Dbfetch

ID   AP012035; SV 1; circular; genomic DNA; STD; PRO; 3749411 BP.
XX
AC   AP012035;
XX
PR   Project:PRJDA60101;
XX
DT   02-MAR-2011 (Rel. 108, Created)
DT   28-SEP-2016 (Rel. 130, Last updated, Version 3)
XX
DE   Acidiphilium multivorum AIU301 DNA, complete genome.
XX
KW   .
XX
OS   Acidiphilium multivorum AIU301
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acidiphilium.
XX
RN   [1]
RP   1-3749411
RA   Hosoyama A., Yamada R., Ito N., Takarada H., Narita-Yamada S., Nakamura S.,
RA   Katano Y., Ichikawa N., Nakazawa H., Fujita N.;
RT   ;
RL   Submitted (28-DEC-2010) to the INSDC.
RL   Contact:Director-General Department of Biotechnology National Institute of
RL   Technology and Evaluation, NITE Bioresource Information Center (NBIC),
RL   Department of Biotechnology; 2-49-10 Nishihara, Shibuya-ku, Tokyo 151-0066,
RL   Japan URL    :http://www.bio.nite.go.jp/
XX
RN   [2]
RA   Narita-Yamada S., Nakamura S., Ito N., Takarada H., Katano Y., Nakazawa H.,
RA   Hosoyama A., Yamada R., Fujita N.;
RT   "Whole genome sequence of Acidiphilium multivorum AIU301.";
RL   Unpublished.
XX
DR   MD5; ac2579c4b9f472267c7e97d5fae91c63.
DR   BioSample; SAMD00060977.
DR   EnsemblGenomes-Gn; ACMV_r0010.
DR   EnsemblGenomes-Gn; ACMV_r0020.
DR   EnsemblGenomes-Gn; ACMV_r0030.
DR   EnsemblGenomes-Gn; ACMV_r0040.
DR   EnsemblGenomes-Gn; ACMV_r0050.
DR   EnsemblGenomes-Gn; ACMV_r0060.
DR   EnsemblGenomes-Gn; ACMV_rnp0010.
DR   EnsemblGenomes-Gn; ACMV_srp0010.
DR   EnsemblGenomes-Gn; ACMV_t0010.
DR   EnsemblGenomes-Gn; ACMV_t0020.
DR   EnsemblGenomes-Gn; ACMV_t0030.
DR   EnsemblGenomes-Gn; ACMV_t0040.
DR   EnsemblGenomes-Gn; ACMV_t0050.
DR   EnsemblGenomes-Gn; ACMV_t0060.
DR   EnsemblGenomes-Gn; ACMV_t0070.
DR   EnsemblGenomes-Gn; ACMV_t0080.
DR   EnsemblGenomes-Gn; ACMV_t0090.
DR   EnsemblGenomes-Gn; ACMV_t0100.
DR   EnsemblGenomes-Gn; ACMV_t0110.
DR   EnsemblGenomes-Gn; ACMV_t0120.
DR   EnsemblGenomes-Gn; ACMV_t0130.
DR   EnsemblGenomes-Gn; ACMV_t0140.
DR   EnsemblGenomes-Gn; ACMV_t0150.
DR   EnsemblGenomes-Gn; ACMV_t0160.
DR   EnsemblGenomes-Gn; ACMV_t0170.
DR   EnsemblGenomes-Gn; ACMV_t0180.
DR   EnsemblGenomes-Gn; ACMV_t0190.
DR   EnsemblGenomes-Gn; ACMV_t0200.
DR   EnsemblGenomes-Gn; ACMV_t0210.
DR   EnsemblGenomes-Gn; ACMV_t0220.
DR   EnsemblGenomes-Gn; ACMV_t0230.
DR   EnsemblGenomes-Gn; ACMV_t0240.
DR   EnsemblGenomes-Gn; ACMV_t0250.
DR   EnsemblGenomes-Gn; ACMV_t0260.
DR   EnsemblGenomes-Gn; ACMV_t0270.
DR   EnsemblGenomes-Gn; ACMV_t0280.
DR   EnsemblGenomes-Gn; ACMV_t0290.
DR   EnsemblGenomes-Gn; ACMV_t0300.
DR   EnsemblGenomes-Gn; ACMV_t0310.
DR   EnsemblGenomes-Gn; ACMV_t0320.
DR   EnsemblGenomes-Gn; ACMV_t0330.
DR   EnsemblGenomes-Gn; ACMV_t0340.
DR   EnsemblGenomes-Gn; ACMV_t0350.
DR   EnsemblGenomes-Gn; ACMV_t0360.
DR   EnsemblGenomes-Gn; ACMV_t0370.
DR   EnsemblGenomes-Gn; ACMV_t0380.
DR   EnsemblGenomes-Gn; ACMV_t0390.
DR   EnsemblGenomes-Gn; ACMV_t0400.
DR   EnsemblGenomes-Gn; ACMV_t0410.
DR   EnsemblGenomes-Gn; ACMV_t0420.
DR   EnsemblGenomes-Gn; ACMV_t0430.
DR   EnsemblGenomes-Gn; ACMV_t0440.
DR   EnsemblGenomes-Gn; ACMV_t0450.
DR   EnsemblGenomes-Gn; ACMV_t0460.
DR   EnsemblGenomes-Gn; ACMV_t0470.
DR   EnsemblGenomes-Gn; ACMV_t0480.
DR   EnsemblGenomes-Gn; ACMV_tm0010.
DR   EnsemblGenomes-Gn; EBG00001461300.
DR   EnsemblGenomes-Gn; EBG00001461301.
DR   EnsemblGenomes-Gn; EBG00001461302.
DR   EnsemblGenomes-Gn; EBG00001461303.
DR   EnsemblGenomes-Gn; EBG00001461304.
DR   EnsemblGenomes-Gn; EBG00001461305.
DR   EnsemblGenomes-Gn; EBG00001461306.
DR   EnsemblGenomes-Gn; EBG00001461307.
DR   EnsemblGenomes-Gn; EBG00001461308.
DR   EnsemblGenomes-Gn; EBG00001461309.
DR   EnsemblGenomes-Gn; EBG00001461310.
DR   EnsemblGenomes-Gn; EBG00001461311.
DR   EnsemblGenomes-Gn; EBG00001461312.
DR   EnsemblGenomes-Gn; EBG00001461313.
DR   EnsemblGenomes-Gn; EBG00001461314.
DR   EnsemblGenomes-Gn; EBG00001461315.
DR   EnsemblGenomes-Gn; EBG00001461316.
DR   EnsemblGenomes-Gn; EBG00001461317.
DR   EnsemblGenomes-Gn; EBG00001461318.
DR   EnsemblGenomes-Gn; EBG00001461319.
DR   EnsemblGenomes-Gn; EBG00001461320.
DR   EnsemblGenomes-Gn; EBG00001461321.
DR   EnsemblGenomes-Gn; EBG00001461322.
DR   EnsemblGenomes-Gn; EBG00001461323.
DR   EnsemblGenomes-Gn; EBG00001461324.
DR   EnsemblGenomes-Gn; EBG00001461325.
DR   EnsemblGenomes-Gn; EBG00001461326.
DR   EnsemblGenomes-Gn; EBG00001461327.
DR   EnsemblGenomes-Gn; EBG00001461328.
DR   EnsemblGenomes-Gn; EBG00001461329.
DR   EnsemblGenomes-Gn; EBG00001461330.
DR   EnsemblGenomes-Gn; EBG00001461331.
DR   EnsemblGenomes-Gn; EBG00001461332.
DR   EnsemblGenomes-Gn; EBG00001461333.
DR   EnsemblGenomes-Gn; EBG00001461334.
DR   EnsemblGenomes-Gn; EBG00001461335.
DR   EnsemblGenomes-Gn; EBG00001461336.
DR   EnsemblGenomes-Gn; EBG00001461337.
DR   EnsemblGenomes-Gn; EBG00001461338.
DR   EnsemblGenomes-Gn; EBG00001461339.
DR   EnsemblGenomes-Gn; EBG00001461340.
DR   EnsemblGenomes-Gn; EBG00001461341.
DR   EnsemblGenomes-Gn; EBG00001461342.
DR   EnsemblGenomes-Gn; EBG00001461343.
DR   EnsemblGenomes-Gn; EBG00001461344.
DR   EnsemblGenomes-Gn; EBG00001461345.
DR   EnsemblGenomes-Gn; EBG00001461346.
DR   EnsemblGenomes-Gn; EBG00001461347.
DR   EnsemblGenomes-Gn; EBG00001461348.
DR   EnsemblGenomes-Gn; EBG00001461349.
DR   EnsemblGenomes-Gn; EBG00001461350.
DR   EnsemblGenomes-Gn; EBG00001461351.
DR   EnsemblGenomes-Gn; EBG00001461352.
DR   EnsemblGenomes-Gn; EBG00001461353.
DR   EnsemblGenomes-Gn; EBG00001461354.
DR   EnsemblGenomes-Gn; EBG00001461355.
DR   EnsemblGenomes-Gn; EBG00001461356.
DR   EnsemblGenomes-Gn; EBG00001461357.
DR   EnsemblGenomes-Gn; EBG00001461358.
DR   EnsemblGenomes-Gn; EBG00001461359.
DR   EnsemblGenomes-Gn; EBG00001461360.
DR   EnsemblGenomes-Tr; ACMV_r0010-1.
DR   EnsemblGenomes-Tr; ACMV_r0020-1.
DR   EnsemblGenomes-Tr; ACMV_r0030-1.
DR   EnsemblGenomes-Tr; ACMV_r0040-1.
DR   EnsemblGenomes-Tr; ACMV_r0050-1.
DR   EnsemblGenomes-Tr; ACMV_r0060-1.
DR   EnsemblGenomes-Tr; ACMV_rnp0010-1.
DR   EnsemblGenomes-Tr; ACMV_srp0010-1.
DR   EnsemblGenomes-Tr; ACMV_t0010-1.
DR   EnsemblGenomes-Tr; ACMV_t0020-1.
DR   EnsemblGenomes-Tr; ACMV_t0030-1.
DR   EnsemblGenomes-Tr; ACMV_t0040-1.
DR   EnsemblGenomes-Tr; ACMV_t0050-1.
