cgcatgctaa aggcggtcgt cgagaacgag atcggccggc ccctgatggt    102060
     gcatgcagcg caccgcaatc cgtccgtgcc ggagcagtat atcacgccaa tggcgatcca    102120
     ggacacgctg atccacgaaa ttgatgtcct gcgctggctt ctcgacgatg actacgtctc    102180
     cgcgcaggtc atctctccac gtcggacacg gcatgcacat gcgagggtcg aggatccaca    102240
     gatcgtcctc ctggaaacca aaagtggcat ccggatcgat gtcgagatct tcgtcaactg    102300
     ccgctacggc tatgacatcc agtgtcaggt tgtgggtgag gaaggtctcg ccagcctgcc    102360
     agacccaatg gcggtcgtga tgcgcaagga tgcaaagttg cagagcgcga tcatgaccga    102420
     ctggaaggat cgattcatcg acagttacga tctcgagttg caggatttca tcaaggcggc    102480
     ggcgcgggga accgcatccg gcccgacggc ctgggatgga tatgtcgccg cggtctcctc    102540
     ggatgcctgt gtagaggcgc agagccagcc gggttcgatc gtgccgattt cgctgcccgc    102600
     gcgccctgct ctttacaact gaggtttctc atgcgcttcg cactcaatca cattgcaaca    102660
     ccgaaacttt ctcttgccga tttcctcggt cttgcgcgcc gcctcgggat gccggcgatc    102720
     gagatccgca acgaccttcc ggatgtcgtc ggcacgatgc cggcgggcgc cgtcagggct    102780
     gcggccgtag catccggggt cgatattctt tcgattaatg cgctttaccc cttcaatgtc    102840
     tggtcggggg acgtgcctgc gcgcgcgctt gcacttgcgg attatgcgca ggcctgtggt    102900
     gcgcgggcgc tcgtcatgtg cccgttgaac gatggcacgc cggtgccgca tggcgatctg    102960
     gtcgctgccc tgcgcgagtt ggtgccgatc ctgcgccaac atggcattac tggtctggtc    103020
     gagccgctgg gctttcctgt ctcatcgttg cggacgaaac gggaagcgat cgaggcaatc    103080
     agggaagccg gcgccggcga tgtctgcaag ttggtgcatg acacattcca tcatcacctt    103140
     gccggcgaga gggaattctt cccggagttc actggccttg tccatatctc gggcgtcagg    103200
     gaaactgatt tggctgtgaa cgacatgctg gatgctcacc gcgcgctcgt cgatgagatg    103260
     gatcgtctga acaatatcgg tcagctccgc gccctcgcga ccggtggcta tgcgggcgcg    103320
     gtgagcatcg agcccttcgc gccttcggtg catgatgatc ctgatccgga agcggcgctc    103380
     cgagccagct ttgctcatgt cgctcagggg gtagcttgag gtgctttgcc gcgtcgtgcg    103440
     tggctcacgg aattttttta ttgattggtg agtatttgct tgacgcgggc gcggccgagt    103500
     gattttttgc atgcctgata agtttgcaaa aatatttgcg ggtctggcat ggtgcggcct    103560
     gcgtgagagg gaggatatga agatgcggac gatcgggacg ggtatgctgg caggtctgct    103620
     gggcggtgtg gcgcttggct gtgtttcgct ggcggggatg acagggacgg cggtggcgaa    103680
     ggcgccggaa tacacgtttg cgatgatcac gcacgcgcag cccggggaca cattctggga    103740
     catcattcgc aagggtgcgg aagcggcggc gaagaaggac catgtgaagc tggtttatct    103800
     gaacaacccg aacgcctcgg gcgaggcgca gctgatcacg aatgtgacgc aacagcatgt    103860
     cgacgggatt gcggcgacgc tcgccttccc ggatgccgag gatccggcgc tggcgcaggc    103920
     ggagaaggcc ggaatacctg tggttggctt caatgcgggc acgagtgagt ggaagaaggc    103980
     cggcatgttg atgtatgttg gcgaggacga gacgatcgcg ggtgaggcgg tgggcgatcg    104040
     cctcaacact ctgggtgcaa agcatgtgct tgtagtcgac cagcagcagg gtgcgatcca    104100
     gcttgaggat cgcggcgacg ggatcaagaa gaccttcaag ggcaaggtgt cggtgctgta    104160
     cgtggacggc tacgatatgg ccggcgcgca gtcgcggatt gtcgcgaagc tgcagcagaa    104220
     tcgtgacatc gactatgtgg tgacgctggg tgcgccgttt gcgccgacgg cgatccaggc    104280
     tgtgaagatg gctaacagca aggcgaaggt tgcaaccttc gacctcaatc cccaggccgt    104340
     gcacctgatc caggaaggca agctgcaatt cgcggtggat cagcagcctt acgtgcaggg    104400
     ctacgaggcc gtcgatttcc tctggctcta caagacgaat ggcgacgtgg tcgggggcgg    104460
     caagccggtg ttgaccggcc caaccttcgt gacctcgaag aacgtagcgg cggtcgcgaa    104520
     gttcgcggag cgcggcaccc gctgatcctg gcccgatcct gaggcttccc gccggctggc    104580
     gccgatgatg gcgccggccg tgcgaagcgc cgagcgggag gagagatgac gatcatgacc    104640
     aatggcacga tgaccgggaa cgatgcgccg cgcactgcgc acccgcagct ggttcagcag    104700
     gcgttctggc ggaagaccct aaagcgaccg gaggccggcg cgctgggcgg ggccatactg    104760
     gtctttcttc tgttcttcgt ggtggcgccg ccgttccgac aagtggatgc gttcacgacg    104820
     gtgctctacc agtcggcgac gatcgggatc ccggcggttg cggtatcgct gctgatgatc    104880
     ggcggcgagt tcgacctgac ggcgggtgtc gcggtgacga cgtcgtcgct ggcggcgtcg    104940
     atgttcgcga cgaaggtggc tggcaatatg tgggcaggga tcgtgttcgc gctgctggtt    105000
     tcactggcga tcggcgcgct gaacggctac cttctgatcc gcacgcggct gcacagcttc    105060
     ctggtcacgt tgtcgacctt cctgatgctg caggggctga acatcgcgct caccaagctg    105120
     gtgaccggca atgtcgcgac cggggacatc agccatgtgc ccggctttgc ctccgcgcat    105180
     gcgatttttg cctcgacgtt ccggatcggc ggtgtcgatg tcagcatcgc gatcctctac    105240
     tggttcctgt tcatcctggt ggcgacctgg gttctgctgc gcacgcggtt cggcaactgg    105300
     atcttcgcgg tgggcggcag cgacgagagc gcgcgggccg tgggcgtgcc ggtgcggcgg    105360
     atgaagatcg tgctgttcat gctggtgggc ttcagcgcct ggtttctcgg catgcacatg    105420
     ctgttcgaat acaacgaggt gcagtccggc gccggtgtcg gcaacgaact gctctacatc    105480
     gccgcggcgg tggtgggcgg ctgcctgatg accggaggct atggctcggc gatcggctcg    105540
     ggcttcgggg cgttcatctt cgggatgacg acggaagggg tgatctatgc cgactgggat    105600
     cccgactggt tcatgttctt cgtcggcgcg acgctgctga cggcgacggt ggtcaacacc    105660
     tggctgcgtc tgcgggcgag cggagggaag tgagatgagc gagagatccg cgccgatcat    105720
     ccagctcacc gatatcggca agagctatgg caatatcagc gcgctgcgcg gcgtcagcat    105780
     gacggtgcgc agcggtgagg tcacctgcgt gctgggcgac aacggtgcgg gcaagtcgac    105840
     gctgatcagc atcatcgccg ggctgcgcga gcacagcacg ggcacctacg cggtggatgg    105900
     cgaggcggtg acgttcggct ccccgcgcga ggcgctggat cgcggcatct cggcggtcta    105960
     ccagacgctg gcgctggtgc cgctgctgcc gatctggcgg aacttctttc tcgggtccga    106020
     actgaccatc gggcgtggtc cgttccgccg gctcgacatc gcctcgatgt gggagatcac    106080
     cgaccgcgaa ctgcgccgga tgggcatcca tgtcgccgat ctcgaccagc ctgtgggcac    106140
     gctctcgggc gggcagcggc aggtggtggc gatcgcgcgg gcgatccatt tcggcgcacg    106200
     ggtgctgatc ctcgacgagc cgaccgcggc cctcggcgtc gcccagtccg gcctcgtgct    106260
     gcgctacatt gcccaggccg cccgcgaaca cggtaccggc gtcatcttca tcacccacaa    106320
     tccgcaccac gcctacatgg tcggcgacca tttcatcatc ctcgcccgcg gcgaggtcga    106380
     actcgacgct gcccgcgacg gcctcaccct cgaaaacctt atgttccaca tggctggcgg    106440
     tgccgggctc aacgcactcc agcacgaact caacagaccc cagccacaag gcgcctgatc    106500
     gtgccggcag caactcagca gaccctgaac gatggcgaaa cgacccggct tgcggcgagt    106560
     aggcgtatga aggcgctcga cgtgatcacg atcggccgct cctcggtcga tctgtatggc    106620
     gcccaggtcg gcgggcggct cgaggatatg cgttctttcg acaaatatat cggcggttcg    106680
     ccgacaaaca tcgcctgcgg cgcggcgcgt ctggggctgc gatcagcggt gatcaccagg    106740
     gtcggcgacg agcatatggg ccgcttcatc cgcgaacagc tgtcccgcga gggcgtggat    106800
     gtgcgcggcg tcgtcaccga tcccgcgcgg ctgaccgccc tcgtgctgct gggcatccgc    106860
     gatgaagacc agtttccgct gatcttctac cgtgagaact gcgcggacat ggccctctgc    106920
     gaggacgata tcaacgaggg actcatcgcc gaggcgcgct cggtgttggc aaccgggaca    106980
     catctcagtc atccccgtac cgaggctgcg gtgttgaagg cgctgcggct cgcgcgggcg    107040
     catggcgcgc gaaccgccct cgatatcgac taccgcccca atctctgggg ggtggccggg    107100
     catggcgcgg gcgagagccg ctatgtcgaa agcgaggcgg taaccgcgaa attgcagatg    107160
     acgctggagt tgttcgacct gattgtcggc accgaggagg agttccatat cgccggcggc    107220
     tcgcctgaca cgctgacggc gttacgggcg gtgcgcgcgc tgaccggggc gaccctgatc    107280
     tgcaagcgcg gtgcgagagg ggcggtggcc ttcgcaggtc cgatcccggc caggattgag    107340
     gatggcgaga ccgggcctgg ctttcctatc gaggtgttca atgttctcgg cgccggcgac    107400
     ggctttttcg ccggcctgct gaaggggtgg ctcgatgacg aaacctggcc gaaggctctg    107460
     gaatacgcca atgcctgcgg cgccttcgcg gtttcgcgcc atggctgtac gccatcttat    107520
     ccttcgcttg aggaactgac attttttctc cggcgcggtg tccgtgaacc cgctctccga    107580
     catgacgccg aacttgaacg gcttcattgg tcgaccaccc ggccgcacgg cgtcgcggat    107640
     taccggatct ttgctttcga ccatcgcgcc cagttcgagg agatggacgg ttatacggcg    107700
     cagaaaggcg gtgccttcaa gcggctttgc ctggaagcgg cgctctcggt gcaggccggc    107760
     cggcacggct acggcatcct gtgcgatgaa cggatcggcc gacgcgcgct gcacgcggcc    107820
     tccggctcgg ggctgtggat cggtcggccc tgcgagtggc ccggctcgcg cccactcgcc    107880
     ttcgagcccg cgctcggcag tgattgcggc ggcctgtccg agtggccgaa ggaaaacatc    107940
     gtcaaggttc tctgcttctg ccacccggac gacgatgcgg ccatgtgggc aacccaggaa    108000
     gcggcggtgc ggcggttgtt cgaggccgcg cgccgcaatg acctggaatt cctcctagaa    108060
     atcattccct ccaaggtcgg cccggtgaat gatggcacca ccgcggcgct gatccgccgc    108120
     ttctacgccg ccgggatcta tcccgactgg tggaagctcg aaccgatggc gagcctggcc    108180
     gcctgggagg ccgcctgcac cgcgatcgag acgcatgatc gccacacgcg cggcatcgtg    108240
     gtactcggcc ttgatgcgcc ggaagccgat ctcgcggcga gcttcgcggt cgcggcgggc    108300
     ttttccctgg tgaaggggtt cgctgtaggg cgcaccatct ttgccggagt ggcgcgcgcc    108360
     tggctcacgg gcgagatgga tgacggcacg gcggtgaccg agatggcgcg ccgcttcgcg    108420
     cggctttgcg cgatctggga cgatgcgcgg acccaggcac gggagaaggc ggcatgagca    108480
     acacgatcag gctgacggcg gcgcaggcca tggtgcgctg gctcgccgtg cagatgaccg    108540
     aggagggtga acgcttcatc gagggcgtct gggcaatttt cggccatggc aacgtggcgg    108600
     gactgggcga ggcgctgcac ggcatcggtg atcgcctgcc gacctggcgc ggccagaacg    108660
     agcagaccat ggctcatgcc gccatcgcct atgccaagac gaaggcacgc cgccgggcga    108720
     tggctgttac atcgtcgatc gggccgggtg cgaccaacat ggtcaccgcg gcagcgctcg    108780
     cccatgtcaa ccgcctgccc gtcctcttca ttcccggcga cgtcttcgcc aaccgccgcc    108840
     ccgatccggt cttgcagcag atcgaggatt tcgatgacgg cactgtcagc gccaatgact    108900
     gcttccgtcc ggtcagccgc tatttcgacc ggatcgcacg gccagaacac ctgctcaccg    108960
     ccctgccgcg cgcgttgcgc gtgatgaccg atccggcgaa ttgcggcccg gtctgcctcg    109020
     ctttctgcca ggacgtgcag gccgaggcct acgactatcc cgaaaccttc ttcgcccccc    109080
     ggacctggcg cattcgtcgc cccgaacccg atccgcgcga agtcgcggat gtcgctgccc    109140
     tgctgcgcgc ggcgcgccgg ccggtgatcg tcgccggcgg cggggtgatc cactcgggcg    109200
     cggaggaacg cctcgccact tttgccgccc agcacaacat ccccctcgtc gagacccagg    109260
     ctggcaaggg cgccgtgtcc tggcaggacg aacggaattt cggctccccc ggcgtgaccg    109320
     gctcggactg cgccaaccgg ctctgcgccg aggccgacct ggttctcggc gtcggcaccc    109380
     gcttccagga tttcaccacg ggaagctgga cggtgtttgc caatccggcg cggcgcctcg    109440
     tctcgatcaa cctggccggc tacgacgcga acaagcacgg cgcgacaggg atcgtcggcg    109500
     atgcgcgggc gacgctggac gcgctgtcgc tggcgctgac ggaacaccgc gcgcccgatt    109560
     tcgacgcgga agcccgccgc gcctggcatg cgaaagtcgc cgccgtcacc gcgccgcccg    109620
     cagaggtcca tcgcaacgcg ctgccaaccg acgcgcaggt gatcggcgcc gtgcagcgcg    109680
     cgacaaccga gcggagcatc gtgatgtgcg cggccggcac catgcccggc gcgctgcagg    109740
     tgctctggca ggcgtcgccg ggcggctatc acatggaata cggctattcc tgcatgggtt    109800
     acgaagtcgc cggcgcgatg ggcgtcaaac tggccgcgcc cgaccgcgag gtgatctgct    109860
     tcgtcggcga cggttcctac atgatggcga attcggaact cgccaccgcg gtgatgcggc    109920
     gggtgccctt caccgtcgtg ctgaccgaca atcgcggcta tggctgcatc aaccggttgc    109980
     aggccgaatg cggcggtgcc gccttcaaca atctctacga ggactgcaat gtcgaggttc    110040
     agcccgagat cgattttgtc gcccatgccg ccgcgatggg ggctcacgcc gagaaggtta    110100
     cggatatcgc ggcgctcgag gccggcatcg cggcggcgcg tggccgcgcc gtcccgactg    110160
     tcctggtgat cgataccgat cccgctcccg gcacaggcgc cggcggccac tggtgggatg    110220
     ttgccgtacc gcaggcgggc ggccccgagc gacttgaaca ggcgcgggcg cgctacagcc    110280
     gcaacgcggc cgcccagcgt gtcgccgact gacccgaacc gtcccgagaa caggatttcc    110340
     cggatgcccg acctgctgcg caaacccttc ggcactcacg gcaaggtgca cgatatcacc    110400
     cccgccgcgg ccggctggcg gcatgtcggc ttcgggctct accgcctgcg cgccggcgag    110460
     ttcgccgcgg aggcgaccgg cggcaacgag gtgatcctcg tgatggtcga ggggaaggcg    110520
     tcgatccgcg ctgccgggcg ggattggggc gtgcttggcg agcggatgag tgtcttcgag    110580
     aaatccccgc cgcacagtct ctatgtgccg aacggcgcgg aatgggcgct cgtagccgaa    110640
     acggactgca tcgtcgcggt ctgttcggcg ccgggcaggg gcgggcacgc ggcgcggcgg    110700
     atcgggccgg agggcatcgt cctgaccgcc cgcggcgagg gcaccaatac gcgccacatc    110760
     aacaatatcg cgatggaagc cgaggactac tgcgatgcgt tgctggttac cgaggtcttc    110820
     acgccggccg gccactggtc gagctatcct agccaccggc acgacgagga cgatgatccg    110880
     cgcatcacct atctcgagga aacctactac catcgcctga acccggcgtc gggcttcggc    110940
     gtccagcggg tctacaccga tgatcgcgcg ctcgaccaga cgatggcggt ctcggacggc    111000
     gatgtcgtcc tggtcccgcg tggccatcat ccctgtgcgg caccgtatgg catcgagatg    111060
     tattacctca acgtgatggc cgggccgctc aggaaatggc gtttcctgcc ggaccctgaa    111120
     ttgggtatcg ctaagtaggg tgcggttttc aaccagaccg gccgctttgt gcgtgccgag    111180
     atgcagcgcc atatcgacaa gtattcgagg cagaaatgag cctgccgatt caaatacgta    111240
     agcatgttga tttccgctga gattgagctc aggccccagt taaacagcgg gttttcctaa    111300
     gcaattgaaa aggcgcgtga aaatgggcgt gcgctggagc tgtggcacta cagggcggaa    111360
     tgcgcagccg gatcaggcta cggcttgctg gggggtctgc agacggggtg acatggcgat    111420
     gcgggcggcc ttgaaggctg cggaggccgc ggcgccagct tcggtgcgga cctgccagcg    111480
     cttgccgttc tgactgattt cgccgtgctg cagtcggtcg agatcacgca ggagatcggc    111540
     ccattcgacg cgcttgccgg cccggcggag tttttcgtcg agcgcctggt gcaggatcag    111600
     cgcgagaaaa gaacagaaca catggccgcg gatggcggcg tcggaggaat ggtagattgg    111660
     ccgggtgcgc atcgtcgcct tcgccacacg gaacagccgt tcgacattct gcaggtcccg    111720
     gtagcggagc accgcctgca gcggcgagat cctggcattg gagcgcagca cgaagacgcc    111780
     gtcgaagcgg gcttcctcgg cgagcttgcc ggcgtcgatc tcgaacagct tgctcttgcg    111840
     gccgggcttt gcgtcactga ccgggcgcag gaagcggcga taggcggagt tgccgatcag    111900
     cgccttgtcg cctcgcgtca gctgacgatc gagggcggcg accacctggc gcctggtctc    111960
     ggcctcttcg atggccacca cctcgttgcg gcagacgata tagcgcttgc ccgcgacctt    112020
     gacctccttg atgaagagct gggtctcgtt gccaccggcg cgctcgaggc agagtgggat    112080
     gtacgggcgc tcatcggcca gcaccacctc gcggacgatg cgatcggtgc gttcccttgc    112140
     gccgaggacg tattccagtc cgcgctcctc cagcgcggcg atcgtcgccg cgctgatcat    112200
     gccgcgatcg gcgacaacgc agacccgggt gatgccgaag cgcgatcgca ggcggtcaat    112260
     caccggcacc agcaccgaga catcggcggt gttgcccggc cacatctcgg tgcagatcgg    112320
     ccttccgtcc tgatcgatca ccacgcccag gatcatctgc gcgagctgtg ggcggtaatc    112380
     cttggagtgg ccccgcgcgc ccagcgtctc gccgccggca ccttcgaaat acagcgaggt    112440
     ggtgtccatg aacacgaccg agaggtcggt gaacagatca tgccgtcggg cgaagagccg    112500
     ctcttccacc agatccttca ccgtccgcgg tgcaaagggc gtggcatccc cctgttcctc    112560
     gtccagcaac tcctcgccga gccaggccat ggcgcggtag aggtgatgca ggccgagctc    112620
     ctcggtgccg ggaatgtcgt aatcgtcgag ccatttgtcg caggcgcgat ccgagcccga    112680
     gaccatgatc cggtggagca cggtggcgaa caccgcgcgc tcgaccggga actcgaactg    112740
     ccgcccggcc agcagctcct cgagcaccgc agcgatcccg ctctcctgcc acagccggcc    112800
     gaagagcaat ggcgcgccga accggcgcat gctcagcatg gtcgcctcat tctctatggc    112860
     ggagagcagc atcatctgct cgcaatggcg ggcgccggag gccaggagcc tcgcgagctg    112920
     gccgcttgct tcgagttcgt ccatccggcc gatggtcagc cgcacaacct ggcggacctt    112980
     gccatcgacc cgcttgttct cgacgatctg caggtagcga cggccacctg atggtttgat    113040
     gcggaagaac atgaccccga ctccggacac cacgttacgg agccgatgca agtaagatca    113100
     acacacaatc gcgcgatacg tggcactacg tttttgaaaa ctcatcaaac ggctccgaaa    113160
     aaaccgttat cttccaatcc tctatcgtgc cgttatcgta tcgttccggg ttccactgtt    113220
     gaagtcgggt cagactcaca gtacccatcc ggtcagagcc gcggacgagt ctatttggct    113280
     ctatctcggt ggatcaggat gatctcgcgc agattttcga taccaaagtc ggtgaaggct    113340
     atgacgccgc cgtcgctgag gttgtaaacc cagatcaggc cgtcttcggg ttccatctca    113400
     ttggcgatgt ccgcgagcca ctcctcatcc tcgccgaggt ctctggcgac acggtcaatc    113460
     gtgaagacgt ggtggatttt attggtctgc acgatcaggc ggccagggcc ctggattgcg    113520
     gtgtccagtt ccatggcatc aatttctcga tgctggcgac tggatgactg gcgatgcgcg    113580
     cgaggatgtc ggcgagccat gcctgtgggt cgacgttgtt catcttcgcc gtcgtgatca    113640
     ggctgtacaa catggcagcc ctttgaccac cgcgatcgga gccggcgaat agccaggatt    113700
     ttctgcccag agcaagggtg cgcagggcac gttcggccgc gttattgctg agacaaatcc    113760
     gcccgtcgat caggaaccgg gcaaatgatg accaacggtt cagcatatag tcgatcgcct    113820
     tcgccacatc attgtggcgc gagagtttgg cgcgctcggc acgcatccag atctcgagtt    113880
     cagcgacgag cggggcgccg agttgctggc gcaccgccag gcgttcggcg ggtgactgac    113940
     cgttgatcgc ccgctcgatc tcgaacagcg catcgatgcg ctgcaccgcg gccaaggcca    114000
     tcggcgccac gaaggcgggg gttttaccct gggccttgcg cttcgcgttc tgcgcgatat    114060
     cggccagctc gaagaatttt cgtcgggcgt gcgaccagca cgccgcctcg atgatcggtc    114120
     caggagaccg gttcaactcg tagagcttgt tgtagccgcc ataggcatcg gcctggaata    114180
     tgccgcggta tccggcgaga tgggtttgcg gatgaacgcc ggcgcgatca cgtgaatagt    114240
     agaacaccgc gcagggggaa cccgatccgc cgaacggccg atcatcacgc acataagccc    114300
     acacgcgcgc cgtatcggtc tgccctcgtg ccatcaccgg caccgtggtg tcgtcgccat    114360
     gcaggcgcgc acccgcgaac accatcgtct cgatgtgctt gaacaccggc tccagcgcca    114420
     cgcaggtagc accaatcaga tcggccaggg tcgagacgct gaggtggatg ccttccagtg    114480
     cgaaccgttc ggattgacgg ttcagcggct gatgctggcc gaatttatcg taggcgatca    114540
     tcgcgagcag gccggggccg gcaaaagcgc gtggaatggt gtggaagggt gctggttcct    114600
     gactgatctt ctcacaatcg cggcaggtga atttctcccg cacatgctgg atcaccttgt    114660
     attggcgggg gatggattcc agcgtctcgg tcaccgtctc gccgagcttg gcgagccgcg    114720
     atccaccgca gcaggcgcac tgggtcgggc ctggcaggac gacccgctcg cgcggcaggt    114780
     gctccgggaa gggctgacgc gacgggcgct tgcgggtgaa gccggcgaca gtcgtggttt    114840
     tggccttcgc ggccacctgc tcggcgcgga gttcgtcctc ggtcgcggtg gtctcgagat    114900
     cctcgagttc cagttccatc tgatcaagca gccgcgccgt gcgttccgcc ttgggaccgt    114960
     agagtgcacg cttgagcttc tcgatctgca gcttcagatg cgcgatatag gcttcggtat    115020
     cggaccgccg agcacggtcg cctagaatga tcgccttcag cgcagcgata tcattcggca    115080
     gggtcgaagg atcaagatcc atgacccgta tagaatcatg cgtggacggc ccattgagtt    115140
     caagtaggca ttgcaagctt tgatgacggt tcgaaagcga tcatgcgttc ggcctgtgta    115200
     cgcggccaca tgccgccggc ccagatgggt tccgcgagca acatccaaac acaagtgcgg    115260
     catattattt accggtgatt ctatcggatt ttgttgctcg tcggttcgac cgatcatcat    115320
     ctcttggtct gcccttaaac tctcggcacc ggcgcgcaga tcaggcggct accggctgat    115380
     gccgatacgc ttcaccacgc gccatcatgg cccagatgat ccgggccatc ttgttggcca    115440
     gagcgatcgc cgcgaccttg cgcggcctcc gctccagcaa ttgcaacagc caagcggtcg    115500
     ctgatttgct gcctggttta gcgaagcgga tcaccgccat cgccccgacc acgagcaact    115560
     gccgcaacct ctcattgcct gccttactta tctttcccat acgatgcttg ccgccggtag    115620
     aatgctctcg cggagtcagc ccgagccacg ctgcaaaatg ccgcccggtc tcaaaattcg    115680
     cagggttcac gttgagcgcc atggtgatcg cggtgattgg cccaacgccg ggaatcgcgg    115740
     cgaggagctt gctgaccgcg ttggccttgt gctgttcgag cagctgtctc tccagtgcgt    115800
     cgatctttgc atcgagatcc gtcacatgct gacccatttg ctcaaacatc gcctttgcaa    115860
     ttgctggaat cgcttcctcg gcagacagga gagcaagcaa tgctgtgacg ttcgcaccgc    115920
     ccttggcggc aacgatgcca aattccgccg cgtgcccccg caacgcgttg atcgcctggg    115980
     ttcgttgatt caccatgagt tcccgatgct tcacgatgat cgctgccgct tgctcatcca    116040
     ccgatttgac cggaaccgtg cgcatggtcg ggcgggatgc tgcctcactg atcgcttctg    116100
     cgtcgttgcg atcattttta ctccgcttca cgaagggctt cacatattgc ggtgggatca    116160
     acctgacccg gtggcccata ccgcccaaca cccgccccca gtggtgcgag ccggcacaag    116220
     cttcaagaac cacctccgtc gaagccaatt tgacgaagaa cggttcaacc tgagcgcgcc    116280
     tgatttcacg ccgcagtacc gggcgctcct gctcatcgac cccatggatc gtaaaaacat    116340
     gcttggacgt gtccatcgaa atacgcttaa atttcattag gcggcccttt cattaggttc    116400
     gttgttcgac cttatattgg cacattcgat gccggtgggc cgtccacccc aacacgaatt    116460
     tccagggttt cgctacagaa atccgctctg gaccaggatt ttccccagaa atcttcgcgc    116520
     ctacccggcc gcttgcggcc gccaggtttg ttgtggattt cgccagtcga tcccctccag    116580
     aagataaccg atctgaccag cggtgaggga cacaacgccg tccgcagtct gcggccagat    116640
     aaaccgccct cgatcaaggc gtttcgaata cagcgacatc cccacgccgt cgtgccagat    116700
     cgccttgacc agcaacccgc cgcgtccgcg aaagaaaaaa acatccccgc agaacggttc    116760
     ccgtcccaga ccttcttgca cttgcaacgc gagccccttc atcccgcggc gcatatccgt    116820
     atgccccgac gccagccaga tccgcacacc ggccgagacc gggatcaccg ccgcaccgcc    116880
     gtcatcaccc gacgcagggc ggcaacccca actccatcat caacccgaac acacgtcccg    116940
     tccggcagca cgatctcgat ccggctcgca tcggatcgcg tggctcgcct ctgcgacatc    117000
     ggatcaacgc tcgcgtcgtt caccgaagct gacttgcctg ccgcccgcgg catcgacagt    117060
     gccgcactcg ccattacccg caccggaatg aattctggta ccatcggcac cggcaccaac    117120
     tcaccgcgcc gaacctggcc gcgccacttc cacaattgcc ctctcgaaat ctcgtgccgc    117180
     cgtgcaacca gcgcaaacac cgcacccggc gcctcagcct ccgccacaat ccgcagcttg    117240
     tcctcatccc gccagcggcg ccggcgctct acccccgtga taatctccat ccgcccgccg    117300
     ccccttacca tgaatcagct cgtagcagcg cttttatgta cgcctccttg ccgtaccggc    117360
     agacggttca caccggatgg atacgactca cattttctgc aggcgacgct catgcgccga    117420
     caacccgcgc ctgaagcagg tcaggtttcg cgcgcccgta catctgtcgc ttgataagct    117480
     tagtacagat aatcttcccg aaattcggcc ggccgctgcg ctgcggccag gccatttatt    117540
     tccggcggcc tgagatggcc gaacgggtgg gcgagaatcg atttgctggc aaaagccacg    117600
     cgagctagtc gcctgtgaac tatgtgatct ggcggtgggc gaagccgagg cttggtgagc    117660
     ggtttgtggc agagagccat gcgacgaggg cacaaagaag cctgatcagc catctgcgga    117720
     ggaggcggag gttgtggccg acgccggcga ggacggcgtt gatggcatca ccgtcgacgc    117780
     cgagcaggaa gtttcgcccc agatggccat cggtcttcat gtggccgatg acgggttcga    117840
     tggctgtgcg tcggcgcaac tcgcggcgga tggtgggggt gatgccgcgt ttctggcggg    117900
     agatgaagat ccttctgccc tcggcttcga cgctgtggcc gcgatagccg cggtcgacat    117960
     aggcgcgggc gacggcaacg ccggtgatcc gctcgacctg ctcgatctgg ccggccaggg    118020
     tgtggccctc atagggattt cccggccggc tctgcatgcc gagaacgaac tgaccgccgg    118080
     gtgcggcggc gttggtggtg gcgatggaga ccttcacgcc gaattcgaag cgcgtcctgg    118140
     ccttgccctt gccgatgcac tcaacctcgg gcgcgtgcag ggaatagagc ttgtcggcac    118200
     cgcgatcgga gcgcttctgg cgaagcaggc gattgatcag gcccagcgtt tcggcgaacg    118260
     tggccttcgc ttcagcgttg cctgcgatct tgcgggtgat gtcacgagcc agccggccca    118320
     gccaggtccg cagcttgcgc acgcgagcct cggctgcgca ttccggtgat gatgaacggt    118380
     caatccgttc gatcgtgaac atcgattccg gcgatcatga acacctgctc gctctggcct    118440
     gaacggggcc tgacgggcgg ccggcggtca tggtggatcg ctgccactga cggttgcgcc    118500
     gtctcatttt tccgtggggt tcgtcaagcg ccctgatcgg attgtgtggt gacggcgtga    118560
     cgcttgcgca ggctcggtcc cttcagttcg atgcgatggg cgcggtgcac gacgcggtcc    118620
     aggatcgcat ctcccagggt gggatccccc accaggtcat gccagcgatt cacgggcacc    118680
     tggctggtca ccagcaggga gcccttttca caacgatcat caacgatttc cagtaggtcg    118740
     cggcgctgct cggcggtcag gggctcgggt ccccaatcat cgatgatgag caggcgggtg    118800
     cgttcaaggg ccgccaacat ccggggcaat cttccttcgc cgcgcgccgt cgcgagttcg    118860
     gcaaagaggc gtggcgcccg ccgatagagg accgagaagc cctcccggca cgccttgtgg    118920
     ccgagcgcgc aggcgagcca tgacttgccc acgccggtcg ggccgctgat gaccagatgc    118980
     tggctgtgcg agatccattc gcaaccggca agtttgtgga acagggctcg gtccagaccg    119040
     cgcggtgtcc ggaagtcagt atcctcgaca accgcattct ggcgcagccg cgcctggctc    119100
     agcctgcggg cgaggcgctt gttgtcccgg ctggtcgcct cacggtcgac cagcaacccg    119160
     agccaatcct cgcgggtcag atcgtcagcc gccgattggt tctgcatctc gatgaacgcg    119220
     tcggccattg ccgtcaggcc gaggccgcgc aggcgctcca ccatgggatg gatcagcatc    119280
     ttgtttcctt tcagtgatag tagccggggc cacggatgtt ctcgtggaac aggctgggtt    119340
     gttcggtctt gtccgtggtc ttcctcccct gagcattctt caggatcgca gcgaccgagc    119400
     cgtaggagcg ggttccgagt gccaaggcac gggcgcaggc ggcatccagc cgctcggggt    119460
     cgtagcgctt tgccaatccg aggatgccaa tgcaggagcg gaacccctgt tcgggatgcg    119520
     ggcgcgagcg caggatgatt tcgaccaggg cggcggtgtc gtcaccgacc gcagtggctt    119580
     cgcgcaatat ccgttcgtgg gtccaatcgc gatagcgccg atgcgaactc ggcatgtgat    119640
     ccgcgattgt ggtcggccgg tgctggcaga agctgcgctg gtgcgtggcc accagcttgc    119700
     cccggtggaa gatttccacc gtcttcgccg tgatccgtgc ctctactgtt tcgcggatca    119760
     accggaacgg caccgagtac ggatgatgtt gaccatcaaa atccgaggcc ggctggcagc    119820
     tattttgggt cgtctccctg tctggggctc cggccaggct ttcgtggccc agttggttgc    119880
     caaccactta ccacgcgttc ataagcgcgt tcggattgct caagccttgc ccgctcttcg    119940
     gctctcgtaa tcgggttgtg ataccgtccg gcgatcccac ggcgcccgcg ctgctgcggc    120000
     cggccggcgc ggagttcgac ggctctgcgt ttgcggccta ccaggcttgg gcgagcaaaa    120060
     acatattcct cctcgcgatg aagaacatgc caaatgatga ccgcgagctt tctggcggtt    120120
     gcgacagcag caatctggct cccccgccgc gccatcaccc tcatgaaaaa cgaccttaat    120180
     ggccctgggg ctcgggatgc tgcccacgcg gcctccacga gcagtgaccg ggccagatta    120240
     gcgcctcgtt tggtgatgcg accatgccgc gcggggccgt tgcccgattg ccgaacgctg    120300
     gggttgagcc cgaagtagct caccagcttc tcagacgact caaagcgctt gtggtccccg    120360
     ataaccgcca ggagcccgag tcccgagacc atgtcgatcc cggtgatcgt tatcatccgt    120420
     tgcaatctga cgtcgttgac tgcctgggtc gccagatcgc gatccaaggc agccagatcg    120480
     gcggccagtc gatccaactc tcgaaaacca cgttccacgg cctcccggtc gccctcaggc    120540
     agattttgcg tcccgagcca cttcttgccg gtagcagtaa acagatccga gaaggggcat    120600
     tgcacgatca agttggaatg gaggatcgcg tgcacctcgt tcttcaaacg agtgcgatga    120660
     cgtaccagct gcgaccgacg ggagaacttt cgtcgcagga tctcggtttc ctgatcgggg    120720
     atccagactt gcggcagaaa gcctgttgcc tgcaactggg caagcacacc tgcatcgatc    120780
     ttgtcggtct tgattttcgc atccgcgata agcctcacct gcagcgggtt cgccaccacg    120840
     atcttgccaa ccatcgggcg caggacacga acgacggcaa aggtgtttgc cgtcgcctca    120900
     agaacgatct cgtcgcttgg cagaagtcgc cgcccaaagg cagtcaggct gtcgcggtcg    120960
     agttgaacgc gccccatctg ggtgtaattt ccaccatcga gtgctaccgc ttgcgcgaag    121020
     tcacgatgga tatccagtcc aataacacgc ggcaccgttt acctccttct ccttcgcgca    121080
     cgacggtggg caacacgaca attacggatt cgcgctcgca gcgcatccag gtcagtcgca    121140
     ggggcggcca gataaaagaa cgagctctca gctcagactc agttgcggcc tacccacctc    121200
     cgtgctcccg atgcccctgt cctggatgag cgcatcatat cgcagggtgt gaccctgcgc    121260
     agaacggtga catcatcccc atcatgcctg ataaaagtgc ttgtcgatct cgacatggta    121320
     atcgaggttc acgcggcagc gcttccagtc cgcgtattcg taaggcgtgg gcggcagtgg    121380
     ttgcagggcc gggcggtcga gctgctcata gagcgcccgc cggttggtgc cccagccgcg    121440
     catcggtcga tcgttcacct gatcgaccaa ttcgcgaatc gcctggttca attcagccag    121500
     cgagaagaag cggcggttgc gcagccgtgc caggatccag cgctggacca cctgcacgcc    121560
     gacctcggcc ttcgccttgt cccgcggctt gtagggccgc gccggaatga tcgcggtgcc    121620
     gtaatgcgcc gccatgtcgg cgtaggtgcg gttcaccgtc ggctcataaa agcacgcgcg    121680
     cgtgatcccc gcgcgcagat tgtcgctgac gatctgccgc ggcgtgccgc caatcgcggt    121740
     caacgcgtta acgtgcgcgc cgatccagtc cgccagcccc tggctccagg tcgcttcggc    121800
     gtagatgaag ctcgaggcac cgagtacggc aacgaagatt tcggcccgcc ggatctcccc    121860
     gctcgcccca tcgatcactt ccatggcgtg gccagcgaag tcgacgaaca gccgctctcc    121920
     cgccatatgt acctggcgca gcgtcggctt cagacgaccc agccattccc ggtagagatc    121980
     gcaaaaccag gagtagctga acccgtccag gccgccggcg ccagcccggt attcttccca    122040
     cagcagcgac agcgtcacat tcggccggcg caattcacga tgcaccgccg cccaatccgg    122100
     caccggccgg cggtccggcg caacatccgg cagcggcgga tatagcagcg tctcaagctg    122160
     cgcgtcgcca aggtcttcag gcagaggcca attcaatccc gccagccgcg cccggctcag    122220
     gtaactgttc acagctccta cgctcagacc cgtactaccc gcaatcgctc gctggctcag    122280
     tccctgcgca aatcgcagcc gcaaaacatc acgtatcttc cgcatcgaca atctctctcc    122340
     cggcattccc atccctcgct gctcagcaaa ggatcgggat tacccctggt tgaagactat    122400
     cagcagcggc gccccaccat cgcactccag gacacgttca tgagcacccg aaccggtgtt    122460
     cacgatccgc cggaatccgc gttcatgatc aaccggatta ggcgttcaca atcaaacgga    122520
     atcgatgttc acaatcaacc ggaacgcgca gcctcggcct cgcggcgttt gccaccatgg    122580
     tgcaggcgcg ccgcctcctg cctggcgtag cgcgcgaccc ggcgatacga ctggcgtagc    122640
     gtgataccgt gccggcgtgc catccgcgcc agtgtctcga tgccgctgtg cagcagcttg    122700
     ctgtcggtcg gatgcgtcac ggcctttggc tggaccgtgg tatcgatggt gacccgctcg    122760
     tagtgcttct ccgccacggc cccaccccgc tcggcggccg ccagcgtctc ggcgagcagg    122820
     gcctccatcc gctccgcccc gatccgcttg cgccagcgcg tcatcgagga tcggtcaagg    122880
     ggcagcgtgt gctggaaatg cgtctcgccg cagaatgcct ggacatacgg actgtcgaga    122940
     tagcgcgcgc aaaccgcttc gtcggacagc ctatccatgt gcttgagaag atgcagcgcc    123000
     accatcaggc gggtcggcag cgccggacgt cccgccgcct cggcgtagag tgcgccaaag    123060
     cgttcctcga agacccgcca gtcgatcagc cgggccagcc gcaccagggg atgccgctgg    123120
     tcgatgatgt tctccagccg cgagcggaac agttcgagat catcctgcga ggcattcagc    123180
     ttcggcggca ttctttcctc cacgccaaac acatgatggt cggcatcaac gggagagaat    123240