DR   EnsemblGenomes-Tr; ACMV_t0060-1.
DR   EnsemblGenomes-Tr; ACMV_t0070-1.
DR   EnsemblGenomes-Tr; ACMV_t0080-1.
DR   EnsemblGenomes-Tr; ACMV_t0090-1.
DR   EnsemblGenomes-Tr; ACMV_t0100-1.
DR   EnsemblGenomes-Tr; ACMV_t0110-1.
DR   EnsemblGenomes-Tr; ACMV_t0120-1.
DR   EnsemblGenomes-Tr; ACMV_t0130-1.
DR   EnsemblGenomes-Tr; ACMV_t0140-1.
DR   EnsemblGenomes-Tr; ACMV_t0150-1.
DR   EnsemblGenomes-Tr; ACMV_t0160-1.
DR   EnsemblGenomes-Tr; ACMV_t0170-1.
DR   EnsemblGenomes-Tr; ACMV_t0180-1.
DR   EnsemblGenomes-Tr; ACMV_t0190-1.
DR   EnsemblGenomes-Tr; ACMV_t0200-1.
DR   EnsemblGenomes-Tr; ACMV_t0210-1.
DR   EnsemblGenomes-Tr; ACMV_t0220-1.
DR   EnsemblGenomes-Tr; ACMV_t0230-1.
DR   EnsemblGenomes-Tr; ACMV_t0240-1.
DR   EnsemblGenomes-Tr; ACMV_t0250-1.
DR   EnsemblGenomes-Tr; ACMV_t0260-1.
DR   EnsemblGenomes-Tr; ACMV_t0270-1.
DR   EnsemblGenomes-Tr; ACMV_t0280-1.
DR   EnsemblGenomes-Tr; ACMV_t0290-1.
DR   EnsemblGenomes-Tr; ACMV_t0300-1.
DR   EnsemblGenomes-Tr; ACMV_t0310-1.
DR   EnsemblGenomes-Tr; ACMV_t0320-1.
DR   EnsemblGenomes-Tr; ACMV_t0330-1.
DR   EnsemblGenomes-Tr; ACMV_t0340-1.
DR   EnsemblGenomes-Tr; ACMV_t0350-1.
DR   EnsemblGenomes-Tr; ACMV_t0360-1.
DR   EnsemblGenomes-Tr; ACMV_t0370-1.
DR   EnsemblGenomes-Tr; ACMV_t0380-1.
DR   EnsemblGenomes-Tr; ACMV_t0390-1.
DR   EnsemblGenomes-Tr; ACMV_t0400-1.
DR   EnsemblGenomes-Tr; ACMV_t0410-1.
DR   EnsemblGenomes-Tr; ACMV_t0420-1.
DR   EnsemblGenomes-Tr; ACMV_t0430-1.
DR   EnsemblGenomes-Tr; ACMV_t0440-1.
DR   EnsemblGenomes-Tr; ACMV_t0450-1.
DR   EnsemblGenomes-Tr; ACMV_t0460-1.
DR   EnsemblGenomes-Tr; ACMV_t0470-1.
DR   EnsemblGenomes-Tr; ACMV_t0480-1.
DR   EnsemblGenomes-Tr; ACMV_tm0010-1.
DR   EnsemblGenomes-Tr; EBT00001615062.
DR   EnsemblGenomes-Tr; EBT00001615063.
DR   EnsemblGenomes-Tr; EBT00001615064.
DR   EnsemblGenomes-Tr; EBT00001615065.
DR   EnsemblGenomes-Tr; EBT00001615066.
DR   EnsemblGenomes-Tr; EBT00001615067.
DR   EnsemblGenomes-Tr; EBT00001615068.
DR   EnsemblGenomes-Tr; EBT00001615069.
DR   EnsemblGenomes-Tr; EBT00001615070.
DR   EnsemblGenomes-Tr; EBT00001615071.
DR   EnsemblGenomes-Tr; EBT00001615072.
DR   EnsemblGenomes-Tr; EBT00001615073.
DR   EnsemblGenomes-Tr; EBT00001615074.
DR   EnsemblGenomes-Tr; EBT00001615075.
DR   EnsemblGenomes-Tr; EBT00001615076.
DR   EnsemblGenomes-Tr; EBT00001615077.
DR   EnsemblGenomes-Tr; EBT00001615078.
DR   EnsemblGenomes-Tr; EBT00001615079.
DR   EnsemblGenomes-Tr; EBT00001615080.
DR   EnsemblGenomes-Tr; EBT00001615081.
DR   EnsemblGenomes-Tr; EBT00001615082.
DR   EnsemblGenomes-Tr; EBT00001615083.
DR   EnsemblGenomes-Tr; EBT00001615084.
DR   EnsemblGenomes-Tr; EBT00001615085.
DR   EnsemblGenomes-Tr; EBT00001615086.
DR   EnsemblGenomes-Tr; EBT00001615087.
DR   EnsemblGenomes-Tr; EBT00001615088.
DR   EnsemblGenomes-Tr; EBT00001615089.
DR   EnsemblGenomes-Tr; EBT00001615090.
DR   EnsemblGenomes-Tr; EBT00001615091.
DR   EnsemblGenomes-Tr; EBT00001615092.
DR   EnsemblGenomes-Tr; EBT00001615093.
DR   EnsemblGenomes-Tr; EBT00001615094.
DR   EnsemblGenomes-Tr; EBT00001615095.
DR   EnsemblGenomes-Tr; EBT00001615096.
DR   EnsemblGenomes-Tr; EBT00001615097.
DR   EnsemblGenomes-Tr; EBT00001615098.
DR   EnsemblGenomes-Tr; EBT00001615099.
DR   EnsemblGenomes-Tr; EBT00001615100.
DR   EnsemblGenomes-Tr; EBT00001615101.
DR   EnsemblGenomes-Tr; EBT00001615102.
DR   EnsemblGenomes-Tr; EBT00001615103.
DR   EnsemblGenomes-Tr; EBT00001615104.
DR   EnsemblGenomes-Tr; EBT00001615105.
DR   EnsemblGenomes-Tr; EBT00001615106.
DR   EnsemblGenomes-Tr; EBT00001615107.
DR   EnsemblGenomes-Tr; EBT00001615108.
DR   EnsemblGenomes-Tr; EBT00001615109.
DR   EnsemblGenomes-Tr; EBT00001615110.
DR   EnsemblGenomes-Tr; EBT00001615111.
DR   EnsemblGenomes-Tr; EBT00001615112.
DR   EnsemblGenomes-Tr; EBT00001615113.
DR   EnsemblGenomes-Tr; EBT00001615114.
DR   EnsemblGenomes-Tr; EBT00001615115.
DR   EnsemblGenomes-Tr; EBT00001615116.
DR   EnsemblGenomes-Tr; EBT00001615117.
DR   EnsemblGenomes-Tr; EBT00001615118.
DR   EnsemblGenomes-Tr; EBT00001615119.
DR   EnsemblGenomes-Tr; EBT00001615120.
DR   EnsemblGenomes-Tr; EBT00001615121.
DR   EnsemblGenomes-Tr; EBT00001615122.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01760; traJ-II.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AP012035.
DR   SILVA-SSU; AP012035.
DR   StrainInfo; 491854; 1.
XX
CC   ##Genome-Assembly-Data-START##
CC   Genome Coverage       :: 8x
CC   Sequencing Technology :: ABI3730
CC   ##Genome-Assembly-Data-END##
CC   Please visit our web site.
CC   URL:http://www.bio.nite.go.jp/
CC   DOGAN ; Database of Genomes Analyzed at NITE
CC   The database contains genome sequence data, physical maps
CC   and the genomic and proteomic data of the microorganisms
CC   analyzed.