     cacgatcgcg accaccgcgc aacgctccaa cggttttgca aggtttttcc cctcaagcca    123300
     cacagacctt gcaaatccca atattgcccg tcgctaaaaa gtcatgacca aatcagcaaa    123360
     gttcgctttt tcacgggtga cgagctaccg accggctgag ccggccttgt cgtgatcaat    123420
     tgtcgaatcc tgtctctcgc aggaaggcgc ggctcgcagc gaggtccgcc agaatactgc    123480
     tggcgttgcg cggatcccgt tcctgctcga tggtgatata accgccgtaa ccaagctctc    123540
     tcagcaagga atggatcgcg cggtaatcca cactgccctt accgatcgag cacatgagac    123600
     ccttggcaca agcgtcaaag aagcggacac gctctcccat caccgcgctc tgcactttag    123660
     ggtcgatgtc cttgaaatgg atatagtcaa gccggtcggc gtagcgccgg attgtagcga    123720
     caggatccat accggcatag gccagatgcc cggtatcgag gcaaagcccg gcgacgcctg    123780
     gtccgatgtc atccgcaagg cgctcaattt cgtcagcgaa ctcgatatat ccgccggcat    123840
     gcggatggat ggttgcacgc acaccgtatc tgtcggtcgc aagttcggca atcgctcgaa    123900
     tattgtccat catagccgcc caggcggctc catccaaacg aggcgcccgc tcggaatggc    123960
     ctgcggcata atcacgctcg tcatgccccc aatccataac cgtcagataa ggggcttcgt    124020
     accgctgacc cgccagctgg gccggccgcg gcagggcgca gacgaaagcg cagatctcat    124080
     gggtctgccg caacagcatc gcgcgattgc ccgggcttgc caggtcactg aaaatcgtgc    124140
     cggcgacgat cgtcagaccg cgctctgaga gcgcttgccc tagccgtggc acgtccagcg    124200
     gcatatagcc ataggggccg agttcgagcc ccccaaagcc tgccagcgcc gcttcgtcga    124260
     gcactttttc ccaggccggc agatgggggt tagacacatc atccaccccc cagcagcagg    124320
     gtgcacatgt gattgtgaca ggaagcgcca tcacgaactt tcagggttga tcgtctcgaa    124380
     ggtcatcttg cgatggaact gctcatggaa ggcgacgaaa gcctgcgtgt atttttgcgc    124440
     catatggaag tcgtgcgcgg ccttgtcggc ccaagcttcc aagaaagcag tttgtcggga    124500
     tcatccgtgc aggtaaaaaa gtcatacgcg aagcagccgc tttcggcgcg catcgcgcgc    124560
     tgtgcctcca ccgcacggtc aagaatgcgg tcgcgcattc caggctcaag cgtgatggtt    124620
     atgatgaatt tgcacatctc ccgctccgtc aatcgatgct gaccacccga ccttcggccg    124680
     cactgatacg tgcagcgtca agcacggcga gaacggcgat ggcctcctca gcggtaacgg    124740
     gcggttggcc tcctgtccgc acagcctcgg cgaaggcctc gtaatacgcg tgataccgcc    124800
     cttgctccga agggatcttc gtcgcgccgt cggctgtccg caaaattccc cagtgagcct    124860
     cgtcatcata tccccaactg tcaggattgt tgattgggcg cttgccggca aaaagcgcct    124920
     gagcctgaac gtctgtcccg gcagcaacgt aactgcccgc tgagccatag gcgcgcaact    124980
     cacgcgtgtt gagccggttg accttgctcg ccgagatatg agaatgcaca ccgctcgtat    125040
     ggcgaagcgt gagcacgaaa cccgcatccg tcggtccttg cggcaagacg accgtgtcga    125100
     gctgggcatc aaccgagaca acaggaccaa taagccacat cgcctgatca acgacatggc    125160
     taccgagatc ccagagtagc cctccagtgg ggcccgcctc cagcgttgcg ggatcgtcaa    125220
     aatccatgcg tgaatgcagc cgccacaact tgccgagcgg gccctccaga agcagctttt    125280
     gcaaggtctg gatgtcggca tcccagcggc ggttgtgata gactccgagc gtcacgcccc    125340
     tgtcctttgc cgcctgcgcc agcgcccgtc ccgccgccgc actcggcgcg aagggtttat    125400
     cggcgatcac gtgcaccccg gccgcaatcg cttctagcac cagatcctgc cgcgtttgcg    125460
     ggggtgtggt gattgtcacg gcatctactc cggccgagag cataccctgc agactcggat    125520
     agatcggggc atcggggaaa tctgcctttg ccttggcgat cgtctcaggc gcccgcgcaa    125580
     cgatgcctgc aagcgccacg cctcgggcag ccgcgatgaa gggcgcatga aaatgctgtc    125640
     cgcccgtccc atatccaaca aggccgatgc ggatcatgct cagcctcctt cagcggatga    125700
     tggtggcttg cagcgcatcg atggaagact ggatgccggc ctcggtggac atggtgaagt    125760
     cctccatctc caggctcacc cagtcattat agcccatcat gccgacgacg gagaaaaact    125820
     ccttccacca ttgcagatcg tggcccgcgc cgacagcgac gtagttccaa cagcggttgg    125880
     cgacgtcggt gacttccttg agttcaagca aaccgttgac atccgccagg ccgcgctcga    125940
     tccgtgtgtc cttcccgtgg acatggtgaa tggcgtcgcc gagcgcacgc gccgcggcga    126000
     tcggggaggc ccccatccag aagagatggc tggggtcgag gttcatgcct accatgggcc    126060
     caacctcgtt gcgcagtctc agcaatgttt ctgggttcca gaccagcatc gcggagaaat    126120
     tctcgagcgc gatcttctct acccccacgc tgccggcatg cttcaccagc ccatgccaat    126180
     aaggataggc ccgctcctcc cactgatagc ggtcgcgctc aggcatttcg acaggccagg    126240
     acttcgtata aacgagccag ttcggcacgg tgtcgccggg cgccgcctcc ggcaggcccg    126300
     acatggtgac gatcttcttc acgccgatct cgccggcgag cgtaaaggtc tcctcgatct    126360
     ccttgcggtg ctttcgaccc agctctccag ggtcaagagg attgcccgaa cagttgaggg    126420
     cggcgatctg aagtccgcgg gcctcgatct ccttgagctt ctgtttcaga agccccttgt    126480
     cggccagcag ctcctcggca cggaagtgcg gcgcgggaga ccagccgccg ccggtcatct    126540
     cgatgccctc aacgccgagc gccacgcatt tatcaagcat ttctgtgaaa gcgtagttgc    126600
     ccatcacgtc ggtgcagatg gaaagtttca tggttttggc ttccgttgaa cggtggttat    126660
     ttgaaatcga cccaggcagc gcccgcatcg gccgagcgca cacaattctc cagccagcgc    126720
     acaccgtcgg tgccggcctt gatgcccggg tagtgatggg tcttcaggaa ggcctcgtcg    126780
     ccgcgtgcct tcgcgtcgat cgcctgggca atccagaggt agatgtttgc ccagctatcc    126840
     cccaacccct cggtgtgcag ggcgcccatt cggtcgatgg cgaggctttc ctcttcgagg    126900
     taaagcatgc cgtgatgcat gatccgaacg ggctcgccct gaacctcgta aatcagctga    126960
     tcgggatgac tgtcggacca ctcgaccgag gctttcgagc cgatgaagcg gtagcgttgc    127020
     gaccccatat tgccggcgtt gaccgatgaa acccaaaggc gcccacgcgc accattgtcg    127080
     taatgcatga gaaccgtcgc atgatcttcg agtggtgcgc ggctcgggat gaaggccttg    127140
     cggtcgcaga gcagcttttc aaccttgaga tgcggcagca caatctcgga aaggtagtag    127200
     acatgtgttc cgatgtcgcc caaaacgaat gtcgcgccgg cggtcttcgg gttggtgcgc    127260
     cacttcacgg catccggcgc atcggcgtca tcgccggcgt tgaaaccgtg ggtatactgc    127320
     atgtcaacga gacggatctc gccgagcatt cctctggcga ccatggccgc catctgccgc    127380
     accatgggat gcccggtgaa gccgtaagtg acgccgacaa tcagctcctt gcgctcggcg    127440
     agcgcggcaa tctcctcgca ttcagccgtt gaaaaaaaca gtggcttttc acagatcaca    127500
     tggatattgg cttcgagaag cgccttggtg atctcgtaat gggtgaaatt cggcgttgct    127560
     acggaaacga cgtcaacacc atcctcacgg ctcctttcgc cgcaaatgag ttcttgatag    127620
     gttgcatagc agcgatcctc agagacgccg agattgatgc caaagtcacg ccctcgcgcg    127680
     gcattcaaat cgaaggcgcc ggcaaccagg cgataggtgc tgtcgcgtaa cgccccggtg    127740
     cgatgcttgt agccaacctg gccggtccga ccacccccga ccatacccca gcgcagaggc    127800
     tgactgatgg tgcgttctcc gttgatcatc ctatcatctc cctatagtag ttgcgtttct    127860
     atcttgatgt ttcggcatag aggccggcct taggcttcat gctgaccgcc tcgcggcggc    127920
     cgctttgcgc agcgcgcagc gcggcgtcgg cgaccagcgt ggccgcatag ccgtcccaca    127980
     ccgagggccc cgccgccgtt ccctggctgg ccgccgcgat ccattcgcgg aactcctgat    128040
     cgtaggcttc gatgaaacgc tcccggaagt ccgcagggat tgcctggcgt atgccatatc    128100
     ggtccgagat aaccgtcgcg ggccggtttg gaagagcagc cacaccggtc tcgcaactca    128160
     cctcgccgcg gatgtcgtag ccgtactcga tattgaccga gatctcgaca tcgacaatcg    128220
     cacccgagac catgtgcaac agaacgatgg tcgggtcgcg aagttcccct ccctgccggg    128280
     accggcgggg aaaccgcacc tccacgccgg ctatctcatc gttgagcagc cagcgcgaga    128340
     tgtcagcatc atgcaccagt gtgtcgttga ggggcatctc cgaggtgtag agcccctccg    128400
     ggacggaagc gttgcgatga accgatcgat agatcaacgg caagccgagg ctaccatcgt    128460
     cgatcaccgc cttgagcgca cgatagtcgg catcgaaccg gcgcatgaaa ccgacctgaa    128520
     caagacgccg cccgaaggca acttccgcat ccatcacgcg cagtgcgcct tcttccgatg    128580
     tcaccatcgg cttttcgcaa aagacgggct tgccgacggc aatgcattcg agcagttgct    128640
     cctcatgcgc cgggccccag gaacatatga cgaccgcttg caccttctgc gaccggatca    128700
     gagcgtgggg ggtgtcgcat agctcggcgc cagcgggagc gattgacgcc gcgcgcttgc    128760
     gatcgatatc cgcgaccgcg acgacggaga cgtcggagag cgtgtgggta aggcggcgga    128820
     gatgatcctg gccaatcatc cccagaccga tgatgccgac ctgaaggctc attccttgcc    128880
     ccaatacttg tcaattagcc gctgcatttc cccgcgcatg aagacgccgg actcgtcggc    128940
     tttctcttcc caggcaaaaa cgcaggcggt catgatgccg tcgaagccga tttcatgcag    129000
     ggtgcggtag aaatcgtccc atggcacctc gccctgcccc atgttgagat gctggtgcac    129060
     ccgcgccgtc gagcccggag gattgatgat gtaacgcagg cccgaggatg ccttgtgatt    129120
     gaaggtgtcg gctatatgga catgggccag cacgtcggcg gactcgcgca gcatggcgac    129180
     cgtgtcatcg ccaaagtaga atgtgtgcgg cgtgcagtag agaaagcgaa cgcggggcga    129240
     attcaccgta cggatgaggt ccaccgaagg ctgcagcggt tcgacccagt cctccggatg    129300
     cggttcaata tggaggttga taccctcgcg ctcgagaatc ggcacgagct cctccatgga    129360
     gcgccaccag gcatcctcgc atgcctcgat catggatccg gtgtggcagc aataacaggt    129420
     gcccttgtcg ggatgaagcc cacggccgaa ttcggaattc atcgtgtcaa cgcccatctc    129480
     taccgcgatt tcgatagccc gcttccagtg gcgcaccgcc gcctggcgtt cgtcctcgtc    129540
     gttggaagcc caacggtaca tcggaagaag cgtcgcgatg ccaactttcg catcggagag    129600
     tgccttcttg aaggtcttga tccgatccgg gaaaacgcgc ggtgctttga accattccag    129660
     gaaatcgccg cgcgggctga gctcgatcca gtcgtagccg agttccgcca ccttcgaagg    129720
     tagttgctcg agagagagag gacggtgcat aaacgggtcg agtgcgattt tcattgctat    129780
     tcacctcgca ttgtgttgga tctcccctcg cgcgctcgcc ggcaccgact ggcatcccca    129840
     tgtcaccgcc atcattcagg tcgaacgcgc agtcgccacc cgcaatcccg aaaccggcct    129900
     gctcaagctg acacacgaca ccgccttcta catgtacaaa tatttttgca gacttggcgt    129960
     gcagcaacaa tctcaagtcc agaggctgtg cgccttctct ctcaacagca gagcctcggc    130020
     ccagcggtcg gtcaaatcct gaccgtccgg ccccgtgatg gcacaagggg ccgggccaag    130080
     ctcgcaggtg aaggaaaaag tggcgtcagg cgcggcgcgc tcccgccatt tggcgaaacc    130140
     catgcgccac caacgctcga actgcgtaac ccaaggctga tgttgcggaa aaatcagtgg    130200
     caactgaacc tggtgcgagc cagcgacccg gccatgaaag gcccaggcgt ggtccagaat    130260
     gcggttgatc gcggcttcag tctccgcggg gatgggcaac tccatctcgc gcgcattgac    130320
     gtaatgcgag aggtcggcgg tgaaacgcag attcgggaaa acatcaagaa gctgcaacgt    130380
     gaacagcagg tcgttggtca tccggccacg gtgtgtctcg atattgaccg cgacacctgc    130440
     cttctccgcc agtctttgcc agccttccaa aatcggcagg caggcatcga ccgtcatggg    130500
     gcaggccatc gcctggatgg tgatgtggtg acagccgaac tcgccggcaa catccagcgc    130560
     cggctccaga tcagctaccg tgcgcggaaa aacctgcccc tcaatggtca gaccgtaatc    130620
     cttgagcaaa gccatcaggg ggaccacatg ggcgcggtca tagaaatgat cggtcacgcc    130680
     atcgaacccc gccgccgcaa tccgctcgat ttttgccgcg aggcttggct cctccgcttc    130740
     gcccagcaag cgctgcatgc cccagaggga ttggaaaatc aggagtttct gcatgtcatt    130800
     ccatattcgc acgaggttgg agaagagttt tgagtttaac tgccgggtct tgcagcgccg    130860
     tggcgggcgg gcaagcgccg gtttcgatca gtttttccgc aagcctgatg tcccttgcga    130920
     tcttgccaat gggaccgaag gcgctcgccc ccacgatgcg cccagatttg aggtgaaaga    130980
     gaaatggcgt tccgtcatta tcacgcgtta cggtctcatc accttcatcg ggcaggcccg    131040
     caatttgcag cgtgtcgcca tactgctccg accagaacca ggggatcgac gcaaaagact    131100
     ccgttgcgcc cagcatggca ttggcggcgt ggcggccttg ctcccccgca ttgcgccatg    131160
     cttcgaggcg caggcggcgc cccccgaaaa ccggatgcgg gaaagagcaa caatcgccag    131220
     cggcaaaaat cgcggggtcg tccgtggcaa ggtgctcatc gacacggatg ccattgtcga    131280
     tggcaagacc tgccgcttcc gcgaggcatg tctgaggaac ggcaccgata cccacgacga    131340
     tgacgtcagc ttcgagtgct ctgccgccgg caaggatgac ggcgcgctcc tcgatagcgg    131400
     caagggcagc tccctcaatg atggtaacgc ccgcggtgcg atggcgcgtg gtgatgattg    131460
     ccgcgagctc cgccggtacg gcacggccca agacgcgcgg ggccgcctcg acgatggtga    131520
     cgtcgcaacc tcgctccacg gcactggcgg caacctcaag cccgatgaag ccgccgccga    131580
     tgacgacgag ccgggcgccg cgagacagcc gggcacggag agccagggcg tcgttgaatg    131640
     tccgcaggta cagcacattc cgcgcctcag tctccggcac gctgagggtt cgtggccgcg    131700
     cgccggtagc gagtaaaagg cgggaataag aaaggcgggt gccgtcttgc aattgcacgg    131760
     ccctagcttc gcggtcgagg cccgttgcca caacccctga ccgacagaga atattctggc    131820
     cggtgagcat gtccgcgccg ccgatgagcg tcggaatggg aagatcggcc gccgtcagga    131880
     ctgttttgga tagcggcgga cgctcatagg gcggatggcg ctcggcccca atgatcgtta    131940
     tggggccagc gtactctctt tcccgcaagg tgagagcggc gaggacacct gcctcccccg    132000
     cgccgatgat aacgattcca ggatcacttg tcgccggcat gatcggcctc aaccaagatc    132060
     aacaaaaata cggccatctt caaccttcac cagaaaagtc ctgagattga tgcaggccgg    132120
     cgcgcccttg gcctggccgg ttggtatgtc gaaacggcca ttatgcttgg ggcattcgac    132180
     aatgcggccc attacgagac cgtccgagag atgcacattc tcgtgcgtgc agaaaccgct    132240
     ggtcgcaaaa aaacggtcat cgtccagccg gtagatggcg aggctttgtc cctcatggtc    132300
     gaagcgaata acatcttcct catcgatttc gtttgccgca caggcattta tccattgggg    132360
     catttcatgt tctccgttat tgttttttcg gccggttgtg ccgtcgcatc cacggatgcc    132420
     agctgcgtgg cgcggggcaa ctcacgcacg atatggtagt tcgggtcgcg gcgctgcttc    132480
     agcaaagccg ggatgatctc ccgataggcg gcaaggatgc tgggataagg ttgcgggcat    132540
     tccgccttga tcagttcatg caaagtaggc agcgcatgat agggcaccat cggaaacatg    132600
     tggtgctcaa cgtgataatt catattccag tagacgaagc gattgatcgg gttcatgtag    132660
     acggtgcggc tgttcagccg atggtccagc acgtcctcgc aaagccccgc atgctgcgtc    132720
     gcgccataga cgatggaaag cgcgccgcca tagagcgtgg gcaggcccac gagcatcgcc    132780
     ggaatccagc tatgcaggcc gaacgagagt gctgcgacag tgagcagaat ggcgatatag    132840
     atccgcgcga cgagaaacac ttttttctgc tccatcttgg ggatgaaggt ctcctcctct    132900
     ggagccagcc ggccggacgc atggatcgca agtttttgca gcgcgaaaaa gctcgatttc    132960
     agggcgaaga cattgagcag gacgcctacg aaatctggcg gccgtttgaa agaaatctcc    133020
     gggtcgcgcc caacgatgat ggtgtcggta tggtgccgcg tatggctcca ccgccagacc    133080
     gttggttctc gcatgatcat gaaacaggca agctgataaa cggcgttatt catccatgcc    133140
     gtcttaaagg ccgtgccatg gccgcactcg tgccagcgcg agtcagaggc cgaaccatag    133200
     agtacgccgt aaaccgcaaa gaacggaacc gcgagccaac tgccccagaa atggacaccg    133260
     aggatcgcgc aaacgagcat gacgccgagc cagatcaccg tgtcgcggat ggcggggcca    133320
     tccttgcggc gcatcagttc tttcatctgc ttacgcggaa tagggtgcgc ataccaattc    133380
     cccgaagtga gtcctcgctc ctcggcacga tgtgcctccg cgcccaccaa gctgtaatct    133440
     ctgcgttcca tcacaatcgc ctccatcggc ttcctctatc ctgaattatg cacgagggtt    133500
     ggcaggcatg gcgtaagccg ttgatttgat gtaagaattg ggtgtcgaga ccaaatcttc    133560
     atcagcacgg aacgcgatgc ccgccacggt tgaaactacc ccatgcctcc ccggtctgtc    133620
     acctgtcgcc ggcaaaccgg tgctggcccg cttcgacggc gagatgctgt cctctgacgg    133680
     cggtctgctg gcattgcgcg aggtcgagaa gcggctgggg attgccgcgc agttggcggc    133740
     ctgcatcgat gatccgcgca cgccggagcg tgtccagcat gggctcgacg agatcattcg    133800
     gtttcgcatg ttgatgatcg cggccggtta cgaggatggc aacgacgccg accggttgcg    133860
     caacgacccg atgttcaaac tcgcgatgga gcgtctgccc gaggcgggcg atttatgctc    133920
     gcaagcgacg atttcacgca ccgagaattt gcccgggcct cgcgcgctgc tgcgcatggg    133980
     cctggcgatg gtcgagcatt attgcgcgag ttttcgcacc atacccaacc gggtcgtgct    134040
     cgatatcgac gataccttcg atgccgctca cggcgcgcag caactctgct tgttcaacgc    134100
     acaccacgat gagtacggtt tccagccgat tgtggtattc gacggcgacg gccggatgct    134160
     cgccgcggtg ctgcgtccgg cgtgtcggcc aaaaggggcc cagatcgtca aatggttgcg    134220
     ccggctgatc gacgccattc gcagccactg gccccgcacc gcgatcatgc tgcgcggtga    134280
     ttcgcactac tgcacgccgg aggtgctgcg gttctgtcgg gcgcgtcgcc tcgattacat    134340
     cttcggcgtc gcaccgacca cgacgctgcg caagcacgtc atcgcgctgg aggccagcac    134400
     cacggcgcgc gcgcaacaag ctccgggaga gaaaatccgg cgcttcaaag agttcaatga    134460
     tggcgcagca agctgggacc gcgtcgagcg gatcatcgcc cgcgtcgagg ccgggccgct    134520
     gggggtcgat acccgcttca tcgtcaccag cctgaaggct ggttccccgc gcaccctgta    134580
     tcaagagatc tactgcgcgc gcggccaggc cgagaaccat atcaaggcgt ggaagaccca    134640
     tcttgccgcc gaccggacct cgtgctcgcg ggccagcgcc aaccagatgc gcctgtttct    134700
     gcatatcggc gcctactggc tgatgtggag tttgcgctcc ctgatgccgc gccggtcgcg    134760
     ctggcgtggt atccagttcg ataccctgcg cctgcgcctg atcaaactcg ccgtccgcct    134820
     cgaaaccctg aaacgctcga tccgcctgca tctgccgcgc tcaatgccag accaggcaat    134880
     cctcggctac gccctggcca gactgcccag gctggtcatc tgatcactgg ggcgtttgcc    134940
     ccgtccggtc ccgatctctg ccacatccaa cgccaacaca tcatagagcc taccaaaacc    135000
     agccaggttc ggccggtaag ccgtcacgcc cgcacgatgt caggttgaac agcacgcctg    135060
     agaaaaatca gaggaaatgc gctcgtgaat aatcccggct atgatcgtta tctttccgcc    135120
     ctatactcgg agattgcccc gtccctccgg atcattttga tggtttccca tcattcagct    135180
     atgtttcagg caaagcggag gaagacagaa tggaacggcg caaaatccgt attgggcttg    135240
     aagatgtggc gcagcgcgcc ggcgtcggga ttgcaaccgt cgaccgtgtg ttgaacgagc    135300
     gaggaggcgt ttccgccaag gccgaacagc gcgttctcga agccgcgagg gcattgggac    135360
     ttcgccgcca actccctaca ccccatgcgc ggtcattgcg catcgaagtc atcctcgcac    135420
     gcccgacaac gcccttcatg aagcgtttgg ggatggccgt tggccaagtt gccgcaactc    135480
     tcgatcgatc catttccatt ctgcgcacga gcatcgacat gaccgatccg tcgcgcgtcg    135540
     cgcctcggat cagaagttcg cgcgctgacg gcatcatcat ctattgcgag gagcagcttg    135600
     agaatatcgc ggccattcac gccgccacca cggttaggcg tccagtgatc tgcgtcgtga    135660
     ccgatgtgcc agattcacca cgcatcgcct atgtcggcat cgatcatgga aaagccggac    135720
     gcacggcagg attcttcgca gcgcgcatgg ggcgccagca tggcaccgcg ctcattatct    135780
     cgaccagcac gggttttcga gcccataagc agcgcatcga gggatttcgt gatgcgctca    135840
     acctgcacgc gcccggcatc aagatcgcgc ccgtgatgac aacgaacgac gaggccgaac    135900
     gcgcctatca ttgcgtcatg cgggcaatgc gcgactggtc tgacctcgtg gcaatctaca    135960
     ataccggcgg cggcaatgaa ggggtgggtc acgcgctgca cgacggtaag catggcgatc    136020
     cggtcatttt tattggccac gaattgaccg aagagagcat tggattacta cgagacggcg    136080
     tcatgactct caccattgac caagcaccgg aattgcaagc gcgctgcgcc atcgacctca    136140
     tgctcagcca tctcggccgt ggtacggacc aagcaatgag cagcgaaatc gctttcagcc    136200
     tgcatacgat ggagaattgt tgagaatgaa ttcccttaga acctgaacaa aaaagatagt    136260
     tgagcgattt cagttagttg tgattctgtt ggtttgcaac aactgacgga atcacgatga    136320
     ctcggactga aaccgctcgg cggcaatact gccgtgatga tcttcgctat gcaagcaacc    136380
     cgatccgcgg cgcgcggaag gcaagcactg caagctgccg cattgttcgt ggatgacgta    136440
     gtcggcgccg gccgccgcgg cgagcgcgcg gccggcggag cggtgatcgg catgcagatg    136500
     cgtgtcgatc acgagacgga tcggcgtcgc cgaggtcgat gcggccagca aatagggctc    136560
     gatcgggaat agcgggtcga cgaccacgcc ggccccttgc cgacacagtc gagcagatag    136620
     gaggtcctag cctgaattat gcacgagggt tggcaggcat ggcgtaagcc gttgatttga    136680
     tgtaagaatt gggtgtcgag accaaatctt catcagcacg gaacgcgatg cccgccacgg    136740
     ttgaaactac cccatgcctc cccggtctgt cacctgtcgc cggcaaaccg gtgctggccc    136800
     gcttcgacgg cgagatgctg tcctctgacg gcggtctgct ggcattgcgc gaggtcgaga    136860
     agcggctggg gattgccgcg cagttggcgg cctgcatcga tgatccgcgc acgccggagc    136920
     gtgtccagca tgggctcgac gagatcattc ggtttcgcat gttgatgatc gcggccggtt    136980
     acgaggatgg caacgacgcc gaccggttgc gcaacgaccc gatgttcaaa ctcgcgatgg    137040
     agcgtctgcc cgaggcgggc gatttatgct cgcaagcgac gatttcacgc accgagaatt    137100
     tgcccgggcc tcgcgcgctg ctgcgcatgg gcctggcgat ggtcgagcat tattgcgcga    137160
     gttttcgcac catacccaac cgggtcgtgc tcgatatcga cgataccttc gatgccgctc    137220
     acggcgcgca gcaactctgc ttgttcaacg cacaccacga tgagtacggt ttccagccga    137280
     ttgtggtatt cgacggcgac ggccggatgc tcgccgcggt gctgcgtccg gcgtgtcggc    137340
     caaaaggggc ccagatcgtc aaatggttgc gccggctgat cgacgccatt cgcagccact    137400
     ggccccgcac cgcgatcatg ctgcgcggtg attcgcacta ctgcacgccg gaggtgctgc    137460
     ggttctgtcg ggcgcgtcgc ctcgattaca tcttcggcgt cgcaccgacc acgacgctgc    137520
     gcaagcacgt catcgcgctg gaggccagca ccacggcgcg cgcgcaacaa gctccgggag    137580
     agaaaatccg gcgcttcaaa gagttcaatg atggcgcagc aagctgggac cgcgtcgagc    137640
     ggatcatcgc ccgcgtcgag gccgggccgc tgggggtcga tacccgcttc atcgtcacca    137700
     gcctgaaggc tggttccccg cgcaccctgt atcaagagat ctactgcgcg cgcggccagg    137760
     ccgagaacca tatcaaggcg tggaagaccc atcttgccgc cgaccggacc tcgtgctcgc    137820
     gggccagcgc caaccagatg cgcctgtttc tgcatatcgg cgcctactgg ctgatgtgga    137880
     gtttgcgctc cctgatgccg cgccggtcgc gctggcgtgg tatccagttc gataccctgc    137940
     gcctgcgcct gatcaaactc gccgtccgcc tcgaaaccct gaaacgctcg atccgcctgc    138000
     atctgccgcg ctcaatgcca gaccaggcaa tcctcggcta cgccctggcc agactgccca    138060
     ggctggtcat ctgatcactg gggcgtttgc cccgtccggt cccgatctct gccacatcca    138120
     acgccaacac atcatagagc ctaccaaaac cagccaggtt cggccggtaa gccgtcacgc    138180
     ccgcacgatg tcaggttgaa cagcacgcct gagaaaaatc agaggaaatg cgctcgtgaa    138240
     taatcccggc tagtgtcagc ccgatcatcg ccgggacgat aaatgtgtac gcggcggtgg    138300
     aaaagctagg cctgcgcgga tcacatctcg ctgaaaatca acaccgattc tttattgcaa    138360
     gagtgaaact cgaaggattc aataatcccg tcgatagaat gctgcggatc gcaagtgtca    138420
     tcaacgtgta atacgatagc ttcttgcaac ccaaacttgc ggcaccttaa atcttcacct    138480
     gtttggggat ttcctaaacg cagaccagtg agcaggttgc ggctcccgcc ataggacggt    138540
     gaattctaaa cgacggatga ataaagcact cggcattgtt gcactgatct gcaaagccgg    138600
     agataagtcc aaggagaaac ataacgcact tttaattacg cccacatatt cgaatccgct    138660
     tttattttgt tccgccatcc ctgagcgtcg cggcttcatt gccccgcatt gcccgccggg    138720
     tctcaatcag ccgccgcatg gcgtttgccc agaactcaac cagcgattca ttcgcaaaga    138780
     gaacctcatt cacatcgccg gggagaccaa tctccttcaa cgcgatcgcg gtttcgacgg    138840
     cgctacggat gaactcggct cgattctcat catcgccgag aaccttatcc aggcgctcta    138900
     cggtcgaagc atccaacctc aatgtcgttg caatcgtcag tcgcttaggt cgtgccatct    138960
     cgtgacgata aggcaaccct attgttttca gcaaatagat gtctcttata atttttctgg    139020
     ccacctttta ttgactttta agatacctct tataagaatg caactcgtgc ttgctgtcac    139080
     ccgatctcga ccatgttttg cacaggagcc agcagcttgc tgatcacccc ggctcatttc    139140
     ctcgtgctcg caagtcgatg cgcctctgac gtcgcaccaa cgacgctagc cgcggttgca    139200
     ggtgccgaat cggggttcaa cacattggcg attcacgaca acacgacgcg tcagaccgtg    139260
     cggccgcaag gtgcccatgg cgccattgcc gttgccacac agctgattgc cgctgggcat    139320
     tcagttgatc tcggcctcat gcagatcgac agcgcgaacc tcgcccgcct gggcctgacg    139380
     atcgccacgg cattcgacgc ttgcgcatcg gtgcgagcag ccgggaaact cctagtgcag    139440
     gactaccagc ggccggccgg gcaggggcgc caagcggccc tcctggcggc gctgtcacgc    139500
     tacaatacgg gttcggcctg ggaaggcttc cagaacggtt atgtcagccg cgtcgtctca    139560
     accgccaaat accttgtacc ggcaatcgat ccagcagatg gcgtaacagc tccaagggca    139620
     agcagcgcga aatccagcca acctaccacc ctctcaaatt cacctgtccc tcggcatgcg    139680
     cctgcctggg atgtgttccc gaactcgatc ggtccggctg gcttcgcgtc ggcgcatgcg    139740
     gtgacacttc aagcgtcccg cgcttctggc cccagcggcc gggctcaacc ctcaaaacag    139800
     gaaactcacg gtgaaacaaa ggctcactaa gctgcgcgat cgcgcggcaa atttcgcggc    139860
     tgggacggtt tcaaaaatag atcgaggggc atggatccat cccgccgtcc ttgtgacggc    139920
     cggcctcctc ctgcccgccg tggcccatgc gcaggtcgtt tccggtggca ccagccccac    139980
     aaccatcatc gacaacatcg cgacattcat cctcggccca ttcggcgagg gagttgccgt    140040
     actcgccgtg gccgcagtcg gcttcatgtg ctggaccggc cgcatgggct tccatgcgat    140100
     cggctggctc gcggccggcc tggtgctggt gtttggcagc tcctacctcg tgacaacctt    140160
     cgtgggcggt ggctgagcga tgaccgagcg gcagcgcgat ccgctatttg tcgccgcgac    140220
     aaggcccgcg ctgtttctcg ggctgccgat cgagatggcc gtggtgatca tcatgatcgg    140280
     cgccatgatc gtcatctttg gacacaatcc cttttatctg acgctggtgc tgccgctctg    140340
     gttcggggcg cgctggctcg ttcgatacga ctacaacgct ccccgtgtgg catggctgtg    140400
     gttccgcacc aaggccaccg gcgccggtga aaatcaggct tggggcgggg cgtcccccgc    140460
     gccgttcccg atgaaggtcc agaagggcag ggggatgcgc gatgccgggt aatcgaatca    140520
     gggtggaacg cagcgctgaa cgctatttgc cgtatctcgg acatgttcgg ccggacatcc    140580
     tgctcatgga tgacggcagc gttcttgcca tggccgaaat tcctggcgct ccctatgagc    140640
     tggcggccga tgcagatcgc gccgcaagcc tggtcacggt caatgcgctc tgcaagaacg    140700
     tcgcagatga caatgtgacg ctgcactcgg ccttcgtgcg cgggcctggg gctgggcaac    140760
     tcgcacacgc ggttatgccc aatgagttcg cggcttcgct cgatcgcgcc tatcgcgagc    140820
     gcgtccttgc tgggcgcctt tatcaaaaca cctggtatct gacggtggtt gtctcccctc    140880
     gcaatccgct gggcggcaag gcgggcggcg ccacggcctc cctattaggt ggcaaacggg    140940
     aactccaaaa gcctcacgcc accgccgagg gcatcggcca gctagaagag gtttgccaaa    141000
     caatcagcca aaccctcgcc ccctatgatg ttcgccggct tggcctacgg ccagccgcca    141060
     atagccagtt ctatttcagc gaaatcgccg aggcgctgcg cctgatcctg acgggcacgg    141120
     cggcgccggt gcccctggtc agcggcccgc tcggtgccgc cctctacacc gatcgcgcga    141180
     tcttcggccg ccgtgccttt gagctgcgcg ggccgggggt gtctcggttc ggcgccatct    141240
     tcggctatcg cgaatatccg tctgagacct atgccggcat gtatgatggg gtcttttccc    141300
     tgccgtgccc ggtggtgatg gtccatactt tcgactttca cgcacggcat acctctgaaa    141360
     aacggcttgg cctgaaagcc gcccagatga cggctgcgaa tgacaaagcc aagtcgcaga    141420
     tcagcgacct tgcggacgcc caggatcacc tcgcctcggg caagatcgct atgggcgagc    141480
     accatttctc gctgacggtc tatgcggaca cgatcgagga gctggatcgg ctgtccggct    141540
     taacccgcac ggtgattgcc aatagtggcg gcgtggtcgc gcaagaaagt gccgggctgg    141600
     aagcggccta tttcgcgcaa ctgccgggca acagaaaatg gcgcacccgg ccgggcacca    141660
     ttaccacgcg caattttgcg gccttctccg gcttcgaggc gtttccgcgc ggccaacgtg    141720
     ccggcaagtg ggggctggcc atggcgcgct tccgcaccac ggcgggcacg gcctatgatt    141780
     acgtgcccca tgtcgaggat gtcggcatga cggcgatctt cggtaagatc ggccagggca    141840
     aaaccacgtt catgctgttc ctgctggcgc tgttcccgca atatttcgcg gcgcgcaacg    141900
     gcgcggtggt gttcttcgac aaggaccggg gcggcgagtt gctgtgccgt gctgtcggcg    141960
     gccgttatct ggtggtgagg gcagggcggg atagcggcct ggcgcccctc aaggcgctcg    142020
     acagcacccc ggaatcggtc gccttcctcg ttcagtggct caccgccttg atccagcaag    142080
     acgggcacgg cccgctcccg ccagaggatg acgcccgact gacccgcggc gttcaagccc    142140
     tgctgcgcct ggccccggac atgcgctcac tcgccgggct gcgtcagttc ctcgactggc    142200
     gcaatccgat gggggcaggc gcgcgcctcg aacgctggtg caagggcgga tcgctcggct    142260
     gggcctttga tggcgaacgt gatgacgtgt cgcttgatgc aaccacggtc ggctttgatc    142320
     tgacggccat cctcgacaat gggaccgtct gcgcgccggc cgcgaattac ctgctttatc    142380
     gcatcagcca ggcgctcgat ggccgccgct ttgtgctgtc ctgcgacgag ttcaatttct    142440
     atctgctcaa tccgctgttc gccaaaatct gggcggattt catgctcacc gtccgcaaga    142500
     gcaacgccgt ggtgcttctg gcgacgcaag agcccgcgcc ggtgctcgat tcaccgcagg    142560
     gcgatagcat cttgcgccag tgccaaaccc tcgtgttctg cccaacacct ggcgcggaag    142620
     aacatctcta ccgcaaacgg ctcaacttca ccgccggcga gttccgcgcc gttgccgagg    142680
     acatgctgcc caactcccgg caactgctca tcaagcggca tggcggctcc gcgatcatcg    142740
     atttcgacct gtccgcactg ccagagttcg tcgcgatcct gtccagccgc aaatcctcgg    142800
     ttgggtttgt cgaacagcta cgcgccaccc acggcgacga tccggcggcc tggctgccgg    142860
     cgttcatggc gcggttccac gaggaagttg aataggagga ccaaatgctc aagccctctc    142920
     gccggctcag aatcgccagc gcgatcgcca tcttcggctt tgcttcaccc accttggcgc    142980
     aagtcccggt gatcgatagt gcctcattgg cgcaaatcat caaccagcta aatgaagcca    143040
     agcagcaata ttctgaactc gtcagccaat ataatgagct gaaatcgacc tataacgcgc    143100
     tctcgcagaa cgtaaacccg aaccaatggg cgcaacagct cgatcaatcg gccatgcagg    143160
     acacggtgcc caacaccagc atcttgccaa acatgctcga cgggatcagt ccgccctcct    143220
     cgctgagcgg caatgtcggc tcgctcgcgc aacaatatta caacatgaac aaggtctata    143280
     tcccggccgg ctcggatttc ggttcaacgc agatccaaca gggcgcgaat gagaccgcga    143340
     attttgaggc gatcgccacg caaaatctgc aatcgctgga agcccgcgag caagagctgc    143400
     cgcagattca gagtcagctg aacagtgcta cgacgatcca gcaagtcgcc tcaatccagg    143460
     cccgcctctc cgccgaacag aactatgtcc aggcccaaca ggcccaggcg caaaacctgc    143520
     aattattggc gttcgaggag aaccgcgcgg gccaggaagc agccgcacaa gaaaacgcac    143580
     agggcggcga acaaacgctc tcgacgctgt gcagcgacgc tcaaactctc ggcggggagc    143640
     catcggcatg tcagggacaa tgaaacttat catcgccgcc ttgattggcg ccggcgtgat    143700
     cgcaggtgga ggggcctact acgtgtacgt cattgcaccg ccagcggtgc aaaacagact    143760
     cgcccctctg ccgaatagtg gtcgtgagac gaacgctcaa tacgatgcag aaataacggc    143820
     actatgcaaa gcaaacggaa aagatgcccc gcctgcttgc aagccgtatc ttgacgcaaa    143880
     gacctcaaaa taatgagtgt ccccacaacg accatcaatg tctttgagtt tatgtataac    143940
     cagtacagca ccgggttcct gcaatcgctg aatagcgatg tgggaacggc gttgtcagcg    144000
     gcattaccgc ctctctccgc tgccctgatc atctgggtca tcatcctcgg atacctcatg    144060
     atgaccggca gcctggatat acgttacggc atctcaaagg tatcaacgat ggcgattgtg    144120
     gtgggcatta ttgcttcaac gtcgctttat gattcctacg tccagactct tttcatgaag    144180
     tcgctgccga gctttgtcgc cagcaccttt tcatctggaa atacgagcaa catcccgcag    144240
     agcctcgatc acaccttcaa tctcttttgg attgccggac agatcatcta ccacaaagca    144300
     aactgcgcga cctgcgtact cgaaccatac gtgcttggca tcgaaatcga gcttgttctt    144360
     gtcgtctttt tcatcgccct tgccctcgtg ttcgcggtgt atctcatctc gacaacactg    144420