CC   URL:http://www.bio.nite.go.jp/dogan/Top
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3749411
FT                   /organism="Acidiphilium multivorum AIU301"
FT                   /strain="AIU301"
FT                   /mol_type="genomic DNA"
FT                   /note="strain coidentity: NBRC 100883"
FT                   /db_xref="taxon:926570"
FT   CDS             237..1709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="ACMV_00010"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79348"
FT                   /db_xref="GOA:F0J0G4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0G4"
FT                   /protein_id="BAJ79348.1"
FT                   /translation="MAGRGAVRLDTQTWQEQGLETRSPGRTRGEISQDELAHQWSRVRG
FT                   RLQEEIGEVEYRNWLRQAVLHGLDGDEVTVMLPTRFLRDWVNKEYGNLLTAFWQAENPA
FT                   VRRVDIRTRPAGTSERAPDLAEVEPKTAIARPAAAARREAEERPDMSAPLDPRFTFDTF
FT                   VVGKPNEFAYACARRVADGHASPGFNPLFLYGGVGLGKTHLMHAIAWELSQRSDEVTVA
FT                   YMSAEKFMHKFVSALRRQSTIEFKNELRSVDVLMVDDLQFLIGKDGTQEEFFHTFNALV
FT                   DSGKQIIVSADKSPSDLSGIEDRLRTRLGCGMVADVHATTYELRLAILEAKAARAGVVV
FT                   PGRVMEFLAQKITANVRELEGALNRLIAHANLFERPVTLETAHEVLHDLLRAYDRKITI
FT                   EEIQKQVAEHYNIRVSEMSSARRARNIARPRQIAMYLAKQLTSRSLPEIGRKFGNRDHT
FT                   TVMHAVSKVTELIEADPDFAEDVELLRRILTV"
FT   CDS             complement(1737..2588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00020"
FT                   /product="carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79349"
FT                   /db_xref="GOA:F0J0G5"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0G5"
FT                   /protein_id="BAJ79349.1"
FT                   /translation="MTSATVLETVSTQKCFGGMQGVYRHEAKETGCTMRFAVFLPPQAA
FT                   AGTVPALYYLAGLTCTEENFTVKAGAQRVAAELGIALIAPDTSPRGLGYPGEDDAYDFG
FT                   TGAGFYVDATETPWRDGYRMYSYITKELPALINASFPVDPARVGIFGHSMGGHGALTIA
FT                   LKNPGAYRSVSAFAPIVSPMRCPWGEKALTGYLGVDRANWRAYDATALIEDRGWDGPAI
FT                   LVDQGTADPFLERELKPELLREACAAKGVKLDLRMQEGYDHSYFFIATFVEDHLRHHAR
FT                   HL"
FT   CDS             2902..3105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00030"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79350"
FT                   /db_xref="GOA:F0J0G6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0G6"
FT                   /protein_id="BAJ79350.1"
FT                   /translation="MAIGTVKWFNTTKGFGFIVPQDGGKDVFVHITAVQAAGMRGLNEG
FT                   QKISYEVTQERGKAAATNLKAV"
FT   CDS             3768..4202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00040"
FT                   /product="MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79351"
FT                   /db_xref="GOA:F0J0G7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0G7"
FT                   /protein_id="BAJ79351.1"
FT                   /translation="MAALHERHQREDEAAGQHGNALYSVSQLARQLGVTARTIRFYEDK
FT                   GLVNPSRAGTTRVYTSRDRARLMLILRGKRLGFSLREIKDYLDLYDVDPTQHTQLRQLL
FT                   AGVRKRIAKLQEQRAALEQSLAELADIERQSENALKQAAK"
FT   CDS             4227..5363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00050"
FT                   /product="putative acetyl-CoA acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79352"
FT                   /db_xref="GOA:F0J0G8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0G8"
FT                   /protein_id="BAJ79352.1"
FT                   /translation="MPSAVIAAYARSPFALARKGGLSRVRPDEMAAAVVRELVNRSGIA
FT                   AGDVEDLIVGCAFPEAEQGLNVARLIGLMADLPISVAGATVNRFCGSSMYSIHMAAGAI
FT                   AMGAGEAFIAAGVESMTRVPMSGFNPMPSPTLFAKMPAAYMGMGETAENVAKRWQIPRE
FT                   AQEEFALASHIKAAAAQKAGKLAGEIVPISLSGAMVSEDGCIRHDASREALAGLKPAFD
FT                   AEGTVTAGTSSPLTDGASAVLVCSEDYAAKHGLAPLARIRSVAVAGCAPDIMGMGPVAA
FT                   SRKALARAGIEASTLDVVELNEAFASQALACIGELGLDPARVNLDGGAIALGHPLGATG
FT                   ARITGKAAQLLRREGGKFALATQCIGGGQGIATVLEAL"
FT   CDS             5363..7723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00060"
FT                   /product="putative 3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79353"
FT                   /db_xref="GOA:F0J0G9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0G9"
FT                   /protein_id="BAJ79353.1"
FT                   /translation="MGAIQSVAVIGAGVMGAAIAAQIANAGIKVRLLDIVPKEGDDRNA
FT                   IARRAIERLKKTQPAPLMSSRAARLIAPGNTEDDFAALADCDWIVEAVIERLDIKQALY
FT                   RRLAEVRKPGSVVSSNTSTIPLAELMTDMPESLRPDFVITHFFNPPRYMRLLELVTGPA
FT                   TSADAIARITEFCDVTLGKSVIPCRDTPGFIANRIGTYWIQTALVLALEMGIEIEEADA
FT                   IMGKPMGFPSTGVFGLMDLVGIDLGPHVNASLARLLPKTDAFHMMNREAPFLATMIAEG
FT                   YTGKKGKGGFYRSAGRGRDRVKETLSLAAAAQGRLEWRPSIRPDIAEVKDAKKDLKRLV
FT                   GAKSKYGRYAWGVLGRVLAYAASLIPEIGDDIAAVDAAMRLGYTWKYGPFELIDRLGAD
FT                   WVSSHLADLDEPIPPLLAKLGKGAFYREDGATLLRFMPDGGYRAVERAPGVLLLEDAKR
FT                   GRKPVLSNKSASVWDIGDGVLCVEFHSIMNSIDGDILALLGKAIALVQKSYKAMVIYSE
FT                   NLRAGPGKENFSVGANLGLAMFAANLRMWGKIEGTVKEGQKALQALREAPFPVVGAPAG
FT                   RALGGGCEILLHCDAVQAHAETYMGLVEVGVGLVPGWGGCATMLARWQGAKDAPRGPMP
FT                   AVSKVFEMISTAKVATSAAEAKELKFLRPGDGITMNRERVLADAKARALAMVAGYAPAE
FT                   PETLQLPGASGRVALGMAVDEFRKKGVATPHDVTVSSHLARVLTGGDTDMTDPVPVAAV
FT                   KDLEREAFMALFRTKESQARIKHILDTGKPLRN"
FT   CDS             7746..9536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00070"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00070"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79354"
FT                   /db_xref="GOA:F0J0H0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0H0"
FT                   /protein_id="BAJ79354.1"
FT                   /translation="MPVYKAPLKDMRFVLHELYDSTAIAELPGNADFTPELIDSVLEEA
FT                   AKISEEVLFPLNQVGDREGCTYENGVVRTPTGYREAYRTFCEGGWTSISADPDYGGQGM
FT                   PLTAAMMVEEMFCSANVAFGLYPGLSHGAYVALKHSGSEEQKKAWLPNIVSGKWTGTMC
FT                   LTEPHCGTDLGMLRTKAVPNDDGTYSITGNKIFISAGEHDLAENIVHLVLARLPDAPAG
FT                   VKGISMFLVPKFLPREDGTLGPRNGMQCTAIEHKMGLNGSATCAMSFDGATGWLVGEPN
FT                   KGLAAMFKMMNTERLSVGIQGLGIAEVAYQNAVAYARERIQGRSLTGTKAPEKQADPIL
FT                   VHPDVRRMLLTSRAYIEGCRALAGWVARELEILEKSDDGDAKQAADDFASLMTPVVKAM
FT                   FTDLGFEIASLAVQTYGGHGYIRDHGIEQYVRDARIAMLYEGTNGIQALDLVGRKLPQD
FT                   GGRLLTRFLDPVLEFIDAHQDNDALAEFLPALSQALEHVQEATGLIMEGAMTNRDEVGA
FT                   ASVDYLRLFGLASLAFVWARMVAVAAPKAGEDGEAAQFYRAKVQTAKFFMERLLPQTGA
FT                   LLAAIRSGAATMMEFEDAAF"
FT   CDS             complement(9556..10122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00080"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79355"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0H1"
FT                   /protein_id="BAJ79355.1"
FT                   /translation="MMPMKRPVSFALALMALAGTARASGFSLRSGAFRDGGTIAAAQVF
FT                   NRFGCTGDDVSPALAWSGAPAGTRSYAVTLFDSDARQGKGYWHWIVADIPARVTSLPAG
FT                   SGSRGGALPRGAVQGIGSGNIHGYQGPCPPVGDPPHHYHLTVYALRVNRLPAAALASYG
FT                   ALRRALARDALASATITGLYGRPAR"
FT   CDS             complement(10125..10838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00090"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00090"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79356"
FT                   /db_xref="GOA:F0J0H2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0H2"
FT                   /protein_id="BAJ79356.1"
FT                   /translation="MLLLLACPFAGLFIMTDWRKFALSSADGRSVAISLAYGLAALAVI
FT                   AVLGTPLAYWLATGKGRMRDGAQVFLLLPLLTPPLALGILLAAFYGPIGPVGILLERFG
FT                   GIITNNPPALLIAGIYAGLPTYVVAARGAFAEIPAELAESALTLGVSRRQIFRHITLPM
FT                   ARDGLGAALALAWVRGVGELGIVLIFAYFPQGMPVRLWVDLEDGGLSATFPLLWLFLLA
FT                   ALPLPLWLLRRGSKR"
FT   CDS             complement(10874..11788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00100"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79357"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0H3"
FT                   /protein_id="BAJ79357.1"
FT                   /translation="MAISRRAFTRLAGAAALAPVTGRAAGRAATIAYAGSMGLLMDRAL
FT                   GPAFTAETSERFHGIGRGAFGLAHLIAAKTLQADAFISITSGPIEVLQKAGLVGHAVPV
FT                   ASTAMVLAWSPHSRFRKDFEAADAGAHWFDILEKPGLRFGRTDPRTDPQGRNVLFTFDL
FT                   AQRYYHKPDLIRRVLGRPVNPAQIFPEPSLLSRIDSGAVDATIGYESGVKSLKLPFLAL
FT                   PRQINLSDPAMVADWYSRAAISLTVKGRRQTLHTQPLVFYACVPRNARNPEAGRAFVSL
FT                   LQSRKGQELFARYGYNPPLGGPV"
FT   CDS             11903..12280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00110"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79358"
FT                   /db_xref="GOA:F0J0H4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0H4"
FT                   /protein_id="BAJ79358.1"
FT                   /translation="MQMHGKTEPLTLRIRVVQGEDLLLGPGRADLLAFIRETGSIAAAG
FT                   RRMGMSYKRAWQLAESMNSTFHAPLILAAKGGVAGGGAQLTELGDAVLAAYRALEAASR
FT                   AGGAAALAILAEARAPLSQDR"
FT   CDS             12360..12881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00120"
FT                   /product="TspO/MBR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00120"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79359"
FT                   /db_xref="GOA:F0J0H5"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0H5"
FT                   /protein_id="BAJ79359.1"
FT                   /translation="MRVFRLPERPEQHRTSGAQILALLGFLALALLVGAVGGTATVPNV
FT                   HSWYDVLPHPPGTPPDWVFGPVWTLLYIAMAVAAWLIWRGPDILTRQRRALRLWGWQLA
FT                   ANALWSPVFFALHRPDISFFVILVLDGLIVMTIAVFRPVSRIAAALMVPYLAWCLYATY
FT                   LNAGFWFLNR"
FT   CDS             12925..13539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00130"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79360"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0H6"
FT                   /protein_id="BAJ79360.1"
FT                   /translation="MTYRSQLHLAALAVLMAGLGFAAPAKAQMAGGGLAGGLGPIGGVP
FT                   QPRHESQSIAPPALPGASAAGNVSAGPVTDTGGDPTTLLFKAINHGDYAQARAAVSRGA
FT                   NLDARNALGETPIELSVELNRNRITFMLLSARAEEHPMSVSVASAPVAAVPPTTSKGSA
FT                   HAKSPPFHKVEAKPAVRPLTISGDPGRPDPSAGFLGFGGSN"
FT   CDS             13684..14235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00140"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79361"
FT                   /db_xref="GOA:F0J0H7"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0H7"
FT                   /protein_id="BAJ79361.1"
FT                   /translation="MNTFNPAPLGLFGFALTTWLLSMINAGLLPGAGLGMVLAMAFAFG
FT                   GSAQFVAGLGEMKVGNTFGFVAFCSYGAFWWSFALFVEIFAKGVPGVMVGWYLLVWGAF
FT                   SFVMFIGTFALNKALQLIFGFLTATFILLALNDLLGAAALGEFGGYLGLVTAVLAFYLG
FT                   AAGIINGAHGKEILPIGAKA"
FT   CDS             14489..14716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00150"
FT                   /product="Sec-independent protein translocase protein
FT                   TatA/E"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00150"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79362"
FT                   /db_xref="GOA:F0J0H8"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0H8"
FT                   /protein_id="BAJ79362.1"
FT                   /translation="MGGLSIWHWLIVLAVVLLLFGTGRVGNLMGELGKGMKAFKNNIAD
FT                   DQPAKDASMLEQQTRAPEANAGQKAGQGKV"
FT   CDS             14727..14984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00160"
FT                   /product="Sec-independent protein translocase protein
FT                   TatA/E"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00160"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79363"
FT                   /db_xref="GOA:F0J0H9"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0H9"
FT                   /protein_id="BAJ79363.1"
FT                   /translation="MGFDSPVHWLIVIAVIALLFGGSRVGNLMGELGKGIKAFKQNMSD
FT                   ADSAKPAPAAKSEPDVQNRIADSSAPAAEKAPEPADTARH"
FT   CDS             15001..15642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnB"
FT                   /locus_tag="ACMV_00170"
FT                   /product="methylthioribulose-1-phosphate dehydratase"
FT                   /EC_number="4.2.1.109"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00170"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79364"
FT                   /db_xref="GOA:F0J0I0"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR017714"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0I0"
FT                   /protein_id="BAJ79364.1"
FT                   /translation="MTVTLAAGPAEAGDVLASRARELVAIGARMDARGWVPASAGNLSA
FT                   RCTADSIAITRSGVHKGRLEAADIIEVRLDGTPLRAGDRPSAETLLHCQVYERLPAVGA
FT                   VLHGHSVAATALTLADNSPGIVLEGYEILKAFPGIATHETRIVLPVFDNDQDMRRLAAA
FT                   IAPAFAAPPIGYVLRGHGIYAWGEDVERCFWRLEALEFLLSCECERRRMR"
FT   CDS             15639..16181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnD"
FT                   /locus_tag="ACMV_00180"
FT                   /product="acireductone dioxygenase"
FT                   /EC_number="1.13.11.53"
FT                   /EC_number="1.13.11.54"
FT                   /note="protein synonym:1,2-dihydroxy-3-keto-5-
FT                   methylthiopentene dioxygenas"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00180"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79365"
FT                   /db_xref="GOA:F0J0I1"
FT                   /db_xref="InterPro:IPR004313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR023956"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0I1"
FT                   /protein_id="BAJ79365.1"
FT                   /translation="MSTLRIFDDANPDAPLVATSDAARMAAELKSIGVRFERWESPVAI
FT                   AADASPEEILEAYRPYLDRLMGETGAGSADVIKMTPDHPQAGTLREKFLNEHIHTEDEV
FT                   RFFVRGSGHFVMHLDGKVYDAYCTEGDLISVPANTRHWFDAGSTPDFIALRIFTDTSGW
FT                   VAHFTGDQISARFPVAA"
FT   CDS             16198..16896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnC"
FT                   /locus_tag="ACMV_00190"
FT                   /product="enolase-phosphatase E1"
FT                   /EC_number="3.1.3.77"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00190"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79366"
FT                   /db_xref="GOA:F0J0I2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023943"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0I2"
FT                   /protein_id="BAJ79366.1"
FT                   /translation="MTTRPELVLLDIEGTIAPISFVHDVLFPYARARLAGFVAAHGDEP
FT                   EIAAALAELDAIAPGAPPVETMLALMDRDAKVGPLKLIQGRIWAEGFAEGALTSRLYPD
FT                   VAPVLRAWHGSGLRLAIYSSGSEEAQRLLLGHTPDGGLTALFERFFDTRMGGKRDAASY
FT                   AAIARSMAVAPAHVLFLSDVADELAAAATAGIQVCQIVRPEDGTIASADYPTAPDLAAV
FT                   AAAFDRPDPA"
FT   CDS             16908..18437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="ACMV_00200"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00200"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79367"
FT                   /db_xref="GOA:F0J0I3"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0I3"
FT                   /protein_id="BAJ79367.1"
FT                   /translation="MSPIDQLAARVPRRLRGEAWQCFALGLLAAVALPPFYLLPVLWFV
FT                   VPALLTRLARAGGWRRAAWLGWCFGFGFNLLGLFWVTEPMLIMASNFWWAVPFAAPALA
FT                   FATAFYMILPALAVFAVPQRNQAGRLAAVLLFAGALVLSNLAQEFLFTGFPWNYWGADW
FT                   AFAGRLGLAMIQPAAIGGIFLLTLLTALAAGLPLLGRRGWAASAVLLALWAGFGFARTS
FT                   AGPAPLTRYTVALLQPDFAVPGSFTQPALQARWRRDLALTREALDKAGKGPNIVVWPET
FT                   ASPALLQTDAAARAAIAAVAGNTPVLAGSFRLAADGSMRNSLVAVEGKGPAVAWYDKWK
FT                   LVPFGEYTPAWIPLKVTPGGGFTPGPGPRTLHVPGIPSVGPLICYESIFPGIITDPKDR
FT                   PAWLLNISDNAWFGDTTGPYQDFATTRLRAVEEGLPIVVDTNSGISAVIGPHGRVAGTL
FT                   GLDRAGILIGKLPVALPVTPFGRFSVTMSGILGFYTMVLGVVCLIVSITLM"
FT   CDS             18742..19227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00210"
FT                   /product="Xre family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00210"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79368"
FT                   /db_xref="GOA:F0J0I4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0I4"
FT                   /protein_id="BAJ79368.1"
FT                   /translation="MNANGGASNDRSDRDGRPSPIDVHVGSRIRLRRTLLGMSQEKLGD
FT                   ALGLTFQQVQKYERGVNRVGASRLFDISRVLDVPISFFFDDMPEGMNEMPMSGPRGRSN
FT                   GLSEAQEPFGVGLDDHMTKRETLELVRAYYRITEPTVRKRMFDLIKSLAPADSFPTE"
FT   CDS             19301..19963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="ACMV_00220"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00220"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79369"
FT                   /db_xref="GOA:F0J0I5"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0I5"
FT                   /protein_id="BAJ79369.1"
FT                   /translation="MSRPSPIIAPSLLAADFGRLREEVAAVERAGAHWLHLDVMDGHFV
FT                   PNISFGALVLNALRPHTRLAFDVHLMIAPADPYLADFAKAGADQITVHAEAGPHLHRSL
FT                   QTIRALGLKAGVAINPATPAEAVRHVLDLIDIINVMTVNPGFGGQSFLAGQLPKIAELR
FT                   RMVTEAGRDIRIETDGGIDAASAPRALEAGADVLIAGSAIFGKPDYAAAIAALGTGD"
FT   CDS             19974..21551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00230"
FT                   /product="heparinase II/III family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00230"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79370"