     acgggccttc tcgtcgccat cgggccattc ctgctgatcg gatatctctt tgaagccaca    144480
     aagggcatcc cggaacgctg gctcggcaag ctgatcggcc tggcgatcct gttgctcctg    144540
     atcacggcgc ttctatcgct gttcaccggc ggcatgactg attttctgaa caccaaggtc    144600
     tcgaccacgt tcaccgccga cccggtgcaa accgaaatca tcatcctcgg cgaaatcgcc    144660
     gcctataccg ccatcacggc cttcatcacg atcatgcttc ccggcatcgc cgcctacatt    144720
     ggcggcggtg tggacttcaa tatttccggg atcgtgaacc cagccaactg gttcaaataa    144780
     tgaagggctc acgcatgttg tctcgcctga ttatcctcat gtgcgcagcc ggcctactgg    144840
     cgggctgcgc ggccagtgac ccgctggcga cggctcacgg gccgatgttc gccctcaatc    144900
     ccggccattg gtcgccaagc gcggcgcagt tggcgcgacc gccgcaggtg ccccactcat    144960
     gaacgcggac atgaaaaaca cggctttgcc gatcgataac gaacggctcg ccgcttattt    145020
     ccaggatgtc gaatccttcc aggccactga gaagcgcaca gcccgccgct ggggccgtgt    145080
     gggctgggtg gtggccggcg tgtccctggc ggtcaacgtg accctcgcgg gggcaatcgt    145140
     gatgatcctg cccctcgaaa agctcgtgcc cgccttcatc accgtgaagt cagacggcac    145200
     caccagcacc accatgaatt tcaacagcct tcccagcgat gagaaggcgg cgatgaccag    145260
     ggcagcgatc tggcaatatg tccgtgcccg ggaaagctat gacttcgccg acgcccaata    145320
     tcggtatgat gttgcctcgc tgatgtccaa ccccacggtg caaggcacct accaaagctg    145380
     gttcctcgat aaagggccag gcagcaccag cccgcaggtc acggtcggta aaaaggggca    145440
     gatcagcgtc gagatggtga gcctgtccat ggtgcggccg aatgtcgcgc tggtgcgctt    145500
     ccgccgcacc gtgacgatgt acggctcaga tccgcagact tcgacatgga cggcaacggt    145560
     cggctttgaa aacgtcgcat ccctgccggt ttccgcccgc ctcgcagacc ccagcgggct    145620
     cattgtgacc aactaccagg cccaaaagga ttcgccatga catgcgcgcg caaactcgcg    145680
     gccagcgggt tcctctggct cggcatgatg gggacagccc tcgccataca gtatccccat    145740
     ccggggcacg aagacccccg cgttcgctat gtgccctatc agtccggcaa cgtcaccgac    145800
     atttggaccg cgccaggcgc ggcgctgacg gtccagttcg gcaggaatga aaaggtcgtc    145860
     tccgtcgctg agagcgatag cgcctatctc aaggtcgtcc cggtccagaa ttaccttttc    145920
     atcaagccaa ccggcattct gccggcacag ccgatcgcgg tcctctgcaa gaccagcgac    145980
     ggcaagctcc ggcattactt tttccagttc gagaccgtga acaagcacct cggcgccggc    146040
     gagaatgtcg attacgccgt ggtgttcacc tatccgcacc aggcgtatga gcgccggctt    146100
     gccaagcgga aggcggccga agcgaaggct gtccagaagg aggccaggag ccgccttgat    146160
     gaagcgcgcg cggtcatgaa cgcggcgacg gtcgatcaat atcaggggcc gcgcaattac    146220
     gaatatgtcg ctcgtggcga tcatcagctg gcacccgccg aggtctggga caacggctat    146280
     tcaaccgtgt tcaccttccc ggccatgcag cgcatcccgg ccattttcta cgtccagccg    146340
     gacggcaagg aggcaacggc caactattcg gtcaacggga atacggtcgt tgtgccgggc    146400
     accgcgccag aatggcggct gcgcgatggg catacggtcc tcgacattta tgacctcaaa    146460
     tacaacccga ccggcgccac gccaggcacg cacacgatca gcccggatgt cgagcgcgag    146520
     atgaggacat tcaacaatgg caaatgagga cacgcccgac cgcccttatg ggccgatacg    146580
     tcacaccaac gcggcgccgt cgccggttga acaggaacaa tctgcggtcg ccagccagca    146640
     gcgcctcagc gggcgccaga tcggcggcat tcttctggcc tgcgcgctcg gcgctggcgt    146700
     cgtgctcgtg gtgacccggc tcaccgcaca tcatgagcca aagctcgccc ataaggccgc    146760
     cgtgacaggc gggaccgagg gccggccatt cgtcaacaat gccagcagcg gcacgacgcc    146820
     ttcctcgaaa cctgccggac tccccctgcc gccaaagcag aacgcggggt ttcacaatcc    146880
     gttcctgacg aatcagcagg aatccccagc catgaaggcg ctcaaggcac cgatcatggc    146940
     gttcaaccaa actggcggtg gatcatccgc gcaacctgcc agcaataccg tgggccagaa    147000
     tggcgctccc tccgcgggat ctgcgaaacc tacggccttc gcgaacaagc tcgatgcgga    147060
     tcaattcagt gcggccgatg cctcgatgat cgcgcatccg aatttcacga tcgcggccgg    147120
     caccatcatt ccctgcacgc tgcaaaccgc gatcaattcg accctgccgg gcttcgtcaa    147180
     atgcgtgttg ccgcagccgg tgcgctcgat gactggcacg gtgacgttgc tggataaggg    147240
     gacgcaggtg ctgggcgagg ttcgcgaggg cctggtgcaa ggccaggacc gacttttcat    147300
     cctctgggac cgcgcggtga caccgcaaaa cgtcgctatt cagctcgcct cgccggcggc    147360
     cgatcccctc ggccgggctg gcgtctcggg ggccgtcaac aaccatttcc tcgaacggtt    147420
     cggcgcggcg atcatgatga cgatcatcgg cggctcgttg caggtcgcgg cgaacgccgc    147480
     ccagaacagc gccggcaaca cgtatctgga atatatgaac tccagcacaa accagatcgc    147540
     caacaccaca ctgcaacaca cgatcgacat tccgcccaca ctgaccaagc accagggcga    147600
     gaatgtctcg atcttcgttg cccgcgatct gaatttctcc aaggtctata agctgtcggt    147660
     tgtctcgcca tgagggaggg ctggcgcacc cgcctggatc gcctgacgca ggcagggcag    147720
     cggctcaatc gccatgtcga aaagaccgtc gtcaaatacg ttgaatggca agatcgtcgc    147780
     cacgcgcgcc ggcggcagaa atttctcagg caaggctggc tctacagcac gcttctaggg    147840
     ctgtggctcg tcctgatcat cttggaattg ctcggccatc aatcagccgc ggtcatccat    147900
     agctcggccg gcctcggcct gatcttcctg gctcttaaac tgaagttttc actggtttga    147960
     atgcaaactc cccgcattta tcgacaacgt ttctgatcag gttttgacgg ttactggaca    148020
     cgcatggggt cgatcccgat cagggcgaag gcggcggttt gcagcggcgt ggggtttgcc    148080
     agggtggtga aggtggcgtt cggggccttg ggcagggccg cggtgttcag ggtctgggtg    148140
     gcaagatgcg ccatcaggtc ggcgaagctt gaaatcggca ggttctggtc gttgcggcgt    148200
     cgcccgcgct tgcgatcggc ggccggggat gtcgatgcgg gggcaaccgg cgataagcgt    148260
     tcggtctcag ctcccgggcg gtcgtgatcc tggaacagta ggggcttgag ggcgtcgcgc    148320
     agatgccact cgacgtaata ggccatcatg cagagaaaga cgtgggcacg cacccgcggt    148380
     gagagccagt gatgcaccgg gcggatcgcg agatcgaccg atttgagggt ccggaacgcc    148440
     cgttccaccc gcgaaaggtc cttgtaggct gacacggctt cggtctcgct catgacgtcc    148500
     gcgctcacac tggtgcggat gacatagatg ccgtcgaggg ccgcctcgcg cgcgatgctg    148560
     gcggcgttgc gctggaaatc gaagcggctg gcggtgatgg tgagatcgaa atgcttggcc    148620
     atcttgcgct ggttgatcac cgcccccacc gccagcccga tcgcggcctc gccatgaaga    148680
     ggagcgcgtt tgcgccgtgt cgcatcccgg atccgcgcca gttccgtctc ggtggccacg    148740
     agcagcgcct cgcgcttgcg ccgtcgttcg gtcgcaaggg ccgcgttgcg acaggcgatc    148800
     agccgctcgc ccggataatc gggcgacgtg atcgcggcga tatcgcgctc gtcgaacagc    148860
     gacatctgca gcggtccctc ggcaagatcc tggatctgcc ccgcgcgcag gcagctgatc    148920
     cagtccagcc ccgccggctt gatcgtctcg cggatccgcg ccgtggtgat catcccgcga    148980
     tcacccacca ggacgacgcg ctcgagatgg aaccgccgct tgagtttctc cacctgcgcg    149040
     gcgatcgtcg ccggatcggc ggtgttgcct tcgaacactt ccaccgcgat cggccgcccc    149100
     tcgcgatcgc acagcaggcc atagacgatc tgtggccgat cgggccggtg atcgcggctg    149160
     tatccgtggt gtgccagttc gcaatgccgg ccttcgaggt aggatgaact gacgtcgtag    149220
     agcaccagcg tgccgtcgcg cagatggcgc cttgcaaact gccgctcgat ccggccctgc    149280
     tgcgcgccca gccagtccag tgcggcgtag atctcgcgct cttcaatggc gccgagttcg    149340
     aggatctcgc cgagactcga tgtcgcggtc tgcgggttca gaccgcgcag ggtcgagagc    149400
     ttcgagcccg gtgcgatcac ccgacccgcg atcagcgcca gggcaagatc gcgctcacgc    149460
     gacgccctcc ggcccagcag gccgggaatc tcaagcttgc gcatcatccc gagtgccgcc    149520
     gccacatgac cgtgcggcag cgagcgccgg atctcgagtg cctgatcggc accaccgacc    149580
     accgcgccac ccgcgagaag cgcacgcagc ccatcgatca gctccggcgg catctggctc    149640
     agattggcga tggtgcgttt atgaaccttg cgaccctcgc ggaaactctc ccgcaacagc    149700
     acggccggcg ccgatcggcc attcggaacc acgtcaatga acatggaggc agggaacgta    149760
     tggcccgccc cgtccgcaag gggtgatttt catctggctc taatcagtct gcttcaacgt    149820
     atccggtctc gggcttcgaa cccggccaag atggagatcc gcgcggcctg atcctcataa    149880
     tcacaccggc ctcggaggcc gttcactgcg tcaggttttc aagccgccgt tcgactgtca    149940
     ggccatcttc ctttcacctc acgcagacat cgactgccct ttcgcgccca actgtgagcg    150000
     ctgttcgggc gattccgtca tgcggccgca gccgccgctt cgaattgggc gtcgtaatcg    150060
     caaccgtgcg ccaaaacggc ccatgcaatc cgagccagct tcgcggccag cgcgactacg    150120
     accacgttct tatgcgctcg atcgagcaat ccccgcgccc agcggcccaa cggcgtatcg    150180
     cgttcgacaa gataaggcag cgccgctcgt gcgccatgga tcaagttctt ccgcaaataa    150240
     cgattgccgc gtttgctgat gccgagcagg cgcggttttc cacccgttgt catttgccgt    150300
     ggaacgagcc ccagccacgc cgccatgtcc cgcccacgtt tgaatgcatg cgcctcgccg    150360
     accgccgccg ccagcgccgt agcgtttatc gttccaattc ctgggatttt ggtcaaacgt    150420
     cgcacagcca cgtcgtcacg agccaactga acgaactcgg cgtcgaagcc ggtgatcctc    150480
     tggtcgagtg aacgccattc cgcccgaaga tcttcgatca acgtccggat gcgcgggctc    150540
     aacgcggcaa aaccgccatc ttcggccaat gtctcaagct cggcttccag tttcctccgg    150600
     ccttgcggaa cgacgatccc tcgctccagc agcaacgccc gcaagtgatt gatcagcgcc    150660
     gtccgttccg agacgaggcg ctcccgggct cggtgcaaag cctggagatc agattggtcc    150720
     tggctcttca caggcacgaa acgcatcgtt ggccgcgtcg cagcctctgc gatcgcctcc    150780
     gcgtcgagat catcgttctt ctgcgccttc acgtacggac ggacatattc cggcgacatc    150840
     agccgcacct cgtggccccg cgcggcgaaa atccgcccga ggtgatgagc gccgcaacat    150900
     gcttccattg ccacaatgca cgacccaagc tcgccaacga aactttccaa cgttccccgc    150960
     cgaagtctcc gcctcaaaac aacccggccg gcggcgtcca tgcccaccac gctgcaagag    151020
     ttcttcccaa gatcgatgcc gagaatcatg atatccatcg gtctgctcct ctctccaaac    151080
     cagcggcgat cctaccagat cgccacgaga ggggcgggcc atcccataat cacataccga    151140
     gacgcgccgc aagccccatg tatggacaca aacagaatac agaaaaacag cgctacgcaa    151200
     ggaaatccgc catgttcagg ttattctgaa gtaaaaactt cagcttaaaa tctggcactc    151260
     ggccatggtc atcagggcta aaaagcgggg ggaattatga acggcaccga tttttccgat    151320
     gacctcgtgg cggaaagccc ggccgcgccg ctgctccgct tcctgctcgc cccgctgcaa    151380
     ccctggctga acgatggggc cactgaggag ctgtgcatca accggcccgg cgagtgctgg    151440
     gtgcgccagc gcggcgtttt tgagcggttc aaggtgcccc tcgatcgctc ggcgctggag    151500
     gatattgccg tgctcgccgg cgcgctgcgc cgtcaggatg tcggccctac ctcgccgctt    151560
     tgctccaccg aactgccagg cggcgaacgg ctgcaaatct gcctgccgcc ggccgtgccc    151620
     accggtacgg tcagcctgac aatccgccgg ccgggctcga cggtcgcgcc gctctcctcc    151680
     gtcacctcca ggtatcagtc ggacggatgg aacagttggg cggaaaaccg ggacacccgg    151740
     aatttcgcgg aagccctgga ctactacgat tccggcgatc ttgagggctt ccttgcggcg    151800
     gccgtgcgct gccgcatgac catcctgctc tgtggcgcca ccggctccgg caaaaccacg    151860
     atgagcaaaa cgctgatctc ggcgatcccc atggcagagc ggatcatcac gatcgaggac    151920
     acggcggagc ttgtgatccc gcaaccgaat catgtccggc tgctctactc gaaagacggc    151980
     ctctccaccg cgaaaatcga cgccgaggcg ctgctgcagg ccagcctgcg catgcggcca    152040
     gatcgggtgc tcctgcaaga gctccgcgac gatgcggcat ggacctatgt gaacgaggtg    152100
     gtttccgggc atccgggctc gatcaccacc attcacggcg ccaacccggc ccaggcgttc    152160
     aagaagctgt tttcgctcat caagggatcc ccgaagggcg ctagcttcga tgacgccacg    152220
     ctttgcgatc tgcttgcggc ggctgtcgat ctcatcatcc cgttcgagac ttccggcacc    152280
     acctaccgga tcggcaaggt ctggtttggc ccggacgcga ccaggcgcgg cgaaacagcc    152340
     gccgccctct tgcgggccgc ctgatgacct ggcgcggcgt gatgcggctc ctcgttgggc    152400
     tggtgctcgg cctggtgttc ttctccgtcc tcgccacgat gatcttcctc attggaaccg    152460
     gactgttctg gcatttccgg catccgttct ggcaatggtg gctctatctt ttcgaggcca    152520
     gcggagatcc tactgtacgg gtctggctgg tcatcagcgg cgtgccggcc ttcgcgatcc    152580
     ccttcctcgc cggggtcgtt cagcttgtgc gcggccggcg cgtcaccggc tggtcactgc    152640
     gccgcgatca cgccccgaca aagcccgtcg atgcgccgat ccgtgcccca accgacaacc    152700
     atggtcatgc ccgctggatg acgatggagg aggcccgcgc caggttcccg gggccagccc    152760
     cggaatatgg cgggcttgtc gtgggcgaag cgtatgaggt tcaccgcgac agcgttgcca    152820
     gtatgccgtt caggccgaag gatcgttcaa cctgggggca ggggggcaag gcgcccctgc    152880
     tgatcgatcc atgcgagatt ggctcgaccc attgcatgat gttcgccgga tcgggcggct    152940
     acaagacgac gacggccgtc tccacgctgc tgacatggac cggctcggcc attgtccttg    153000
     acccctcggt ggagctgggg ccgatgttgc gccaggcgcg tgaggacatg ggccacaagg    153060
     tctatatgct cgatccccgc acggcccgcg aagtcgggtt caatgtgctc gactgggtcg    153120
     atgtctcctc ccccctcgcg gaaatcgatg ttcaggccgt ggttgagtgg gtttgcggcg    153180
     ataccaaagc aggcggcgat gaaaacgcct ccttcttcaa gaacagcggc aaggagctgg    153240
     tgacggcgct gctcgcgcat atgctctggg acgaacacct ggaaccgcac gaaaagacct    153300
     tgcgcgccgt ccgcgcggcc atcgttacgc ccgaaaagga gctgcggaac gtcttggccc    153360
     atattcacaa gaactcgcaa agccgcctcg cccgcgatct ggccggtagc ttgaaggaca    153420
     ttgtggatga gacctttagc ggcatctaca agaacgccac ccaggacacg gcctggcttt    153480
     caaccgccgc ctatgcggat ctcgtctccg gcaatgcgtt ccgttgcgct gagctgacgc    153540
     tcggcaagac cacggttttc atcaacattc ccctcaaggc gctcgatgcc accccggccg    153600
     tcgcccgcgt catcaccggc gcgctgctga acgcggccta tgaagcggat ggcgtgatcg    153660
     aaggccgcgt gttgttcctg ctcgatgagg ccgcccggct tggccccatg aaaatcctcg    153720
     aaaccgcccg cgactgcgcc cggaaataca agatcacgct gtttccgttt tatcagtcga    153780
     tcggccagct tcgcgagctg ttcggccaga acggcccggc caagtggttt gaatcggtca    153840
     gctggtatgg cttcgccggc gtcaaaacca aggccgttgc cgaggagctg gctgcggcga    153900
     tcggcgaata tggcgtgctg gcctggtcgg aaggctcgaa caccggcaac tcggcaaagg    153960
     gcctggaagc aggcacgcgc tcgaccggcc agaccaaaac ctatcatgag ctgaaacgcc    154020
     aactcatccg ggccgaggaa atcatgcacg acatgaggga tgatgagcag atcatcttcc    154080
     caaaatccgg ccggccgctg cgctgcggcc gggccattta ttttcggcgg cctgagatgg    154140
     ccgcacgtgt gggcgagaac cgctttgccg tcaacgcaac ttaacccagg ggcgggcaag    154200
     acgggtaggg aagtgccaaa ttgaatatct gcacacgatc caagaatgtc gttcgcgagc    154260
     cgagtaagcg ttgccgaaag cagccgttta ccacttcggc tacacgaacg gctaaacacc    154320
     gcagacggac aagctccgat tgctcaggcc ggcaatctct cgaagggcga ttatggtttg    154380
     gaatcccttg acgttcggat cattatggaa cacgtcgcgg gcgaacctct cgtaagcgcc    154440
     cacgccgctg acttggagca aaagcacgaa gtcggcttca ccggtcgcat accaggcgca    154500
     tttgacctca tcgcgccccc gcagtttcgc ctcgaaggcg tcgagagcag cgatgccctc    154560
     gcgttcgagt gaaaccagca cgtggatggt caggggcgtt ccgagcaccg cagggtgcac    154620
     aatggataca tcggcaacaa tcacgccgct tcgacgcaag cgccgcaacc gacgcaaaac    154680
     cgcactctcg gaaagcccga cttggtcggc cagcaccctg gccgaggtct gattgttgac    154740
     ctggagcttc gaaagcaaag cccgatcgaa ctgatcgaga tcgacggttt ccatcggcta    154800
     cgcgtccaaa aatgacgata tccgtcttat cacgcctgaa tttaggcgcc aaccgttaga    154860
     tgaaaacggg catgattatg gttatgaacg caacaaccga aactccccgc acctccggca    154920
     ttgcctcgga tctcgcccgc ctctcgccgg attacgcgcc gacgccgcta ctcgagctgc    154980
     ctgccttggc cagaaggctg ggcgtcgccc aggtgctggc gaaagacgaa gggtgccgca    155040
     tgctcggcag cttcaagtcg ctcggtggca cctatgccgg gcttcgcgca ctggcgcgtg    155100
     ctgcgaacac ggacatcgcc gcgctgatcg ccacacgtcc gggcgggcag cctaccctgg    155160
     tctgcgccag cgacggcaac catggcctgg cggtcgcggc cgcagcgcgc ttcgccgggg    155220
     ctagcgcccg cgtctacctg cacagcagcg taccccaatc ccgtgccaag cggatcgagg    155280
     cgcaaggcgc cgaggtgatc tgggtccagg gcacctacga cgacgcggtg cacgaagctg    155340
     ccgaggcggc ccgtaacgag gttgggattc tcgtggccga caccacggac gatccgaacg    155400
     acccggtggt gcgcgacgtg atggcgggct acggcgtcat ggccgccgaa atccgcgccc    155460
     aggtggaagc cgccggtcac gcgcggccca cgcacctgtt cgtccaggct ggcgtcggcg    155520
     gcctcgccgc cgtcatggcc aaaggcctgg gcgactggct tgcggcaccg ggccggatca    155580
     tcgtcgtcga gcccgagact gcgcccgccg tggccgccgc tcttaccgca ggcacgatca    155640
     tccgtgtcca aggtgacctg gagacgaccg cggaaatgct gtcctgcggc gaggccagcg    155700
     cccccgcact cgaaaccctg cgacggcacc gcgtggaagc gatcaccgtc tctgaagcca    155760
     ccctcgacga ggccccgctc ctcctgcgcg actgcggcgg cccagcgacg acgtcttccg    155820
     gcgccgcaag cctggcgggc gccctcgcac ggcccggcct cccggcggat gccagggtgc    155880
     tgatcctcgt caccgaaggg gtgccggcat gatgaccgac gacgccttct gggccgaact    155940
     ccgcgcctgg cgccgcgact ttcacgccca cccggaattc ggcttcgagg aacggcggac    156000
     gagccgcctg gtggcagagc gtctgcgttc cttcggcatc accgacatcg tcgaaggcgt    156060
     cggcggcacc ggcgtagtcg ctacgcttac ccggggtagc ggcaaccgcg ccatcgcctt    156120
     gcgtgccgac atggatgcgc tgcgcatcga ggagaagtca gacctcgcct atcggtcgca    156180
     ggtgcccggc gtgatgcacg cctgcggcca tgacgggcac accacgatgc tactcggcgc    156240
     agccaagcta ctcgccgccg aaggcggctt cgacggctcc gtccgtttcg tgttccaacc    156300
     agccgaggaa tggggcaagg gcgcgctcgc catgctcgcc gacgggctca ccgaacggtt    156360
     cccattcgag gagatctacg cgctccacaa caaggcgggc ctgccggttg gcaagttcca    156420
     ggcccgcgta gggacaacca tgtcggccga ggacaatttt gagatcgtcc tgcgcggcat    156480
     ggggggccat gcctcgcgcc cgcaagacgg tcgcgaggtg ctcgtcgccg cctgcgcgct    156540
     cgtggtcaac ctccagacga tcgtatcccg ccgtgtggcg ccgaccgact cggccgtggt    156600
     gtccgtgacc gagctgctga ccgacggcac acgcaacgcc ctgcccagca cggcccgcat    156660
     cctgggcgac gcgcggagct tccaaacggt ggtgagcgag acgatcgagg cggaactgcg    156720
     ccgcatcgcc acgggcaccg ccgctagcta cgacgtaggc tgcgacgtga cctacacgcg    156780
     cgagttcgtg ccgaccgtca acgatcccgt cgcgaccgcg gcggcgctcg cggccgcccg    156840
     caccgtgctg ggcgaggaga acgttacact agccgatcaa ccaggcaccg ggtctgagga    156900
     cttcgcccgc ttcctgcagc acgcgccggg ttgctacgcc ttcatcggca acggcgaggg    156960
     ctccgtccca gcccaccacc ccgaattcga cttcaacgac gacgcgctgc cgacaggaac    157020
     gggcttcttt gtccagatcg tccgcgaccg gctcgcgacc cggccgacgc agccgtgacc    157080
     ggcccccgca tcaacgccga acgcttgctc ggccgcctcc gcacgctcgg taacattggc    157140
     cgcgacgagg gacggctcac ccgcctcgcc gcctcggaca gcgaccgcgc cggccgcgac    157200
     gccgtggtgg gctggatgca cgacgccggg ctggaggtca tggtcgaccg catcggcaac    157260
     ctgttcggca tctggcacgc cggtgacgcc aattccgcgc cgctcatgct gggctcgcac    157320
     atcgacacgg tcatcgacgc cggaatctac gacggatgct acggcgtggt gggtgggcta    157380
     gaggtggtcc aaacgttgag ggaggccggc gtgaagccgg accggcctgt cgtgatcgcg    157440
     gccttcacca acgaagaggg cgtgcgctac gccccggaca tgatggggtc cctcgtctat    157500
     gccggcggcc tcggcgtggc cgaggcgctt gccaccgtcg gcaccgatgg cacggtgttg    157560
     ggcgaggaac tcgcccgcat cggctatgcc ggcccgcacg agcccggctt cctgcgcccg    157620
     catgcctatc tggagctgca catcgagcag gggccgattc tggaccgcga aggtgttgcg    157680
     atcggcgccg tcgagaacct gcagggcatc tcctggcagc gcgtgacgat cgacggcgtg    157740
     gcgaatcatg ccggcaccac gccgatggcg atgcgccgcg acgccggaca agccgccgca    157800
     cgggttgtga ctttcctacg cgacctgatc tcgcaaacca acgccccgac cgtcgcgacg    157860
     gtgggctgca tggcgttcga gccgaacgcc atcaacgtca tcccgtcccg ggccgtgttc    157920
     actgtcgacc tacgcgaccc cgacgaggat cgcctgcgcg cggcagaggc gaccctcgcg    157980
     cgatacctcg aaagtctggc cgacgccgaa ggggtcactg tcgtcgtcga acgtctcgcc    158040
     cagttcgacc cggtgacctt cgacccggcc atcgtcgcgg ccattgaagc cgcggccgcc    158100
     gagaatggcc tacgctcccg ccgcatgacg tcaggagccg gacacgacgc gcagatgatc    158160
     gcccgcctct gccccgccgc aatgatcttc gtgcccagcc tcaagggcat cagccacaat    158220
     ccgcgggagc acacacaagc tgccgatctg caggccgggg ccaatgttct gctcgacgtc    158280
     atccgcaagc tcacacacgt agcctccggc gaggcacgat ccttctcgca acagaactca    158340
     aagttgggct tcgcttacga cgattcgttc acaaaagagg gcatctgaag cgattgagtt    158400
     aactcgagcg gccgcttgtt gaagctggga aacaacagcg gacagttcgc ttcccaccca    158460
     aaccggacat aaatgaagcc cacgttaaaa cgaattcgcg accagcattt ccccggcttg    158520
     cgtcgtgtat cggggggaga gattttgccg gcgtgcgccc catgatgggg atgtggccgt    158580
     cgaagcgatc cgcagggttc cgcgcccgaa ccgggcgttg atcgcatcca tagctttcat    158640
     tgcggcggcc gattggtcac ggtcgaagct ggcgaacaga acggcctggc gccgcgccgg    158700
     cgccagatcc tgcaacatca cccccgcctt gaaataccgg tatccaggat gccagacggc    158760
     ccgcaacagc ctgatcgcct cgccgatcaa cagaccggta tcggccgtgg gctcgatctt    158820
     gccctggcgc tgcgccgaat accacgggtc accgttatgg gggttggtat gggtgaagac    158880
     cgtgatctgg cccgcctcaa gcccctcggc gcggagcttc tccgccgcgc gcgcggcgaa    158940
     ggtacagatg gcctcgcgca gttcagccgg cctgtcgatc atgtgtccga agctgcggct    159000
     taccgcgatt cccttccgtg ttggcgccat tagcgatagc ggcaggcagg aggcgcccct    159060
     caactctgtc tgtaccctag cgccggtgac ggtcagcatg tcgcgcaccg cgcgcggatc    159120
     cgcccgcacg aaatccgcga tcgtggtgat ccccgccgcg gcgagttttg ccccgacctg    159180
     gccgccgatg ccccagacct cggcgatagg cagccgttcg tagtgccgcg cccggagctc    159240
     cggatcgcgt aggtcgcaca cgccaccgag cgccgtctcc tttttcgcga tcttgttggc    159300
     gagcttggcg atcgtcttgg tcgggccgat cccgacacag gtggggatct tggcgatctg    159360
     tcggacatcg cgccggagat cgcgacagaa ccggtcgaga tcggggatac catcgagatc    159420
     gaggaacatc tcgtcgatcg aatagggctc aacctgcggc acccgttcag tgagcacgtc    159480
     gtagacccgg cggctcatgt cgccgtaaag ggcgtagttg ctcgaccgcc attcgacggc    159540
     cctgctctcc gggcgcttgc ggaacaggtg ccagggctcg cccatcttga tcccgagcgc    159600
     cttggcctcc ggcgttcggg cgatggcgca gccgtcattg ttggacagca ccacaagcgg    159660
     gcgggagcgc agttccggcg caaacgcctg ctcggctgag caatagaagg aattgccgtc    159720
     gattagcccg aaagtcggca ttgcgatcag acctgagttc gcaccaggcc ggtgatcacc    159780
     gcccagattt cggcgtcatc gccctcgacg gggaggggct cggtgccggc gcggccggag    159840
     agcagttgcc actgcccgtt gcgccaggcg agctgcgcga ccagcacgtc gccggccagc    159900
     atcaccaccg cgaccttgcc gggcgccggc ggtgtggcgg catcggcgat caggatatcg    159960
     ccggagaaga tgccgcggct ggtcagcgca tcgccggcta cgcgcacggg gtagcggctg    160020
     ggccggcgga gatcgaggat ctcggacaga tcgatcggtc cctccaggct atcacctgcg    160080
     gggctgacga aacctgtggt attcccgcct gtgtagcttc ccatgtacac ctccatcggt    160140
     cagaacatat ggagaacatt tcaggagagc aagaggcgcc atgtgcggac gttttgcagc    160200
     cttccagccg gttgaagcga tccgcaagct gttcggggcg gtcaattcag cgccggcaga    160260
     tgcacggccg tcctggaata tcgccccgtc acagcgggcg ctggttgtcc gccgacatcc    160320
     tgaaaccggc gagcggcgca tcgacctcct gagctggggt ctggtgccgc actggaccaa    160380
     ggatctcaag gaggcccgcc ggccgatcaa cgcacgtgct gagaccttgg caacctcgcc    160440
     gatgttcaag ccggcgttcg cgtcccggcg ctgcctggtg ccggtcgacg cctggtatga    160500
     gtggcaggtg acgccagacg gcaagcggcc gttcgccttt gcccgcacgg atcgcgcgac    160560
     gatggctttc gccggcctct gggaaagctg ggtcacgccg ggtacgggga aagtgctccg    160620
     caccttcacc atcattacca cgtccgccaa tgccatggcc gcgccagtgc atgaccgcat    160680
     gccggttatc ctcgatgcag acgattggcc gctctggctt ggcgaaagga caggggagcc    160740
     ggctgcttta ctccggccgg ctccggatat gatgatcgag gcatggcccg tcgggcgatc    160800
     tgtcaactcg ccccagaata acggcctgga actcctttcg ctgcttgctg aacataaaga    160860
     cttgtatcta accaatccgg cagatggttg attggcagtg ccgctccagt gacagcatca    160920
     tcgatgacga tatgggcata aaggacgtgc tgcgcggcgg tcccgatgaa ggatcgttgg    160980
     caaaaaaaat cccgaaatcc tcatacagtt acgcaccgga cttctgcatc tgaatccccc    161040
     gcttatggcc tatggggagg atgtggtgcg aaattcttga tttttggaaa tcctcccctt    161100
     aagccgtagc agtcatacct ctatcagagg aatcgtttag agagtttgaa ccgcccgacc    161160
     aaaccaaggc cgataaggcc agtgccaagt agaagaaggg agccgggttc tggcactggt    161220
     gttggtgtcg gtgtcagggg ttttgataca agatcatagt tattttttgt tccaacccag    161280
     ttaatcttga aatctgggct gtaccctgaa aataaaccag atgataatgt aacatagaat    161340
     gtataattaa tgctgctgtc tgctggcaat gccggacctt gtggtgttgt ttcggccgca    161400
     aagcagtaaa agtttccctt tccattacag ccgtttgcgt tcaatcctcc cgataattct    161460
     gtgaatcccg atggggctgc agcacttgcg aaatttgatg ggggattaag agcaaaagac    161520
     tgtacaccat accgcccacc ctctgcatcg gaagggccat ttatgcccgc tatattaagg    161580
     gtgaactgat ccgttaaggg attggctgtt gctgattcgg acagcgtata ggttatgcca    161640
     tcggcgatca ggctggcgtg cgctccggcc gttgtaagcc ccagtacgac gatggcgctg    161700
     gcaatatggc gaaacttcaa catgaagaac gttccttgcc tatccggttg ttacccacac    161760
     ccactaaatg tagggtgtgt ccattccccg gaataaagct cgtcaaaggt tggtgcggct    161820
     gccctacccg cgattccgag cagcgagcgg aacgcgttga agggatagag gcgccggttg    161880
     aaccgaaacg tgaattcatt gaggtaggct tgtagatgtt tggcgctgac cccgtgatgg    161940
     atgccgttga tccaggtctt caggttggta aagaccaagt ggacgatcgg caggaattct    162000
     tctgccacct ccgggtcgcc gcattcggcg attgcatggt ggtcgaaccc gcgccttccg    162060
     agaccggcat agccgctcca gtcgtcggta acgatcagcg atccgggagc aacggcgttt    162120
     tcgacgaatc cgcagagcga attggcgcta cggtcgggga caacagcgag acgaacgcgt    162180
     cccgcgtagc gaccgtcttt ccgattgtcg agcttggttc ccggtttccg gtggcgcacc    162240
     tccacggcac aggcgacgag aaccttgtga tggacacccc gtccatcgcc tcgggttcgt    162300
     cctccaaccc acgtttcatc cacttcgacg tgttcttgcg gcgtgtcgcc aatcttgtcg    162360
     cgctcggggc gcaccatccc ggcgcgcagc ttatgaagga tgccgaaggc ggtctcgtag    162420
     cgcgacaggc cgagttgccg ctgaaattgg acggccgaca ttccgggcgt ctggctggcg    162480
     atcaagtaag ccgcccagaa ccaagtcgac agcggcgtgt gactgcgttc cataacggtc    162540
     ccagccatca ggcttacgtc tttgcgacag gcccggcagc gcagaacgcc cgggcgcgcc    162600
     tcgaaacgga acggctcgcc aacgacgccg caccttgggc aggcgaaccc tccattccag    162660
     cgggcgcttt cgagataggc ggcacaggcc gcgtcgttcg ggaaaatacg ctggaattcc    162720
     ggcagagact gcgggaacgg caggtcttca cgggccagga catccatgcc caacactaga    162780
     tctagtaggt atgggagtca accggatagg caaggaacgt tcctttcgaa ataccggcgt    162840
     tgactgacgc ggtcggttca tccctttgtg aagccggaac aacgattttt ggccgcataa    162900
     ttaagcaggc aatttctatg ccgagctaaa taacctaaca aaatcaatgc gcataaattt    162960
     tcagacgata gagatgtaaa atatcccgac actatctaga gttgtttggt cataagtaat    163020
     ggaacgcccg acgctgtagt cagagggcag agctacaggt ttgaaccttg cctatccggt    163080
     tgttacccac acccactaaa tgtagggtgt gtccattccc cggaataaag ctcgtcaaag    163140
     gttggtgcgg ctgccctacc cgcgattccg agcagcgagc ggaacgcgtt gaagggatag    163200
     aggcgccggt tgaaccgaaa cgtgaattca ttgaggtagg cttgtagatg tttggcgctg    163260
     accccgtgat ggatgccgtt gatccaggtc ttcaggttgg taaagaccaa gtggacgatc    163320
     ggcaggaatt cttctgccac ctccgggtcg ccgcattcgg cgattgcatg gtggtcgaac    163380
     ccgcgccttc cgagaccggc atagccgctc cagtcgtcgg taacgatcag cgatccggga    163440
     gcaacggcgt tttcgacgaa tccgcagagc gaattggcgc tacggtcggg gacaacagcg    163500
     agacgaacgc gtcccgcgta gcgaccgtct ttccgattgt cgagcttggt tcccggtttc    163560
     cggtggcgca cctccacggc acaggcgacg agaaccttgt gatggacacc ccgtccatcg    163620
     cctcgggttc gtcctccaac ccacgtttca tccacttcga cgtgttcttg cggcgtgtcg    163680
     ccaatcttgt cgcgctcggg gcgcaccatc ccggcgcgca gcttatgaag gatgccgaag    163740
     gcggtctcgt agcgcgacag gccgagttgc cgctgaaatt ggacggccga cattccgggc    163800
     gtctggctgg cgatcaagta agccgcccag aaccaagtcg acagcggcgt gtgactgcgt    163860
     tccataacgg tcccagccat caggcttacg tctttgcgac aggcccggca gcgcagaacg    163920
     cccgggcgcg cctcgaaacg gaacggctcg ccaacgacgc cgcaccttgg gcaggcgaac    163980
     cctccattcc agcgggcgct ttcgagatag gcggcacagg ccgcgtcgtt cgggaaaata    164040
     cgctggaatt ccggcagaga ctgcgggaac ggcaggtctt cacgggccag gacatccatg    164100
     cccaacacta gatctagtag gtatgggagt caaccggata ggcaaggttt gaactgaccg    164160
     cattcaaagc ggcagaaagt acaggaaggg ccaaggccgg cgagcaaaag gtcattgaga    164220
     ctgatcggaa aggcttggct ggcccaagat cccgttcgct gcatcagacc atgcgtggcc    164280
     tccgaggtcg cgtgacgcgc tgatcataga tatcaatctg aaagaccttg gcggccgatt    164340
     gaaataaaat tctgtcagaa aattttacac atctgagtgc tggttctttt aatgaaaaat    164400
     aagtcattgg aattatttgg taaattgata tggcccgaaa cttgctggga aaaaactgtc    164460
     taacccccca ttacacaagg atgtatttgt catgtctctc aaatttgcca cgatcgcggc    164520
     ctgcgccgta gggggattga tgatgggctc aggcgttgcc cacgcgaccc cctcgctcga    164580
     tttctcggtt caggcatgga ctgcgcaaac gccgaattcc ggtagcgcca gctctaatca    164640
     gcaggccctg ccaagcaacc cgataatctc tgccaccaac gcattcttta ccgggaattt    164700
     cctgggtttg ccgaactggc aagacaactc ccaaaataca aatacactca acgactttac    164760
     caataatctg accggattca gtaacgtcaa atattacaat ggcaattctg gcacaacggt    164820
     actgagcact gggggatttg gttcggccac gctgttcgac ctgactttca ccctcaacca    164880
     cacgctgagt gccaccgtca cgcatgatga tggtttcagc ctgtggaatg caaccaacac    164940
     aggtaatgcc ctctttaact atgcccaccc cactagcgct gttcctgaca gcatcagcgt    165000
     tggtccaggc acctataatc tctggtatct cgaggcaaac ggtgccccgg cacagctgac    165060
     gttctcgaac gtcaaggttc cggaaccggg ctcactgttg ctgctcggta ctggcttggt    165120
     cggacttggt ctgatcttgc gccgtcgccg ctcgcgcacg gcgtaatcag ccgcaacgat    165180
     gcttttcgac aggcggtggc agcaccgcct gttttttgtg tcctcttctg cggttacagg    165240
     cgtgaaatgt ggcccgcacc agaacctgca ttatggaact tcacggcaag tcgccggcaa    165300
     ctcacagtcc aattcggccg tgtatttctg cgccttatga atatccctgc agcagcgaca    165360
     atcaaacaat gcgataccgt catttctgcc ccctcatcct gacagccact ctctgagctt    165420
     cgaccatcgg cgccgccccg agacattccg cacggcgatg gcgacagcac gccgactgcc    165480
     gaccagaacg actagccgcc ggccgcgcgt gatgccggtg tagagcaggt tccgctgcag    165540
     catcacgtag tgctgggtca gcaccggaat gacgacggca gggtattccg agccctggga    165600