FT                   /db_xref="GOA:F0J0I6"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0I6"
FT                   /protein_id="BAJ79370.1"
FT                   /translation="MMRGARQWVARLAALRGGNVPDAPSVALRDPWPGEPARGARIIKG
FT                   EIEYQNVVRPLRPGLFHENDGSPVFIAHIQGFVWLRDLRALGTDAARSRARALIADWID
FT                   CEALPPVASAPEVSGARIAAWLGHYDFFAASADDDFRQMLMARLVADARMLSANLPAEV
FT                   RDGRAFTAIKGLIAAAVALPEHGAFMQRALRFLVPEIERQILPDGAHVERSPAAHFAVL
FT                   QDLTEIRALLQLARAEVPPQLPGAIERMAVGLRALRHGDGGLALFNGTSEDWPNLIDLV
FT                   LSQAGRTGRSASALAGVGFHRLAAGRSLVLVDAGPPSGPGIDRFAHAGTLSFEFSVGRD
FT                   RLIVNCGAAPAASGEWRDALRNTAAHSTLVVADVSSSELRDEGLGRRPAHVEVQRQEAN
FT                   GAHWLEASHDGWQKLFGAVHRRRLYLAESGEDLRGEDSIEADQPQPFTLRFHLHPNVTA
FT                   SIQQDGEGALLRLSSGQGWRLRAGGATLSIEDSIYFGGPEPRRAEQIVLTGTPDGPQQV
FT                   KWALTRMG"
FT   CDS             21556..22554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="ACMV_00240"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00240"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79371"
FT                   /db_xref="GOA:F0J0I7"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0I7"
FT                   /protein_id="BAJ79371.1"
FT                   /translation="MARIMLTGGAGFIGSHTAVVLLERGYDIVLLDDFSNAARDVPDRL
FT                   RQITGIAMPVIEADIRDPEAMRAAFAAFPVDAVVHFAAKKAVGESEADPLLYFDVNILG
FT                   TIRLLAAMRDAGVGRLVFSSSATVYGEPDTCPISETASLRVTNVYGRTKMVMEGMIEDL
FT                   SRTGVLAASAILRYFNPVGAHPSGLIGENPRGVPANLMPYLCQVAAGQRPYLTVFGNDY
FT                   PTHDGTGVRDFIHVMDLAEAHAAAVDRILAQDGGFTVNLGTGTGYSVLDLVHAFKAATG
FT                   IDVPYQVGPRRPGDVAACYADPGLAASLLGWRASRGVQDMCRDAWRWQSRH"
FT   CDS             22562..23686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00250"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00250"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79372"
FT                   /db_xref="GOA:F0J0Z0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0Z0"
FT                   /protein_id="BAJ79372.1"
FT                   /translation="MSRHVVFLIGEDWFFASHFRVRALAARAAGWRVTILTRTGRAADA
FT                   LRAEGFEVIDVDFRRARLNPLAEFRLLRSIAGHYRALKPDLAHHVALKPILLGSLAAAL
FT                   ARVPAVINAPVGQGFVFTSATLKARLLRPAVSLGLRLAVGARGALAVFENHDDLTAMTA
FT                   SGAIPSERAYLIRGAGVDLVLYCPHTPPAGKVRIVLGARMLADKGVREFIEAARLLRLR
FT                   GVVAECLLAGGPDPQNPASLEAAELQRATEATWLGPVTDMASLLASCHIACLPSYREGL
FT                   PKFLLEAMASGLPCVATDVVGCREAVADSESGVLVPPRDPAALADALERLVADPELRAR
FT                   MGAAGRARAETLFADEVVCAATLAVYERAIRHDV"
FT   CDS             23698..24165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00260"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79373"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0Z1"
FT                   /protein_id="BAJ79373.1"
FT                   /translation="MIRRLALLGIMAGAWAFAVATAQAETRIGAVSTNFRLLGANDKVV
FT                   VERLDDPKIPDIACYASFAKTGGVKGSLGVATDPSRFALSCIATGPVTLPAGLPAKQQI
FT                   AAISASFLVKHFNLYRLVDPDRKAVVYLLISTKIIHGSPANAVSAVPVSGH"
FT   CDS             24181..25722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="ACMV_00270"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="bifunctional protein"
FT                   /note="protein synonym:bifunctional purine biosynthesis
FT                   protein PurH"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00270"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79374"
FT                   /db_xref="GOA:F0J0Z2"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0Z2"
FT                   /protein_id="BAJ79374.1"
FT                   /translation="MNDRVNIRRALISVSDKAGLVELGRALAAAGVEILSTGGSARALR
FT                   EAGIAVVEVADYTGVPEMLDGRVKTLVPKIHGGLLGRRDLPEHLAQMQRHDIPPIDLLA
FT                   VNLYPFEETVAKGSDFETCVENIDIGGPALIRAAAKNHDSVAVLTSPAQYDDLIAALAA
FT                   GGTTLEQRRRLAAAAYARTAAYDAAISAWFAQQTGEMFPAHLALAGARQQMLRYGENPH
FT                   QSAAFYRTGNRPGVATARQLQGKELSYNNINDTDAAFECVAEFDRPAVVIVKHANPCGV
FT                   ALGADLAEAWDRALDCDPVSAFGGIIAVNRPLDVAAAEKMASIFSEVIIAPDAAPDAVE
FT                   LLARKKNLRLLLTGGLPDPAEPGLAWRSVAGGFLAQTRDAGRIGRDDLKVVTQRAPTNA
FT                   EFADLLFAFRVAKHVKSNAIIYAKAGATTGIGAGQMSRVDSSRIAAQKGGEKIPGSVVA
FT                   SDAFFPFADGLVAAIEAGATAVIQPGGSIRDNEVIEAADAAGIAMVFTGMRHFRH"
FT   CDS             25728..26285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00280"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79375"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0Z3"
FT                   /protein_id="BAJ79375.1"
FT                   /translation="MTHTPRLGLPDPARMSEAQRAAHDAIASGPRGRVEGPLAVWLHSA
FT                   ELANNAQALGAFCRFGSSLPPRLSELAILVLGSYWRAGFEWYIHAPIAAKAGVPEAVIA
FT                   AIKAGETPVFAEPDARAVHDFARELLTAHEVSDETYAFARRQLGDRALVDLVGILGYYG
FT                   LISMTIKAFRVPVPDGETEPFA"
FT   CDS             complement(26325..28286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="ACMV_00290"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79376"
FT                   /db_xref="GOA:F0J0Z4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0Z4"
FT                   /protein_id="BAJ79376.1"
FT                   /translation="MTDLFEQAAGQASYSAKDIEVLEGLEPVRRRPGMYIGGTDDAAMH
FT                   HLAAELLDNAMDEAVAGHASIIEMTLAPGNLLTVRDNGRGIPVDPHPKFRDKSALEVIL
FT                   TTLHSGGKFAGKAYATSGGLHGVGSSVVNALAERLEVEVAREKTLWKQDYARGKPLTKL
FT                   VNAGATPNRRGTLIRFVPDPEIFGDKKFSPARLYRMCRSKAYLFRGVRIRWACDAALIA
FT                   AGADVPAQAELHFPGGLADSLAEELGAAPKLVAPVWAGQADLPDDAGRIEWACAWLETG
FT                   EATLSTYCNTIPTTLGGTHEAGFRAALLKGLRGFGEQRGNKRAAVITAEDATGALAAKL
FT                   SLFIRDPQFQGQTKEKLTSPEAQKLTEAALRDRFEHFLTGDPANADNLLAFVIERAEER
FT                   IRRREQKDTPRKSATRRLRLPGKLTDCSRESREDTEIFLVEGDSAGGSAKQARNRETQA
FT                   VLPLRGKILNVASASTEKLRQNQELKDLIEALGCGVGDRFQIDALRYGRIIIMTDADVD
FT                   GAHIASLLMTFFYRELPELIRGGHVYLAQPPLYRLTQGGKSVYAMDDGERDRLVKTAFK
FT                   ANAKVEISRFKGLGEMPPAILKETTMDPKRRVLLRVLAPPEARAETAEIVESLMGRKPE
FT                   LRFRFIQDHASSVQELDV"
FT   CDS             complement(28312..28950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="ACMV_00300"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00300"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79377"
FT                   /db_xref="GOA:F0J0Z5"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0Z5"
FT                   /protein_id="BAJ79377.1"
FT                   /translation="MTRPIVIAIDGPAASGKGTLARRLAAAFNLPYLDTGLLYRAVARR
FT                   VLDRGGDPADPAASEEQARSLSRLDLERGDLRTPEVDRAASAVASIKPVRAALLDFQRR
FT                   FADASGAVLDGRDIGTIVFPEADVKLFVTASLDVRAKRRHLERLAHGIDPGFDSVRAEL
FT                   AARDEADRTRAAAPLVQAKDALLLDTSHMDANHAFTAAADLVNKVLARG"
FT   CDS             complement(28947..30284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="ACMV_00310"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="protein synonym:5-enolpyruvylshikimate-3-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00310"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79378"
FT                   /db_xref="GOA:F0J0Z6"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0Z6"
FT                   /protein_id="BAJ79378.1"
FT                   /translation="MEHAATLPQTSRRPATPLTGTITVPGDKSISHRALMFAGLAVGET
FT                   RISGLLEGEDVLRTAAAMRALGATVERTGPGAWRASGPGIGGLQSPDDVLDMGNSGTAA
FT                   RLLCGILASHDIFAVMTGDASLRRRPMRRVIDPLGATGAVFAAREGGRLPLSVRGAAEA
FT                   MPLSYRLPVASAQVKSALLLAGLNARGITEIEEPEPTRDHSENMLRYFGAEVEVATHGT
FT                   GKLIRLRGQPELRGADVVVPGDPSSAAFPIVAALIVPGSRVTIGGVGLNPLRTGLFLTL
FT                   REMGAAIEIVNAREAGGEPVGDLIVTASDLRAVDVPAERAPSMIDEYPILAVACAMARG
FT                   SSRLRGLAELRVKESDRLAATLAMITANGVKAQVDGDDLIIEGGGARGGATVATHMDHR
FT                   LAMSALVMGLATETPVTIDDARFIDTSFPGFLPLMRGIGAAIEAAA"
FT   CDS             30423..30746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00320"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79379"
FT                   /db_xref="InterPro:IPR012644"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0Z7"
FT                   /protein_id="BAJ79379.1"
FT                   /translation="MAKPELGDKHTCVSCGARFFDLGKVPAVCPKCGTEQPAEQPKLKR
FT                   SVPMPDDAKKPAKAQTTEDDVDTDDVEDTGDDDILTDADDLEDDDAIDADIEVERDSDE
FT                   NER"
FT   CDS             30859..31050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00330"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79380"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0Z8"
FT                   /protein_id="BAJ79380.1"
FT                   /translation="MTQFAPAKTADHHEPIVSPLILVDRLISLAQDAERAGLPAVANRL
FT                   VRLALRSCVPPAGGTHRH"
FT   CDS             31136..32365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00340"
FT                   /product="putative CoA-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00340"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79381"
FT                   /db_xref="GOA:F0J0Z9"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:F0J0Z9"
FT                   /protein_id="BAJ79381.1"
FT                   /translation="MSEQPSAGIASPSGPLAGLTVFDLTRVLAGPTCVQMLADLGAEVI
FT                   KIEKPGSGDDTRGFAPPALPGTEQSAYFAGANRNKRSVTLDIAKPEGQKLARALIAKSD
FT                   ILVENFKVGTLPRYGLGYNDLRADNPGLIYCSITGFGQTGPYASRPGYDSLIQAMGGIM
FT                   SLTGVPDGQPMKVGVPVADLFAGLYGAIGVLAALRHREITGQGQHIDIGMLDTHVAWLA
FT                   NQGMNYLASGKNPPRLGNEHPNIVPYQVFATEDGHIVLSIGNDPTFARFCNAFGLEHLL
FT                   ADERFATNAARVANRAFVTDTLAAVLARHPSAWWLERLEELKIGCGPINTLEQVFADPH
FT                   VIARGNLIEMTRSDGVPVKLVANPVRLSETPVDYRLAPPMLGEHTDEVLTNMLGLDEPA
FT                   RAALRRDGII"
FT   CDS             32380..33219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00350"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79382"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:F0J100"
FT                   /protein_id="BAJ79382.1"
FT                   /translation="MARQGFVPYLLGNDFHRLAFVEFGNPAAPAVLCVHGLTRNGRDFD
FT                   ILADSLADRYHVICPDLPGRGRSEWLRDGALYQPPSYVIALAHLLAWLNKPVAWVGTSL
FT                   GGICGMMVAAAAHTPITRLVLNDIGPHIPAAALGRIRDYMGEAPAAFPDLAALEAHLRT
FT                   VHAPFGPLTDPQWAALALHSARPVEGGGLALHYDPAIAEPIRASVPMDADLGAIWTAIR
FT                   VPVLALRGATSDLLTEATLARMEEDGAATHTVPACGHAPALMDGPTIAVIRRFLDGA"
FT   CDS             33219..34070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00360"
FT                   /product="putative ribonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00360"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79383"
FT                   /db_xref="GOA:F0J101"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:F0J101"
FT                   /protein_id="BAJ79383.1"
FT                   /translation="MRWRTRLDLWFRALRAAAIEVMSGEMSLVAAGCAFYATLALFPAM
FT                   TALISLYGLAFNPVTVEPQLLYLKHLMPPAAFALIGGRIQQLVSGGKTTLGIGLVISLG
FT                   FTLYSSASGIKSLIYALNVIHKRQETRGFFEFQAVTLAMTLIAMLGAVIAIAVLVGMPL
FT                   VLAFLGLAKAPAVLTVLPGFALLIGSMGLALGLLYRFGPAFGRDAGHPVVPGALVAILV
FT                   WLVVSYGFAVYVGQFAAYSRTYGPLATIIGLMMWFYLSAYAVLFGALFNATLDRASVAF
FT                   RP"
FT   CDS             34256..36493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="ACMV_00370"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.-.-"
FT                   /note="protein synonym:RNase R"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00370"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79384"
FT                   /db_xref="GOA:F0J102"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:F0J102"
FT                   /protein_id="BAJ79384.1"
FT                   /translation="MTRKPVRRSAELPTEAVLREFIAEAGTRLRKGDIARAFGLGPDQK
FT                   PALRAMLRNLERDGMLVRAGGRQVRAAEALPERCVVEITGTDRDGDPLARPVGWDRQGK
FT                   PPIIFMLPEKRGHAALAPGARVLARLRRIDDDRYEGRTVRRLDEEPASIIGVFRAEGEG
FT                   GWIEPVDRKSRAEWKVPPGETAGAESGDVVRAMPLPAFGYGPKPARIAEHLGRMGDARS
FT                   ISLIAIAALGIPADFPETAIDEAKRARGVRPGRRTDLREVPLVTIDGADARDFDDAVFA
FT                   EPAGPGHRIVVAIADVAHYVRPGSALDREALKRGNSVYFPDRVVPMLPEALSNGWCSLR
FT                   PGEDRGCLFVEMIVDAEGRKLSHKFGRGLMRSFARLTYEEVQGAFESGWEADLPDGTIG
FT                   HLYAAYRTLLAARQARGTLDLDLPERKITLDEAGRVTDVAPRPRLDSHRLIEEFMILAN
FT                   VAAAEELERLRQPCMYRVHAPPSPEKLDSLRNLLATLEISLKPGDQLHPRDLDHVLRLV
FT                   AGSDAAPLVNEAVLRSQSQAEYAPENIGHFGLALNSYAHFTSPIRRYADLLVHRALIAG
FT                   LKLGTDGLRPEHADGFETIAAAITSTERRATDAERQSADRYLAAYLADRIGEDFSARVS
FT                   GVTRFGLFVTLDATGASGFVPMALLPDDFWHFDEADGTLSGTRSRVVFRLADPVLVRLR
FT                   EAKPLTGGLLFSLIEGGSAPGEGGGQHRRLPARKGGRKPGRAPARHKRSRR"
FT   CDS             36502..38094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00380"
FT                   /product="putative peptidase S41"
FT                   /EC_number="3.4.21.102"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00380"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79385"
FT                   /db_xref="GOA:F0J103"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:F0J103"
FT                   /protein_id="BAJ79385.1"
FT                   /translation="MARSLARRSRAHRARRPALVRPIRRIVTVLCVMLPICGAQAGQRG
FT                   FDSTHAAAVWGAALAFMAPRTLQPLGIPRMAVWGLSGITALDSDLTVQEQSGKLLLFGP
FT                   NRVIFATLAPPVGDAAKWGVACAAVAAHAFAASPTIERAGTGGMIRSFFDELFNHFDPY
FT                   SRYVAPREAATERALRLGLGGIGMTLARHDRIVTITGVTPSSPADRAGIAPGMQLLAID
FT                   GRDAAAQPVAQLQQELAGPIGSMIDLTIRPGHSLPQTITLARALVPTQSVTGQIDDGIA
FT                   HIRVLGFDHGTARQFAAVLAQLVQAQPAPKGIVIDLRGNRGGVLRQSVLSLDTLLSQGT
FT                   IIHTIGRDPAANKVWHAEGADIAHGLPVVVLVDGGTASAAEVFSAAIADNDRGVVLGSA
FT                   TLGKGLVQSVTELPGGGELFVTWSRMIAPRGWPLQSLGVFPQVCTSLGTDQLAKQINAL
FT                   RHGVDLLAKPLAETRAARAPMPLAEVLALREACPAAIGGNGYERAAAALIDHPAAYRAA
FT                   LIRPLLPHARAGG"
FT   CDS             38140..38307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="ACMV_00390"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00390"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79386"
FT                   /db_xref="GOA:F0J104"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="UniProtKB/TrEMBL:F0J104"
FT                   /protein_id="BAJ79386.1"
FT                   /translation="MAKTNTVQIKLVSTADTGFFYVTKKNAKAQTGKLEFRKYDPVARK
FT                   HVTFKEAKIK"
FT   CDS             complement(38471..39610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="ACMV_00400"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00400"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79387"
FT                   /db_xref="GOA:F0J105"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:F0J105"
FT                   /protein_id="BAJ79387.1"
FT                   /translation="MTLVYVVAGEASGDVLGARLIAAMRARAGGIEVAGIGGARMAEQG
FT                   VASLFPMQELALMGLAEVLPKLFRLRRRLEQTEADIAARRPDIVVTIDSPGFTLRLLRR
FT                   IVPLGLRRVHYVAPQVWAWRQGRVKHFPGLWDRLLCLLPFEPDFFAPHGLNPVFVGHPV
FT                   LESGADAGDPARFRARFGLAESARSLILMPGSRRTETARLMPVFGATVERLRPRFPDLV
FT                   PVLAAAPALAGELQAQAAAWPRPPLIVTNVAERYDAFAGAEAALTKSGTSTLELALAGV
FT                   PMAVTYRVNPISAMLARRLIKVPHVAMINLLAGQELVPELLQDACTPERLSAEIASLLG
FT                   DPERAAAQRAGFSAALSTLAIAGSASPSEAAATAVLDLL"
FT   CDS             complement(39607..40482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00410"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00410"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79388"
FT                   /db_xref="GOA:F0J106"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniProtKB/TrEMBL:F0J106"
FT                   /protein_id="BAJ79388.1"
FT                   /translation="MIMRVALSPFLIHRPTGLDDFLDRVDRLADEAKSGGADLLVLPEY
FT                   ASMALAGAFVAAPDVAAELDAVVSRADTLVEGFRAIARTHRLLLLPGSVPMRGADGNIR
FT                   NRAPLIDGDGRIAFQDKRVMTRFESERWGITPGGPPSVFETDFGRLGIAICYDSEFPLL
FT                   VRAQALAGADTILIPACTDSLHGFNRVRLSARARALENQCFTAVAPTTGMAPWSAAVDE
FT                   NRGYACVFGPVDRGFPEDGLLARGALDAADLLFATLDPARLAATRDDPAVRNRTDWPDD
FT                   PAPARIVRLT"
FT   CDS             complement(40479..41000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00420"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00420"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79389"
FT                   /db_xref="GOA:F0J107"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:F0J107"
FT                   /protein_id="BAJ79389.1"
FT                   /translation="MFRAWPYLYEGNEAYERDYVATYAASERAAIVIARDGDAIVGAST
FT                   CLPLTDEDEAMQAPFRAAGIDPASVFYFGESVLLPAYRGRGVGVAFFREREAHARAVSD
FT                   AAQAAFCAVIRDNADPRRPTDATTLDVFWRKRGYAPVSGLVCRMRWREIGAAHEVENRL
FT                   QVWMKPLGGA"
FT   CDS             complement(41089..42816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhB"
FT                   /locus_tag="ACMV_00430"
FT                   /product="gluconate 2-dehydrogenase"
FT                   /EC_number="1.1.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00430"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79390"
FT                   /db_xref="GOA:F0J108"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="UniProtKB/TrEMBL:F0J108"
FT                   /protein_id="BAJ79390.1"