     cttgtggatc gtcgccgcat aggccggcac aagcccgtcc agctcgccga gaccgtagac    165660
     cacctcccgt ccatcgaagc cgacgccaac ctccccggcc tccgcatcga cccgggcaat    165720
     aaagccgata tcgccgttgt agacctcccg gtcgtagtcg ttctcgatct gcatgacctt    165780
     gtcgccggga gcataggtcc agccgaatcg ctcgacccgc ggttccgccg cgccgttcag    165840
     cgccgcctgc agggtgatgt tgagtgaccg cgcgccgacc ccaccccggg ccatcggaca    165900
     gagcacctgg atgtcgcgga tcggatccag tccaaaccgg tgcggaatcc gcgtcttcac    165960
     cagctccacg atgcgctcga ccgccgtctc cggctcgtcg gccgccacga aatggaaatc    166020
     gctctcggga tcagcgcggc cgagatcggg gatctccccg cgattgacgc tatgcgccac    166080
     ggtgatgatc cggctcgccg atgcctggcg gaagatctcc gtcagccgca ccaccggtac    166140
     cgcgccagac ccgatcagat cggcgagcac ctgccccggt cccaccgagg gaagctggtc    166200
     gacatctccc accaccagca gcgctgcctc gtcggggatc gccctggtca gcgcatgcat    166260
     caacggcacg tccaccatcg aggtctcgtc gatcaccaga aggtcgcatt ccagaggatg    166320
     gtcgacgccg cggcggaaac taccgctcgc aggatctacc tcgagcaggc ggtggatcgt    166380
     cttcgcctcg ccccccgtcg tctcggcaag gcgcttggct gcccggccgg tcggcgcggc    166440
     gagcagaatg cggacggatt tcgcagcgag gatccgcagg atcgcccgga cgatcgtggt    166500
     cttgccgaca cccggtccgc cggtgatcac caacagcttc gcggtcagcg ccagccgcac    166560
     cgcctcactc tggctcgtcg ccagattcat gccgagatgg ctttccaccc agccgatcgc    166620
     cttgtccgca tcgatcgatg gccagggcgt tgcaccagag gcaacaatcc gcagccgttc    166680
     ggcgataccc tgctccgccc gatacaagcc ggccaggaac acacagtcag tccccgccac    166740
     ctgatcggcg atcaccgtgc cctctgccag ttcgaggtcg agtgccgtcc cgatcagcgg    166800
     cgccggcacc tcgagcaacg tttcggcgag cgagaccagt tcgccggccg gtaggccaca    166860
     atggccatca tccattgccg tcgccagcgc atgaccgatg ccagcacgca cacggatcat    166920
     cgcgtccctg gcgatgccaa gcttctccgc gatcgcatcc gctgtccgga aaccgatccc    166980
     cctgatgtcc cgcgccagac gatacgggtt ctcgctcatc acctgcaccg cgtcggcgcc    167040
     gtaggtcttg aagatccgca cggcgcgggc cgtgctcacc ccatggctgt gcaggaacac    167100
     catgatctcc cgcaccacct tctgctcggc ccaggcattg acgatccgcc cggcccgcac    167160
     cgcgccgata cccggcacct cgcgcaggcg ctcgggcttt gcctcgatca cgtcgaacac    167220
     cgtctcgccg aaggctcgga tcagtttctt cgcatacacc ggcccgatgc cgcggatcat    167280
     gcccgaggcc agatagcgct cgatcccctc ggccgtggtc ggcgccgatg tccgcaggaa    167340
     ccgcgcccgg aattgctggc catgaacccg gtcgttcacc cactcgccgc tcgccgtcag    167400
     ccactcgcca gcgctgatcg tcgcggcatg cccgatgact gtaacgagat cacggtgccc    167460
     ccgggctttc acccgcaaca cgcaaaagcc gttctcgaca ttgtggaacg tcacccgctc    167520
     aaccaggcca gcgaggacct cgcgatcggg tgtctgagca ggggcagtgg caataaaatg    167580
     gttccccatc accccatgcg acgctgtctt ccggcgccgg tcaagtcagt cgcaggcgcg    167640
     tctgcttacg cggcgcggct ccaaggggag gggcaaaaaa atggcggcca ttgaggccgc    167700
     caagtttagg gaggaaacgt ccaaaaaggc gaggcagtgc ctcgcacagg accgatatag    167760
     cgcggcagga cgcagtcgtc ttatatattt tgtgcagtgc agcattgttg cctgtaatga    167820
     cccggagcaa cggggtggaa ttcctggcac cggttatgga attggccgtg ccagaaagca    167880
     gcagggacga cagcagttcc tcaaggaatt ggatccaaaa ccctaccgcc cgcggccacg    167940
     cttgcggctt tcctgttcaa ccggacgttc ctcggcttgg cgctgcgcct ggcggcgatg    168000
     cccctccagc gctttctgta gccgcgcccg ggcactccga tgcgcggcct cgatcaatgg    168060
     ccgcgcccgc tcccaccccg ccgccacggc tgcccgcacg gccggagccg cccgctcgat    168120
     gcgggccagc gcctggccct tatcctcgac agcgcgcgcc atggtttcgg tcaagcggct    168180
     ttgcgtgccg gcccgggctt gggtgcgcgc aaaacgctgg gacaggtcag agggcaagcc    168240
     tgcggcctcg cgcttctcgt cggccgccag ccctttgagg aaggcgcggg ccgcattgcg    168300
     gcgggcctcc tcgccgatct tcaccagatc gagcgcattg gtcttttcag gctgacgcgc    168360
     gatattccgc gtccaattcg tccagatgtc gtgctcgcgg atcgggcgcg gatcgcccag    168420
     cggccggcgg cccgcgatct cctgccgctc agccccctcc gaggtcagcc agtaatcccg    168480
     ttcccggtgc cgtgacccgg agacataggt cttgaaaccg tccgtggtct gcgagccgcc    168540
     aggtgtcaca aagatatgct cggtcgtggt gatgccctgg gcggtgttgg tggtcatggc    168600
     atagccgtag gccagccgca tccggccggt ttccttgtcg gccagcgtgt cccacttcac    168660
     aaagccctcg cggccatggt cgttccgcag caccaggcct tcgtcgcgga tgctggtgat    168720
     ttcgaggatc gagccattat cgccgatcgc gcccttgccg ccgtccaaca tcgcagcatt    168780
     ggtgcgggcg aagagccgga ttttttcgcc cgtcgcgatc ggcagcgcgt agtgctcacc    168840
     ggtgttcttg tcgatcgccg ccagcgtcat gcggctctgc cccagctcgc cagaggcaag    168900
     cagccgttgc cggattgcct cgccgatcgc gcgtgcgtcc tgattggtcg gtgtgctgat    168960
     cgaaatcgta aagcgcggcc gatctacatt cgctttccgg cgctcatccc agagcgcggc    169020
     agctcgcgcg atcacctcgc catgcccgcc ggcgatgatc tcggccgtgc catcctgccg    169080
     cttcatgtcc agcgccttgc caacagcttc ggcgccacct tttcgcagca agcccgcgat    169140
     ttcgcgcgcc cgttcgttgg tctgccgcac gctgctttca atcgacggca ccttgcccag    169200
     ccctttttcg agaaggccga tcacctggcc cgcctcgatc gactggcatt gcttcggatc    169260
     accgatcgcc accatacgga acccgtgccg ctcctggagc cgcaacagat cgagcatctg    169320
     gcgcgtgccg atcgtgccca gctcatcgat caccacgaca ctgcggctgg acaagtccag    169380
     ccggccgctc tccacccggt tgatgaacac cgagactgcc gcgatcgtgt cacgcccgcc    169440
     ggcctcggtg tcggtgtcgg tattcagccc ggcctcgcgc agctcgcgcg cctggcgcca    169500
     gccgaggctg atgccgtgaa tgtccgcacc ctgctcgcgc catgccgtca ccagcggctt    169560
     caacagcgtg gtcttgccag ctccggccgc cccgatcccc accgagaacc ggccgcccat    169620
     gccgagatga tcgatcatcc ggcgctgtgc cgcgccatgc gcgccggtga aactcagccc    169680
     gctcgcctcg atcccgcgct tgatttgtac cgggttgagt gtgccgcgcc gatcgcggcc    169740
     agcttgtccc gccagctcga ccagcgcgct ctcctgctcg acatgggcgc gcgtcgtcag    169800
     cctggttgtg gtgatcgtca catccgggtt ttccgggtca tccctctcgg tctcgaccgc    169860
     gatgatctgc gtgcgtgcgg actcaccgtt gccgccagca ccaccggttt cgacaacccc    169920
     gcgcgcccgc aaccgcgcga tcacctgatc aacatcgccg ccatccttga tgccggccgc    169980
     caccaggcca cgcgctgcgg caacgcgctc atcctcggcc ttgatgaccg cccgccgggc    170040
     aaactgctcg cccagcaccc gcgaagccgc ctcataggcc cgatccagcc gggccgcttc    170100
     ggtcatcttc tccgctggcg ccgcgttctg cagaacgctt ttgtgctggt agccgcgtgc    170160
     ctccgcctgg cgccgccagc tcgcaaaatc gctcagatca tcggccttgg cactgcggct    170220
     cgcaaaggcg ccgcctttca gcagcttgat tcgttcatcg ccggtcatgc ggtcccaatc    170280
     cgcccccagc gaggcagcat aggctttcgc gtcggagagg gcatcgcggg tccgcttact    170340
     gaacgccgcc cggatctcct ccggcacggc gctgagccgc gccgcgccgg tggttcggtc    170400
     cagctctata ctcgcgccgg ctcgccggag attctgggca agatgcgcct ggtagatcgc    170460
     cccccattca tggatgcgac cgtgcatctg caacgtattc agggacacaa cccggccgct    170520
     ctcggtgacg atgacattcg gcaccgcgac atgggtatga agctgcggat ccccggccac    170580
     cttcacggag acgatctcgg tttccgtgcg gccatccgct gtctgccggg cgatttcgat    170640
     tgtgggccgg gccgtgtagt ggtcaaaggt aatccacccg atgcggccct gctcggtgcc    170700
     ttccttgccg cctttgccct tccgggcctg gccaatgacc tgctcgatct ccgccatggt    170760
     cgcggccacc gcatccttgt gcgcctgggc cagctggttg cgctccgcct cggtcggcgc    170820
     gaaggcccag gccagcgaca ccgacttgtc ggccgagaag gtaaaatcaa cgtagccgat    170880
     cggggttttc gagcggttga ccgcgtttcg ccaatcggcc gcatccagcg ccgtgccatc    170940
     cgctcgcttg ccctcaagga tgttggcccg ctcggtctcg gaaaggccgc gcccgtcttt    171000
     ggcctccagc gccttgtaga gccgcacaag ctcgggatga ggcgcgggct ggccttgttc    171060
     ggtctcctgg gcggacgggc catccggcgc ggcgccggga gaggcggatg acaacttcgc    171120
     ctcgatccgc gcccggtcgg cagcgctcga cgcttcggcc gtcgccagcg cccgccgcaa    171180
     gccggcggcg ccactttcgc gcaaggcatc ggcccaatcg gcgccctttg ccccgcccgc    171240
     gacatcagcc ggcggttcaa gatagaccgc ctcgccgcca ttggcctcga tcaaggccgc    171300
     ggccttggcg gccgccttct gcccggcctc gccaacatca cggccattgt ggaggcgggc    171360
     attgtcgcga tcggccagca ggacaaccgg cgtcgagccg ctgaattgcc cggcccaggc    171420
     caccaggccg cccgcattgt agccaacaac accagcctgc cgcgttgcct gcacgacact    171480
     cgcgacggtc tcgaaccctt caccggcaac ccgggcctgg tcatggccac cgatcggcac    171540
     cgctgcgcca gccggcggat gcagcagcca ggcgcccgag gcccccagca tccggcggcc    171600
     gatttttgct ccgccttcgg tcagataggt gcgctgcacg ccggtcagcc gcacccggcc    171660
     atcctcatcc tggccgaaca tcggcgtcag catcaccacc gccgcaccgg ccgccacttc    171720
     cgccgcatca tagttcggat gcggccggac cagccgcaca tggctcatca gccaatcatc    171780
     atcgaggccg cgcccgctga gataggcccg ggctgacgcc cgcagggccg cggcctcgtc    171840
     cacgcgcgcc gcatgcgctg tccgctgctg caacttctgc cccgcagacc cgtgcaagct    171900
     cggagcgtgc agctcgccag tgcccggaat cgcctcatcc cagagcttcc cggcaatgct    171960
     cttgcgaaag acgttgcgcc gtatctcggc agtacgcgcc gccttggccg cctcgggatc    172020
     cagctcgacc gcctcggctt tgacgcccag ccggcgcacc aggctctcga accgcccgcc    172080
     ttcgctggcg gcaaagtcgg tccattgacc cgttgtggcg ttgaccgaaa ccgtccagct    172140
     ttctactccg cgccaggtcg cttgcaggcg caaccggccg ccgctggtcc ggtagggcac    172200
     accggcggca tcaagcgccg ccgcaacgtc gatcgcccgg ggttccgctg gccgatcctc    172260
     ggccgccggg ccacgcggcg gcaccgccgg ttcaccgccc cgcgcaatat ccgcctgcca    172320
     gtcggccgcc agcgccgcat cccgatcata cccggccacc tcctccatcg ggggcggcac    172380
     aaaatcttcc ggccagggcg gcgggccatc ggccgcactt cccagctcgc caagcgccgc    172440
     cgcttcggcg gcaagggccg catcgcgatc ctccgcctcg tgcgcctcaa cagcctctgg    172500
     cgctgcggtc tgcggagtga tcgcgggggc cgcctcgact ggcgcggccg gcagatcaaa    172560
     tccgtcagcc cgtttgccgg caaggaggtt ttccagttcc gcgcgggtcg gcaaccgcat    172620
     cggatcaagc ccaaacactt cggcaagcgg cgtcaccgcg cgctgatact gtttgcccgc    172680
     gatcttctcg ccatccgctc gattgcccgc cagcagctcg gcaatctcgt cacgggtcag    172740
     cgggcgcgac gtgtcgatcc ccagcgcggc ggcaacggtg gggtgcatat cccggcgggg    172800
     ctcgggaatg gtgcctgggc gggccgcgtc cgtcgcggtg gccgccgcgt tatcttccgc    172860
     cgctgccgtg cctggctgcc aaagcccgcc ctcgacggtc atgccgcgct gataatacgc    172920
     cgccatatcc tgctcgaacc ccggcagtgt catggtcatc aggtgatccg ccatctttcc    172980
     ggcggcaccg gatgaagtgg aggccgcacc ggcgcggaac gtcagcacgt ctctccgcct    173040
     gcctctgact gcgatccgtc gtcgtccggc tcgagcgccg tggccaggcc acgcatcacc    173100
     ccggcctcaa cctctgcccc caacccgtcc agcgttgtgc cgatttgcag aagcgcggtg    173160
     gtctgatcgc gcagcgcacc ggcgatccct gccagggctt cctcaagcgg gctctcttcc    173220
     gaaggggtcg ccagctcgat caaccgcgcc agcatttggc tgtgcgtatt ctgcgtttcg    173280
     atcatcagcc gcatcgcctg gatgacggca tcgaggcggt catctttccg gggcgacggg    173340
     gcggcttcgg gctctggcat cgggcggaac tcctgtgatc accgtagcgc cattgtcact    173400
     tgtgccgcaa gctccatagg tgcaatggtc tgtgactacc cctctggatt ttccctccac    173460
     acagtgccgg gggtttggcg agcttcatgg cgcggtgctg ctgtgattat gctgtgaatt    173520
     tgcatcgtat atgccgtgat attgatgatg ataatgccga gaatatgctg cggttgtgct    173580
     gcgttctatt gacgtgcgga gattgaaatc ggtaggattc gctatgcccg cacctgacct    173640
     cgatatcgaa aagctcgggg cggcgatggc ttccggcctt cgtcgtcggt cgccgttgat    173700
     ggtctggttt atcgagcacc acgacgaatt cgctgccctc ctcgacaagc atggagcgca    173760
     ttggaaaggg ttggcggagc acttcgcggc ggccgggctg gtctcgcgca ccggccagcc    173820
     gctcacgccg cgcacggtcg aaaactattg gctgcgggcg cggcgcctgg tcgccaagcg    173880
     ccgcgcggaa gggcacccgg ttacggcggc accggccggc gcaccggcac ccgaaccgaa    173940
     attcgagttt gtgcgtttgc ggaatgaggg tcggggtgtt tccgcagcgg aacgccatgc    174000
     cctcggcgat ccaactgctc cggccgacca ggcggcccag ccggcaccca agtttcaacg    174060
     gtcatggatg agaaacgagg gccgcggcgt ttctgctgcg gaacgccgtg cccttggtga    174120
     tccaacagct ccggccgatc ctgacgatcc gaaatggaga ggcgacaaat cccgatagga    174180
     gaatttgatg actgaggccc cctcatcaga aaagaaaccc aacggcgccc acaaacccgc    174240
     aactcccgta ttccgccccg atagcgcagt cgccggactc aagcctgcgg aaatcaagcc    174300
     tctgctgacc agcgagcaat ccagcaccga acccgtcgcc cagggcctcg atctcgccga    174360
     tcgccccaag atcatcctga cggccggccg gggcaaaacc ggcaagacca ccttcctgcg    174420
     ctggatcgcg gagatggcgc agcgggacgg gaaagcgcct ctcctggctg acattgatcc    174480
     caccaacgca accttctcga cctatttcgg tggggtcgct cggccggaca ccttcaacca    174540
     ggccgcggtt cgcgactggc tccaggactt catggagttc gccatcgccg aaaaacaaac    174600
     cgccatcgtc gatctcgggg gtggcgatac gatcctccgc accatagccg gagaaatgcc    174660
     cggcttcgat gcaatgatcg aggaggcggg catggccgtg gtgatgttct acctcgccgg    174720
     cccgcatccc gaggatttaa ccccggccgc cacgctcggc gccttgggct tcaagccccg    174780
     cgcgcggggc ttcgtgctca atgaaggcat ggctcaagcc ggacaatccc gcgaccaggc    174840
     gttcagccgc gtcacctcct cgaacgtcta tcgcgatgaa accgcggacg gcgcgctcac    174900
     cctctggatg ccgcgcctgc atgcggccga ggcggtcgag gcgcgcaccg cgagttttat    174960
     cgctgctcgg gacggccaga cagaaccgcc gctcggggtg ttcaaccgat cgcgggtggg    175020
     ccactggctc aaggcgatgg atgagcaatt cgccggcgtg aaatcttgga tgccatgagc    175080
     gaggccgtcg atcagggcgg agcagaagcc gcgatccgcg ccgcgcgagc ggagctggat    175140
     cgggccgaac agctggcccg gctcgacaat gaccccaccg cgcacacgct ccacgcgctc    175200
     cgattgttcc tggactcgac agccgccatc gccgcggatc agcggcgcgt tatggctgag    175260
     caccgacaga acatcgatca ggatttcagc gccgtgcgcc aggcgcggga tggcttggcg    175320
     caaaccatcg atcaagcctt ccaggcggca aaggcgcagg ccgaggcggc acatgcggat    175380
     ctctcgcgtc agtttgtggc ctccttcgcg aaagaagcag aacagcgcct caagtccatg    175440
     tcgcggtggg tatggtggcg cacgatcgcc tcgggcgcgg cgctggcgat cgtgatcctc    175500
     gcgctcggct tcggcctggg ctactggcgc ggcaacgcgg ccgggtacag ccgggccgcc    175560
     gggacgattc aggccgccgg ggccgttgag caatccgtcc tcgcctcgca aggcccggct    175620
     ggcttggcgc aatggcacca gctcatgcgc gacaacgcca ttctcgacac catgaaatcc    175680
     aactgttcgg ggaagaacgt agcgcatcag gacggccgca cggcctgcca tctttggtta    175740
     tggaccacgc cgaatgtcgc gtccgccgcg catgggtagc ggaatggacg agcgttttac    175800
     tcccaccgcg gatgggtcgg ctcgctcggc cgacttcacc tcccagctcg gccgggtttt    175860
     gctcggcctg cttcggggcg ccttgcgctg tatgctggcg gctgtgctcg acgtggtgat    175920
     cctcgcggtg cggttcgtgc tctggttccg ccgcatcctg ttctggctgg gcttcttctc    175980
     agctctgtcc tgcattttga attatgaggt tcatcgactg cgccttgccg ccttcgcgct    176040
     cggggctggt atcctcatga tggcactctc acgcgccagc ctgctcctca atgaccggct    176100
     gcgcttctgg cagctgcaac tccatgcctg ggcgcaaggc tggccagtga agcgttatgc    176160
     cttcaccgtg ttgccgtccc ggcgctgatg gagttggccg acttaatacc taaccagaag    176220
     ctgaacaatt acatgtaagc atgttgttgt gttggtaggg gcataactcg atcctggtca    176280
     ctggatggcg gattgtctgc ctctgaatcc agccgttcaa tgccgacccg agctggcggg    176340
     agcgcgccca acatgtcgcc caaccttccc aagggaatgc tccatagccg aaactcgtgg    176400
     gcactctgct ggctaaccgc cttgggtgga acgcggaatg gccgctttga aacgagaaag    176460
     ctgcgaaaca gacatttcct gcatagcccg ctccggccga agcccgcctg ccagctccgg    176520
     cgtacgtcgt ggcccaaagg ctgcgcggcg gcaggggccc tcttgcacat tcactgcgcg    176580
     atcacgcgtc gtgctgcaag tcacgcccgg caggccattg tttgcacgtt gtcctcaaac    176640
     caattgcacc atctcgggat gtgcctgact tccgccaatc tcgtcggatt gacgcaatcg    176700
     tcgtgccggt tgcctggttt ggcccgtttc ttgctgagtt acgctcggct acattccaga    176760
     cggattaacc accctgcgtg tatattctga ttgccgacac tgatcgtact cgtgctgagg    176820
     cgcttgcggc gcggcttggt gctcagacgg ccggttatgt tgtgcaggtt gctccgtcca    176880
     acttgagcct gtcgaccgcg gtcgcagaac tcaggccaga tgtggtgatc gttgacatgg    176940
     cccggccgga ccgcgacagt cttgaacagg ttcgcagcgc caccgcccag ccggcaccgg    177000
     tgatgctatt cgtggatgag gatgacccga acttcatgga ggaggcgatc ggcgccggtg    177060
     tcgcatccta ccacgtcgat atcgcgacca tcgccgacat caagccgatc ctgcgcagcg    177120
     cgatcgccct gttccgacgg ggggccgaac gcgaacgccg ccttgctgag gcggagtcgg    177180
     cccttgccga gcgccggctg gtcgatgctg ccaagcgcct gctcatgcag cgcgacatga    177240
     tgaccgaacc ggccgctcat cgctttttgc agcgccgggc aatggagcgc caggtacgcg    177300
     ttgccgaagt cgcccgcgct ctactaggcg atgacgagga aaaaatgccg tgagttccat    177360
     accgatccgc atcggcgtct tgcggctgat tgactgcagc cccccgatcg tcgcgcgcga    177420
     gtacggcttc ttcgccgatg ccgggcttga ggccgacatc gctgtcgaac cgtcctgggc    177480
     caatatcgcc gacaagctag cctacggcat tctcgacgcc gcggtgatcc tggggccgct    177540
     cgccatcgcc atggggctcg gcctgcgggg acggcgaacc gccctggcgc ttgtcgcgat    177600
     gctttcgcgc gaaggcaatg ccgtggttct ccggcatggc gcggagcggt ggctggaaga    177660
     ggcccgcttc gctgcggtcc atgcatactc caaccatgac ctgctgctca ggcgttatct    177720
     ggcggaagcc ggaatcgacc tggcccgaac aaagataggg ggccgcccgc ctgccgagat    177780
     ggtcgcctcg cttgcggccg gcgagatcga cggcttctgc gccggcgctc cctggggcgc    177840
     gctcgcggtc cggaccggat tcggcacggt tgtcgccgat tctgcgacgc tggcacccgg    177900
     gcatccagaa acgtatggcc cgccccgtct gcaagtggta ttttcgatga actgaccagt    177960
     ctgcgtcaac gtatccggcc tcggagcaag ctcccggcca agatggagat ccgcgcgatc    178020
     cggtcctcat aaaattcacg gcatcaagcg cgccattttt tgaagcaggt tcccgaaacg    178080
     ccggtcgact gtcaggccat cttcattcca ccacccgcaa acatcatgac cggctatcaa    178140
     gttagcgaga tcattagccg gctaatcatg ccatccctga tgcggacctg gcatcaaacg    178200
     tgccgccgtt tctcagtacc gcccaagcga tccgcgccag cttgttggcc agtgcgacaa    178260
     ccactgcatt cttgtggacc cgagcggtga gcccgcgcag ccagccgccg agcggcgttg    178320
     agctggtcaa cagactggga agagcggcgc gagcaccatg gatcagcagc ttgcgcagat    178380
     acttgttgcc gcgcttgctg atcccgacca gccgcggtcg gcctcctgtc gtgatctgcc    178440
     gcggcaccag accaagccag gcagcaagat cgcggccccg gctgaacgtc tcaccgttgc    178500
     cgatcgcggc aatcagcgcg gtcgcgttca tcacgccgat cccgggaatg ctgatcagcc    178560
     ggcgtgccgc ttcgtcctcg cgcgtgcgag cgacaaattc gtcctcaaaa gcggtgatcc    178620
     gccgatccag ctcacgccat tcggcccgca tgtcggcaat cagcgcccgc agccgcggcg    178680
     tcaatgtcgc cggtggctcg gcttcatcgc catcgaacat ctcgatcagg gaccgctcga    178740
     gcttgctccg cccctgcggc accgtaaccc cgcgctccaa caggatcgct cgcaactggt    178800
     tgatcagcgc cgtccgttca ccgaccagcc ggtcacgcgc ccgatgcagg gtctgcatgt    178860
     caagctgctc ctccgttttc atggacacaa aacgcatcgt tggccgtgtt gccgcctccg    178920
     caatcgcctc ggcatcgcga tcatcgttct tctgcgcctt cacataaggg cgcacgtatt    178980
     ccggcgacat cagccggacg tcgtgtccct gcgccgcgag aagacgggca agatgatgag    179040
     cgccgcagca cgcctccatc gctatcacgc aaggcggcaa ctccttcgtg aacgtcacca    179100
     cggtctccgg tcgcatccgc cgccgtttga tcaccgcacc agtcccatcc agtcccgcaa    179160
     ggctgcagct gttcttgccc agatcaatcc ctaaaaccgc gatctctgtc ttcattgcct    179220
     gcctcccttt cttccgttgg cccccggcag attactctac aagcgggaaa ggggcgggcc    179280
     attccataaa attcgtggtc ctgcgggctg attttgcagc aatccaacct gcagccgccg    179340
     ccttgcgcgc tgctcttggg gccgctaccg cgctctgccg cgcgccagat ggagcacctt    179400
     cactcgcccg cctgcttgcc gcccccgccc atctggacct gccggaaggt atggtacgcg    179460
     acgcgctcat cccccggacc ggcaatccga tcttcatgac cggcgcctcg cttctgccgg    179520
     acaaggccga cattgcctgg accatcgcgc ggatggtcga ggccggccat cttgatcctg    179580
     caggagaaga tccaagtctg gccattatta caccataata acaagccata aaataggcat    179640
     aagaacgaaa aatggtctta tgttgtataa acaatacgca tatattgtgt tgtcgtaccc    179700
     tataaggccc gtttttggac aactcataag cttggcatcg atattgcgta gccgcatatg    179760
     catggtgaca tgcggcttcg ggccaatgac ggctcgaggg tcgtgcgggc gttgcccatc    179820
     cttgatcgat cgcgcgccaa cgggggccgc atcgcggatc gcaagatccg caggagtgcg    179880
     accatgcata ccacgacgga aaaatcgttt ctgatatccg gccatctacc gacccttttt    179940
     gcagcgttcc tctatttcga cgccagtttc atggtctggg tgctgctcgg tccgctcggt    180000
     gtgcagatcg gccggacgct gcatctcgat cccgcgcaca aggggctgat ggtcgcggtt    180060
     ccggtgctgg ccggtgccct cctgcggatt ccgaacggat tgtcggtcga ccgcttcggc    180120
     gggcggcgca ccgcgatcgt ggcgcagttc atcgtcatca ccggccttct cctcgcctgg    180180
     gcgaccggcc tgccaagcta cggctcggtg ctggcgctgg ggctcgtcct tggcctcgcc    180240
     ggcgcatcct ttgcggttgc tctgccgctc gcatcgcgct ggtatccgaa ggagcatcag    180300
     ggaaccgccc ttggcatcgc gggcgcgggc aattcgggca ctgtgcttgc cgccctgttt    180360
     gccccggcgc tcggcctcgc tttcggctac gccagcgtct tcggcatggc ggcggcgatc    180420
     atggtcgtcg tgctgtgcgt cttctcgata ctcgcgaaag acagcccggc ccatccggcg    180480
     ccgcagagcc tcggcgccta tctccgcgtg ctgcggctcc acgacacgtg gtggttcatg    180540
     ctgttctaca gcgttacttt cggcggtttc gtcggactcg cggcatcgct gacgatctat    180600
     ttccataccc agtacggcct ggctgcggtc aacgccggct acgccacggc ggcctgcgtc    180660
     ttcgtcggat cgtcggtgcg gccgctcggc ggctggctcg cggatcggat cggcggaatc    180720
     gcggcactct cgatcttcta tgtcgtcgcc gcggccacgc tggctctggt tagcatcggc    180780
     ctgccggacc tcgccctcgc ccttgctgcc ttcgtcctcg cgatgctcgc ccttgggatg    180840
     ggcaacggcg cggtgttcca gctcgtgccg atccgcttcg gccgcgagat cggggtaatg    180900
     accggcctgg tcggcatggc cggcggggtc ggtggattct acctcgcctc cagcctcggc    180960
     ttttcgaagc agttcaccgg ctcctaccag gacgggttcc tggtcttcgc cgccctcgcg    181020
     ctcgtcgcct tcgccgggct gatgacggtg cgtcgccgct ggcgcgcgga tttcacctcg    181080
     ccccccggca acggcaccgt ccggatctga aaggaacgaa cgccatgcat ggcaccaccc    181140
     tctcgcggcc gcgcctcgtc gtcgtcggta acggtatggc cgggatgcgg acggtcgagg    181200
     aaatcctcgc catcgcgccc ggcatattcg acatcaccgt gttcggcgcg gaaccccacc    181260
     cgaactacga ccggatcatg ctctcgccac ttctcgcagg cgagaagcgg ttcgaggata    181320
     tcgtccttaa tgactacgac tggtacgcta gcaacggcat tcgcctcatc gccggcgagc    181380
     atgtcgactg gatcgaccgc gcgcgccgga tcgtgcgagg tgccgccggc accgaggcgc    181440
     cctacgacct gcttctgctg gcgacaggct ccagcccatt cgtcctgccg atccccgggg    181500
     cagaacttga tggcgtgcaa accttccgct ccgtcgccga tgtcggggac atgctggcaa    181560
     ccgcgcggcc cggcgcgaag gcggtggtga tcggcggcgg gctgctcggg ctggaggcgg    181620
     cgcacggcct cgacctgcgc agcgccgaag tgacggtgat ccacctgatg ccgaccctga    181680
     tggagcgcca gctcgacgct tccgctgccc atctgctcaa gcagaccctc gaggcgcgcg    181740
     gaatgacgat cctgaccggc accgagaccg ccgcgttcat cggcgacgac cgggtgcgcg    181800
     cggtccggct gaaggacggg cgggaaattc ccaccgacct cgtggtgatg gccgtcggta    181860
     tccgtccgaa tgcaggcctg gcccgggcga ccggtctcga atgcaatcgt ggcgtgatcg    181920
     tcgacgattt cctgcggacc tccgatcccg cgatcttcgc gatcggcgaa tgcgtcgagc    181980
     atgacggcaa ggtcttcggc ctggtcgcac cgatctggga gatggcccgt gtcgccgcgc    182040
     gggcgatgac cggcacgccg gggatcggat tcacgccggc ggccagcgtt acaaggctca    182100
     aggtctcggg cgtggagatg gcctcggccg gcgccttcct cggcgattcc ggcaccgagg    182160
     acatcgtgct gcgcgacggc gcgcggggga cctatcgccg gctcgtcctg cgagaaaacc    182220
     ggatcgtcgg cctcgtcgcc attggcgatg caagcgacgc cgcctggcat ttccagctcc    182280
     tgaaggacgg gaccgatatc ggcgagatcc gcgacagtgt gatcttcggc cccctcgcgg    182340
     acggaccggc cgaccccgac gccgccgtga tggccctgcc ggacggtgcg gaaatctgcg    182400
     gctgcaacgg cgtctgcaag gggacgataa cgagggcgat caaagcgttc ggcctcgcaa    182460
     gcgtcgatga cgtgcgcgcg aggaccaagg cgtcctcctc gtgcggttcc tgcacaggcc    182520
     aggtcgaggc gctgctgcgc gccgccctcg gcacggagta cgcacccgcg acggtcaagc    182580
     cggtctgcaa atgcaccggt ctcgaccatg gcgaggtgcg caggcggatc gtcggcggca    182640
     aactgaaatc aatcccggcg gtgatgcagg cgctggaatg gaagaccccg gacggctgcc    182700
     atgtctgccg cccggcgctc aatttctacc tgctctgcgc ctggccgggc gaatacgttg    182760
     acgacgccca gtcgcgcttc gtcaacgagc ggatgcacgc gaacatccag aaggacggca    182820
     ccttctcggt ggtcccgcgc atgtggggcg gcgtgaccaa cgcgcgcgaa ctgcgcgcga    182880
     tcgccgacgt ggtggacaaa ttcgacattc cggaggtcaa gatcaccggc ggccagcgca    182940
     tcgacatgct cggtgtgaag cgcgaggacc tgcccacggt ctggcgcgac ctgaacgccg    183000
     ccggcctggt gtccggccac gcctacggca aggcgttgcg gactgtgaag acctgcgttg    183060
     gctcggaatg gtgccgcttc ggcacccaga actcgacccg catgggcatc gcgctggaaa    183120
     agatgagctg gggctcgtgg catccgcaca aggtgaagat ggccgtctcc ggctgcccgc    183180
     ggaactgcgc cgaggcgagc atcaaggatt tcggcgtgat cgcgactgag gccggctggg    183240
     acctgctggt cggcggcaac ggcggcatcc gcctgcgcgg caccgacctg ctgtgcaagg    183300
     tgacgacaga ggccgaggtg ctcgaatact gcgccgcctt cctccagctc taccgcgagg    183360
     aggcccatta cctcgagcgc accgcgccct ggatcgagcg cgtcgggctc gactatgtga    183420
     agcaagccgt tgtcgaggac gaggacaacc gcgaggctct cgccgcccgc ttcctgcatg    183480
     cccaaacatt cgcccaggcc gatccctggg ctatgcagtc ggccgcggcc gccggcgcga    183540
     aattcaccca tgtcgcggag cttacgtgat ggacgcgatc atgaccgata ccggcttcgt    183600
     cgatgtcgcc gccctcgacg acatccccca acgcggcgcc cggaccgtgg cgaccgcgca    183660
     cggcgatgtc gcgatcttcc gcaccggcga cgacgccgtc ttcgccctgc gcgattcctg    183720
     cccgcacagg ggcggcaaaa tcagccatgg catcgtccac ggccatggcg tcacctgccc    183780
     gctgcacaac tgggtgatcg cgctcgcgac cggtgcggct gagggcgagg cggccgcctc    183840
     ctgcgtcccg cgcttcccgg tacgcgtgac cgagggacgc gtgctgctgg acgtctccgc    183900
     tccgctggcg ccggcatgaa cacgacctgt ccctattgcg gcgtcggttg cgggctgatt    183960
     gccggcgagg ggacaatcgc tggcgacccc gcccatcccg ctaatcgcgg acggctctgc    184020
     gtgaagggcg cgaaactcgc ggccacgctc gacgaccggg agcgactgcg gacgccgatg    184080
     gtcggcgggc gcgagacctc ctggagcgcg gcgctggatg cagcggcgga cggcttcgcg    184140
     cgggcgatcg ccgcgcacgg gccggactcc gtcgccttct acgtgtccgg acagttcctg    184200
     accgaggatt actacgtcgc caacaagctg atgaaggggt tcatcggcag tgccaatatt    184260
     gacactaatt cccggctttg tatggcgtcc gcggtggccg cccaccgccg atgcttcggc    184320
     gaggacctcg tcccggggat ctacgaggat ttcgacgagg cggaactgat catcttcgcc    184380
     ggctcgaacg ccgcatggtg ccatccggtc ctgttccagc gcgcacttgc cgcccgggcg    184440
     acgcgcggga cgcggattgt cgtgatcgat ccccgccgta gcgcgaccgc cgagttcgcc    184500
     gacctgcacc tcgccgtgcg cccccgcggc gacctcgccc tgttctgcgc gctgctcgcc    184560
     gcctgcgcgg accgcggcgc gctcgatcgc gactacatcg cgcggcacac cgccgggttc    184620
     ggcgccgcgc tcgccgccgc gcggcaggcc gagcacggga tcgatcccgc cgcgttcgaa    184680
     accctcgccg gctgggtcgc cgccaccccg cgcatggtga ctgccttttc gcagggcgtg    184740
     aaccagtccg agacggcgac cgacgcaatc ggcgcgatcc tgaacctcca cctcgccacc    184800
     ggacggatcg gccggcccgg cgccggaccg ttctcgctga ccggccagcc caacgcgatg    184860
     ggcggccgcg aggcgggcgg cctcgccaac cagctcgccg cgcatctcgg cttcgacgac    184920
     cccgacgacc acgcgacgct ctccgaattc tggggcgccc ccaacctcgt gcgccggccc    184980
     gggctgaagg cggtggacct gttccgtgcc gtcgccgacg gcaagatacg cgccctctgg    185040
     atcgccggca ccaaccccgc cgaatccctg ccagcgagcc tcgacgtgcg cgacgcgctg    185100
     tcccgttgtc cgcacctcgt ggtcgccgat tgctggccca cggcgacgac cgcccatgcc    185160
     catgtcctgc tgccagcggc agggtggtcc gagaaggacg gcaccgtcac caattcagag    185220
     cgcatgatct cccgccagcg cgcgtttcgt cccgctcccg gtgctgcccg acccgactgg    185280
     tggatgttcg ccgaactcgc ccggcggctc ggccatggcg cggccttcgc ctgggacgtg    185340
     ccggctgcga tcttccgcga acacgcggca ctctccgctt tccgcaactt cgggcgacgg    185400
     cggttcaata tcggcgggct cgctgccatc ccggatgacg attacgacgc aatgcgcccg    185460
     ctgcgctggc ctctggccgg agatcgcctc tttgccgagg gaaacttccc gacgccagac    185520
     gggcgggccc gcttcgtcgc cgtatcacca ctccgccacg cgcgcacgga tttcaccctc    185580
     aataccggcc ggctgcgcga ccaatggcac accatgacgc gcaccggtcg cgtcgccgaa    185640
     ctgatggccc accaggatgc cgcgaccctg gaactcgcac cgacggacgc ggcgcgcctc    185700
     ggcgtgctgc ctggtgatct tgtcgccgcc gggagcgaag gggcgcgcat cgtcttcccg    185760
     gcagcgatct cgccgggaca gtgcgaaggt tcggtgttcg ccgcgataca ctggaccgca    185820
     gcgcagggca gcgccggaag cgtcaaccgc ctcactgttc cggcgaccga cccgatctcc    185880
     ggccagccgg ccttcaagca ttcgccagtg cgacttgcgg cggtgccgac gctctggagg    185940
     gccattgcca tcggccgtgc cgcttcctgc gcgatggcag ctggcaaaca agccgtctgg    186000
     tcgcaggcac tacgcccggg cgggctggcg ctgtcgcgct tcaccgggtt tgccccgctc    186060
     gctgcccgca gcgccgtgga cgcggcacgg tggctgctgg agctgccgga gggtgccgaa    186120
     ttcctcgact acgccgaccc gacgcgcggg gtcttccgcc tcgccgtgct ggaccgggcc    186180
     ggcgtccagc tccttctcca cgtcgcgccg gcggagcttg cgctgccgga ccccgaggcg    186240
     ctggaggcgt tgttcgcggc cccacaagca ggagccgatc cgacgctcct gcttggccag    186300
     cccgcccgcg ccaccgcgac ccgcgggcgg caggtctgcg tctgcaacgc ggttgccgaa    186360
     cccgcgatcc gcgccgcgat ccgcgccggc tgccggagcg tcgaggcgat cggcgccgcc    186420
     accggcgccg gcaccggttg cggttcatgc cattccgaac tgaagggatt tctccgccat    186480
     gacctcgttg ccgccgaata gcaaggcaca tcccgtcatc ctcgccggca ccgggccggg    186540
     cgatccggat cttctcaccc tgcgggccgt acgggcgatc ggcgccgccg aaatcatcct    186600
     gcatgatgcg ctggtcgatg ctcgcatcct ggtccttgcc gccccggatg ccgtcctcat    186660
     ccatgtcggc aagcggtgtg gccggcacgc gatgagccag acagagatca accgccgcct    186720
     tgtcgaatgc gcgcgcaccg gcgctcgggt gctacggctg aagggcggag atccgatgat    186780
     cttcggccgg gccggcgagg agatcgcggc cttgcgggcc gcaggcatcg cggtcgaggt    186840
     gatcccgggg atcaccgcgg cctcggcggc ggcggcgtct gcctgcgtct cgttgaccgc    186900
     gcggggcagg gcgcgcgccg tcaccctggt caccggccac accgccgatg gcggggtacc    186960
     gcctcaggac tgggcggcgc tggcccggct cgattcgacc ctcgtcttct acatgggctc    187020
     ccgccacgcc cgagcgatcg ccgaccgcct gatcgaggcc gggctcgatc ccgccacgcc    187080
     ggcgatgctg ctgaccaatg tcagccgccc gaacgagacg cgccggcttg accgcctcat    187140
     cgacctcgca gacggaatcg ccgccgccga tctcgcggcc ccggcgctga tcctgatcgg    187200
     cgccgcgctc gacgcggcgg ttccggtggc gactattcgg gcggacgccc gcgagctgtc    187260
     gtgagccagc cccgcgcctc gacatggtcg gcgatccggc gagccgtttc gggcatcgac    187320
     atcccttcgg cgcgccatcg ctcgcgaagt accgcgattt cagacagccg tgcggcccag    187380
     tccgccccga attcgacttc gagatgccga cgcagcacag aggacaggcc ggctgcctga    187440
     ccgccggtcg agaccgtcag cagcagatcg ccgcgcctca cctgcgccac ggaatgaaag    187500
     tcgcagtcgg gcaggcggtc ctcgacattc accagcacgc gcgccgcccg cgccgccgcg    187560
     accaggcccg cgcgaaccac gtccggaacg tcgacgatcc agagcgcatg cagtcgcgcg    187620
     aggtcatcgc ccgtcggcat tctgcggcat agcgcggcgc cagcttccgc gatcgtcgcc    187680
     gcatccggat cgtcactgaa cagcagggcg gcatcggcgc cgccttcacg cagcgcacgc    187740
     agcctgcgaa gcgacatagg accgttgccg catacgctga gacggcaata gctcggatcg    187800
     agcacgatcg gaatcatgag atcatcccaa catgaaacgg aaccgcatca aggctagcaa    187860
     ccgcaagatc gctcacaatc gtgcgtcagg aggatagcgg cgccttgtct gctttcagaa    187920
     gttcaaaaat cgctgcgtta cgaccgaaac ccagatagag gccgcccctt gtgcccgcga    187980
     acgaccgccc ttgggatcat tcaatttgac ctcggtgtcc ttgtcgggtt gctccacgcc    188040
     aaggctgatc gtcccctgaa tggcgacttt cctctggtcg ggagccgtaa gccgccatta    188100
     cggcttcggc ccggcctcgc cgcaaggtga acatctggta tccgctttcg taagacatca    188160
     gccgactggc cgctatacgt ccccattggt gctacccagc ggatataaaa tcataaatct    188220
     actggtcact gcctacactt ggtcgctcag gccacatttg cctgaaaacg gcgtactggt    188280
     ggctgcttgt gttgtcgtgc aagccaaagg tcatagtttg cctgcatccc aagccatgcc    188340
     tgggccgtgc tcacgccagc ctgttcaagc cggatcgcca aatcagggct aatggcagcc    188400
     ctggcgttca acacacgcga caacgctgcg cgggacatag ccagcctctg ggcggcctcg    188460
     gtaacggaaa gccccagatc actgatgaca tcctctctta gcagttcgcc aggatgtggc    188520
     ggattatgca tcattttgcc ttctcctagt ggtagtcttg ataattcacc aactcaacgc    188580
     cagcctcaac gaaccgaaac gtcactctcc aattcccgtt gacccacacg gaccagtgcc    188640
     cggcaaggtc acctttcagt gggtgcagct taaacgccgg gatgttcata tccttcggcg    188700
     tctgcgccac atccaaaagg ccaagaatgc gcttcaactt gccagcctgt gcggcttgaa    188760
     tcccgcgcat ggagcccgtg cggtaaaacg cctccagacc ccaggggcta cgcatgaaaa    188820
     tttcgggcat agttgacggc atggaatcgg gtgtgattcg gggagtctcc ttgagattgg    188880
     gagacgtgca tgtcggtgag gcggcttgtg gaggaatttt cggcgttgga agacccccgc    188940
     tgcggcggca aggttgagca ccggctaatt gatattctgg tgattgcggt gtgcgcggtg    189000
     attgccgggg cggaaagctg ggaggatatg gcactgtatg gccgtagcaa gcaggaatgg    189060
     ctgggcacgt ttttggcgct gccgaacggc attccatcgc acgacacctt ccggcgtgtg    189120
     ttcatgctga tcgataccgg gcgtttcgag gcatgtttcg aagcgtgggc gcgctcattc    189180
     gggacgactt tggaccggga agtggtggcg attgacggga aaacgatccg cggctcgttt    189240
     gatcgcagcc gggaccaggc ggcgcttcac gttgtgagtg catgggcgag tgatcggggg    189300
     ctggtgctcg gccagcgtca ggtcggcgac aaatcgaacg agatcaccgc gatcccggaa    189360
     ttgctggatg tgctggacat caagggcgcc attgtcacgc tggacgcgat ggggtgccag    189420
     cgagccatcg cgtccaaaat tctcgagcgg ggtgctgatt atctcgtcac cctcaaagca    189480
     aaccagggga agaaacacag cgccgtgcag gagtattgcg caaccacctg cttcagccgc    189540
     tcacccgttg atcggccggt gcatgacgaa ttcgatgatg gtcatggtcg tcttgttcgg    189600
     cgccgggtgt tcgtctgtcc ggacgccgta gcgctggaac cgctgcgcga ctggccgggg    189660
     ttgaagagcg ttctggccgt ggaaaccatc cgcggcgtca acggatccgg caagatcgaa    189720
     gccgaaatcc gctacttcct gtccagcagc gacgatcaac ccgaaatcct ggcgaaagcg    189780
     atccgtcaac attggcagat cgagaacagc ctacactggg tgctcgacgt caccttcaac    189840
     gaagatcact gccggatccg ggatcgcaac gccgtccaga acttctccct gcttcgcaag    189900
     atcgcaatca acctcgttcg ccgccatcag gcatcaaagg ccagtctcaa ggggcgccgc    189960
     aaaatggccg cctgggataa ccgttacatg gagcaagtgc tcaccggctt ctttcatgcg    190020
     taacccctgc tccagaccct tatctcggaa actcaaaatc ataagcaacc gtagcgcgta    190080
     acgcgtcact atacaacttc aatcaacacg gtcacgccca aaatcgaccg gtttcggaca    190140
     cctagccgag aatatgccca aaactatgct tgacggcatt gtgggcattg tccgatctta    190200
     aaggcaggtt tttggacgaa attgccctat gtcgcgcgtg tttttgtatg cccgtgtctc    190260
     gacggtcgag cagaccgccg agaatcagat cgccgaggcg aaggccgcag gattcgccat    190320
     ccgtccgaac aggatcatta cggaaacgat ctcgggcagc atcgcggctc gtcagcggcc    190380
     ggagttccgc cgcctcctcg atcgcctcga agatggggac gttctcgttg tcaccaaact    190440
     cgaccgtctc ggccgcagcg cgctcgacgt gcgggctacc gtcgatgccc tagccggcct    190500
     cggggtccgg ctgcattgtc tggccctggg cggcgtcgat ctcaccagct cggccggccg    190560
     catgaccatg caagtgatcg ccgctgtagc ggagttcgag cgggacctgc tgattgaacg    190620
     aacacaagcc ggggtccaac gagccagagc gagcggcaag gcgatcggtc ggccagcatc    190680
     tttaacagaa gagcaaaagg cggcagtcag ggcggagcga gattctggtg catcaatttc    190740
     attcctagcg cggagctata aggtcagccg tcagaccatc ggccgtgtct gcgaatgaag    190800
     ccttgccgtg cgggtgcggg tcgccgatgg accgccgcag cgcatccgcg acatgggggc    190860
     tcagcacatg ccaggtgaag agatctggct catcggagag cgccgtgcga atggcgaatg    190920
     caaatactac ctcgtcaccc gtgaaaaatc gaactttgct gatctggggg cgatgttttg    190980
     gtggctggca atattgggat ttgcagggtc tgggcgagct gaggggaaaa accttgcaaa    191040
     accgttggag cgttgcgcgg tggtcgcgat cgtgattctc tccctttgat gtcgaacatc    191100
     atgcgtttgg cgtggaggaa agaatgccgc cgaagctgaa tgcctcgcag gatgatctcg    191160
     aactgttccg ctcgcggctg gagaacatca tcgaccagcg gcatcccctg gtgcggctgg    191220
     cccggctgat cgactggcgg gttttcgagg aacgcttcgg ctcactctac gccgaggcgg    191280
     cgggacgtcc ggcactgccg acccgcctga tggtggcgct gcatcttctc aagcacatgg    191340
     atgggctgtc cgacgaagcg atctgcgcgc gctatctcga cagtccgtat gtccaggcat    191400
     tctgcggcga gacgcatttc cagcacacgc tgccgcttga ccgatcctcg atgacgcgct    191460
     ggcgcaaacg gatcgggccc gagcggatgg aggccctgct cgccgagacg ctggcggccg    191520
     ccgagcgggg tggggccgtg gcggagaagc actacaagcg ggtcaccatc gataccacgg    191580
     tccagccaaa ggccgtgacg catccgaccg acagcaagct cctgcacagc ggcatcgaga    191640
     cactggcgcg gatggcacgc aagcacggta tcacgctacg ccagtcgtat cgccgggtcg    191700
     cgcgctacgc caggcaggag gcggcgcgcc tgcaccatgg tggcaaacgc cgcgaggccg    191760
     aggctcgcgt gcgcaagctg cgaacctggc tgggccggct ggctcgtgac atcacccgca    191820
     agatcgcagg caacgctgaa gcgaaggcca ctttcgccga aacgctgggc ctgatcaatc    191880
     gcctgcttcg ccagaagcgc tccgaccgcg gtgccgacaa gctctattcc ctgcacgcgc    191940
     ctgaggtgga gtgcatcggc aagggcaagg ccaggacgcg attcgaattc ggcgtgaagg    192000
     tctccatcgc caccaccaac gccgccgcac ccggcggtca gttcgttctc ggcatgcaga    192060
     gccagccggg aaatccctat gacggccaca ccctggccgg ccagatcgag caggtcgagc    192120
     ggatcaccgg cgttgccgtc gcccgcgcct atgtcgaccg cggctatcgc ggccacggcg    192180
     tcgaagccga gggcagaagg atcttcatct cccgccagaa acgcggcatc acccccacca    192240
     tccgccgcga gttgcgccga cgcacagcca tcgaacccgt catcggccac atgaagaccg    192300
     atggccatct ggggcgaaac ttcctgctcg gcttcgacgg tgatgccatc aacgccatcc    192360
     ttgccggcgc cggccacaac ctccggctgc tccgcagatg gctgatcagg cttctttgcg    192420
     ccatcttcac atggctctcg gccgcaagac cctctccaga ccttcgccta ccgaactacc    192480
     acatcgctta attcacagac gactacctct ccaacgagag cgaggccggc gcaccaccac    192540
     cattgcttcc cttgccaccg ctcggcccac tcgagcgccg ccagttcgac tacacagacc    192600
     tcaccgacag cctcgcagaa ctcgacgcca acatccgcag cacgcggcaa tcactggatg    192660
     ggatggtgtg gaaatggcaa ggcgagccgt aatgaacaag cacatttttg tttgacttcg    192720
     ttctcccgcc aaacctccat gagaaagagt caataaaccg atgatcccga cgacatcacg    192780
     aaaggaaggt ctacaccgtg gcgccttacc gggatctccg gctatcaagc aggctggcct    192840
     gcggctgaca ccatctggcc atctcgtatt cgagcccgag aacccggcga ttgaacccgc    192900
     tgtagctgcg aggcttgcgc aggcttttgc tcatggctca gggccaggac tgctgcaact    192960
     gagcgccgcc gaagtcgtac ctgatttgcc gctggccctg ggctggtggc ggagcttcgg    193020
     ccaacgttac attaccgtcc tccgcctgca aacgaccgag caggcctaca tagtgaaatc    193080
     aaactctcag ccttcagttc cttcccccga tgaagctgag ctgacgaccc tggtgctcac    193140
     cgcgccgata atgccgggtg ctgagtttct gacccaggac attttgcgca cgctctggtc    193200
     cgagatcgat cgagcactga tcgaggagct tgaaaccaga cagatcgatc tgcaatcgta    193260
     cctgcatgcg ctcaacccga cctggaacct gctagggcgg gtgcatttca atctagcgga    193320
     gaacaagggc gatcccgagg cgccattcgc gttcatggca acctacacca cgcggctgtc    193380
     ggcccaggcg aaggtgcagc atctaccgct ggggcaagcc ttgcgcgaat atgccggcgc    193440
     ggcaaatcgc cggcagttgc tgtctttgct gatgccggtc cagagagcgg cggaaagctg    193500
     tgcgtggctg aagccgatga ttgagggcgg cgaaatctat cacccgctgc gctggacgcc    193560
     gggcgaggcg gcgcggtttc tcgccagcgc cgccgagctt gaagcggccg ggatcgtgct    193620
     ccgcatgccg gcgaattggc agacgaaccg gcctacgcgt ccgcgcgtct cggccgtgat    193680
     cggcagcgtt gcgccgtcga agctgggcct tgacgggctg atggatttcc agatggaggt    193740
     cagcctcgat ggcgaggctt tgagtccggg cgagattgaa cgcctgctgg ccggcaccga    193800
     gcagttggtg ctgctccggg gcaaatgggt tgaggtagac cgggcgcggc ttgaacgggt    193860
     catggcgagg tttcgtgaag ccgaaaccct ggcggccaaa ggcagtctcg actttgccga    193920
     agcgatgagg ttgctcgctg gcgtcgatga aagcgaggcg gcggaagtcg ccgaccagga    193980
     gtggagtcag gtgagggcgg ggctgtggct tgaggagact ttgcagacgc tacgctcacc    194040
     cggctccctt accgaggata cgccgcccgg actgcgcggg acgctgcgac cttatcagaa    194100
     ggccggcgtg cagtggctgc gcctgctttc tgctctgcgg cttggtgcct gccttgccga    194160
     tgacatgggc cttggcaaaa ccattcaggt tctggcgctg ctcctggcgg aaaaatcccg    194220
     gagggccgtc cggcagccca gcattctggt ggcgcctgcc tcgctgctgg ccaactggtc    194280
     aggagagatc gatcgcttcg cgcctgatct tcgcgctcgt atcgtccact cctcaacaag    194340
     cagtgccacc gagatcaaga cctttactgc ggaggatgcc gcggccttcg atttggtgat    194400
     caccagctat ggaacactgc tgcgtctgcc ggctctcacc gaaatcctct ggcgcttcgc    194460
     cattctcgac gaagcacagg cgatcaagaa cccggcggcg aagcagaccc gtgccgccaa    194520
     ggccttgcgc gccgaggccc ggatcgcgct caccggcacg cccgtcgaga atgcgctcgg    194580
     cgatctatgg tcgatcttcg atttcatcaa cccggggctc ctcggcaatg ccaggaaatt    194640
     cgcccggtac accaagagtc tcgccaacca gaggcagaat ccctacggac cgctgcgcga    194700
     tctggtgcgg ccttatatcc tgcgacggat gaagaccgac aaggcgatca ttgccgatct    194760
     gcccgacaag atcgagatga atgcgcactg cctgctgagc cgcaagcagg cggcccttta    194820
     cagcgaagcc gtcggcgatc tcgctcgcag cctggaggag gcggagggaa tggcgcgccg    194880
     ggggctggta ctggcttcgc tggtccggct caagcagata tgcaaccatc cagcccactg    194940
     gctgaacgat ggaaattggg atgaggccgg aagtggcaaa ttcaggcggc tgcgtgagat    195000
     cgccgaggct gttgcggcgc ggcaggacaa gatgctggtt ttcacccagt tccgcgagat    195060
     ggtagcgccg ctggccgccc ttctggcttc ggtctttggc cgcgacggtc tggagttgca    195120
     tggcgggacg ccagtacgac agcgccgtac gctggtgcag cgatttcagg aagacgagga    195180
     ggtgccgttc tttgtcctgt cgctgaaggc gggcggtact ggtctgacat tgactgccgc    195240
     ctcgcatgtc gtgcatttcg atcgctggtg gaacccggcg gttgaggccc aggcgacgga    195300
     tcgtgccttc cggatcggcc agaaatcgaa tgtgctggtc cacaaattta tctgccgcgg    195360
     cacggtggag gagaggatcg acgcgatgat cgaggcgaaa cagtctctct cgaccgagtt    195420
     gctctccgga gagaacgagc ttgacctgac cgagatggac gattcggcac tgatcgatct    195480
     ggtatcgctc gatatcaatg ctgtagtgga agactgatgt cctggcactc tcggaattgg    195540
     gcgccttatg tcccggtcgc gcaacggcga cgccagggtg cacgggaagt ggcaagactg    195600
     cgcaaggccg ggcagatggt cagcccggtg gaggtcgccg gccgcgccat agccacaacg    195660
     ccctggggca aggcgtggtg cgatcacctc gaatccctgc acgactatga gaaccggttg    195720
     ccgcgcgggc gaacctatgt ccgcaacggc tcggtgatcg atctgcagat cgcgccgcgg    195780
     gtggtgaccg cgctggtcag tggctcggac atctatcggg tgacggtgac gattggcccg    195840
     gtgccgaaga tggtatggca gacgatctgc tccgattgtg ctggtcagat cgattcgctt    195900
     gtcgagttgc tgcaggggcg gctgtcaaag gcggtgatgg cccggctgtg ccggcgggag    195960
     cagggattat tccccaagcg gtcggaaatc cgcttctcct gctcctgccc tgattatgcc    196020
     gctctgtgca agcacgcagc agcagtactc tatggcgtcg gggcgcggct ggatacaaga    196080
     cccgagttgc tattcaggct gcgcgacgtt gatgaggcgg ccctgattac caatgccggt    196140
     acgacgctgc cggaatcggc ggcaacgatc cctggccgaa tcctggaaga tggcgacgtc    196200
     gccgccttgt tcgggatcga tattgcagca tcggcggtcg aaaatgcgaa accgccgacg    196260
     tcgcaggtgc ctgtgagcgg caagaggaaa gcgtcgagac caacatgccg aaccaccgga    196320
     gacaaggttg cctccactca ggagtcggct gcaaaacctg ttggccgggc ggccaaggca    196380
     ccgaaagagg ccaaagccaa acgtccggca gctccggcca gtcagaccgc gcctgcaaaa    196440
     cccaagctgc aagccgccga caagccggta aaatggtggc tgaaaccaaa ggtcgccaac    196500
     ccgccgaagc gaggcatccg gagcaaacca aaaattggct gatccagccg tactgaagcc    196560
     tcttccgcag atcgccccgc cccctgctca gaccaactcc aaccgcagct cacggccgac    196620
     gagcgcggcg gcacgctgga gggtctcgat cgtgatgttg cccttggcct tgaggatacg    196680
     atcgacctga gcacggctgg tgtgcatgcg ctcagcgagc gcagctttcg ttataccctg    196740
     gcgctccatt tcctgcgaga gctgccaggc gaccacgcgc gtcagagcct cggccttcgc    196800
     ggcttcgcgg ataccttctt cgccgaggaa ttcatcgagc gtcgtgcccc aatgaggatt    196860
     cttcttgatc acacctgcat ctccttcatg cgccggcggg cgaggtccaa atcgtccgcc    196920
     ggtgtcttct gcgtcttttt gatcaaccca tgcaccacgc cgatccggtc atcttcgata    196980
     aagaacagca cgcgggcgat gcgccggctc ggcaagctgc tgcggacctc ccacaggccc    197040
     ctaccaagcg accgacatag cggcatgccg atcggccagc caaactgcac cgtcgccagg    197100
     tcggtgccga tgatgcggcg atcctccgcc ggcaggcgtc gcagccagtc gagaaccggc    197160
     tccgcgccac cggccgtgcg atagaaaaca acgggtatct cggtcaggcg cgcggggttc    197220
     atacatcctc ctagcttgcc tttgtatcac aaaagataca ttactgcaag gccgaatatt    197280
     gccccgtcat gtcggcccgg agcgcgtttc cgatctgcgt gcgctgacga accagaaagt    197340
     cccgcgtgcg gtgaaccacc agaatcgatg aacaggcttc gctcttgatg gcgatattaa    197400
     ccgcatggag ggacgtatca cggcctcgcg gatcgcggct gcagccgcgg cattcgtctt    197460
     gccgcactcc acgtaagggg cagtgtcctg aatttcgtgt gtgagtggca tagcgggtag    197520
     aaaggaagac ccatatggca cgacggagag cgccggcgat cccggacgaa ttgctggacc    197580
     agcttctggc tgggggagac gcggcggcag cgctgaattc cggggatctg gtgaacgcgc    197640
     tgaagaaggc tctggcggag cgggccctga gcgcggagat ggattaccat ctgagtgacg    197700
     aagcggaggc ggagaacagc cgcaacggct atggccgcaa gtcggtgtcg accggcacgg    197760
     ggaagatcga gattgcgatc ccgcgagacc gtgcgggtag ctttgatccg cagttgatcg    197820
     ccaaatacca gcgccggttt ccagcgcgca gaccgtctgg ttcagcgccg gccacgacat    197880
     gccgccggca acaaggtgga cctgaaaagc acggacctcc caaggccgag cttctccggc    197940
     gagcggctga aaaagcggcc aaacttggcg accgcatgca cgtatgatcg ttgggtcgca    198000
     ggcgatagat tgcggaccgt cgtatcctca atcatgcggc ggcgcagagg gctcatctcg    198060
     gtcatcgggg cggtcccgtc cagggttggg gtgaaagcac ccaaatcctg gcagactacc    198120
     gccagaccat gtaggaaaac cgccgtctca gacgcaacta ccgcgccagc ggtttagttc    198180
     aatccgcacc ccgtcgccat gcaggcgcag catgtgtcgc aattgtctca tggtctgctt    198240
     cctcttcgcc ggcatcccag tcccccgctg atgaaagcgg taaccgtgat gcctccgttg    198300
     ctgacccaga agcccccgcc ggcggccgga tattgatcgg aatgccggcc ggcttcacgt    198360
     cggaatccgc agtcaggacg gacggtcgga ggccggaggc cggagaaact tgatgacggc    198420
     caccgccgcg acatccgcga gagcggaggc gagcgcgcga tcaaggccga tccagcacga    198480
     acgctagctg ccagcggtct ggcgaccgct ggtacgacat catcggcacg ccgtgcttga    198540
     gggttccgcg atctggtccg ccgtcgcgtc agacgaattt ggggcgccga aatcgcagaa    198600
     cgctacggcc taatcgagca caaccgccac acgcgctacg tcgtcgcctt ggaggagcaa    198660
     ttgctgccta gacagctcct cgatgaaatt ggcgtagaag ctcttgctgc tgacggctgc    198720
     cttcttcccc aagtttccaa tgttggtggt ctgattgacc tttaggagac tcagatcgcc    198780
     ggtgtctttc tttgtgttca ttatagaagt gttggattgc gcgaaggcct tatccagctg    198840
     tggagaatcg accgcggctc cgggggtggg gtcgtttacc accgaagcaa agaatcccag    198900
     ttcggcattt ttgatacttg ggccgttgta gcccacgatc tccaggccac ccaggccccg    198960
     tccccgcagc ttgctggcca ggacttcaac ggtcgaagtt ggacgagacg ggtccgggcg    199020
     caccccggcg taacacgagg tcacgattag tcttcgcaag ttgcggccca cacctctgac    199080
     cgggtcggcc atggcgttgc cgatgctttc agccgacacg ccttcaatac tcccggggct    199140
     gccgtggccg acgagcgcaa ttttttctgc atcgtgcatg tttaacccag gcgaaaatgc    199200
     gaccacactc tcgtctagag gttcgctgaa gttcagcttt gccagcgcaa aggcaatgct    199260
     ggtctggacg ataaagtcat aattaccgtg cttgttcgca aagatgatga ccatttggat    199320
     gcccctcgtt cacggcttca gctcgccgag cggcaacgtt gccgtgtgtc aaggggagag    199380
     tccagcctat ttgccgcggt tgatcacaat cacagcgtct cgaccctggc cgatcaggtc    199440
     ggggcggcat gtcatgcgct ggtaccgctc taccggctga tcgaaaccga tgttcatgct    199500
     gccgcgcgcc tgcatagcgg cgacaccacg gtgccggtca tggcgcgcga caagaccgat    199560
     acggcgcggt tcaccctcgg aaacctgcat accgcgagac gggtcacccc aatctcgggc    199620
     aaacatctgg tctagcgggc tcgaccgagc gcggcggaga ggagcgcagc taagccccgg    199680
     gcggctctag cgttggtggc gcccaatacg acgtgtgaac ctccgttgcg caggtcgacc    199740
     gccacacgat agccccggtt gcgggtatcc cagcgtggga tttcaatgac aacgccggca    199800
     atatttcgga tcggaatagt ctttccgggg gtgcgggacg aacggattgt gcctgcttgt    199860
     ggcgacagca cgagcgtttc tgagcacggt cggaacattg agccgccacc agccagcagt    199920
     ccaacgagac taagggcgcc aagaaacctg cggatttggg gcgagtgacg ggcccagtcc    199980
     attgtcatgg cgagtgctat cagaccaacg gcgacgaacc caagagcggc catttgaggg    200040
     cgaagagcgt agggctccgg ttggattacc gtgagccccc cgccggctag gctatggacc    200100
     cacgcgactc cgccaaggag cggagtgaag ccggcatgag cgaggcgcag tgattcagtg    200160
     gcgatctggc ttcgtactgt gaggaaagca agagtcgcga ccaccatcgc agtaccggca    200220
     atcataagcc gccggtcaag ggttgatgtg gagaaccacc caagggcaac cggcccgcgt    200280
     gccttcgaag caccaaggcg cgacgaaggt cggttgcgga acggtcgcat tctcgaggtt    200340
     cgtctagtcg ccgaggatcg gtcggcgctg tccgtcgccg tagaaggcat aagcctcttc    200400
     accgtgaacg gcatcgtcgc cgatctcaag cattgtctca ggcatccgga gcggcacaaa    200460
     cacgccgata accttcaaca ataggtaagt catcacgacg ttcaacacga tgatgaatgc    200520
     ggcgccgtag atctggagca aaacttggtg ccagttgccg tcgatcgcgc cgcccggggt    200580
     gctgagaccg aaggctgcgc agccggcttt ggtcgcgagc aggccgacca tgatgccgcc    200640
     aagcagccct gcgatggcat gggtgtgtac cacgcccagt gtatcatcaa ccttgcggaa    200700
     gatcgcgaga cgcttaccga gcacgttcat cgtataccag ggcacaacac cagagacgat    200760
     gccgatgatc agtgcgccgt agccgttcac cacgcctgcg gcgggggtga tcgcgacgag    200820
     gccggtgatc atgccctgca ctgcgccgat gacagcgggc ttaccaaaat acttaatgtc    200880
     gagtgcggtc cagaccagca ggctcattgc ggttgcgacg ttggtattca gcactgccgc    200940
     acctgcgtcg cgacttgcag catagggatc gccgccattg aacccgttcc agccgagcca    201000
     gagaatgccg gcgccgacca gcatgagcag gacgttgttc ggctggaaat tctctcgatc    201060
     gcgcgggctg cgctcgccga tgaccgccgc accaacgaaa ccggctacac cggccgcaag    201120
     atggatgacg tagcctcccg aatagtcgat cacgcccatc tgcgcgagga atccgccacc    201180
     ccacaggcta aacgcaccga tcgtgtagga gaaagtgagc cagagcggta cgaagatcat    201240
     ccaggcagtg aaattcatac ggccaatgaa cgcgccagcc ataatgatta gggtgatcgc    201300
     ggcaaagacg aactggaagt agaccatggt ggacatcgga aaattcgccg aagccttggc    201360
     tgcagggatg accgcttgat tcaactcgtc ggccatgctg gcgatcgggt gtggaatgcc    201420
     gacaaatgga aacaactggg cgccaaaacc catgttgtag gcccaaagca accaagctat    201480
     caggacggcg gcgaaggcgt agaatgccat aaaggcggag ttgatcgccc atttcttctt    201540
     gacgatgcct gcatacatca cgacaaggcc gggcacactc tgaaggccga cgaccgttgc    201600
     ggcggtaagc tgccatgcat tgtcaccggt gttgagccag gagacggaca tgcaaaaccc    201660
     ttccattttt gaattggaag cgcgcgctga aaatcagtac cacgagcgct ccggacgtag    201720
     aggatagatt tgtctcacac gacccacgtg gcggagcggc gaaagccgtc gaccgccgct    201780
     tcggtcagat ctggagcaag atcacgacgt gcaaatactg acctccatat ttcggttcga    201840
     cgagagcagg cgagtcagtt gggcctgagg cttcccctca tgcgacaagg ggtgcagcaa    201900
     gtagcatgcc agaggcggtg gctgggccga ttcgggtggt ttgggtgaaa agcacagcct    201960
     gatcggcgca aattgctggc acattgagtg gccactgcaa aatatatatg caaataaaga    202020
     tcattttata cgcaaaagaa taaataatgc tcgaagatga agggcgataa acttatctgt    202080
     cagcacaaaa tcgtgaagtg tcaacccttc tttggcatgg aatacgaatt cttgtcgcta    202140
     aacgcggact cgcttttctc tgcgctggag atcccgcccg aggttcgcga ggaccaacta    202200
     actatatcgc ctgatggctc aacgttctga aggtcccagt acatcaggca agagtgtgtc    202260
     ggccagccct cctgttcgcg gcggatgcac cggcgggctc gctgttcaag ggatatgagc    202320
     tggggttacg cataaaagat gccggtgagc acttgctcaa tgtaacggtt atcccaagct    202380
     gccattttgc gtcgcccctt gagactggcc tttgaagcgt gatggcgccg aacgaggttg    202440
     atcgcgatct tgcgaagcag ggagaagttc aggacggcgt tgcgatcccg gatccggcag    202500
     tgatcttcgt tgaaggtgac gtcgagcacc cagtgtaggc tgttctcgat ctgccaatgt    202560
     tgacggatcg ctttcgccag gatttcgggt tgatcgtcgc tgctggacag gaagtagcgg    202620
     atttcggctt cgatcttgcc ggatccgttg acgccgcgga tggtttccac ggccagaacg    202680
     ctcttcaacc ccggccagtc gcgcagcggt tccagcgcta cggcgtccgg acagacgaat    202740
     acccggcgcc gaacaagacg gccgtgacca tcatcgaatt cgtcaccgcc tgttgtgcat    202800
     tatgcgcccc cgccagtcgt atatgtgcca tcacctgtat acttcgggcc gccttcacta    202860
     tcctttggtg taacctatct tctccattag gaaagtatgg acatagacaa gatcagaaca    202920
     taaaacgaac aaaggagttg ctcccgaagt ttcaggatag gcgatcacac tatcgttatg    202980
     atccggaccg ttccccagat cgatcttgaa ctcgaggccg agcggcggct cctcgaagct    203040
     gccgtcgccg aagcccgggc cgatctccgc ccggctgtgc cgcatgagca ggttcgagcc    203100
     gatctcctgc gcgagatcaa gcggctgaac ctggcgatcg ccggtctctg agcatgcagg    203160
     tcgaatggca tccgcttgcc ctggaagatc gtgatgtcat tgttgcttat ctcgaactgc    203220
     tcaacccgaa tgcagcctca agcgttctgc gtggattggt tctcgccggc gacagcctgg    203280
     cgctgtttcc caccaggggc cgcgtgggct tagccaccgg cacccgggaa ctggtggcgg    203340
     tgtggccgta tctgatcgtg tatgaggtcg atatgtcatc cgatacggca cggattctgc    203400
     gtatctggca cgtcgcccag gatcgaccgt gatgaatgcc aaaatgaaaa tggcggccta    203460
     ggagaccttt gcgcggatag gcgtagccag cggttcgggt tgctgattct ctgttgccgt    203520
     ttggagatgg aggggttcag tggcgcaacg tcggattggc caagagcggc ttgccatggc    203580
     ggaacaaccg cgcgttgcct cttcgctcga cgcgctgtct gaacttattg attggcagcc    203640
     aatctctgat ctgcttgccc cgctctatcc ggcgaggaaa ggggaacccg gttggccgcc    203700
     actggcgatg gtcaaggcac tgctgctggc gatgtggcac gacctgtccg acgtcaaact    203760
     cgccgaagct ctcgatgacc gcgcttcgtt ccgccggttc tgcggctttg cgcagcttga    203820
     ggcgacgccc gagcggacgg ctttcgtgcg ctttcgccga ctgctggtgg cacaccggct    203880
     cgatggtgga ttgttcgagg ctattactgc gcagctgaaa gcgaaggcga tcacggtgaa    203940
     gaccggcacc ctggtcgatg cgacgatcat cgcctcggcc agcaaggacg atggtgaagg    204000
     acgctgggtc aagcataagg ggcgacccgc catccacggc ttcaaggccc atgtcggcgc    204060
     tgataccagc acggcgctgg tggagagggt ctcggtgacg ccggcgaacg tcaatgacgg    204120
     ccgcgccggc gacgccgcgc tacccgatga tcctggcgaa gtctttgccg atagcgccta    204180
     tcgcggcgcc tgctttcgcg cggcggtccg gaccaatggg ggcacgccac gggtgatcct    204240
     gaccgcgatg tggggccgcg acgaacagga gacgcttgcg cgcctcgacg cctggaaccg    204300
     ggcgatccat cggatccgcg gccgcatcga gaagatcttc ggcatgtgga agcgcagcta    204360
     cgggcttcac cgaatgcgat ggcgaggtct cgccaaagct gccgtccagg ttcacttcac    204420
     cgccatcgcc tacaatctca agcgtaccct caacatcctc ggaacagcag cgtgaatgtt    204480
     cgcactagcc aacggcgtac cgcacgcagc tcagaaagat ctcagcgccg cgtgaatctc    204540
     tccgttgcca gcatatgccc ctatccgcgc acaggtctcc taattcggcc gtgcacgcag    204600
     tgcggaagag cgtccggaat ctccttccgg gggctgagga tcgccgagcc gaggatcctg    204660
     gctgataaag attgcgcaga cggaagatcg taaaaatcag ccatgcggaa tttcaactat    204720
     tccgcgagcc ttgacatcga taagatcgaa aatgaagaaa cggtaatatg ttcgacaaga    204780
     aagggtcttt gggatggtgt cgctgcggca acgcttcatt cgcgtcgtgg attgcatcag    204840
     cgcgaaaagc gtcattctct atgatcgtcc gatcgcgtct tttgctgttt tgatgatcag    204900
     tgtcatcgct gtcatggaca tagccttcta tcttcacggc catcaccgtg cccagtagcg    204960
     cggaataggt aggatcccag cgccgatgat gcgggccaca ctcgaattca tcaggctggt    205020
     tgtgataccc actgtagggc aggggcgtcg ggccgagagg cggtttgatg cggcacgaat    205080
     gacggttgac tagctccagc ttcctcgtgc catgcgcgcc ggcgatttca aagccagatg    205140
     aacaacgcca gaataacgga ccaggccgcg atcgagacaa gaaaaatcaa cagcgccgcc    205200
     ttcggccagg cgagccgttc agcatcctcg tggcgtatgt atcttgccgc ggcactcaga    205260
     tgtatcttgc cgcggcactc agacgcgaaa taactccgac atcaatttgc atcgattgta    205320
     tccatatggc gaagacctcg gcgtgattgg ggggcggtgt ttcagcatcc cctgggtccg    205380
     ttgatcaggc tgcctgggcg gctgtacttg gatcttgctg agcgatccag ttccatgcgc    205440
     atcaattcca agagactttc gacgaaattc catgatacgg attctggcat tgcggctatt    205500
     cgcccaattt atacaaccaa agatattttt catgatgact cgaccaaaag tagtgtcagt    205560
     atattttaca tctcgcttgt ctaaaatatt ttatgcattg attttacgag cttatttggc    205620
     tcggcatggg aattgcttat tctattttgc ggcccaaatc ggcgcctccc ctgcgtaaag    205680
     cagccgaacc gaaatgaacc gaccgtgtca gtcaacgcca gcctttcgaa agggacgttc    205740
     atgttgaagt ttcgccatgt tgccagcgct gtcgtcatcc tggggcttac aacggcaggc    205800
     gctcgcgcca gcctgatcgc cgatggtctc acctatacgc tgaccgaatc agcgacagcc    205860
     aatcccttaa cggatcagtt cacccttaat atcgcaggca taaatgggcc ttccgataca    205920
     gaaggtgggc gctatggcgt acagtcgttt gctttcaacc aaccatcaaa ttttgcgagt    205980
     gctctggccc cgtcaggatt cacagaatca ataggagggc tgaactcgag cggctgtaat    206040
     ggaagtggaa atttctactg cttcatggcc gaaacaactc caaccggccc cgtgttgccg    206100
     gccaatacaa gcattaatta tgtattcaat gttacgttgt cgtctgggac attttctgga    206160
     tatagtccgg attttaagat taactgggat gggacaaaga ataattatga tcttatatca    206220
     gaaaccctga cgccgacacc cggtactcca gtacccgaac ccggctccct tcttctgctc    206280
     ggcactggcc ttgtcggtct tggtttggtc ggacggcgca aacgctccaa acgctacctc    206340
     tgatagaggt agggcttact gcggcttggg gtggggttcg caaatcaaga gaatatcaca    206400
     ccaactctgc cccattggcc acaagcggga ctttctgttg cagaagtctg gtgcatagta    206460
     ccggcatgat ttacgggtct ccaccgacgg ccagagcgtg gccgcccaga tcacccagct    206520
     gaaggccgca ggctgcgtca atgaggccga ggcgaaaaag gacagggagg accgccaggc    206580
     catcatcgac gggctgcagg cccagttgaa gaagggcgac aaggcgctgg tcggcaactc    206640
     ggcctaccga cgttatctcc gcagccgcgg caacgccttc gagatcgatc cgggcaagct    206700
     ggccgaggag gcccgcttcg atggcctcag cgtgctcagg accaacgcaa gggtcacgcc    206760
     cctgcaggcc gtgatccggt atcgcgacct gctcgaggtc gaggccctgt tccgcgccgc    206820
     caaggccagc ttcgatacaa ggccgatctt tcaccaggct gacgccgcga tccgcggcca    206880
     cgttttctgt tccttcctgg ccctgacact cgccaaggag ctgaaccgcc tgtgcggcgc    206940
     cagcggcttc cagcccgaat ggcagaagtt gctgaacgat ctcgacaggc tccagcaggc    207000
     aaccatcgaa aagggcggca aggtcatcac cacgaggacc cacgtcaccg gccaggtcgg    207060
     caatgtcttc aaggccgtca gcatcgcgct gccccacaac atcagcgaat gaacgaatag    207120
     atagcaacga aatacataca acctatagca tattttaaaa tatatttcga cctaaagtgt    207180
     atattgaaat aatattttgt cggaatctct tacatctcat agaatgagac tagatagctg    207240
     tttgattcct tgcctatccg gttgttaccc acacccacta aatgtagggt gtgtccattc    207300
     cccggaataa agctcgtcaa aggttggtgc ggctgcccta cccgcgattc cgagcagcga    207360
     gcggaacgcg ttgaagggat agaggcgccg gttgaaccga aacgtgaatt cattgaggta    207420
     ggcttgtaga tgtttggcgc tgaccccgtg atggatgccg ttgatccagg tcttcaggtt    207480
     ggtaaagacc aagtggacga tcggcaggaa ttcttctgcc acctccgggt cgccgcattc    207540
     ggcgattgca tggtggtcga acccgcgcct tccgagaccg gcatagccgc tccagtcgtc    207600
     ggtaacgatc agcgatccgg gagcaacggc gttttcgacg aatccgcaga gcgaattggc    207660
     gctacggtcg gggacaacag cgagacgaac gcgtcccgcg tagcgaccgt ctttccgatt    207720
     gtcgagcttg gttcccggtt tccggtggcg cacctccacg gcacaggcga cgagaacctt    207780
     gtgatggaca ccccgtccat cgcctcgggt tcgtcctcca acccacgttt catccacttc    207840
     gacgtgttct tgcggcgtgt cgccaatctt gtcgcgctcg gggcgcacca tcccggcgcg    207900
     cagcttatga aggatgccga aggcggtctc gtagcgcgac aggccgagtt gccgctgaaa    207960
     ttggacggcc gacattccgg gcgtctggct ggcgatcaag taagccgccc agaaccaagt    208020