FT                   /translation="MPHSKKTIFRRAPLWAATLLIALTSGAVGIEAAFGQEAGGYMPTP
FT                   TAAKPEAFPALPEPVTKGMSQAEIAQVRRGEYLTAAADCMPCHTAPGAKPFSGGLSFVT
FT                   PFGTLYSPNITPAKTTGIGKWTPRQFYNALHYGVSPGSSLGVFPKYLYPAMPYTSYAKL
FT                   TRPDVMAIKAYLDAIPAVHAPHAPNRLGFPFNIRAMLLGWRIMFFSTAPVHYKKDWSPA
FT                   VRNGAYLAEALGHCSECHSPRNLLFAIKSGDTLAGAQILGEPWYAPNISSSKTYGVGGW
FT                   SRKDLVDYLHEGGNMNRGSAFGPMQSVVDYSLSQLPRQDVDDLAAYLQTATPPRENPVK
FT                   KVALAPGELAQGKALYDDNCAACHQADGKGVKDVFPNLAGNDAVTNGPSDNVIGIVLGG
FT                   MIPWHANGPAMPAFGSMLNDAQIAAIANYVRTAWGNKGVTDADAAKVLGIRASTPPHDI
FT                   ALADADYLDLPPIASAAARRMNCPLLTKDLVSPGHGTMEIMQGVTPATLGNRTRMLVAA
FT                   IRKAYPDITQKRMAEFLTAAYCPVVAQERGLSLGEKKKAIQRFLSEAASMDTAARKGS"
FT   tRNA            42985..43060
FT                   /locus_tag="ACMV_t0010"
FT                   /product="tRNA-Lys"
FT   CDS             43270..44481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00440"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00440"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79391"
FT                   /db_xref="GOA:F0J109"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="UniProtKB/TrEMBL:F0J109"
FT                   /protein_id="BAJ79391.1"
FT                   /translation="MASIRLTDTAIRKAIQEACDAGTRIELTDITTPGLRIRVNRDGGA
FT                   AWSVMTRDQTGRNRRFSLGEFPTVGISQAREQAGITKHKVRHDGVDPVAEKRAARQQAE
FT                   AEKNAEPEMTLIDLVRLWGQQTGSDKRRAWIDRHRRISDVFKTLADRPAKGLTSEQIQI
FT                   VADGWPSPSSAAAAVRYLRPILKWGAKRKYVSAEAALIEPTRKPEKRGRYLSKPELAAV
FT                   VPYLRQNAERSTRAAVMLLLLYTATRLNEAVQAVWAEFDLEADQPTWTIPGERIKNTRP
FT                   GKQKSDHVIPLPRQTAEFLRSIRKGRTTGFVFAGPKGGLPSKWDWFSKKVMAETGTSGW
FT                   TRHDLRRTAATWMGELGIPPHVTEAVLNHADIHSNLSGVYNKSRYSTQAKLALEVWSDF
FT                   LDGV"
FT   CDS             45134..45925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00450"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79392"
FT                   /db_xref="InterPro:IPR014988"
FT                   /db_xref="UniProtKB/TrEMBL:F0J110"
FT                   /protein_id="BAJ79392.1"
FT                   /translation="MDWPAANHITEVCPDGATGRLFTYDAVVGLAQPESRWFADAFHGF
FT                   LQIVDEDGFPCLFAKKSLKDKSPLFLFCEPCVGEEGMELHAGLLRYTRFVRDTVVVKRL
FT                   YTPLIVFFHQAYTAMAVSPHSAAWQALQWAHDRDSDPWPWDVPLDPEDPNWSYCFGGVQ
FT                   LFINISCATHSIIKSRNLGRYLTLIINPRQNFDVVANGETRSGRLIREKIRQRSGVYNG
FT                   GYIPPELGSYGDPNKKEWRQYQLSEPGHNAPEACPFKVKTG"
FT   CDS             45927..46574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00460"
FT                   /product="putative lysine exporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00460"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79393"
FT                   /db_xref="GOA:F0J111"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:F0J111"
FT                   /protein_id="BAJ79393.1"
FT                   /translation="MNIHLGVLSVYIVTVITMIAVPGPVVILVTGAGLSGGWARAFRTI
FT                   IGTNAASLVMIALSALIIKGIFDVNQTIFDILKLFGAIYIGYVGLSIIREAYHSDLVDM
FT                   AFSKKLGGIRRGFSLAISNPKDIIFFSSFFPQFIDVTSNKNASLGILTVVWILLDFTTL
FT                   MTVYFTISRVARPSSNAVMLKIAGSLLVLIAIIGATVSIAALLGDASLSSRL"
FT   CDS             complement(46576..47943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00470"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00470"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79394"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:F0J112"
FT                   /protein_id="BAJ79394.1"
FT                   /translation="MPPKLNASQDDLELFRSRLENIIDQRHPLTRLARLIDWRVFEERF
FT                   GALYAEAAGRPALPTRLMVALHLLKHMDGLSDEAICARYLDSPYVQAFCGETHFQHTLP
FT                   LDRSSMTRWRKRIGAERMEALLAETLAAAERGGAVAEKHYERVTIDTTVQPKAVTHPTD
FT                   SKLLHSGIETLARMARKHGITLRQSYRRVARYARQEAARLHHGGKRREAEARVRKLRTW
FT                   LGRLARDITRKIAGNAEAKATFAETLGLINRLLRQKRSDRGADKLYSLHAPEVECIGKG
FT                   KARTRFEFGVKISIATTNGAAPGGQFVLGMQSQSGNPYDGHTLAGQIEQVERITGVAVA
FT                   RAYVDRGYRGHGVEAEGRRIFISRQKRGITSTIRRELRRRTAIEPVIGHMKTDGHLGRN
FT                   FLLGVDGDAINAVLAGAGHNLRLLRRWLIRLLCALLAWLSAPNRSPSLGFAHRQIS"
FT   CDS             complement(48162..49205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00480"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00480"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79395"
FT                   /db_xref="GOA:F0J113"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:F0J113"
FT                   /protein_id="BAJ79395.1"
FT                   /translation="MAYFSTAAYKLKRRFHLERVVLVGDRGMITTARIRETIKPAGLDW
FT                   ISCLRAGQIQDLAEGPLQMSLFDERDIAAITSPDYPGERLIACRNAALATERRRKREAL
FT                   LAATETELARIRDATRRKRAPLHGEAAIGLAVGAVINQRKMAKHFDLTITASRFDFQRN
FT                   AASIAREAALDGIYVIRTSVSADVMSETEAVSAYKDLSRVERAFRTLKSVDLAIRPVHH
FT                   WLSPRVRAHVFLCMMAYYVEWHLRDALKPLLFQDHDRPGAEAERSSPVAPASTSPAADR
FT                   KRGRRRNDQNLPISSFTDLMAHLATQTLNTAALPKAPNATFTTLANPTPLQAAAFDLIG
FT                   IAPMRVQ"
FT   repeat_region   49178..51750
FT                   /note="Belongs to IS21 family"
FT   repeat_region   49178..49203
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 26 bp inverted repeat"
FT   CDS             49297..50796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00490"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00490"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79396"
FT                   /db_xref="GOA:F0J114"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:F0J114"
FT                   /protein_id="BAJ79396.1"
FT                   /translation="MYSVEVYAAVRQFVFVEGRSRREAARVFGLNRETVAKICRFSVPP
FT                   GYRRERPAAKPKLGPFIPVIDAILEADRGAPVKQRHTARRIFERLRDEHGYTGGYTVVK
FT                   DYVRPARLRLREAFVPLSHPPGHAQVDFGQCIGFIGGVRTVMHVFCMDLPHSDAPFVKA
FT                   YPAETTEAFLDGHVSAFAFFGGVPLSILYDNTKLAVARILGDGQRTRTRAFTELISHYL
FT                   FRDRFGRPGKGNDKGKVEGLVKYTQRRFMTPLPHAVSFDALNAALEARCLARQDEHAGR
FT                   HEETIGERLLRDLAALRVLPAGPFEPCEKKPARVSSTALVRYRMNDYSVPASYAFRDVL
FT                   VKGFVDRVLVVAGAEVIARHERVYGRGEFIFDPLHYLALIEQKPGALDQAAPLQNWALP
FT                   EGFQRIRRLLEARMGNRGKREFIQILRLMEVFPETVVSTAVNDAMRLGAIGFDAVKQLV
FT                   LARVEQRPAQLDLTRYPYLPAAHVRMTSAADYGVLLSRDAA"
FT   CDS             50793..51620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00500"
FT                   /product="putative transposase-associated ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00500"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79397"
FT                   /db_xref="GOA:F0J115"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:F0J115"
FT                   /protein_id="BAJ79397.1"
FT                   /translation="MSGAIETPQVLLAHHLKALKLPTFLREYAKVAAECAKDRADHPKF
FT                   LLRLAELELLDRERRLVERRIRAAHFPAVKSLDTFDFTAIPSLNKMLVLDLARCDYINA
FT                   HDNIIALGNSGTGKTHVALALGLAACQRGLSVGFMTAAGLVHQLMEARDERRLLRLQAQ
FT                   LASLKLLIIDELGYVPLSQTGAELLFEVFSQRHERGSTIVTSNLPFEDWTSVFGAERLT
FT                   GALLDRLTHHVQILEMNGESYRLKQSRARRRKGIEKAGDDLPHDPETGEINDS"
FT   CDS             complement(51684..52058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00510"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00510"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79398"
FT                   /db_xref="UniProtKB/TrEMBL:F0J116"
FT                   /protein_id="BAJ79398.1"
FT                   /translation="MFIDVVPNGRSAPAVLLRESFREGRKVHKRTIANLSQMPPELIDG
FT                   LRALLAGGAVVGGADQALEIRRSLPHGHVAAALGMMRKLELPRLLGRRASRERNLALAV
FT                   NGGSKPGRRGGVKAGHWIVT"
FT   repeat_region   51725..51750
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 26 bp inverted repeat"
FT   CDS             complement(52332..53372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00520"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00520"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79399"
FT                   /db_xref="GOA:F0IY11"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:F0IY11"
FT                   /protein_id="BAJ79399.1"
FT                   /translation="MDIMILGIDLGKNSCSVVGMDAAGRVVLRRRLRRGTLESFVGELG
FT                   SCIVAMEACCGAHHLGRIFAARGHEVRLMSPEYVRPYVKAQKNDDLDAEAIAEAATRPT
FT                   MRFVPVKSQDQSDLQALHRARERLVSERTALINHLRALLLERGIVVPQGRRKLEAELET
FT                   LAEDGGFAALSPRIRTLIEDLRAEWRSLDQRITGFDAEFVQLARDDVAVRRLTKIPGIG
FT                   TINATALAAAVGEAHAFKRGRDMAAWLGLVPRQMTTGGKPRLLGISKRGNRYLRKNLIH
FT                   GARAALPYLVERDTPLGRWARGLLDRAHKNVVVVALAAKLARIAWAVLAHGCDYDAQFE
FT                   AAAAAA"