     cgacagcggc gtgtgactgc gttccataac ggtcccagcc atcaggctta cgtctttgcg    208080
     acaggcccgg cagcgcagaa cgcccgggcg cgcctcgaaa cggaacggct cgccaacgac    208140
     gccgcacctt gggcaggcga accctccatt ccagcgggcg ctttcgagat aggcggcaca    208200
     ggccgcgtcg ttcgggaaaa tacgctggaa ttccggcaga gactgcggga acggcaggtc    208260
     ttcacgggcc aggacatcca tgcccaacac tagatctagt aggtatggga gtcaaccgga    208320
     taggcaagtt tgattctatt aagattgtaa atatggcgtg atttttgcgt gagcactgaa    208380
     cgcacttcat gtatgaagtg tccgtggtca ttcatggcat gatttctcaa acgtttggag    208440
     attgaacatg tctagcgtcc gcaaatatct attacatgga gccgtggtgc tcctcggcct    208500
     cacgggaata gcgcgggcgg atatttataa tccgacctgg ctagtaacgg cctggaccac    208560
     aacgacaggt aagattggcg gcaccaactt cataaacgct gcaagccagc ctgcgccatc    208620
     ggccgtagat gcactggctt ccttcacata ctcagggcag ttgagtttcg acaacaccaa    208680
     taagcaggga cagtcgaata cgtacgccga cttctttacg aataccgcca acatctcaaa    208740
     tttcagcggt acgggtggcg aggctgcgtt ccttggaacc acgatgagtt ctccaggaag    208800
     ctcgaattat tcatatctgg agttctcgct ccaaggcccc gctgcgaata tagctgcagg    208860
     cacctacgtc acgatcaccc acgacgatgg cgccagcagc tatgcaaacg gcaacaacgt    208920
     gacttactcg cctggcgaaa ctcaagccgt cagcgatacc ggcacgttac ctgtgggatc    208980
     gatgacaagt ttcgctgtcg actacgttga ggcgaacgga gcaccggccg ttctcaaagt    209040
     ggacgtaccg gaaccgggca gtgttctgct cctcggaaca ggcttgctcg ttctcggtct    209100
     cgtcgttcgc cggcggcaga aagccctctg agacccgctg gtcgatctaa acttgtgcgg    209160
     tcccgctcac tcgggaccgc ctttcaaatg aaaatagcga cgatggcgcc aatcaagcaa    209220
     attaacttgc ttgccaaact cccactacga ggaagcatct cgttcggatg atggagtccc    209280
     gatattttgc atgaaattta tttcatcagc cacataaggg cgtcattccg actatgcttc    209340
     aacggcaccc taaaaaatag ccgaataaaa catatggttg ttcgagccga tcgcccggcg    209400
     ctacagccgt gccaggaaag atgaacggct acgcactgag cattttcact tctggtggtg    209460
     ccatggccgg tcataggtgg agcgaagcgg agcctgaggg aaccacctct ccaaccccgc    209520
     cgttcaaggt ccaaactggc ttctgccgcc cccaccagca gccccaattt tgctacggca    209580
     ggagaattat caggcgtcag gcggcaccac cacccgccgc agccaggcga ccagcggctc    209640
     aaagctgaaa ccgtccgctt catacagact gacgataaaa tcgtaagtct catctggatc    209700
     ggcctgcacc ccagcgccat tgataaccag gaaggcatag gtggcagcaa aagccgtgcg    209760
     tttattgccg tcgaaaaacg gatgattctg cgccagactc tcccacaagg cggcagcctc    209820
     gtcgatcaga tcggcataat atcccgtctg tgggcgatac aaggccgcct ccagctggcc    209880
     agggtcacgc acgccatgag cgccaccgta gcgatcgatt tggtctgcat ggatagccag    209940
     aacctcgatg acggttagat aatccgtcat tcagccagct ttttatacag tgtcccgaat    210000
     ttttcatggc tcgcctgata ggcggccatc acgttggcgc ggggccgacc ctgcttgcgc    210060
     ttttcaatga ggtcggcgag cgcctcatct accagcgctt gcaactgccg cccctcgctt    210120
     tgcgcgaggc ggcgcaccgc ggagagaatc tcagaattca cctgagtcgc gaatttttca    210180
     cgggtttggg ctgccatgat acatctccaa tctttccttg atttatcatg atgtgtcatg    210240
     aaatatcaag aatctgtacg gctttcgttt cctcaatatc ccttaaacac ccgatatttg    210300
     tcgcttttcc cgtatgcccc tgaactttgg ttgatgacga cgcagggacg attgcctggt    210360
     tcgcagcctg tcagcttgtc tgagcctctg gcgtgtcgcg cgccgatcgg tcaggctccg    210420
     aggatgcgtt cgcttcgcgc ccgactcgcg ctgctctggt cgatctcgct gatcgccgcg    210480
     atcatcgcgg gcgggctgat catcgggctg ttccatcaat cggcgacggc gagcctcgcg    210540
     cgtgaccggc aggtcgccgc ccgagcctgc gattcgattg cgcgagccta tggattctac    210600
     agcgccgggc ttggatcggc gccgcaggac gaggcgtttc gcaaggggct gagaggtgtt    210660
     gcggccttcg ggctctggcc gtttcccgat gtcgccggcg gcatcgtctc gggcagcacg    210720
     gcactcgcgt cgatcggcgt cgatacgccg catgacgcgg gcatctccac ggcgaccgcg    210780
     gcagcgctgg acgcggacca tctggtgctg cgccagcgcg gagggttcgg tgaccgtgcg    210840
     gtgatcgccg cctgcccact tggcagcccg gccgaagacc ttgcggggtt caccatcgtc    210900
     cggctcgacc tgctgcgcac gcccttctcg aaacttgccg ccggcggcct ggccgtgctg    210960
     ctgctcttcc ttatggtctc ggcctggttc ctcacgcgtc tggtgctcgg cttctcccgc    211020
     cgcctcgccg ccgtcgaggc cggcctcgcc accgaccccg aagcaaaact accactgacc    211080
     ggcgaacccg attttgaccg gctgatcgcc gcgttgaacg gcgctaccgc ccgcctcggc    211140
     cgcgcccgcg cgcgcatcgc cgagcaggag aaactcgcct cgctgggacg gatggcggcg    211200
     gggctggcgc atgaaatccg caatcccctg ggcgcgattc gcctccgcgc ggaatccggc    211260
     ctggccggcg acgccgcacg acgcggcgct gccctcgacc gcatcctcgc ggaatcggcg    211320
     cggctggaaa agctcaccgg caaattgctg ggcttcgccg ccgcgcccgc gccgcagact    211380
     gaagaggcat cgctcgcgca tcttttcggc gaggcgcgcg cacccctcga agaatatgcc    211440
     gcggcgaagg gcgtcacgat cgaaacgaac gatcggggcc tctcctggac gctggacccc    211500
     gcgctgaccc tccgcgcgct cgacaacctg ctgcgcaatg cgatcgacgc ctgcggcgag    211560
     gacgatacgg tgcggctgac cgcggcacgc gatgcggacg gtctcacgat tctcatcgaa    211620
     gataccgggc caggaatcgc acccggaatc gcggcccatc ttttcgagcc tttcgtcacc    211680
     ggacggccgg aaggaaacgg gctcggcctt gccatcgccc gcgagatgat ccgcgcccag    211740
     ggcggcacgc tggtccatga cccatccgag cacggcgcgc ggttccgcat aaggttcagg    211800
     ggggtgtcgt gatggcgcgg atcgcagtga tcgacgacga tgccgggttc cgcgccagcc    211860
     ttgccgaggc gctggatgat ttcggccatg acgtcgccga attcgccagc gccgatttgg    211920
     ccctgacggc actggcgacg gacccggccg ccctcgtctt tctcgacctc cgcatgccag    211980
     gcatggacgg gatcgccgcg ctggaagcgt tgaaatcgcg cgacagggcg ctgccggtcg    212040
     tcgtgctcac cgcctacgcg accggtgaga acacgatcgc cgcgatgcgc cttggcgcgt    212100
     tcgatcatct gaccaagccg gtcggccgcg cagatctcga agccctgcgc gaccgggtgc    212160
     ttaccggcac ggcgacaacg tcggccccgg cagactccgt cgcgcctggc gaaatcatcg    212220
     gcacgagtcc ggcgatccgc gaagtccaga aacggatcgg cctcgccgcc tcgggccagg    212280
     cgaccgtgct gatccttggc gagaccggcg tcggcaagga actcgtcgcc cgcgcgatcc    212340
     accggttcag cgaccgcgcg tcgcgcccct tcgccgcagt gaattgcgcg gcaatccccg    212400
     ccgatctgct ggagagcgaa ttgttcggcc atgagcgcgg cgctttcacc ggcgcaatcg    212460
     gcgcgaggcg cggccggttc cgcgaggcgg agggtggcac gatcttgctc gacgagatcg    212520
     gcgacatggc gccggcgacc caggcgaaga ttttgcgggt gctggaagaa cgcgaggtcg    212580
     tgccgctcgg cggcgcgccg gtcgcgatcg atgtgcggat gattgccgcg acccatcgcg    212640
     accttgccga acgcgtggag gaaggccggt tccgggccga tctctattac cgcctcgccg    212700
     tgctgccgat cgtcgtgccg ccgctacgcg agcgcgtagc cgatatcgag gcgatcgccc    212760
     gccatctcct cgcccgcatc cgcccggcct cgccgccgac gctgagcaag gccgcattgg    212820
     actcgctctc cgcctggccc tggcacggca atgtccgcga attgcgcaat gtactcgaac    212880
     gcgcggcaag ccttgcgccg ggacgggtga tcgatgcggc cgatctcgcc ctcgcgccat    212940
     cgccgcgcca gaccacgtcc ctgccgccgc cgcgtcgcct ggcggagact gtcgcggatg    213000
     cggaaatcgt cgcgatccgc gccgcgctga tccgcgcccg cgggaatcgc acggaagcgg    213060
     cgcgcgaact cggcatcagc cgcgccgcgc tctacgaccg gctcaatcga tacgggctga    213120
     caacgctgtc ggaaaatccg acggagactg tcggcggatc cgacgagtcc tccgtcgtgt    213180
     aactcccgaa acccttgccg ttcaacgcgt tatggtttgg cacgccgtgt gcagagcatc    213240
     agggcgacgg atcataccgt cgacatcatg gagatacgca tgacacaact gaagcttatg    213300
     ctcgccgccg ccaccgccac gacgatgctc gccaccggcg cggcaagcgc cgcaacccat    213360
     ggcaaccggg cggcgctcaa ggacctgccg acctattccg gaacggtggc gcatttcacc    213420
     atcacgccgc gcggcgcgat cgacgggatg attctctcga acggcaccga gatcctgttc    213480
     ccgccctatc tctccacgga gatcgcctat gcggtgaagc agggcgacca ggtcacggtg    213540
     cgcggcctga aagcggccgg cgaacccgta atacgcggtg tcacgatcaa cgatgcgacg    213600
     acgcatcagc gcgtggtcga taacggcccg ccagccggtt tcggtccgca tcaccatgac    213660
     cgcgcgacgc ggatgatggc ggatggcaag gtcgcgcagg ttctctacga tccgggcggg    213720
     cgccgcaacg gcctgctgct cgagaacggc acggtgctgc atctgccgcc gccggaattc    213780
     ggcaaccaga agatcgcggc actcctgaaa ccgggcgcaa ccgtcgccgc agtcggcgcg    213840
     ggcacggcga atgcgctggg caaggcggtg atggtgcgcg cgatcggccc atccttcgac    213900
     gcgctgaccc ggatcgcgcc gccgcaccgc ccgcaccgtt tcaagcctcg cggaccgatg    213960
     gcgggaccgg gcgcctggca ccatgcggaa tggcagccca gaccttcgca gccggcgccc    214020
     gcaaaataac gggacgacag cttctccaca tcgaaacgcg gccgggacat caccttccgg    214080
     ccgcgtgaat cgtttcgtta gattacggag cccgccttgc gacgtcagac gacgacgctg    214140
     catccagaag atgcatctac ttgaggtcga cggcgatcgg cactgtctcg ccgaccccga    214200
     ccttggtata cagggcgatc cgcacgcgcg gccatttccc cagcgatgag gccgcggcca    214260
     aactgctcta tctgatcctg aaccgatccg aaaaagagcg ggtgatgcca cctcgagaat    214320
     gggctatggc aaaggctcag ttcgccgtca tcttcggcga tcgtttcgta agggccttgg    214380
     cggcttgatg ttcaaccgcc acccatacac ggaattcctg gcattgccct tcccgcagtc    214440
     ggcggccttc agctgggcat cggcattaga gcggtagccg aaccatctga atcgctgggg    214500
     taccggaagc ggttgaaatc tgattcaagc tatctgcggg agtttggagg ccggcaggaa    214560
     tggcaaagac tctttcggag gatctgcggg gccgtgtggt ggcggatcgc cgagttcagg    214620
     aggccattac tctcgtcttc gacaaggtgg ctgagctcgg cagcgcccga caggctctgc    214680
     tctggttcct ggagcacagt ctggatctgc cggcccgacg cgccaatggc gatgtggtct    214740
     ggcgcaggcc gacctacgcc accatccacc gcatgatcga gaacccggtc tacggcggcg    214800
     cctacgccta tggtaagact cgcgtggcgc cgcggcacga cgcgatcgtt ccgcgatccg    214860
     gcagtcgtcg caagcggcgc ggcgactggc tggcgctgaa gccaggggcg catgaaggct    214920
     atgtcagttg ggaacgggca gaggcgatcc gcacgatggt cagcgacaac atccctgcga    214980
     gccggcatca cggagcgccc aagcatggcg atgctttgct ggccggcctg ctgcgttgcc    215040
     ggcgctgtgg ccgcaagctg acggtccgtt atactgggac caatcacaac atcccccgct    215100
     attcctgctg gcggggcctg ctcgacaatg gcgagccgcg ctgcatcgct ttcggcggcc    215160
     tgcgggtcga cgacgccatc gaggaggcat tgctgcgggt cgtcgaaccc ggcgccatcg    215220
     ccgccgccgc cgcagaggcg caagccgccg gccggcgaga ccaggtgcgc gaggctctgg    215280
     tgcgcgatct cgaagcggcc cgctaccagg ccgctcgggc attccggcaa tatgacgccg    215340
     ctgatcctgc gaaccggctt gttgccgcgg agctggagac gcgatggaac cgcgccctcg    215400
     cgcaggccgc cgaggtcgag gcaaggattg ccgagcacga tgccgccgcc ccaaaatcgt    215460
     cttccttggc ggtgctcgac gccgccaggc ttggtacgaa ccttcgggcg gtctgggcgg    215520
     cgccgacaac ggattcccgg ctcaagaagc gtatcgtccg caccgtcatc catgaaatgg    215580
     ttgccgatat cgatgacaca gcctccgaga tcgttctgct ggtccactgg attggcggtg    215640
     cccacacaga gcttcgcctg ccgacgcggc gccgcggaca gcgcaacagc acggcctccg    215700
     agatcatcgc cgcggtgcgc catctcgcgc tcatcgcctc cgacgacctg attgctggca    215760
     tcctcaatcg gaaccgcctg ctgaccggcc atggcaaccg ctggacccgc gagcgggtca    215820
     cagccctccg ttcgcatcac aagatcccgg tcttccgccc cgcgcccgac ggcatcgaac    215880
     ctcagctcaa ccttaccgat gccgcacgcc tccttggcgt ggcgcccaag gccctcaggc    215940
     tcgccgccga ggccggagtg atcgagggcg accacccttt gcccgacggc ccgtggatct    216000
     tccgccggtc cgaactcgcc aagccagccg ccgcgcagat cactcatcgc gcacggcaga    216060
     accccaaaca ccccgcggga tcacacaccg atcagaaaaa cctatccctc tcaataacat    216120
     aaacaaatgg gtcttatgaa acaggattgt actgccgccg ccaagcctcg gtcaggatct    216180
     tcgcgtccat cagggtgtag aagatctccc ccgtcggctg tgctgtggcc atgagctgct    216240
     ttgggtgtga cttgggttac gggctggagt agatatttgg ggtatgaatg ggaatggtgg    216300
     ggaggggttg gaatgtcgat cgataggttc gtggctgatc cggctgggta ttccaagggg    216360
     catatcgtgc agtttcaaca ccaagcattt ccgccgtcgc aggcgggtat gcaagtcgtt    216420
     tccacgatga acaactgggg cggccagtgg acggcggagc gttacgaccg ggtggcgggg    216480
     cagttcacca agttccggtt ccgggagtcg gggttacagt atttcaagaa gggtaaggcg    216540
     gtgacgatgc caacgcgggt gggcaagggc agcggcgccc tgcacacggt ggaggttagt    216600
     caaggggcgg tggatctcgg gatacggttt ctgccgtgga aggccgacac cgtgacttat    216660
     atgcggctgg acccggcggc gcgcacgttt ttcaccgggc cgattaatgg gtgttcggtc    216720
     tatctggggc aggtgggggc ggattggtgg gcgttccatg ccaaccgcaa caatgccggg    216780
     gtgcataacc ccgccgtgaa agcggcgatg accgacaacg tgaacatgcg gctgccagtg    216840
     ccggtgcgga tcgttcatgc ggcgatttat cagcgcgact ataatgacct cggcttcgtg    216900
     tgcgggcagg taaagcacgg gcagtggcag ttttacgtag tggatatgag cctagtgcag    216960
     gtaggaaaat atgcccaaac ggtgcgccgg ctgccatgag acttgtgcgc ggataggcga    217020
     cgatactgga aaaagtgaga agtgcgccgg gctccgtcag gttgccgagt cttggtgtgg    217080
     cacctacccc gggtcttgat gatcgacatc gaagccccgc cgctcaaagg gtaccgcttc    217140
     ccggggtcaa ttatcgcttg tgcagaatgg gcgtatcaca ggtttgcgct ctgcttcgac    217200
     gaatggatcg atatccgatt aaattccatc ggaatgactg gccgatcccg gagcggaatc    217260
     ctcaggaaat gcttggcagt tccgccgctc tacggatccc gttgttctcc agcctactag    217320
     atctttcaca tgtcgtgctg gagcttcccg atgactgaca atcgtacgcc ctggcacgac    217380
     atcaacaatt tccggaagac tggccaactc cttttggcct caagtcgcct agcttggcca    217440
     gaaggccgtc gccctcccca gataatcccg ttgcgcgcct tacggcgtat gggatcactt    217500
     aaacccgcac cgaacaaatc gaccccgatg gtcaattttt gcgttgcaca atctaaaaag    217560
     ccaccccagc gccgagtgtc gcaaccagag cattcctcgg ccctccattg gcatgaatga    217620
     tccattgcaa gtcgggctcg atgatcattc gatctggcaa atgggccaca aaggcaacct    217680
     cttccgttgt ttcggccatg gtacgagcag tgctgaacca ggctcttgca attccaaagg    217740
     ttagcgcatc acggcggtgc tgagcccaga agccggaaag ttttcctcca aaaccgaggt    217800
     aactggagat aggaccttgc gattctggat ttccagcgac ttgtgcgaaa aatccgagac    217860
     ggtaacgttt gatcggaata tttctccact cagcaatacc gtagacgcca ccaacggacg    217920
     ggccgagtgt cgaacgaagc ctccgatgct gccagtagtg ccatacacct gctttgaccg    217980
     taatttcccg ggccgcatta cgccacgtcc gatctacctc gaggaacccg atggcacccc    218040
     gatcgaatgg ctgatcaaat gtctggaccg ggtcaccctg atacaggcca acacgccaca    218100
     cgagtgaccg tgccttaagc catatcataa atccggcgct ggtatgggag aagcctgcaa    218160
     cgttgtcgcc gattgtcggc gtcaagttaa aagacaggtt ctgcaagctt gcagcgaggc    218220
     cagtaacaga tagcgtccgt caatgtggtg gaaattctgg tgtagctgaa gcggccaatg    218280
     gtcacgcggc gacggtggaa attcgtggtg tatcggcatc gatggcgggt gccatgagtt    218340
     cgaccattcc ctcgatctgc atatagcggt tctgtgtttg ccattcgtcg ttggcctcga    218400
     gcagcacggc cccgatcagg cggatgatcg aaccttcatt gggaaagatg ccgacgacat    218460
     cggcgcggcg cttgacctcc ttgttcaggc gttcgagcgg attcgtcgag tgaattttgg    218520
     ttcggtgctg ggcgggaaag tccatgtgcg ccagcacgtc ggtttcactg tcgtcgatga    218580
     acgcgccaag ttttggccat ttgccccgga gctggtcggc cacatggcgc agggtctggc    218640
     tggcactgac gcgatccggc tggataaacg cctgacgcaa cgctgcagac accatgctct    218700
     gctgcccctt cggcacatag gacaaggcgt tgcgcatcca gtgaacgcgg catctttgcc    218760
     aggatgcccc catcacccgg cggatcgccg ccttcaaccc ttcatgagca tcggagatca    218820
     ccagtttcac ctcacgcaac ccacggcgga ccaagctctt gagaaaggtc gaccagaagg    218880
     tctccgcctc ggacgggccg atgtgcaggc cgacgatctc gcgccgaccg tcggtgttca    218940
     ccgccactgc gattatcgct gcaactgaga cgatccgccc accttcgcgc tgcttgagat    219000
     aggtcgcatc caaccacaga tacggccact cgccggcgag tggccggtcg aggaaggcgt    219060
     tcaccctctc atcgatgtcc ttgcacagtt tcgagaccgt gctcttgctg atccccgtca    219120
     gccccatggc ctgcaccagc tcgtctaccc gccgggtcga gacgccgcca atccaggctt    219180
     cctggatgac cgcggccagc gccttctcca ggtccggcga gcttccagga acggcgggaa    219240
     gtagctcccc tgccgcagct tcgggatccg aagctgcaag ctgccaagcc gcgtgtccaa    219300
     tgcgcgttcc cggtagccgt tgcgataggt cgcgcgctcg ccgctgcgct cgtagcggct    219360
     ggcgccgatc agcccatcca catccgtctc catcagcagt tgaaccaccg cctccgcgac    219420
     gctgcgcaga aaatcgccgt ccccggcttt ggccagtagc tcagccagtg gtaatctatc    219480
     ttcggtcatc gggttctcca ggcttcaggt tgaagtctcg caactccacc atagccgact    219540
     gatccgatgg ccacctcaaa ctacaccgtt acagggccca aaagtccacc acgaccccgg    219600
     acactaccgc cggccacccc agcatgtagc gcgacaatct gggtgagaag gagcgacaat    219660
     cagcatgaga aaagctgacg gcgacggggg cgaggatatg tgttttgagt tggatggcaa    219720
     gtgggttttt gttgattgtc gctgagcggc gatcaggcgg cgtcgatcag gtttctgaat    219780
     ttggggtttg cctggctggc ggccttcctg cggctcgttt gcgggcgata gcggtgcggc    219840
     gccggtagct ttcgacattc atttcgatga tggtggcgtg gtgaacgagg cggtcgacag    219900
     cggccaaggt catggcctgg tcgggaaaga tcttgttcca ttctccgaaa gcctgattgg    219960
     cggtgatcat gatggagcga tgctcgtagc gccggctgat cagctcgaag agcacggagg    220020
     tctcggcctg atccttggtg acgtaggaga tatcatcgag gatgagcaga tgatagcggt    220080
     cgagtttggt gatggcggct tcgagggcga ggtcttgcct ggcgacctgc aggcgctgga    220140
     cgaggtctgt ggttctggcg aacagcacgc ggaagccggc ttcgatgagg gcgcggccga    220200
     gacctgaagc gagatgcgat tttccgacgc cgggcggccc gaacacgaga caattggcgc    220260
     cgtgttcgat ccaggcattg ccggaggcga gagcggtgat gtgggccttg ctgatgaccg    220320
     gcacggcgtt gaagtcgaaa ttgtcgagtg ttttgccgat cggcagatga gcttcgagga    220380
     gatggcgttc gatgcggcgc cgttcgcggt cggccagttc gtgttcggcg agcgctgcca    220440
     ggaagcgtgc ggcaggccag gcttccttgt cggcctgggc ggcaagatcg ggccagagct    220500
     gcttgatgct gggcaggcga agttcgttga ggagaaaggc gagacgtgcg gcatcggcgg    220560
     caggagtttt gctcatgctg catctccacg actgatcgta ccgagttggc tatagagatt    220620
     gagcggcacc gactggatcg tgatttttgg aactgcggca ctggtgggac ggaagcgctc    220680
     gcgcaaggtg tcgagatttg ggagccgacc ggcatcgagt tcagcatcga ggactgcggc    220740
     gagttcggcc tcgcaccccg cctcatgcgc gagggcgagc aattcgacgg tgatcttgca    220800
     ggcggtcttg tcggcacgac gcgcggtcag ggcctgccag gcgcgggcat aggcggggcg    220860
     gggaaagagc ttatcgcgat agacgaggtt gcgcagcgcc atgggtttgc ggcgcagggc    220920
     atggatcaca tggcggtagt cgatgacgtg accatgcttg ccggtggcat gatcggcccg    220980
     gccgcgcacc aggttgagga caggactgcc gccaaggaaa cattcgaggc gatcgtcata    221040
     gagccgaatg cgcaggcgtt ggccgatcag gcgggcgggc accgagtaga agactttccg    221100
     caagacgaaa ccgctggagg aagtgacctg caccagggtc tcctcgtaat cgacggctcg    221160
     ggcctccggc agcgcctgca gggcattgcg ctcgatcgcg atgagcttgc cgcggcgggc    221220
     attgtggcgg gcgaaaatct cgtcgatgaa ccggcgatag gctggaagat ccgtgaaggc    221280
     gggactaccg cgcagcagca gcgcatcctc gattgccttc ttggcatggc catgggcgct    221340
     ctcgatcacg ccattctcat gggcgatacc ggtattgttg cgcgtcggtt ccatgccgaa    221400
     atgggcgcag agtgctgcat agcgggtcgt cagatcgtcg atcgtggccc ggtcgagatt    221460
     gcggaaggcg gcggacaggc tgtcggtgcg gtgcttcagc ggcgcgcccc ccagggcgaa    221520
     gagcgcgttc tgcagcccct cggccagtgc gggatagctc tccccaccca ggatgacatg    221580
     gccgtgctcg aagccggaat gggcgagccg gaaatgatac aggcgatgat cgagggggtg    221640
     gccggcgatg atcacgccca gcggtgtcag atcggtgaaa tccgagaggc cgagttcgcc    221700
     gggcggatgc gcctggcgga agataacatc ttgagctggg ccgtgcaggc cgcgccagag    221760
     cttgatcctg cgttcaaggg tacgccgcac acccacgccg atctctggat gccgtcgccc    221820
     cagctcctcc aggattgcca cggcgcgcaa ccccggcgcc gccgcgagca tcggtacaat    221880
     ctcgctgtcc cagaccgcga taagcgggtc aggccgccgg cgaccgcggg gggccactgg    221940
     taatgatggg tgatccgccc cggcttcgag acgataggca gtggctgtgc tgaaccccgc    222000
     cttggcggca gcttgctgcg gggtgtcccc ctcggtccga aatctcatga acaatctctt    222060
     ctgctgaacg gtgatcgggc gaccaggcaa ggctgcggct ccatcggtgg agccaacccc    222120
     taccagccgg tcacggtcag ccagacagga caaaacaacc cgctccgggg ctggggcctg    222180
     ctcaggctac gccctcacag cccccagccc cggattctca ccctgattgt cgcggattct    222240
     cacgctgatt gtcgcgcggc accagcaaat tccgcgtatg ttgagccttt taggctgtca    222300
     ggctcacaga taggccgcaa cgcttcctca agccccatac cgatccgtga accgtgcagg    222360
     aagctcgttc cgcccttctg cagcccgccg actggctcca ctggtaagcc atccacgatt    222420
     ggccgttcat cgcgcgtatg tccggcccac tcgtaaaccg ccgaaaacag aaagcgatgg    222480
     atgtctttca ggtggtcagc gtcaaagcgg cccgctgggc catgccaagt tcgatttcaa    222540
     ccagacgctc gctggtgatg cggtattcat caatgcgaag ctgtgagtgt gttcgatagc    222600
     cgaaccgatt gcggagaacg tcttgttggt cagggtcgtc agacgtgttc gggtaggtat    222660
     atccgtgagg gggcgtatca tccgccatcc cggcacctca caccggacgc cttagcgccc    222720
     ggtgccgacg atctccccga tcgcctggcg aaaaccagca aggtcaagtt ccccacgaac    222780
     aaagcggtca ttgatcgctt ccagcacggg gtcatgaaca tacccctgcc gaatgttcgc    222840
     cgcccgcgcc cgctcaaccg ccctgcggcg ccgctcaacc tcagcatcgg agatcaaagg    222900
     ctttgcaaca acctgatcca tcagcgcctc gctcctttcc aacgtttcac aacatagcga    222960
     gaaatctgca ttgttacaag aaaatgcagg cataatctgg gaattctctt tgcaatccgt    223020
     cccgcaaatc gccccctgac tgtgctggtt tgcgacgctg cgggcctatc caatcatccg    223080
     aagatcgatt gttcggccgc cagcacaagg aacacgaggg ccgctcctag ggccaggctc    223140
     caaagctggc gcgtgcgggt tggcttctgc cgcctcatgc gccgtctgtg cgcatccgag    223200
     agcgcagcct gccgggcttg cccccggaac cgcgccaggg tctccaaggc cgccagagcg    223260
     cggccagagg cggcccctgc cctcgtcatc tccatgacgg cactggtgag cggcaccatc    223320
     cccggcactg gcccgccagc aagccgcaca tggccggcaa ggatcacaag cggcctgacg    223380
     ggcacttgtg ccacccggcg gatcacgtcg cgatgggtct cgttctgcat aagcgggtta    223440
     tagacgctct gcgcggcacc atccggcttt ttcagggtcc attgctgggc atagcagctc    223500
     ccgacatagg ccgcatgctg gcccggatca tggccgatcc ccagcttgtc cgcgatcatc    223560
     agcgaggcga tctccgccct tagctcctcc cgcgcgtagg cttccgatcc gaacggcgtg    223620
     ccaagatccg gccggttcag ccgcgagggg tgccctgtgg cgtgcccctt atgccgacat    223680
     cggcataagg ggcataatgc cgagatccgg attatgccgc atctgctcgg cagggcgcgg    223740
     ttggcggtat gatcgcacca atcccattcg gcataatctt catcgctcca acaacatgga    223800
     gcacgacgat catgcctcaa tatttgcaga cctgcatcga gccgtatctg gactcgttcg    223860
     ccgagagctt tgcggcggag aattacaccg ccggcacggt caagacctac caatcgatcc    223920
     tgcggaaggt ggggcacgcg atggatgtcg agggcatcag tccttcggcg ttgacgctcg    223980
     acatggccga gcatctggga cgcaaggtgc cgcgcaagaa gacgggctcg gtatggccgt    224040
     ataggttggc ccgccggttc gcgcagcatc tgctcgatat cggcgtcacg cagccggtgc    224100
     cgttgaccga ggcgcagcag gcgcgcgcga ccctgctggc gaacttcgag acctatctgg    224160
     tcaagcatcg cggcctgagt ccgcggacga tctatcacac gctgcggttc gccaaccggt    224220
     tcctcgatca tcgctttggt gatgcgatag ttgatccggg gcggttgcgg cctgccgacg    224280
     tgatcagctt catcgagcat gtgttggcag gcgcgcgtcg cgacaaaacg gtggcaacgc    224340
     atgttcgtat cttcctgcaa tatctgttcg gcagcggcgc gacagcgacc aatctggcgc    224400
     tgagcgtgcc tagggcggcg aagcgctggg gcgcacgact gccgcgccat ctgtcgcccg    224460
     agggcgtcga ggcggtgctc gcctgcgtgc gcgacagccc ccggcacggc gctcgggact    224520
     atgcgatgct gctcatcatg gcccggctcg gcttgcgcgc tgccgaggtc atcgcgatcc    224580
     agctggacga catcgactgg cgcgcgggcg aactcttggt gcgtggcaag gggaagctcc    224640
     acgatcgcgt gccgatcagc gcggaggttg gcgaggccct ctgccgctat ctgcgcgagg    224700
     aacgcggacc cgcgtcctgt cgcacgatgt tcgtcaccca tcgcgcgccg taccgtccgt    224760
     tcaaggacag ccagatcgtc aacgccgttc tcaaggatgc gctgaaggcg actggccaga    224820
     agccggtaac gccctatgtg ggatcgcacc tgctgcgtca tagccttgcc acccagttag    224880
     tgaactcggg tgcatcgctc gacgaggtgg gcgatgtgct gcggcaccgc tcacgcacat    224940
     caacgatgat atatgcccgt ctcgacatcg atgggctgcg gtcagtggca atgccttggc    225000
     ccgtggcggg aggcgcgcaa tgagcctcac cttccaactc gaccgctatc tggctgtgcg    225060
     gcgccgcctc ggctacgacc tgagcaccag cgagcgcatc cttcgccgct tcacgcggtt    225120
     cgccgacagc gagcgtgtga cgcatatcga cacggcgctg ttcctgcgtt ggcacgctac    225180
     gctcggcgag gccaacggca tgacgcgagc ggcgcggctt accgccgtgc gcctcttcgc    225240
     gcagtggctg agcagcttcg atccggcgca tgaaccccca ccacggggcc tgttgccgga    225300
     cactgtcatg cgctcgcgtc cgcatatcta cagcaatgcc gaggtcgctt cgattatcgc    225360
     ggccgcaaag gcgctgccgt cgatctgcgg gttgcgcggg ctgacttgct cgacactgtt    225420
     cgcgctcatc gcggtcacgg gcttgcgcat cagcgaggcg ctcgcgctcg atgggaacga    225480
     cctcgacgcc gataatggtg tgctgcgcgt ccgacagggc aagaacggca aggagcggtt    225540
     gctgccgctc gaccccagca ccgtcgagcg actgctcaac tatcgcatcg aacgcgatcg    225600
     gctgatcggt catccggcgg tgccgctgtt cgtaaccgac aaggcgaccc ggctcaccga    225660
     ctgcacggcc cgctacaact tcgcgcaggc gtgccagcag atcggcttgc gatccgagca    225720
     gcagtaccat cggcatggcc gagggccacg catccacgat ctgcgccaca ccttcgccgt    225780
     gcgcacgatg atcgactggt accggaccgg caaggatccg gcgcgcgaga tgatccggct    225840
     gacgacctat ctgggtcata gcagcccttc ccgaacatac tggtatctgg aggcggtccc    225900
     ggaactgctc gatctggcga tagcccgtgc caccgcgagc ggcggggaga tggcacaatg    225960
     aacgccgtca ccttgcccgc gctgatccag cgcttcttca ccgaccggct ttgcacgcaa    226020
     ctggaggcga gccgacatac ggtcgccggc tatcgcgata cgttccggct gctgctcaga    226080
     tatgcgagcg cccgccgcaa aaagccgccg gtcaacctga cggtcgaaga catcgacgcc    226140
     gatctggtcg cggacttcct cgcccacacc gagaccgcgc ggggtaatag cgctcgcagc    226200
     cgtaataccc ggctcgccgc gatccgatcg ttcttccgct tcgtcgcgat gaccgatccg    226260
     acttggctgc tgcactgcca gcgcatcctc gccatgccca ataagcgcta tgtgaagcgt    226320
     gcggtcacgt tcctcgatgc cgaggaaatg gcggcgctgt tggcggctcc ggatcgtaca    226380
     acatgggcgg ggcggcgcga tcacgctctg ctcctgcttg cggtccagac aggcctgcgg    226440
     gcttccgaac tggtcggcct cacgcggggc gatgtcgtgc tggggaccgg cgcgcacatc    226500
     cgttgcatgg gcaagggccg gaaggagcgc gccaccccgc ttcgccgcga gacagccaag    226560
     ctgctggcga cgtggatcgg caacgacaaa gatgagggca agccgctgtt cccgtcgatc    226620
     cggggcgaac ggctgagccg tgacgctctt gagcatctgg tccgcaagca ctgcctcacg    226680
     gcgtcgcgcg cgtgcccgag catcggcacg aaacaggtca cgccacatac gctgcgccac    226740
     agcacggcga tggacctgct ccaccacggc gttgatcctg cggtgatcgc gctctggctt    226800
     ggtcacgaga acgtcgagac cacccaaatc tacatccatg ccgacatgcg gatgaaggaa    226860
     aaggcgctcg ctcgcgtcgc cgctccagcc acgccgtcgg gccggttccg gcccgacgat    226920
     caactcctcg cgttcctgga agggctctga ttatgccgaa cagccgcatg gccaatgccg    226980
     ggctatccgg cctccagcgg aggccatgcg gcataatccg gatcgcggca ttatgcccca    227040
     gctcatgcag cgccgtgata aaccccccat atccaagcgc cggcttcctc ggccggaggc    227100
     ggatcaaatc gcctggtggc gttcatctgc tttgcgattt cgaaggcggc ggccatcgga    227160
     cggcagcggc gatcatcaag cgtgctcatc agctgttcca atcacaggtc gagttcagaa    227220
     tgggagccaa ggcgcacaag gcgaagcgtg ccagcgtcgg gaagctggta gatcagcacc    227280
     aggtcgggcc tcacgtggca atcccgatgg tctttccaat cgccgctcag cgcgtgatcg    227340
     cgatggcgtg gttccagcgg cagatcggcc agcaacgcgg acaggacggc gtgcaggtcc    227400
     gcgtcgagcg tggcgcgatg ccgacccttc ttctcgcgtt tgtagtcgcg cttgaactgg    227460
     ccggtatagt caggcgtccg cattgagatc atggaacagc gtatcgagat cggccgcctt    227520
     cgtgacgcgg ccggctcgtg cgtccttcat cgcctgaatc gtcgtcgcgt tcgggatcag    227580
     cggctcgaaa ggcagtgcct tgtcctgcgc caccttcgtg agcagcagcc tgaccgcatc    227640
     ggagacggtc aaacccatgg cggccaacac cgtagccgcc tcctctttga tcgcgccatc    227700
     gatgcgagtt tgcactagct ggttggcagc catgatggtc tctccctttg ggaatgttgt    227760
     gaatgacaat gtaattcacg gcattcagaa atgcaagact tttggaaacc ggataaccct    227820
     cccctgtcgc gctattggtc tacttccacc gtatcggtgt cggcacgggg aatggaagaa    227880
     aggtcagcgg agctgatgtg acgattgtat ctctagccgg gaagttggcc gagtttgcgg    227940
     tactccgtcc tcgatagcgc ggtgcccgaa cggatgtaca agtcagttta gatggatatc    228000
     gtcagcagaa aattttcgga tgattgattt cgcttctgta ggatgatcac tccccctaag    228060
     aagagatttc caaaaatctt catcgaaagc actatccaaa aacatatatc ggcaggctat    228120
     gagtagagat acacggtccc atgtcgtacg gccagaccgg actctgtaat gatcttctag    228180
     ctgataaaag ctaggcactt ctttcccgag ccctctatct gatcgacttt gtcgggctgg    228240
     cgatgtctct tgccgcgctc agggtcattc cctaattcct gcttccgaca attgcggccg    228300
     ccttcgccaa ggcgcggatg cgctggtttt cgtcggcctg acgccagaca aggccgagcg    228360
     gcagcagtgg catgtcgcga agcgggattg atacgatgtc gggccgttgg aagagtgcga    228420
     ggctgtcgag ggtgatgtgg acgactgtgc ccgaagcgac cgcctgggcg atttcgatca    228480
     tcgatttgac ggggaggatc cgctgaatcg atttcccgga gggcgtgacc tgcggattga    228540
     ggacgtccat cagcgcagcg ggaaaaggcg cttcggccca aggcacccca tagtccgcaa    228600
     tgtcctcgat cgacacagat gatcttttcg ccaacggatg gcgcgctgca acgatgacca    228660
     ctctcggaag aaggtcgagc acaggtcccg cgaccagatc cggttcgtcg atggcaagcc    228720
     aagtgaccag cacgtcgacc tcgccggccc gcaaagcgcg gtatgggtcg aacgactcga    228780
     cttccgacaa catcagcctg cagttcggaa cgcggcgcgc gaacgcctcc atcagccggg    228840
     tcagcacagg ccccgtggtc gtggcgagcg cgccaacgcg cagaacgccg tcgacgcctc    228900
     gtgccttgtc tcgagcctca ttgaaggcgg ttttgaggtc cgcataaggc tggctgaggg    228960
     aatcgcgcag gagggtgccc aacggtgtga gcctgacgcg ccggctggtc cgctcgaaaa    229020
     gcgcgccacc gacctcattc tccagccctc ggacgatccg gctgactctc ggctgaggca    229080
     agcccaggcg ctcggcggtc cgcccgaaat gcaactccgt ggccagctta aggaagactt    229140
     cgatggcggt gagatccatg gcatgacgtc cagatcaatt caattttgac cccagttaaa    229200
     cagcgggttt tcctaagcaa ttgaaaaggc gtgtgaaatc tggcgtgcgc cggagctgtg    229260
     gcactacagg gcggaatgcg cagccggatc aggttacggc ttgctggggg gtctgcagac    229320
     ggggcggcag ggcgatgcgg gcggctttga aggctgtggc cgccgcaacg ccggcttcgg    229380
     tgcgcagctg ccagcgcttg ccgttctgac tgatttcgcc gtgctgcagt ctgtcgagat    229440
     cacgaaggag atcggcccat tcgacgcgct tgccggcccg gcggagtttt tcgtcgagcg    229500
     cctggtgcag gatcagcgcg agaaaagaac agaacacatg gccgcggatg gcggcgtcgg    229560
     aggaatggta gattggccgg gtgcgcatcg tcgccttcgc cacacggaac agccgttcga    229620
     cattctgcag gtcccggtag cggagcaccg cctgcagcgg cgagatcctg gcattggagc    229680
     gcagcacgaa gacgccgtcg aagcgggctt cctcggcgag cttgccggcg tcgatctcga    229740
     acagcttgct cttgcggccg ggctttgcgt cactgaccgg gcgcaggaag cggcgatagg    229800
     cggagttgcc gatcagcgcc ttgtcgcctc gcttcagctg acgatcgagg gcggcgacca    229860
     cctggcgcct ggtctcggcc tcttcgatgg ccaccgcctc gttgcggcag acgatatagc    229920
     gcttgcccgc gaccttgacc tccttgatga agagctgtgt ctcgtcgcca cttgcgcgct    229980
     cgaggcagag cgggatgtag gggcgctcat cggccagcac cacctcgcgg acgatgcggt    230040
     cggtgcgttc ccttgcgccg aggacgtatt ccagcccgcg ctcctccagc gcggcgatcg    230100
     tcgcggcgct gatcatgccg cgatcggcga caacgcagac ccgggtgatg ccgaagcgcg    230160
     accgcaggcg gtcgatcacc ggcaccagca ccgagacatc ggcggtgttg cccggccaca    230220
     tctcggtgca gataggcctt ccgtcctgat cgatcaccac gcccaggatc atctgcgcga    230280
     gctgtgggcg gtaatccttg gagtggcccc acgcgcccag cgtctcgccg ccggcacctt    230340
     cgaaatacag cgaggtggtg tccatgaata cgaccgagag atcggtgaac agatcatgcc    230400
     gccgagcgaa gagccgctct tccaccagat ccttcaccgt ccgtggcgca aagggcgtgg    230460
     catccgcctg ctctgcctcc ggcaactcct cgccaagcca ggccatggcg cggtagaggt    230520
     gatgcaggcc gagctcctcg gtgctgggaa tgtcgtaatc gtcgagccat ttgtcgcagg    230580
     cgcgatccga gcccgagacc ataatccggt ggagcacggt ggcgaacacc gcgcgctcga    230640
     ccgggaactc gaactgccgc ccggccagca gctcctcgaa cacagcagcg atcccgctct    230700
     cctgccacag tcggccgaac agcaatggcg cgccgaaccg gcgcatgctc agcgtggtcg    230760
     cctcattctc catggcggag agcagcatca tctgctcgca atggcgggcg ccggaggcca    230820
     ggagcctcgc gagctggccg cttgcttcga gttcgtccat ccggccgatg gtcagccgca    230880
     caacctggcg gaccttgcca tcgacccgct tgttctcgac gatctgcagg tagcgacggc    230940
     cacctgatgg tttgatgcgg aagaacatga ccccgactcc ggacaccacg ctacggagcc    231000
     gatgcaagca agatcaacac acaatcgcgc gatacgtggc actacgtttt taaaagatct    231060
     tcaaacggct ccgaaaaaac cgttatctcc caatcctcta tcgtgccgtt atcgtatcgt    231120
     tccgggttcc actgttgaag tcgggtttga catcgatcat tgcgctcggg ctcattgatc    231180
     cgcaagcggg attccgcgag cgttgcggca cggtaggggc cgcctcctca cggtcctctc    231240
     gccccccgcg catctccgac gtcagagcat gctctgaacg tggtgttcgc cagcgactta    231300
     ccggccgagg agatcattca tattggcgcc acaggcgctg gagatttttg tcgtgagtgc    231360
     tgcacacttc cccatcgcga tcgaagacaa tgtggcgatc ctgaagctca atcgcgcaac    231420
     gtgcctggac gtcgcgggca agcatgcttt gacggaagcc ttggacattc tgaaggggcg    231480
     agaagacttg cgcgcgctcg tcatcgccgg tgaacatccg caggccttcc tggtgaacgt    231540
     ggccgaactc gccgacatgt cggcgcagtc cgcgcgcaac ttcagcgcct ccgggcatgc    231600
     gcttgcggcg gcgctggagg ccctgccgtt cccagccgtg gcggtggtgg aaggaccagc    231660
     gctgggtggc ggctgcgaag ttgtgctggc ctgcgacatt gcctttgcag gacgcggagc    231720
     gagctttggg cagatcgagg ccttgggcgg ggtcatgcct gcctttggcg ggagttggcg    231780
     gctcgcacgg cgcgtcggct acgctcgtgc gctggagatg atgttcaccg cggctgtcat    231840
     cgacgctgaa actgccaagg cctacggcct tgtgctggaa acagcggagc gtggcggcgc    231900
     gctcgacgca gccaaggcct ttgcaaggcg gctgtcgccg acccgggcgg cctccgtggc    231960
     ggcgatcaag gccgcggcga tcttcggttg gaatcgtagt ccggccgaca tcaacaggtt    232020
     cgaggaagac cgcttcgcaa ccctcttcgg gcccgagcaa tcgcagcgca tgcacgcctt    232080
     ccttgcccgg caacaggagc cggccaagcc atgaccgaca tgctgttcta caacgtctgg    232140
     cgcaccgaga ctcccgagaa ccaggcacga ctgatcgaag cgatgcgtga ggaggcgccc    232200
     aaactggctg ccaagccggg cttcctgtcc atgacggtgc tcgaaagcca ggacggacgt    232260
     gtcctcgtcg aaggccgttg ggcaagccgc gaggcattcg atgctgcggt gagtcacagc    232320
     gacgatgcgc aagcgagccg ccggagtttg gaggcgttcg ggacggcgga gcccggcgtc    232380
     ttcaccgagg cattccgaat cggcccagtg gaggcgccgc cggctgacta tcccagccca    232440
     accttctggg atcgatttgc gcgacgcgaa gtcgtggcga acgggctgaa gctcagcgtc    232500
     gtggagggcg gccagggcga gccagttctc cttgtgcctg gcatgctgga aacgtgggcg    232560
     atatggagcc gcgtcatgcc ccgcctggcc gatcgctacc gggtgatcgc gccggacctg    232620
     cgtgggttcg gggaaagcga ggggactggc gcaggctata acaaggtaac cctcgctgcc    232680
     gatctgctcg cgctacttga cgcgctcagt gtcggccgcg tgcatgtcgt gggtcatgat    232740
     ttcggcggtc aggtcgctta tgcgctggcc gccgaacatc gcgatcgcgt cgccaccctc    232800
     agcgcgatcg aggccctgct gccgggtatc gccgtcgcgc cccgcggcga cgagggcaag    232860
     ttctggctgt tccccttcca catggcgcct gacgtgccgg agatgctgac cgccgggcgc    232920
     gagcgcgagt acgtgcgcgc actctgggat ctcttcgtcg aaccggacag cgaggtcagc    232980
     gttgaagacc gcgctgaggt cgagcgtgtc ttcgcccagc ggggcgccct gacctccggc    233040
     ttcggccttt atcgggcgac acctaaagac atcgccgacc tgacgccgca ctacgcgaac    233100
     aaactcacca ttccggtcct ggccttgggg ggcgagcact gcttcgagcg ccggacgctg    233160
     gagacatttc agcaggtcgc gaccgatgtt accggcggcg tgatcgaggg cgctgcccac    233220
     tttgctccgc ttgagcgtaa cgaggcgacg gcccgcccgc tcttggagtt cctcgcagct    233280
     cacccgatcg agactgacgg ccgcagccag gtctgaagac aacaccggga ggatctcgaa    233340
     atgtcggttg tccgtatctc gctcgcccgg tttgacgcca gccaatacga cacgatccgg    233400
     caaatgttgg acgaggcgca ggccactctg gcgccggcga tccgggcgct gaaggggaac    233460
     ctcgctttct atgccggcat cgatcgcgag aattgcgcca tgcacaatgt cagcgtctgg    233520
     gaaacattgg acgacgcgaa gcagatggac acgctacagg tgatgctgga cctggggccg    233580
     cccttcgtgg cggccggcgt gcgcttcgaa cggccgatca ccaatcacga gaccttatgg    233640
     gctctgtgac gtcgagcaac gataccgacg tcgatcttag gtgtggcgcg ccgagcgcga    233700
     tgccaaccac ccggcggcct cgtgtcgtcg cgacttatat cgtgatctcc gccagcgcgc    233760
     tttccatccg aatgcgacgt tcgatcagta gcggcatcgc caggcgtcta aaacatcggc    233820
     ggggtccgag gccctggagg tgacgagggc tgcgtacttg acgccgcgcc accgccgaag    233880
     tgccatacgc taatggcgag ccgccccgca gacactaccc ctgcccaagt accggatcgc    233940
     gaggtcctcg ctggcctggt tgagcgggtg acgttccaca atgtcgagaa cggcttttgc    234000
     gtgttggccc gaagtaacgg atcgccccgc gctgtagcat aagcggacaa agtgggaaca    234060
     tcaggctgcg tgggtggtcg tgtcggggat tggccggagc ggccgcaatc cggcatggtt    234120
     ttccgtcgat ttctgattgg cgctccagat gtagtcgccg gtcaggttca catgctccca    234180
     gccgatcggc gagagatgtc tgaggagggt tccgggcaca tcctcgacct ggcgtagggc    234240
     ctgtatggct tgcgcgagat agcgtgtgtt ccagaggatg atggcggtga ccaggaggtt    234300
     caggccagag gctcgatgtg tctggttctc gaaggtccgg tcgcggattt cgccgagccg    234360
     gtgaatgaag acggcgcggg ccaggctgtt gcgggcctcg cccttgttga gttcatgact    234420
     gctttcacgg cgcaggcccg gatcttccag ccagtcgagg gtgaacagcg tccgctcgag    234480
     acggccgagt tcgcgcagtg ccgcggcaac ggcgttctgt cgtgggtagg cggcgagttg    234540
     tcgcaggatc accgacgcgg acaccgtgcc ggtgcggatc gaggtggcga tcctcaggag    234600
     atcggaccaa tgggcgcgga tgagacacat gccattccga ctatgttttc cgtacatgat    234660
     tcggcacgaa atccgggatt tttcggcggg tctcggacca ccgacggaaa acaggtgttt    234720
     tccgtcagcg cgcgattccg gcctcagaac cgcgctctcc gctcaaaccc gcagaaaacc    234780
     tcgatcccaa ccaatcaacg ttcccacttt gtccgcttat gctacagcgc agggcgtttc    234840
     gttacttcgg gccacctcga tctccggccg ccgggtcgcg cgggaactga ccggattgat    234900
     caggcgccgc ggcaagcccg acatcatcgt ttccgaccac ggcaccgagt tcacctcgaa    234960
     cgccatcctg gcctggtcaa aggattaccg ggtggactgg cattacatcg cgcccgccaa    235020
     gccgatgcag aatggctatg tcgaatcctt caacggccgc atgcgggacg agtttctgaa    235080
     cgaaagcctg ttcttcgacc tcgatcatgc ccgcggagcc atcgctgact gggtgaagga    235140
     tttcaatacc gcgaggccgc actcctcgct cggctaccag accccggcgg cctacgccga    235200
     ggtcctcacc gcaaccggct ccagcgctgc gctccgcaat ggctccgcgc ctccgccggt    235260
     tgctcacccc gcgccaaacg gcgtaacaaa atcggtcgag gctccaatca cagccggatg    235320
     aaagttcagg ggctggtcaa tccgaatcct cccgaaagtc gcccgggcgc agtgctaaga    235380
     aaccacgcgc acctcgtatc ttgctatttt cattgaatta ttttcatacc gctgttcaag    235440
     tcgggtcgga tgccggagcg cctctgctcg gtgcgaccga ttgggcgctc cggctgaccg    235500
     agcgcttcgc aacctgcttc accgatcggc gctctgcccg atcacatcga gcacgacgtg    235560
     cggacgctcc tgctccagca gggtggtcgg catcgcgctc ggctacgagg acctgatcga    235620
     tcatgacaaa ctgcgccatg atcctcggag gcatccacaa tttcagttca tagtaagaag    235680
     ctcggagcgg cttgcgcgcc gttcggcgga actcccaggc acagttgact gtttgaacga    235740
     aaatccgccc taacagacaa cttcatcgtt tgcgcgcact ttcgggtgat cacgaacgtt    235800
     taatcaattc aatcgtgatc atctttaact gatgagcaaa aggctgccgt aaggtcgggc    235860
     cgaatatccg gcatatcaat ttcacccctc gtggtcctac tctcgctctt tgaaacgtat    235920
     gttcctgcaa gcacgtagta gcaaagtcct gcgaccacaa taccggcttc gaagctgcag    235980
     tcgccgagat gaagtatccc tgtcattagt ggacttgcaa gtgttgaaga attcgaaaag    236040
     agaatgcagg cacaaattcc cgcgataaat gacactatgc caggccaaaa aatcccattc    236100
     cggtaccagt aggcgctttc tttccattgc atcatcccgt cgctgtcgta atgtccacgc    236160
     cgcagaaaat aatctacgac cacgatagcc gcccagggcg ctatccaata cgacatgtaa    236220
     gcgagaaaat tctcgtaagc cccgacgaaa tcaccaagca gcattacagc tacgcgaatt    236280
     gccagcgtga acagagcaat caccaggagc gacggcaccc gcttgatcgg cattcgtaac    236340
     gctagaagtc cgagacctgc cgtatagcca ttcggcacgt tggctgcgat gccgccaaca    236400
     atgatcccga gcagaagcgg aacaacaaac cttgcctatc cggttgactc ccatacctac    236460
     tagatctagt gttgggcatg gatgtcctgg cccgtgaaga cctgccgttc ccgcagtctc    236520
     tgccggaatt ccagcgtatt ttcccgaacg acgcggcctg tgccgcctat ctcgaaagcg    236580
     cccgctggaa tggagggttc gcctgcccaa ggtgcggcgt cgttggcgag ccgttccgtt    236640
     tcgaggcgcg cccgggcgtt ctgcgctgcc gggcctgtcg caaagacgta agcctgatgg    236700
     ctgggaccgt tatggaacgc agtcacacgc cgctgtcgac ttggttctgg gcggcttact    236760
     tgatcgccag ccagacgccc ggaatgtcgg ccgtccaatt tcagcggcaa ctcggcctgt    236820
     cgcgctacga gaccgccttc ggcatccttc ataagctgcg cgccgggatg gtgcgccccg    236880
     agcgcgacaa gattggcgac acgccgcaag aacacgtcga agtggatgaa acgtgggttg    236940
     gaggacgaac ccgaggcgat ggacggggtg tccatcacaa ggttctcgtc gcctgtgccg    237000
     tggaggtgcg ccaccggaaa ccgggaacca agctcgacaa tcggaaagac ggtcgctacg    237060
     cgggacgcgt tcgtctcgct gttgtccccg accgtagcgc caattcgctc tgcggattcg    237120
     tcgaaaacgc cgttgctccc ggatcgctga tcgttaccga cgactggagc ggctatgccg    237180
     gtctcggaag gcgcgggttc gaccaccatg caatcgccga atgcggcgac ccggaggtgg    237240
     cagaagaatt cctgccgatc gtccacttgg tctttaccaa cctgaagacc tggatcaacg    237300
     gcatccatca cggggtcagc gccaaacatc tacaagccta cctcaatgaa ttcacgtttc    237360
     ggttcaaccg gcgcctctat cccttcaacg cgttccgctc gctgctcgga atcgcgggta    237420
     gggcagccgc accaaccttt gacgagcttt attccgggga atggacacac cctacattta    237480
     gtgggtgtgg gtaacaaccg gataggcaag caacaaacca taccggcaga atattcgcca    237540
     actgagcgac gggatttgcc gacaatccgc caccaactag gattgcaacg aggacgccca    237600
     ggatctcaca cagaacgacg gctacgaact ggccgagccc agccgccagc gcgaccttct    237660
     tccagctcaa cgtttcagga aaataccgac tataatccga tgcgtagttc gaccaaccga    237720
     ccggaaatga aaacgcgagg ctcatcgcgc taagccagtg aaccattgaa aacacagttt    237780
     gctgttgtgc cacaatatgt cccacgggca tcccaagaat tacgaaatag gccaagaccg    237840
     caaagattac ggcaaggagg atcgcgatat atgattccat gaatatgatg gtcgcatgcc    237900
     catatatcgc aatcacgact tccagaacca gtatgatcgc caaaccgatc catgggacga    237960
     tcacgcctgt aacgcctgcc atcgcaaata atttattgat agcttcagtt gccagaatag    238020
     cgttgatcga gaaccagctc agcgcagtga taacgctcag aatcttcgga aaaaatgagc    238080
     ctagttgtcc aaaggacgtt ctggatgtca caatccccgc cgtaccagtt cgcggtccca    238140
     tgatggatgc cataccgaca atgatacaac ctagagcgtt ccctacgagg atcgcggtta    238200
     tggcagacgt aagcgacaac ccgaacgaca agataaatcc gcccgtcacc actacgacgt    238260
     aattcgtatt tgcacccacc cagagcttga acaactcaaa ggcattaccg tgacggatat    238320
     tttgaggtat cggatcaatc ccgtgtacct caacatgcca tgtagcgtct gctttgatag    238380
     aacttggtga gctcgacatt tcagatctcc ctatcatctt gtttttaatt ggatggttgt    238440
     gccggactac ggagccagag gtgagaaagg agccgccctg gcaatcctgc tctccatagt    238500
     gtcgatcaat tcctggattt tcggcataaa cgcctgccag cctggatcgg cggccaacgc    238560
     agcccgccgc ctttcccgct catccagact ctcgtaggcc caaatgtgga taatctcgtt    238620
     caatgagccg atttcggtgt agaaataacc aaccaatgct ccgagatatg atttctgaat    238680
     tgcaatacct tcgtcctcga cgagatgaag atatgcttga actgtgccgg gcctgagtct    238740
     gtaggtacgt atctcgtaga acatatcagt ccttcagcgc atgataaacg gatcgggaaa    238800
     cggacaggtc gaactgttga tccagacagc cttcggccgc gtatattcca taaccgattc    238860
     ccgaccgccc tcgcggccca acccactcca cccaaaccca ccaaacggaa caaccggtga    238920
     gatcgcccga taagtgttca cccagacaac accagctttc acacttctga taagcctatg    238980
     ggcacgacgt agatcgttcg tgaaaatacc agctgccaac gcgaagcagg tatcgtttgc    239040
     aaaggcgatg ccatcggctt cggtatcgaa acgcatcacg ctcaggacgg gcgcaaagag    239100
     ctcttcgcgg ctacagggaa tatcgttgtt cgggcactgc agaatcgtcg gttcaagata    239160
     aaatccccgc tcgtgtcccg gtggaacctt ccctccagcg gtgagcacgg cgcccgcctt    239220
     cacgctggat tggatcactt ccacagcttt ccgatgctgt cgcgcggtcg cgagcgggcc    239280
     catctcggtt gccggatcgc tgggatcgcc aatcttgatt ttcccgactc tttcggagag    239340
     catgctaact agagtgtcat ggatgctgtt ctggaccagc agccgcgacc cggcaacgca    239400
     gctctgcccg cttgctgcaa agatcccggc gatgatggcg ttgcatgcat tgtcgagatc    239460
     ggcgtcatcg aaaaccagca cgggagattt gccgccaagc tccagcgtta cgtgagatag    239520
     attttcggca ctgttgcgca cgacgtgccg cgcggtttcg gggccgcccg tgaaggcgat    239580
     cctggaaacc aggggatggc ttgtcagacg ttgaccgcaa ggatcgccga atccggtaat    239640
     gatgttcacc acaccaggag ggaagccggc ctgatcgaca agttgtgcga actcaagaag    239700
     aggtgccggc ccatcctcgg atgccttgac cacaacagtg caaccggcgg ccagtgcggg    239760
     accaattttg accgcggcca gaaagagttg ggagttccac ggcaccaccg ccgcaacgac    239820
     gccgatcggc tcccgccgta gatatacctc catatcgggt ttatcgacag caaggtgcgc    239880
     gccttcaatc ttatcggcca acccgccgaa gtaacggtag tattccgcga tgtaggcgac    239940
     ttgtgcgctc gtctcgcgaa tgaccttgcc ggtatcccgc gtttcaagct cggccaaggc    240000
     ctgagcctgt tcctccagca ggtctcccag ccggtagagg agtcgcccac gcgcggtggg    240060
     ggtcagcccg ctccacgaga ggtcatgcag agcccgatgg gctgcagtga cggcacggtc    240120
     gacatctgcc gcgtcggctt cgggcatcaa gctccaagca tcaccggtgg ccgggtcgat    240180
     gctctcgaaa ctccgtgccg catcgacgaa ttcaccatca atatactgcc ggaaacgtcg    240240
     catcatagcg ccggctcttc cgctcgggtc ggggttgacg tcgcgaaacg cggcataacc    240300
     tcgtgaatga agcgcagcaa tgacgccttc ttgcgatcga atggcatgcc gctgtcaatc    240360
     cagaagctgt actgatcgta acccagagcc tcatagtgcc ggaggcgttc cgtcacctca    240420
     tccgcggtcc cgatgaccaa gttgcgtctc atcgtctccg gtgcgtagtt cgtcatagcc    240480
     ttgatctcat catcgtcgag ttcggcgatg aatccttctc gcaccggcct cttgttgaga    240540
     aaccagctcc cgaaataaca gtagaaacga ctgagatcct cggcagctcg cgttacatct    240600
     gcttcattct gaccgacata ggtatgcatc agaagcatta tctttggccg gggcagattc    240660
     tgatgtgccg tacaggccgc gccgaaacgg gcgatcagcg tgtccacttc agtatctccc    240720
     gacgcgaggg gcgtcacttg cacattccag ccattcgaaa cggcaaattc atgggaattg    240780
     ggatctcgcg cagcgaccca gatcggaggc gccggctgct gcaagggctt cggaaccgat    240840
     gtgctcttcg ggaagcgcca gaactcgccg tcatgcgcat agtcgcctga ccagagcttc    240900
     tcgaccgctg gaatgagttc ccgcatgcgc tgcccggcat tccaagcatc cagtcccggc    240960
     atgagatggg gtaacgggcc ggtcatctgg agatgacgga ttgggtggct gtccctcaga    241020
     atgatggtgt gagtttgaac ggagtcagga tggtcctgct ccaagcatca tcgagggaca    241080
     accatggagc attatgcagg aattgacgtg tcgttggaaa gctcggcggt atgcgtgatc    241140
     gacgcgacgg gtcgggtggt ttgcgagggc aaggtggcga cggaaccaga gacgctgatc    241200
     gactggctgc gacaatcaga tgttgctttc gcccggattg gccttgaagc gggcccgctg    241260
     tcgcaatggc tatatgcggg cctgcgggag gcgggttttc ctattgagct gctggagacg    241320
     cggcatgtgc gggcggcgtt caggacgatg ccggtgaaga cggatcgcaa ggacgcccgg    241380
     ggcattgcgc agctgatgcg ccttggctgg ttccggccgg tgcactgcaa gtcgatggcg    241440
     gcccaggagt tgcgggcgat cttgacggca cgcaagctgg tccagggcaa gctgcatgac    241500
     gtggagatga gcctgcgcgg cattctccgc ggcttcgggc tgaaggtcgg tccgacgaca    241560
     cggcggacat ttgccgaccg tgtccgtgag ctggtggccg gacatccgac cttgcaaatg    241620
     atcgccgaag cactgctgtc ggccagcgat gaactgggtc gtcagcttgg ccagtttgag    241680
     gcgcaggttc ggagcctggc acggcggaac ccgaaagctc ggctgctgat gtccacaccc    241740
     ggcgtcggcg cggtcgtggc gttgacctac gtggcggcaa tcgacgatcc ggctcggttc    241800
     cgatcgtcac gaacggtcgg ggcgcatttc ggcctgacgc cgcggaagta ccagtcgggc    241860
     gagacggatg tgacgggacg gatctcgaag atcggtgacg tcggtgtccg caccgcgctc    241920
     tacgaagcgg cgaacgtcat tctcactcgg ccagtgaaag gatcgacgct gaagagttgg    241980
     gcgatgcgcg tggccgctcg cgcggggatg cgcaaggcca aggtggccct ggcccgcaag    242040
     ctcgccgttg tgctgcatcg gatgctagcc ggcggcactg cgttcgacgc cacgatggcg    242100
     gcagcgccgc gggcataagc atgagcacaa aatagaagca ggaggagata tcaagttcgg    242160
     gcgaggctga cacctctcgt ccggagcagg tcccgtcgcc gggacgatgg atcaggccag    242220
     gccgctatga gcgcggcagc atcattcggt gactgcgcat cttgagattg gccgaccggt    242280
     cctcatcaga ccccatgaag cagcggacca gcgccgactg cggacagaag caagacaccg    242340
     gcgatggtac agctctcaac gagggacttg acacccatag gcccgttaca gaaggcgctc    242400
     atactcgaag ctgtacgcgc ctctggcgat gcccagatcg agccggccgc cgctggcaat    242460
     atcgagcata gcggcttcac cggccagttt gattgggtgc cagaacggcg cgataaccgt    242520
     gcctgtcccc agcctgatgc gttcggtgcg ggcggcaaga taggcaagat tcacgaacgg    242580
     attcggagcg atcgtgaatt ccatagcatg gtgctcaccg atccacgccg tctccatgcc    242640
     tccctgctca gcaatgcgta cgagttcttc cagttcccgg aacagaccag catgggtctg    242700
     attccgatca aagcgctcca tgtgaacgaa gagagagaac ttcatgcgat tgcttcctca    242760
     tctattgtgt ggacaacacc ttcgctcgct gtgcctacgt aaacaccgaa accatcggtt    242820
     ctctcgcgca cgtagcgtgc gagcatgcta cgagacgcgg ggtcggccac gcgttcgaac    242880
     gggatcgccg tcagcgggtg gggttcaacg ttggcgccag cgatcccgcc gctcgcggtg    242940
     cctcggtaga cgattctcat cgctgccatg tccggatttt cgaagacggc aaaaaggaaa    243000
     tccaactgcg ccctgagacc gaacgtctcg aggaagccgt aaagcgaagt ggggctcgag    243060
     cgtgggccga gggtggcgcc gccgggtaga gcgaggcaac cgtccaggct tcgcagcagg    243120
     agcacgcgat cgtcgcgctc caagatggcc tcgacccgga tttcgcggcc cagcgcggaa    243180
     actgcgcttt gcgagagggc gaaatcgaca taggttcccc ggcaatagcc gagcggctcc    243240
     tcgggggcat gaccataatc gagcacccgg ccaagtagga tcacatggtc ccccgcatcg    243300
     atcgcgcgtt cccgcgcgca cgagaaccag gcagcgcctc cctcgatcac cggcaggccg    243360
     gcggcaccgg agcgccacgc gacccgtgcg aatttgtcag cgtcctttga tgcgaacaga    243420
     gcggagatcg gcttctgggt gtttttcagg atagtgaccg caaaaccctc cgccgcctcg    243480
     aatacgccgc ggctcgcggc ggccttggct atgcagacca gcaccatcgg cggctcgagc    243540
     gacaccgacg tgaacgagtt ggccgtgaag cccctgggtg tgccatccgg ttcgcgagta    243600
     gtaaccacgg tgacgccggt gggaaacgcg ccgagggctc tgcggaaatc gcgggaatcg    243660
     aacatcgtcg cccccatcat cctgccacaa ggggaagcgt ggcatcttcc tccagaaaat    243720
     cacgcagcgc ggcgttgact gtcacgggcg aagcgagact catcatgtga cgttctccac    243780
     tcaggataag agcgcgggca tcgggtgcct cagctgccat ttgccttgcc attgcggggg    243840
     aggagttccc gtcgagttca ccggttagga acaacgctgg caggcgcaag cggccgagcc    243900
     ggccggtatg cgccgcatca gcggtcgcaa acaggcgata ggcacggcgg tagccttccg    243960
     gacgaagaca gcccagcgcg gcgcggaccc agaccgccgc aggcatacat tgcggcgaga    244020
     tgcgggcgcc aaaccagcga tccatcgcag attgctgcca gtctgccggg tgatcgtcgt    244080
     ccaacaaccg cacacggcgc tcgaccgccg cgcgctgctc gggtgagcgg cggtagaccg    244140
     cgttcatcgc aaccacggcg ccaattcggt ctggatgacg caacgccaag tcaagggcga    244200
     taagagcacc catggaatga cccacgacct tcacgcggcc gacgccgagc ccgtcgagca    244260
     ggtcaatcgc ctgtgccgca tactcagcga gggttgcagg gtccgacggc agcgggctgc    244320
     cgccatgccc tagagtgtcg taggcaatga cgtcccattc cggcgagaag gcattgattt    244380
     gcggcgccca gaatccgcaa ttcatcccga caccgtggat cagcaacagc acttctccgg    244440
     caccggcgcg gatgtagtga gtgcccttgt gccaaccggc ggacaggccc tgttcagcca    244500
     tgaagatcgc ccatttcttg tagatcctta taccgatcac cgatgcgatg atgcggtcga    244560
     ccaccgatgg aggcgccaag ggcgacgacg atctcgtccg gccccggggc atcgtcgatc    244620
     gagaactgga cggtttcgta atgcgaacgc atcccttcgt cgtgcttgtg catcaagggg    244680
     atctggattg aggcacccgg cgctccgcgt gtattcgtaa atgccagata ggatttggcc    244740
     ccaacggcgc ggcgataatg gtttccgaag cgtagggtat ggattagggc agagccgtgc    244800
     tcgatctctc cattcgatcc cgtgaccgcc gactttccgt atccttctac agctccccca    244860
     cctcccgcca acttcagaat ttcttcggtc agcagatgtc cgagttccgg ggctacttcc    244920
     cttatctccg aagccagatc ttccacaaat ccggaacctg cccaggggtt acgcaggacc    244980
     gccgcgacag ccatcagtcg cgacatctta ggcaccgctc tgccgccttc agtccaaagc    245040
     acttccgtgt gggtaacgag ttttctcaac tccaatggca tcgatcgtct ctcccgccgc    245100
     aacaatatta tggtatacca taagatggta tgaaaattga gtcaagcagt ctatcagcga    245160
     cagtcaagca ccgttgcggt tggctaaggt ggatcgtgag gatgagatgg gaacggacga    245220
     aggcagcatg ccggaattag gcgatgatac aatgctcgtg aatcgcgcca caaagactct    245280
     gcggcagctt acgcttgaaa aggtcagaag cgcgattctc actcttcagt tccgacctgg    245340
     cgaacgcctg gtagagcgaa agctctgtga acgtctgggc gtcagtcgca gcgtggttcg    245400
     cgaagtccta cgaaacctcg aatccgaagg attggtggag gtcattcccg ggcacggtcc    245460
     cgcggtagcg agtccagata cggcgaaagt gcggcagata tatgagctac gttcgatgct    245520
     cgaatcactt gcagcccgcc attgtgccga acatgcgaca gcagaagacg tcgaagcctt    245580
     agctcgcggg ctagatcgca ttcgtgacgg ctatgccgct cataatccgg ccgctgttct    245640
     tcaagctaca acagaattct acgagatcat gttccatgca gctggtcgat cggttgcatg    245700
     ggatgtcgtt tcggctctga acggacgcat cacccacctc cgagccacta caatcgccac    245760
     gaaaggccga agcaagtctg gcgttgctga agttgagcgc atttattcgg caattgtcag    245820
     gcacgatgcc gacgaagcgg aagccgcatc aatagagcat atcaactccg ccctgcggat    245880
     tgcgttggag caattgcaaa tttcgaagct tgtcggtcat caaggctcac agtcatgatg    245940
     taggcatggc tgctaaatgc tgatttttga tctcgtgtaa gtccgatggt tctggcgcaa    246000
     actttcgacg ttctgagcgc gcgtgatatt ttggcgttgt cagagagtta gctagtcgcc    246060
     tgtgaaaaat cgaattttgc tgatcttgcc gcgatgattt agcggcgggc gatattggga    246120
     tttgcaaggt cttggagacc tgagtggaaa agccttgcaa agccgttgga gcgttgcgcg    246180
     gtggtcgcga tcgtgattct ctccctttga tgccgaacat catgtgtttg gcgtggagga    246240
     aagaatgccg ccgaagctga atgcctcgca ggatgatctc gaactgttcc gctcgcggct    246300
     ggagaacatc atcgaccagc ggcatcccct gacgcggctg gcccggctga tcgactggcg    246360
     ggtcttcgag gaacgctttg gcgcactcta cgccgaggcg gcgggacgtc cggcgctgcc    246420
     gacccgcctg atggtggcgc tgcatcttct caagcacatg gataggctgt ccgacgaagc    246480
     gatttgcgcg cgctatctcg acagtccgta tgtccaggca ttctgcggcg agacgcattt    246540
     ccagcacacg ctgccccttg accgatcctc gatgacgcgc tggcgcaagc ggatcggggc    246600
     ggagcggatg gaggccctgc tcgccgagac gctggcggcg gccgagcggg gtggggccgt    246660
     tgcggagaag cactacgagc gggtcaccat cgataccacg gtccagccaa aggccgtgac    246720
     gcatccgacc gacagcaagc tcctgcacag aggcatcgag acactggcgc ggatggcacg    246780
     ccggcacggc atcacgctac gccagtcgta tcgccgggtc gcgcgctacg ccaggcagga    246840
     ggcggcgcgc ctgcaccatg gtggcaaacg ccacgaggcc gaggctcgcg tgcgcaagct    246900
     gcgaacctgg ctgggccggc tggctcgtga catcacccgc aagatcgcag gcaacgctga    246960
     agcgaaggcc gcgttcgccg aaacgctggg cgtgatcaat cgcctgcttc gccagaagcg    247020
     ctccgaccgc ggtgccgaca agctctattc cctgcacgca cctgaggtgg agtgcatcgg    247080
     caagggcaag gccaggacgc gcttcgaatt cggcgtgaag gtctccatcg ccaccaccaa    247140
     cgccgctgca cccggcggtc agttcgttct cggcatgcag agccagccgg gaaatcccta    247200
     tgacggccac accctggccg gccagatcga gcaggtcgag cggatcaccg gcgttgccgt    247260
     cgcccgcgcc tatcgcggcc acggcgtcga agccgagggc agaaggatct tcatctcccg    247320
     ccagaaacgc ggcatcaccc ccaccatccg ccgcgagttg cgccgacgca cagccatcga    247380
     acccgtcatc ggccacatga agaccaatgg ccatctgggg cgaaacttcc tgctcggcgt    247440
     cgacggtgat gccatcaacg ccgtcctcgc cggcgccggc cacaacctcc gcctcctgcg    247500
     cagatggctg atcaggcttc tttgcgccct cgtcgcatgg ctctctgcac caaaccgctc    247560
     accaagcccc ggcttcacgc accgccagat cacatagttc acaggcgact agctagaggc    247620
     cggcgacgtg atcgagttca agggcgtgca ctatccgaag tcggtgatcc tgtacgcggg    247680
     attcttctac ctgcgctacg ccgtctccta ccgcgacttg gaggagatcc ttggggagcg    247740
     gggggttacc gtcgaccacg cgacgctgaa ccgctgggta gtgaagttcg cgccgctaat    247800
     cgcggcccag gcgcaagcga ggaagcggcc gaccgccacc tcctggcgga tggatgagac    247860
     ctacatcaag gtgaagggca agtggaccta cctctaccgt gccgtggacc gggatggcca    247920
     aactcttgat ttcatgctct cggagcgccg caatctggcc gctgcccggc ggttcttcaa    247980
     acgggcaatt gccgccaacg gcgtgcccga ccgggttgtc atcgacaaaa gcggtgcaaa    248040
     tcttgcgggc ctgcaggcgg tgaatgtgat cctgaaattc accggcgatg gacgcaccat    248100
     cgaggtccgg caggtcaaat tcctcaataa catacttgaa caggaccatc gcttcatcaa    248160
     gcagatcacc ggcccgatga tgggcttcaa ggcgttccac tcggccgcag cgaccatcgc    248220
     cgggattgag gccgcccacg tgatcagaaa aggccagatc ccggccaacg gcaccagcgc    248280
     gtttcagacc ttcgcggagc tcgcggcata atagtgtccc tagctcgggc tactccgcca    248340
     tccggaaaag tttgcgacgt aaccctcttc cgtcctgtgg gcgtgctgcg atcgagttgt    248400
     acaacaccgg caggccgcac agttcgctcg gatatcgccc gccgccccca gaaaccgcga    248460
     cgccgccacg gccgccctcc ggttccgctt cgctccaccg aaggccggcc atggcggcgg    248520
     agacaagaat gcactaactt ccaacacgca ccactcactg ggggccggtc aagccgtttc    248580
     ggaagcgttc caccggcagg cagtaaaccg gtcgtttgat tgccggcacc ccagcattca    248640
     accaacgctc cggtgcaatc agcgtgggca cgacaccgat gattgcgatc ccagttgcag    248700
     ccgttatgcg cccatgtgca atgatttcgg gccagacccc aaaaacctgt tgcaatcatt    248760
     ccgggcacag ccgcccgatg attgcgatcc caagcaccga tgattgcagt tcactacaca    248820
     aaccgatccg gcaggccgaa cccctccagc cccaccgcac gatacggcac cgcgtgcaga    248880
     gcggcgatcg cttcgatcat cccggtctgg atcgcaccgc gaccagtgcc gccagccccg    248940
     gaatccaccc ctccagatac gcgcccagtc gcaccggatc gagccgatgc tgctgcagac    249000
     cctcgcctaa cccctcatcc atccaggtcc ctcccgaccc gcactgtccg cgatcgccgt    249060
     ggactgtcaa gcgcggccga gggcaggatc aactcacggt gtcgcccctg accgtgaccg    249120
     ggctggtcgc ctccgaaatc cgcttgccga ccttctccac ctggttgcgc tggcccccgg    249180
     tcatgtcgcc gtccatgtga aaatcgacca cgccgagcag cttgccggtc tctgccacga    249240
     acagcaggtt cttatgcgcg ttgccgccga catggatgtg gttgatccca ctcgtccccg    249300
     gcgcgctgcg ccccacgttg gcgccgatcg ccatccgtac cgcctgcgcc atcagccggt    249360
     cggtccccct gatctcggtc gcaccgctca ccgcgaccgt gccggtcgcc accgtctctg    249420
     gcttccagaa ctgcccccaa tcgaccccgg ccgacttcgc gagttgcgca atcgcctcct    249480
     gggtcgcccg tccatccttc ggaaacgtct cgtcgatcgc gatccgcaac ttggtctcga    249540
     ccgtcgccgc cggcaataac tcgccccgat cagcccgctc gcgcagccaa cagaagttcg    249600
     gatgcttctg caccttcgac agttgcttaa cagtaagccc catcgcacga tcccccggta    249660
     cccaccgcca tcataatgtt agtccggttc cccctcccga tcaatccgct cccgacatag    249720
     tgatccaaac cagttatacg ccgccaagtc cgcagtcaaa gctccggtct gctcggccag    249780
     atatgcgatt gcagcgtccg ggaactcgct ggcagcccgg ccaaaccttc ctgtcgcacg    249840
     atacatcatg agctgcgcgg caaaaccgag ccaggtgccg gccggcttgg cattcaggaa    249900
     cgccaggtcc tcaaagccca ggctccagcg aatggccaac gccccatccg gccgtcggtg    249960
     gagtcccgtg catagccgta aatcatgccg gcactatgca ccggacttat gcaacagaaa    250020
     gccccgcttc cggcctacgg ggcggggctg gtatgaaaat cttgattttc gtgcagactc    250080
     agcgcatttg ggggaaacca gacctacgcg tcttgctgtc ctcgtgcggc taattgatcg    250140
     agggctgacc cctcaagcac ataataaatc ttgtcagacc cgtttgcgcc cagcccgtca    250200
     tagagcgacc gcgctgccac gttttctctt gaggtggacc attcgatcct agtgcttcct    250260
     gcggccttcg ccgcctgtgc aatcccagcc atcaacttct gtgcgacgcc acggcggcgt    250320
     gcagcgtggc cgacataaac ctgctggacg taagtgaatg tgagcaggcc ggcgacgggg    250380
     tagagagagg tgaacgtggc aaagccgaga agtcgaacat cgtcgtgggc tacgatgatg    250440
     tccacctgcc gggcacggcg aagcacgtcc tcagcgacta ccagatcaga actgatagtg    250500
     gctccgtaga aaccagccat ctcgatcatc aagtcggcta gggcctgagc atctttctcg    250560
     tcaaagcgac gtatgcggac caccattcac cctttcccga cacaacctgc tgcttcgcta    250620
     catggcctac ttttctacca ccgcatacaa ggatgagtta tgcattacgc cccattctgg    250680
     ggctgccggg ggtagttttg tctatttgga gaggtgacta atccgcttat ggtaaagaca    250740
     tgagcgatac ctctgattcc gtagccttga ttgcaaattg gatttccttt ggcagcttcc    250800
     tccttacagt ggggattctt atcgccgcgt gggcagcact aggcacttgg cgcgcgcagg    250860
     tgctcggcgg acgaaaaatt caactagccg aagaatgcct gtattcggcg cacgacttcg    250920
     ctgtgcaggt caagctatta cgcttggtat ctcccaataa tcttgacacc gaaaagaaga    250980
     tcgaagaact tcgaaaaaca ctctggcaat ttcagaggtc atttctaata ataaattatt    251040
     atcttaaatc accgatatct gaggaaattc cgaaagcgtt catcgatttc tttgcctctc    251100
     tcgacacgaa ttttcgaatt ttgaagcagt ctgattttca acagccacca ctggttgtac    251160
     aaggtgcttc tctacttgcc gcggcagccg catcttcgag caggcaacac tacgacaatg    251220
     ctctcgatat cttctacgga aaccgccaga acgacccaat cgaagcaacg tatggtgaac    251280
     gtgtcaacga actacatggc attctacaac caatactgac ccccaatagg gggtgcctcg    251340
     gttggctaat cgacaaagcc gctgctgcgg tacaacaatc ttgattttcg agacttcaaa    251400
     ccaaaggcgc aaatttaccc cttaaccgtc acttcattca tctaatgtca aacttgttaa    251460
     aggaaatacg cttgattcca tttttccatt attaaaccat tcacaccagg cgctttgtac    251520
     tccagaagat actccaaatg acgcaggtat atcgattttg ttgacggtca ttgcaggcga    251580
     tcctgactta agtcttacaa catcgccaac ttttatttgg tttgtcatag cgtttttcat    251640
     tcccgtttac gtctacctga caaaattata gctgggtttc ggactcagcc aagaggcact    251700
     cattgcccca gaattctgca ttatggaatt tcggcagaag tcaccgtgaa gtcttcagat    251760
     atatgccgcg taggccggca accgacccca tagtagacgt gcaaccgaga ctgtcaaagc    251820
     accccgccag aagcgggcga tggcggcgcg aatacttgga gcgagcgaat ggcggcgatc    251880
     acgaaaccga tgaggcaacg aaccgacgcc aggtgcggca cggcctgcaa gccgtacgcg    251940
     caaggtcact ggtggcgggt acaaaaagag aacgatgaca acggtcagac cagcggggga    252000
     gccaacattc cggggaccta aacacaagga aaaccttggg tgaaataggt ctgattggct    252060
     gtcgtttgta tcaaaatgag aaatccgggg gatgttatac gaacccccaa gacggccctg    252120
     aaggggccgt atcgatctca cggtaatgcg tcactgcggt ccctggcacc atgccagatg    252180
     cggaggattc gaacaaaatc ggcgttcatg tcgatctcgt agacgatcag atacggccac    252240
     acggccacca gttcgcgggt gccggcaacc aggccgaggc ggccccggtt gggaaacagc    252300
     gccaggctgt cgccggcgag gaccaaagag cgcaacagat tcgctgccgc atgggggttc    252360
     agaggttcga gataggtgac gatggaatcg cggtccgcca aggcgagcgg atgccattcg    252420
     acccgcacgc tcagtgaccg gagatcttcc ggttcagccg ttcgatctca cgcaggagat    252480
     cggcgcgcac ctcttcatgc ggtacacctg gacgaggatc ggcccgcgcc tcggcgatgg    252540
     cggcctcgag aagccggcgc tcggcctcga gctcgggatc aatctggggg actgtctggt    252600
     tcattcggcg aactccaggt gtaacttctg acaggccaat cagatcctgc atccatgttg    252660
     gttgcacgcg ccagaagatt tgacttccgg acgacggccg gcttctcggt gcacaggaaa    252720
     ccggtcggga tgcagtatca cctatatcgt gtgcggcggg caacccgccg atagcgacag    252780
     ccgatgtctg gaataggcgc tgatgtccgg acaggaatct acctgaacca cgacgaaggc    252840
     gccggccgga accagtgggc gggcggccat tttttccctg ggctttggct tcgcctggga    252900
     caggccggac accatgacca tcttttccgg cctggttgat ttagcgtcac tcaggatcat    252960
     gccggcttcc aaaaccccat gtccgccgca gatagcgcgt tcttaagcca agatttcaat    253020
     gcgatgtaac gccttcttgt cgtggccgca gatgcgtttc caaagctatg ctgcgtcgca    253080
     caaaattcat gttgaagcct ctcttggctg agctatatct catcacacgg ggctcatgcc    253140
     ccgttggacg tttcctccct aaacttggcg gccgcaatgg tcgccatttt ttttgcgccg    253200
     atccgattgg ctggaagtgt ccgcaatgac cgaacgccat cctctatccg caaaagtcct    253260
     ttgagcctgt cgtggtccgg catttcatct atggatatgg cctgacgcac cgcgtggatc    253320
     gccggatagg cctcggagga cagattgtcg ctggccggga tagaagcggg tttttagttg    253380
     gcagatcctc atgatttacc gccctgccgt tgcacgccgt gcctgccgct cctgctcggg    253440
     ctgttcggct cgttccgccc gccggatttc cgcgccgctc tcagcggccc gctgccagta    253500
     accacgcgcc tgctcacccg tctggctgtc agcccggcca gtgatctgcc ctgccttctg    253560
     ctcggctcgc agcgccatca aatacccgga aatcttctcg gcatcggcag ccgcccggaa    253620
     gatctctcgc gcgtcttgct gcaaggcttt gatccagctt ccgacatagg ccgcatgctg    253680
     gcccggatca tggccgatgc ccagcttgtc cgcgatcatc agcgaggcga tctccgccct    253740
     tagctcctcc cgcgcgtagg cttccgatcc gaacggcgtg ccgagatccg gccggttcag    253800
     ccgcgagggg tgccctgtgg cgtggccgtt atgccgatgt cggcataagg ggcataatgc    253860
     cgcgatccgg attatgccgc atggcctccg ctggaggccg gatagcccgg cattggccat    253920
     gcggctgttc ggcataatca gagcccttcc aggaacgcga ggagttgatc gtcgggccgg    253980
     aaccggcccg acggcgtggc tggagcggcg acgcgagcga gcgccttttc cttcatccgc    254040
     atgtcggcat ggatgtagat ttgggtggtc tcgacgttct cgtgaccaag ccagagcgcg    254100
     atcaccgcag gatcaacgcc gtggtggagc aggtccatcg ccgtgctgtg gcgcagcgta    254160
     tgtggcgtga cctgtttcgt gccgatgctc gggcacgcgc gcgacgccgt gaggcagtgc    254220
     ttgcggacca gatgctcaag agcgtcacgg ctcagccgtt cgccccggat cgacgggaac    254280
     agcggcttgc cctcatcttt gtcgttgccg atccacgtcg ccagcagctt ggctgtctcg    254340
     cggcgaagcg gggtggcgcg ctccttccgg cccttgccca tgcaacggat gtgcgcgccg    254400
     gtccccagca cgacatcgcc ccgcgtgagg ccgaccagtt cggaagcccg caggcctgtc    254460
     tggaccgcaa gcaggagcag agcgtgatcg cgccgccccg cccatgttgt acgatccgga    254520
     gccgccaaca gcgccgccat ttcctcggca tcgaggaacg tgaccgcacg cttcacatag    254580
     cgcttattgg gcatggcgag gatgcgctgg cagtgcagca gccaagtcgg atcggtcatc    254640
     gcgacgaagc ggaagaacga tcggatcgcg gcgagccggg tattacggct gcgagcgcta    254700
     ttaccccgcg cggtctcggt gtgggcgagg aagtccgcga ccagatcggc gtcgatgtct    254760
     tcgaccgtca ggttgaccgg cggctttttg cggcgggcgc tcgcatatct gagcagcagc    254820
     cggaacgtat cgcgatagcc ggcgaccgta tgtcggctcg cctccagttg cgtgcaaagc    254880
     cggtcggtga agaagcgctg gatcagcgcg ggcaaggtga cggcgttcat tgtgccatct    254940
     ccccgccgct cgcggtggca cgggctatcg ccagatcgag cagttccggg accgcctcca    255000
     gataccagta tgttcgggaa gggctgctat gacccagata ggtcgtcagc cggatcatct    255060
     cgcgcgccgg atccttgccg gtccggtacc agtcgatcat cgtgcgcacg gcgaaggtgt    255120
     ggcgcagatc gtggatgcgt ggccctcggc catgccgatg gtactgctgc tcggatcgca    255180
     agccgatctg ctggcacgcc tgcgcgaagt tgtagcgggc cgtgcagtcg gtgagccggg    255240
     tcgccttgtc ggttacgaac agcggcaccg ccggatgacc gatcagccga tcgcgttcga    255300
     tgcgatagtt gagcagtcgc tcgacggtgc tggggtcgag cggcagcaac cgctccttgc    255360
     cgttcttgcc ctgtcggacg cgcagcacac cattatcggc gtcgaggtcg ttcccatcga    255420
     gcgcgagcgc ctcgctgatg cgcaagcccg tgaccgcgat gagcgcgaac agtgtcgagc    255480
     aagtcagccc gcgcaacccg cagatcgacg gcagcgcctt tgcggccgcg ataatcgaag    255540
     cgacctcggc attgctgtag atatgcggac gcgagcgcat gacagtgtcc ggcaacaggc    255600
     cccgtggtgg gggttcatgc gccggatcga agctgctcag ccactgcgcg aagaggcgca    255660
     cggcggtaag ccgcgccgct cgcgtcatgc cgttggcctc gccgagcgta gcgtgccaac    255720
     gcaggaacag cgccgtgtcg atatgcgtca cacgctcgct gtcggcgaac cgcgtgaagc    255780
     ggcgaaggat gcgctcgctg gtgctcaggt cgtagccgag gcggcgccgc acagccagat    255840
     agcggtcgag ttggaaggtg aggctcattg cgcgcctccc gccacgggcc aaggcattgc    255900
     cactgaccgc agcccatcga tgtcgagacg ggcatatatc atcgttgatg tgcgtgagcg    255960
     gtgccgcagc acatcgccca cctcgtcgag cgatgcaccc gagttcacta actgggtggc    256020
     aaggctatga cgcagcaggt gcgatcccac atagggcgtt accggcttct ggccagtcgc    256080
     cttcagcgca tccttgagaa cggcgttgac gatctggctg tccttgaacg gacggtacgg    256140
     cgcgcgatgg gtgacgaaca tcgtgcgaca ggacgcgggt ccgcgttcct cgcgcagata    256200
     gcggcagagg gcctcgccaa cctccgcgct gatcggcacg cgatcgtgga gcttcccctt    256260
     gccacgcacc aagagttcgc ccgcgcgcca gtcgatgtcg tccagctgga tcgcgatgac    256320
     ctcggcagcg cgcaagccga gccgggccat gatgagcagc atcgcatagt cccgagcgcc    256380
     gtgccggggg ctgtcgcgca cgcaggcgag caccgcctcg acgccctcgg gcgacagatg    256440
     gcgcggcagt cgtgcgcccc agcgcttcgc cgccctaggc acgctcagcg ccagattggt    256500
     cgctgtcgcg ccgctgccga acagatattg caggaagata cgaacatgcg ttgccaccgt    256560
     tttgtcgcga cgcgcgcctg ccaacacatg ctcgatgaag ctgatcacgt cggcaggccg    256620
     caaccgcccc ggatcaacta tcgcatcacc aaagcgatga tcgaggaacc ggttggcgaa    256680
     ccgcagcgtg tgatagatcg tccgcggact caggccgcga tgcttgacca gataggtctc    256740
     gaagttcgcc agcagggtcg cgcgcgcctg ctgcgcctcg gtcaacggca ccggctgcgt    256800
     gacgccgata tcgagcagat gctgcgcgaa ccggcgggcc aacctatacg gccataccga    256860
     gcccgtcttc ttgcgcggca ccttgcgtcc cagatgctcg gccatgtcga gcgtcaacgc    256920
     cgaaggactg atgccctcga catccatcgc gtgccccacc ttccgcagga tcgattggta    256980
     ggtcttgacc gtgccggcgg tgtaattctc cgccgcaaag ctctcggcga acgagtccag    257040
     atacggctcg atgcaggtct gcaaatattg aggcatgatc gtcgtgctcc atgttgttgg    257100
     agcgatgaag attatgccga atgggattgg tgcgatcata ccgccaaccg cgccctgccg    257160
     agcagatgcg gcataatccg gatctcggca ttatgcccca gttcatgcag cgccgtgctg    257220
     taaaatcgat ccgccgtctt gaattggtcg cgctccggca tcgtgacccg atcttgcgcc    257280
     agggtgtaaa aggcccggtc gccgggccgg tagatgatcg gcaccccgga attgctcatg    257340
     atctgctcgg ctgcggcgtg ccgttcccat tccgccaggg cgggccgggc ctcgatcttc    257400
     ggcatgccgg cgatctgctc ggcattgaac accacggccg aaaacacccg cggccgttcc    257460
     agctcgacgc tgcggtaaac ctgattgcct tcggcatcct tcaccggccg tccctgctcg    257520
     tccttcaccg gcacccggtc aaacttcttg aaatactgga tcagcgtgcc cttttcgccc    257580
     ttcatcacct gggcatcgag gctctgcgcc tgcttgtagg tggtccagcg cggatcgctg    257640
     tagcccttca tctcggccac tgccatcagc cagattgcgt tgccgccctg gtaatccttg    257700
     ccggtgatcg cgttgtaggg aatgaaccgg aggccgctgg gctcccacgg cttcacccag    257760
     ggtgcggtgc catcctccaa ctgcttgacg atcgaggcgg caaccgtctg ggcataatca    257820
     ccggccatgg gtggcctcgt tggtgttctc cacgtccgca ttggactccc aggcatccgc    257880
     ctcatcgagt gccgtttcct caaccagtcc cagctgctcg acctcagccg ggtcgatctc    257940
     caccatgacg cccggccgca tcagatcggc cagatcgcgc gagatgattg gtggcttcgg    258000
     gtccatcgct gtcctccttc tcaacgtgct ctgtatcgtc cggcgcaatc ggacggccct    258060
     acctcggccc cctacccttc cccggcacgc gcgggagggc tgcgcaaacc aaccttgttg    258120
     cacaggccat cggtcagatc gggctcatag gatatgtccg gaccagtgtt gcggtgcggc    258180
     tcgggatctt ccgccatccc cacaaaccga acctggggca ttagcgcccg gcccggatcg    258240
     cggcgatcat ccggcgatcc aggcccgcca tgtcgatctc accccgaatg caccgctcat    258300
     tcacggcctc aagctccggg tgatgaacat aaccctggcg gttattcgct gcatgggcct    258360
     gctcgatcgc gcgccagcgc tgcatcatct cggattccga aattttgctg accagccggt    258420
     ccatcccgcg gcgcctcttt actaccggaa gtagaggtta agggggtcac cgcacgatct    258480
     gttcaaaatc gtacgctaag cggcgcgggg tatgaacgga gcgcgaacat cgcgtagcgg    258540
     cctgaagctg gcattgggat tggcgggatt ccagacataa tcgccggtca gagcgatgtg    258600
     ttcccatccg agcggcgcga catgcgccag gagatcatcg ggcactgccg taccctgggc    258660
     ccgcaggtgc tggacggcct ggtcgagata gatggtattc cagtggacga tggcggcggt    258720
     gatgagactg agcccggagg cccggaagct ctgattttcg aaggtgcggt cgcggatttc    258780
     accctggcga tggaagaata cggcgcggcg cagggcattg ctggcctcgc ccttattgag    258840
     cccggcatga ctgcgctggc gcagagcggg atcggacagc cattgcaggg tgaacagggt    258900
     gcgctcgatc cgccccacag cccgtaacgc cctggacaga gtgtttcctc caccggcggc    258960
     ggccagcttc cgcaagatga cggaaggcag aacagtgccg gcattgatgg atgcctttaa    259020
     ccgcatcaac tccggccatt gcccgaggat ggcggtggtt tcgacggcgt cgccgatgag    259080
     cggcaccagc agcggccagg tgcctggctt ttctatcgtg tagagcttgc ggtcccggag    259140
     atccttgatc ctgggggcaa acctgtaacc cagcagatgg cagagaccga agacatgatc    259200
     ggtcgcgccg gcggtatcgg tataatgctc ggcgatgcgc agatcggtct ggtggacatg    259260
     atgcagcagc ccgtcgagca cataaggcgc ctcgctcatc gtcgcggaga tgacgcgcgt    259320
     gtggaacggt ccgtattgac cggaaacatg ggtgtagatc accgcgcccg gctcgatgcc    259380
     gtatttggcg tttaccgagc cgccggctcc ggcgcggcct gcggcccgga aatattgccc    259440
     gtccgaagac gagcttgtcc catcatccca gattgccgcc atggggtgtg catggtgcgc    259500
     attgatgatg gcggcgcggg cggcgacata attgtcatcg ctgatgtgcc attgggccac    259560
     attgaccagg tggtgatagc tgagaccgcg cgaggcgtcc gccatgcggg caaggccaag    259620
     attggtgccg tcagcgagca ccgctgccag cagggccgct ttgtcggtga cggggttacc    259680
     ggtgcgcaga tgcacgaacc tgtccgtgaa cccggtccag gcatcgacct cgctcaaaac    259740
     ctcggtgatc cgcacccgcg gcagcatact gttcagccgc agcgccagat cgcgagccgc    259800
     gtcgggcacg gtgggcggcg tgcgggcgat aaaaagtttg ccgtcctcaa tctccacccc    259860
     gtcgaggtcg ccctgcgcgg cccgggcggc cacgaaggtc agacgctcgc gcagcatctc    259920
     tgcccggctt gcgacgtaac gatcgggatc ggcctcacca tcgatgccgg tggccgcacc    259980
     cgccccggcc ggaagcagat aggtctcgaa cgcctggtaa tcgcggctgc cagcgaccca    260040
     gatattactg ccccgcagct tgtcgcgcag cacggccagc accgctgttt catagagccg    260100
     ccggtcggct gtgccgccgg caaaaatcaa tttccgccac tgcggcggca ggaacgtgga    260160
     gggcggccgc ttgggcaagc tgcggatcgc gccacggttc agggcgcgga gaagttcgat    260220
     cgcggccaga acgggatcgt tcggcatatt cgaccggaaa tcgaaggcgg ccaggaagcg    260280
     ggggctgaac cggcggagca ccgtatatcg ctcggccgcc gtgaccaaaa tatcctgatc    260340
     cgccacatcg gcgacggcgc cgatgatcgg cagcacatct tcgagctggt tcatgccgat    260400
     ctcgcgctcg atggcggtga tcccatcttc tccggcctcc ttcgcctggc gaagggcggc    260460
     gatcgtccgg cggaacagca gtagcgcctt ggcgacatcg cgccgcgtgg cctgaaaccg    260520
     acgctcatcg cggttgcgcg cccggctgaa caaagtgccg acatatttct cgaacatggc    260580
     aagcgtcgcg tccgtcagac gggtttccag gcttgcgatc tgggcaatga gaatggctgt    260640
     gcgccgcgcc ggctccagat cggcgatgtg ctgcacggtc atgagcgccc cctcgtcggt    260700
     cagccggacc aggcgggcag catggatacg accagcccgt gcgggatcaa tgcccatggc    260760
     gcggacatat tcgaggcgat cgagcaggga gacgatgttg gagggagctg gtgattccga    260820
     ataatcccgc agccaggcaa aacgggagcg acgcaactcg ggatcgaccg tcagcagctc    260880
     ggtcagagca ctgcgctccg catcggccat cccggctgcc agcacctcga atgttttctt    260940
     gcgtgctcgg acacgggcgg ccagtccaat tcgctccaac actgtcgccg agggaagcaa    261000
     tacccggctt tctctcagat gaacgagcat agcctggatg atgggttcgc cgcgatctgt    261060
     ggcccaagcc gtatccgcac cagcatgtag gcaggcgcgc cagtcatcga ggccaaaact    261120
     acgcagacca gtgaactttt ggagctcgac caaatgctcc cgacgggttt cagcacggcg    261180
     cgcgtattcc gcaaacaaca aaggatcgac accgatctgt tcagcaacaa aagccagcgc    261240
     cggcgccggt ggatattccg atggatccag agtgcggcct gggaagcgga gaacacagag    261300
     ttgcacggca aagccgagcc ggttgcttgc ccggcgtctg accctgacca tagcgaggtc    261360
     agcagcatcc agtacgtaat gccggctcat ggaggccatg tccgttggaa ttgaaaacaa    261420
     acgggctcgt tgttcagcgg ataaaagaac gcggagtggc atatcgggtt ccggttgatg    261480
     agaaaattag cgcccaccgt gcgtccgcaa gaggatcgtt caacggacag atgtaacggc    261540
     ctggcactgg tggctgtttc cctcggcaac ggatggatca tttaactggt acgatatctt    261600
     ttgcaatgaa ggggggtcat acgttacaat tccgcatggc ccacaccctg atcggttacg    261660
     cccgctgttc aaccgaccgg caagatctcg ccgcgcaacg cgccgaactc gaacagctcg    261720
     gggtaaagcc ggaccgcatc tatacggacc atggcctcac aggcaccaat cgtgcccgcc    261780
     ccgggcttgc tcaagccttg gcggcggtgc gtaaaggcga caccctggtc gtgccaaaac    261840
     tcgaccgcct tgcacgctcc gttccagatg cccgtgcgat cgccgatgaa ctcattaccc    261900
     gcggtgtcaa actcgcgctc ggcgcggccg tctatgaccc aaccgaccca atggggaaga    261960
     tgttcttcaa cattctcgcc accttcgcag agtttgaggc cgacctgatc cggttacgta    262020
     ccagagaagg catggccatc gctcgcgcca aaggaaaatt acgcggcaaa aggccgacgc    262080
     tatccgaaag acaacaaaaa gaactgcgcc gcatgtacga cactggcaat tattccatca    262140
     ctgatctcgc agacctattc tccgtctccc gcccaaccat ctatcgtacc ctcgccaggc    262200
     agcccgccaa cgcttagcgt acgattttga acagatcgtg cggtgacccc ttaagaagaa    262260
     gcgcagcgaa gttcaaggaa cctcaaaggt tcatttcggc gcggcgaatg tctgtcttgg    262320
     aaaaatcatc acctttgaac agcagcgctg cccgataaga tttggcggcg ccataggcaa    262380
     agcaatcgcc tatattcaag gcggccggat gccgcccctt cccgaaatcg gcataagcct    262440
     ggattgccag atcatattca cgctcaccaa gagaaatgac ctcgatctcg agcgcgctca    262500
     taaagctctt caccttttgc cgggcaccgt ccatcgaaag gccgaagctg cggcagagcc    262560
     cggccgtcgc ctcccacatg gcaaccggcg agacgagacg ggtgcgttcc tgggccagaa    262620
     gatccgccag catgtcggca tcctcctcgc cggcgatcat cgcgatcagg gccgaggcat    262680
     cgatgaagat cattccccct cccccgacag atcatcgaaa aacgccttgt ctgccttcaa    262740
     ccctgtgggc ggcggcagcg gattggcttc gcgccactca cgcaggcgct cgcgcaaggg    262800
     cttggcttcg cgggttcggt caagctcggc ctgcaccgca agccgcacgg catcctgttt    262860
     ggttaaaccc cgctctttcg ccagtttggc gacaagctcg gcggtcgcat catcgcggat    262920
     ataaaggggc atgggcgcct caagatattc aaatatctga ttaaagatat ctcgatattc    262980
     agcctggagc aaggatatcc accagaacat cgcctgctcg acatatgcct acgccccgga    263040
     atggatttcc tggctcctct cattgccagt gctaccttca ccgccgaacg gcttccatgt    263100
     gaccgaatgc caggaacttg gcttttagtt cccacccccc acaccgagtg acgccgcgat    263160
     atcgctgatc gagcggagca ggaccaacgg atcgtccctg gattgctcaa agccgcgccg    263220
     ctgccagaat tcggcggctt ccttatcgac cgcgttgacc atcaaggccc gaccgccaat    263280
     aagcgaagcc gcctgaacgc agcgctgaag ggcgtgcttc acaaggcctg tgccgatgcc    263340
     caaccccgcc cacctggtgt cgatcgccag ttgaccgagt agcatgcatg gaaccggatt    263400
     gggtggctgc cctgtccgga tcgagcgggg cagaactgtc ggcacgatag cggtgggagc    263460
     aaggccgtaa tatccaacaa cacgaccagc ctcatgcaca acgacgacgg cggtaaagcc    263520
     cttctgctgg ttggaaagcg cgcgcgattt gagccagtga tcgagcggcg atttcccgca    263580
     ggagaactcc gatacatcgt gagcagcggt aagtggttca ggctccgaca gcggcaaata    263640
     gctcaccgct tggcaacgta accgggctcc cacggcgcgg gtcgcttcag gacttccacc    263700
     atctccggca ccggagcggc gggacgcgcc aacacatcca tgaattcggc gaagccttcc    263760
     gcgctcatcc ggatcaagcc ctgctccatc acaacctctt ctgccgcacg cacagcggcg    263820
     tcgcgtacga aatccgtgcg cgaacgcccg cgcaagctcg cagcgcgatc gatcattgca    263880
     acatccgcct cgggcaagcg catcgagatc gggtattcct tgcgttcagc tactgtggcc    263940
     atggctaatc tccttgcctg ccatatagcg caccgtatcg caaaatccaa tacataaagc    264000
     tcgacaccat caccaacgat ctcatgagga gaggcgcagg atgacgatgc aagcgcaagg    264060
     ttcttaaaaa cctggctcat cagggcacca gccgcctcgg cttactcgct ccccctatca    264120
     atcatcccga catcacgctt cattcttgag cctacggatc tgggtggcac gggcatagcc    264180
     tctttgttag actttgccgg ctatgaactc ctctcagcaa aatatcgagg cacccagatc    264240
     cagtcagata tatcgacacg cctcgctgca acctggtcat ctgcaatatt ccgcatctga    264300
     cgcgtgtcgt gcgacagaaa gggatttcaa atcgatgcag ttggctctgt tcccagagca    264360
     aatcagactc atccgggtcc gacccgaaca caacgaaaag cgctactacc agatcgagat    264420
     cgttacagac ctgttcggtg ccgtcggcct cgcacgaacc tgggggcgga tcggacgttc    264480
     cacacactcc cggtttgacc ccctccccga tctcggcacc gccatcgatg ccctccgccg    264540
     tctggctcgc gccaaacgtc gccgcggcta tcaggactat ccatctacag ggtggttctg    264600
     acaaaaatac agttccgcga cagccaagct caggcgcatt cgaagagcca agttccgatc    264660
     gatcaggcct ttgtagccga gcgcgatgca aaccacgcgg ctgtattgca gacattagat    264720
     cgagcgcgac gcgtcacatg cgtgcgacct tggtggccgc ggcatcccgc tcgctgcccg    264780
     gatcccccag atcgatcgcg ccaggttcag ctcgccggcc cgcgcccggg ccaccatccc    264840
     gtggaaatat ccacccggcg agccgcggaa gtggtcgctc ggcttggtcg agacgatggc    264900
     cagtgccacc gccgcctgtt cgcgccccat cgccaggcat gcatcccccc atagcggctt    264960
     cgagacaccg aggtcatgac gcagccagtc ggccgcctcc acgatctccg gccatccggg    265020
     cgaggatttc gccaggtagg cccgcaaccg gggcgccagc ctgaccagct cgtccggcgt    265080
     catgcggaac accgtgccgt ccggcgggat ttcaggcttt atcgcccgac tgccggttgg    265140
     ccgatgcccg gcttcctttc catccccact cctgccggtc ctcgtcgagc ctccagcgct    265200
     cgtgcccgcg ccacccgagg tggagctacg ctttctcaat gcagatacgt gatccgcagg    265260
     atcaagagtc tggtttgtat atgtaatatg aggctcatcc gtgagcccct tggggttcat    265320
     atttgttgat tcgacaccac ccagcgcggc ctccttcagc gtgtcgatcg ctgcctcaag    265380
     cctgccgcga aggtccgcct gccggttttc cagcgtcgtc acgccgagcg tcacctcgtc    265440
     cagctcctcg atgcgacgga tccgcgcgac cagacgcctc gcctcatccg cctggcgggc    265500
     ccatccttcg gcgatcccga gctctgtcgc cgtctccacg atctgctgga tcccgcgcac    265560
     cgcgatcgtc gcccgacgac gcagctgctt cagcgcctcg aagcgggccc ggccacgctc    265620
     ggcgatctcc cggaactcgg cctggcggac cgcaatgggc gagagatcga agccatacgc    265680
     ctcgacgatc cggccgcgcg gatcccggcg gccgtagcgc ttgccgttcg gactgtcgcg    265740
     catggtgatc agcccgagat gagcgagcag ccggttcagc cgcttcacct gcgcctcgct    265800
     caggcacagc gcctccatct gcatcgccgc cgacggccag acaatcggcc gcgcgccctc    265860
     ctgccagtcc tgcacctggg tgaagcggaa cagccagtcg atcgcctgcg tgacccgcgg    265920
     accaaaccgc agatacggcg ctgccgcctt gaaggcggcc agcacccgac cggggtcgac    265980
     ctggccaccc tcgctcaccg taccgaaatc atcggcgagt cgctctgtcg caaccatccc    266040
     gagcgtgagg cgccgcgcgc cgcgcacgcc tcgtcttttg ggacccggcc ccgattcggg    266100
     gcggaaattc tccatcttga tcctccatca gtgtcggatc gcgacgggca tagccctccc    266160
     gtgagcggaa acggcaattt ccgcttggca ggatggcttc cgatgagtat gttcgggatt    266220
     gcgaaatcac cgaacggctc tcggagcccg tagcgaattt agcgaaagcc cgcccggcaa    266280
     ggcgggcttt cgcgcgtctg ggttataaag ttctgggtga ggccgccctc cattcctcaa    266340
     tgagctgctg gagcgcttgg ccgcggctgc gcagaccttt tcgctccttg atggtgtcga    266400
     tcaggctgat cgtctcgttc ggaaggtgga cgagcacacc tgtagcgccg cgcgcgcgtt    266460
     gcctgcgcct gtagcgtgcg ctcgcatcat caccggcggt acgtgtgttc ggcatcctgt    266520
     tcactccacc atctctatgg ctagtcagtc accattcaga gattcacgga gcgagtccac    266580
     agtttcttgc gcccgagtcg cgcttagcgg ctgatatgaa acgctttttc ctaaaatttt    266640
     tctttgcacc cccgagtcgc agacggcgta gatggctagc ctgagagcgc cgggcgcatg    266700
     cgactcggga ccggcagtcc gacctgctgg attttgtccg ccatccgcaa accacggtca    266760
     gggggcaatt agcctggtcc tgggatcttg tccggctctg cggcaccgtg gccgctcgct    266820
     gccgcagttc cttaaactgc cgctactgca tagtttcgga attttcctcg ggccataggc    266880
     cgacattgtc cttgctgctc cggccgatcg tgcagtgacg cccactcact cccattgcca    266940
     attggcacat cgctataata taagtgccag aggagagagg ttgtgaaatt cgccacggtt    267000
     cagccactca cggcacgtcc tgacattccc gttatcacag atgaggaagc aacggcgcta    267060
     gctcgagcta ccgtcaatct ttttcgcgcc tggagcctga ccgatcagga agcccgagtg    267120
     ctccttggcg agatggccca gcggacatgg gcgcgctgga aggctggtga cgtcggccgt    267180
     atcgaccgtg acctgcgtgc ccggatggcg atacttatgg ggatccataa ggcgctgcgc    267240
     tatctgttca ccgaccctgc ccgcggatac gcgtggatcc gcaagcccaa cgacgccttc    267300
     gagggtcgaa gcggcctgga tttgatgttg cgcggagaga tcaccgatct gatggacctt    267360
     cggaaatacc tggatgcaga acggggcgct tggtgaatgt accgatccgc cgggtgatct    267420
     ggccgcgcac catacgcatt atccgctcta tctatccgcc gattgatctc tttgaggaca    267480
     ttgccgaccc ggcggactgg gatgctttgg tctcggcgga ggccaagttc aacccgcgca    267540
     tccgcgatag catcggagat ctgtccaagg tgccagtggc gcggcgcgta accgggccgg    267600
     gcgctagttg ggttatggca ccattcgttc attgctcacc tctacggcct agccgattct    267660
     cagatggcag cttcggactc tactacgcgg gcgaccgcac ggaagtcgcg atagccgaaa    267720
     ccatccacca ccacgcccgc ttcatgcgcg ccaccaacga agaccccggc tggacctcgc    267780
     agttccgcga acttgtcgga accatcgagg tagatctgga cgacgcgacc ggccgtgccg    267840
     acctccttca tcccaatgaa tatgtcgcct cgcagacctt cggagccgaa cgacgcgcag    267900
     caggatcaaa cggcatcata tggccaagta tccgctatcc ggacggtcag tgcatcgctg    267960
     ttttctggcc cgacgtcatt ccgattccca tccagggcgc gcattatgcc tatcactgga    268020
     acggcagcgc ggtggattac atcaagcgtc tcgacgatgg cgtggtctgg gaggtggcgt    268080
     agccggcaac accgccctgc acgtggccac cctcagacac tccggactct tccaccgcgg    268140
     agcccccccc cgcgccgcac atcactcgcg tcaccaggcg gatggtatgg agaaggctga    268200
     ggggggcgcg acccgctccc ccgggaggtc ctcggtttaa ggtttgccag ttctctcaag    268260
     caggagccag gcaatagggc cggcaaggtt cgaacgagca gaacattggc attttgaaag    268320
     agtatcaggc gggcttgtct gcgactgatc tgtgcagcaa gcaccgggtt ttccgtttgc    268380
     tcatgggctg atttccgggc cattgtcgtc cggcgccgcg cttgacatcg cgtcattcag    268440
     catgccgcgc acccgatcga tccgattggt gcccatttcg cctggtgaag acccgatccc    268500
     ctcaccagag tccacgggct catgccgaaa tcacgcttca aaccagcgtc tgctcccggt    268560
     gcaatgccga ggtacccatt cggcacaaac cgtggactct ggtgatatgc ttggaccatt    268620
     gctcactaaa gtccacggtt tgtgcccaga gtcaggatgc aaacgagtgt ggattttggt    268680
     gagaagcagc gttggtgggt gtgcaaccag ccatatggac cctgtcagct gacaagggtg    268740
     agcggcggat aagcctttga tctcgtgatg ttggccttgc gaccacaaat gattccggat    268800
     ctcggcaaaa gctcgacgac taggccgtgg actctggtga ggggatgatg gggaggcaca    268860
     ggaaatctga accgaggcgt ggactctagt gagttgccat agaaccggca ccagggcgtg    268920
     gactctggtg agatgccata ggaccggcac cagggcatgc actccggtga catgccaaga    268980
     aaacagagat caggatgtgg actttggtga ggaaatcgag cctggcgtgc tggcgtggac    269040
     tctggtgatg ccagccttaa tgcggaacag taggtgtcta tcggatcgat tgcacgcgag    269100
     gacgcaccgg tggccggctt gatttcagaa ttacaccctc gtccacgata tccacctgcg    269160
     catctggata taccgcaaga gccagcttca gcgcactcgg ccagcgagcc ttgaaatgat    269220
     atacttctcg atagccacag ccgaactgcg ccttcagagc cttccaggtg actagctttg    269280
     cggcgggcag tgcgtgcagg cggtaggcca gccagaggta gcaatccagc gccccggggt    269340
     tgttgttgat ggccttgatg gcagcttcct caagcggaac cggatgcttt tgcagctgct    269400
     cgaaaaagcc ctccgagagt cgcgccattg agagcatcgg ctttccgctg ccctcctcgg    269460
     tatcttcgac gaacagggcg ccgtccataa tcgactggtt gatcaaaccg actgatttgc    269520
     cgccctgaat gtgaaatgtc aggcggcagc ggctgatcct ctcggcctga tccttgacca    269580
     acttcgctgt cttgccgccg acgcttaccc cgattcgact cagccagtcc cgcaaagagc    269640
     gcccgagctc gatttctctc gacccggtcc tgatcgcctc ggtctgaagg tagagaagga    269700
     taagtcgtgc atgtgcccca aacggtacac cgacgaaatc tagagggcct tcttcgctcc    269760
     tgggcttccg accaggctcg acgacaagcc ttgttctttc aatgctgatt tcccatggtt    269820
     gatcatccgc cagcctgcga tgagggaggg cgcactgagc ccaacccgaa taggcaaagc    269880
     tcagggtcgt gtcctcgtcc cccatatact gggccgcagc ttcaacaaaa ctgcgctcga    269940
     taccggcatc aagcgcccct gcccttcccc tcgcctcgat tagattatgg atttctccca    270000
     tcgcattttc cttgcctatc cggttgactc ccatacctac tagatctagt gttgggcatg    270060
     gatgtcctgg cccgtgaaga cctgccgttc ccgcagtctc tgccggaatt ccagcgtatt    270120
     ttcccgaacg acgcggcctg tgccgcctat ctcgaaagcg cccgctggaa tggagggttc    270180
     gcctgcccaa ggtgcggcgt cgttggcgag ccgttccgtt tcgaggcgcg cccgggcgtt    270240
     ctgcgctgcc gggcctgtcg caaagacgta agcctgatgg ctgggaccgt tatggaacgc    270300
     agtcacacgc cgctgtcgac ttggttctgg gcggcttact tgatcgccag ccagacgccc    270360
     ggaatgtcgg ccgtccaatt tcagcggcaa ctcggcctgt cgcgctacga gaccgccttc    270420
     ggcatccttc ataagctgcg cgccgggatg gtgcgccccg agcgcgacaa gattggcgac    270480
     acgccgcaag aacacgtcga agtggatgaa acgtgggttg gaggacgaac ccgaggcgat    270540
     ggacggggtg tccatcacaa ggttctcgtc gcctgtgccg tggaggtgcg ccaccggaaa    270600
     ccgggaacca agctcgacaa tcggaaagac ggtcgctacg cgggacgcgt tcgtctcgct    270660
     gttgtccccg accgtagcgc caattcgctc tgcggattcg tcgaaaacgc cgttgctccc    270720
     ggatcgctga tcgttaccga cgactggagc ggctatgccg gtctcggaag gcgcgggttc    270780
     gaccaccatg caatcgccga atgcggcgac ccggaggtgg cagaagaatt cctgccgatc    270840
     gtccacttgg tctttaccaa cctgaagacc tggatcaacg gcatccatca cggggtcagc    270900
     gccaaacatc tacaagccta cctcaatgaa ttcacgtttc ggttcaaccg gcgcctctat    270960
     cccttcaacg cgttccgctc gctgctcgga atcgcgggta gggcagccgc accaaccttt    271020
     gacgagcttt attccgggga atggacacac cctacattta gtgggtgtgg gtaacaaccg    271080
     gataggcaag gcattttcca gtgactcggt gatcggacaa atccgatata gcaaagttat    271140
     caacatctgt cgctgtggac tttggagagg aagctatttg gtagaatatt agattcctat    271200
     tattagtttc atcgcaaggg tccacgggat aatcctgtta agttgttgat tttccactta    271260
     gggtctctct caagagtcca cagattttat cactgaagtc cacaagagag gctcacgacc    271320
     tgtggataag atcgtgctga ccgaatccga ctcggggtgc ctccccccgc gaatcgcgga    271380
     acgctggctc accaacaaaa tggatagaac cgcatctcaa gcacttaatg gcagttcttc    271440
     agctatcata agaagccgaa ttttctggac aacaagttgc aaggcccata tgacatgacg    271500
     ggtaacgcct gtcagggcgt atttttgccg tcagatcgag gcttcattta gtcttcggag    271560
     ggtttcaatc ata                                                       271573
//