FT   CDS             54084..56573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00530"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79400"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:F0J118"
FT                   /protein_id="BAJ79400.1"
FT                   /translation="MVKSQSRSRGGSFWRRATLASTALPLIILAAPAVFAATPASESLP
FT                   SNFITNNTNTKYSVTAASGQATGTINFGNSSRTRNIVAQFGGGTIPGSNAVNANDGSAL
FT                   PTGVTQNTGFSLGPNSTLNLTNAGSGAVLINDVSGAPSQIFGAINDTSAGPLFIANGNG
FT                   VVVGATGAITMPAGEAVGLVGLTPTTSNLTAFEGASSPSGSITIGGSNNAGSGAVTLDS
FT                   AAKIAATGGLIVAGNGAINIGAGPEDGGSIFIASGAAVSVNPYSGIISPPPTLEVSTAS
FT                   VNLTGGTKSAPLVVAGLYAAGNVTNSGYVALNSGAEKVGGTFTNTSTGVVDVAGEPSSS
FT                   LAAGAVNNAGSINGSTNLTVTGIYGVTNTGAISSTAGITLKSSDGNIVNTGALNLGAGG
FT                   QDLNLTASTGSIYFGGSVTQGGKALGSTNAVNTLRIAASTNTDGDSTTIDNGGVIDYAN
FT                   TVYANTANVTADAVRFLSGALVSSTNGAVNVKVGMAATSTNAITDPFFGNAKLNYNLSV
FT                   FPSALIKGNQVQLDGGPYGVSSNSGNMNIDGVVSSQIGSGGYIDVSASTVNASATGGFA
FT                   LNNDGALDLSFAGNVNNPNGAKRAGSSAWQDNYVPVAVANTADGKTGTATIFLAPSSNA
FT                   PSSNAASPQLVNLLVNGNAILKTCASPSALNGLSTSTTINPESSYVNNHLVVQSTGNIQ
FT                   VGTNSGSTPSTFYWPGLVYLSNVASASNPTQLSTTGSISLGSNAASPVNLVNVLPAVVS
FT                   GNGGIFLETSNLNLNGGQIWTNTNSWINFSNATVSANVQKNDGNSIFGAVEKTLSGSTI
FT                   TTGLGLQVLPTADYSPQ"
FT   CDS             56838..58181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00540"
FT                   /product="putative major facilitator superfamily
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00540"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79401"
FT                   /db_xref="GOA:F0J119"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:F0J119"
FT                   /protein_id="BAJ79401.1"
FT                   /translation="MLNEPQSRSSVLVVPFPPRSAALGASLLLFLAYILAFADRTVVAL
FT                   LVVPIERDLGLTNLQMGLLQGTAFALFYALFGLPIAWAVDQYSRRFIAFIGVMTWSVMT
FT                   GMAGLSRSFLPFFLARIGVGAGEATILPSATSLLADYLPPLWRGRALGLFGSGIYIGSG
FT                   LAYILGGQILNALNGRSIVVPGLGSLVPWQTVLLSLAALGMPVTLAMTLMREPIRRHLI
FT                   VKKASQGISFSACLAQAKSALISHMVGFTALGFAGVAATVWLPTILVREHEWSPAHVGT
FT                   VLGLLTIVIGPLGSCIAGVIADRLEDRGIRDGKLLVAGVGSLVAIPAAYLLGACRDPLC
FT                   ILAAAGALLFSSSLLWGLAPAALQEIVHGSALGRVVAIYTAILNLVGFGLGPPAVAVIA
FT                   KFCFQGNLGEAVDAVVPVATILALMAFVTGRPGYRAARERLDRGWDGS"
FT   CDS             58629..59009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00550"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79402"
FT                   /db_xref="UniProtKB/TrEMBL:F0J120"
FT                   /protein_id="BAJ79402.1"
FT                   /translation="MPLIETMTISNPPNNWVRLQARIYQLDSFKFGAYFHSRGYDKGLL
FT                   EVRKVQQELAPEISQLIRDQRLMFTTRLVVNSLADWQRGVLPLQSGVGVDDLQVFAGNL
FT                   IDCTQAIIGAESVPFKLPDSTI"
FT   CDS             complement(59035..59883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00560"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79403"
FT                   /db_xref="GOA:F0J121"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:F0J121"
FT                   /protein_id="BAJ79403.1"
FT                   /translation="MIAALIISGLALAPKHHIKSGILLGLASINPAFSICVPSALIGAR
FT                   VAVVLGISIAISVDIMSLAAYLEPNVFFNWLHQLIHRSTATAIENTTYHSVDTIWVSFQ
FT                   HHIAGLQSGSEGTALIITSVGAFLLVATAFRRSTKRSDRALAIFVAMAMTPVLTPFMPA
FT                   INFVAPIQITALALLYLYPGWKVAAVQMKRLFFLILAILVLPGFLLLFSSPLVSQAVIL
FT                   ASCSIVGIFAALGIQRNPLAGLTDVYDEENIGDGSTPISLDDVINRENVKQEWMRARYW
FT                   R"
FT   CDS             61310..62446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00570"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79404"
FT                   /db_xref="GOA:F0J122"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:F0J122"
FT                   /protein_id="BAJ79404.1"
FT                   /translation="MTRHANRHHFTADMVAGRDFGVLWSGGRTAIAGLFRHASIVTLFS
FT                   PSRFGNVVKADWPILHGQRLWSYPPTMMPVMMVFGGLPLIGAAALYVGVGIMVMSLAVA
FT                   AAMDIRRDLACLIVLMAPGTWDCILAGQDSLIIGALVIAGIMRARRYPVLAGMLLGLAT
FT                   AKPQLGMSTPAALIGQKAWKAIFVAIVSVGVMAVLTSLLWPGAWGLWLSHVVPVQMARM
FT                   DRPYIPTPSQAYSGSLYEFMRAEGLGEAASSFVSAIASGLAMFGVAVVFRRASHDRERR
FT                   VALLASLALLPVASPWLMDYDFAAIQPIAIALIFQGRDIWEFGPSKYLLIIAILASLVL
FT                   PEFGFILSLRTGVAPIAPLVISMLGLAAIVASWQWRQE"
FT   CDS             complement(62499..64322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00580"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79405"
FT                   /db_xref="GOA:F0J123"
FT                   /db_xref="UniProtKB/TrEMBL:F0J123"
FT                   /protein_id="BAJ79405.1"
FT                   /translation="MMVNRVQDHRSRYMPAPPPSRVIYLWLFCAAGVLSVLASFRTIWP
FT                   VLHGNLVDPDSFMRLLRIQQGLRTGHLVNIVNRDDSGSPLILEWSRLFDAAIVALAAPL
FT                   VPLIGWRHALFVSGVATGPISTGLLGASLGFAAAPVTQRRFIWAAAVIAPIVPGIRNFS
FT                   AFGVIHYHIAQAAAVAITSGCALRSCSGHRVWAAMTGITGGMAIWLMPETMPWVLLAQA
FT                   GLGWYWLFRPPVPPLLINGAAFFATLAAALAVDPPHGGYLTPEIDRLSIVYVGLGLAIL
FT                   LVTFSLARLDKVDLPTKSRNLIGIFVATCIFLAWLAIFPHVALGPFGLMSASEMHIFFG
FT                   SISETQPARTASQVVGLLGPGILACTFAITQILYYRRRLLPVGAWSLFMIGTVLATGLT
FT                   ARFLIFQQYPSAFLCGILPIMLDRITTRLGSREHYAAAGRVGLVAVIVLGPIIADAAPK
FT                   MLWNHAKIDHHRPTCSMRHIAHLLAPAADQIVLTRPGEVPELLYRTQIIGVGSLYQHGV
FT                   RAFLRDWAAWRANADHKSEPAAVRASGARYVLFCPAGKSYPIAQKSGPEALWTMLSQNR
FT                   TPPWLKKIGQQKSSGFRLYQIVTDGRAQIAK"
FT   repeat_region   64574..67885
FT                   /note="Belongs to IS110 family"
FT   repeat_region   64574..64591
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 18 bp inverted repeat"
FT   CDS             64763..65803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00590"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00590"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79406"
FT                   /db_xref="GOA:F0IY11"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:F0IY11"
FT                   /protein_id="BAJ79406.1"
FT                   /translation="MDIMILGIDLGKNSCSVVGMDAAGRVVLRRRLRRGTLESFVGELG
FT                   SCIVAMEACCGAHHLGRIFAARGHEVRLMSPEYVRPYVKAQKNDDLDAEAIAEAATRPT
FT                   MRFVPVKSQDQSDLQALHRARERLVSERTALINHLRALLLERGIVVPQGRRKLEAELET
FT                   LAEDGGFAALSPRIRTLIEDLRAEWRSLDQRITGFDAEFVQLARDDVAVRRLTKIPGIG
FT                   TINATALAAAVGEAHAFKRGRDMAAWLGLVPRQMTTGGKPRLLGISKRGNRYLRKNLIH
FT                   GARAALPYLVERDTPLGRWARGLLDRAHKNVVVVALAAKLARIAWAVLAHGCDYDAQFE
FT                   AAAAAA"
FT   CDS             66077..67810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00600"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00600"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79407"
FT                   /db_xref="GOA:F0J125"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:F0J125"
FT                   /protein_id="BAJ79407.1"
FT                   /translation="MFIDVVPNGRSAPAVLLRESFREGRKVHKRTIANLSQMPPELIDG
FT                   LRALLAGGAVVGGADQALEIRRSLPHGHVAAALGMMRKLELPRLLGRRASRERNLALAL
FT                   IAGRVIAPGSKLSTLRGLTPQTATSSLGEILELGAIEEREIYAALDWLGAQQGRIERQF
FT                   ARRHLRDGTLVLYDVSSSYLEGRHCELAHHGYSRDHRPDRPQIVYGLLCDREGRPIAVE
FT                   VFEGNTADPATIAAQVEKLKRRFHLERVVLVGDRGMITTARIRETIKPAGLDWISCLRA
FT                   GQIQDLAEGPLQMSLFDERDIAAITSPDYPGERLIACRNAALATERRRKREALLAATET
FT                   ELARIRDATRRKRAPLHGEAAIGLAVGAVINQRKMAKHFDLTITASRFDFQRNAASIAR
FT                   EAALDGIYVIRTSVSADVMSETEAVSAYKDLSRVERAFRTLKSVDLAIRPVHHWLSPRV
FT                   RAHVFLCMMAYYVEWHLRDALKPLLFQDHDRPGAEAERSSPVAPASTSPAADRKRGRRR
FT                   NDQNLPISSFTDLMAHLATQTLNTAALPKAPNATFTTLANPTPLQAAAFDLIGIAPMRV
FT                   Q"
FT   repeat_region   67868..67885
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 18 bp inverted repeat"
FT   CDS             67927..68268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00610"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00610"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79408"
FT                   /db_xref="GOA:F0J126"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:F0J126"
FT                   /protein_id="BAJ79408.1"
FT                   /translation="MADQLRGKWPKLGAFIDDSETDVLAHMDFPAQHRTKIHSTNPLER
FT                   LNKEVKRRADVVGIFPNEGSIIRLIGAVLLEANDEWQTQNRYMQIEGMVELMAPAIDAD
FT                   TPRISTVAA"
FT   CDS             complement(68317..69753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00620"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00620"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79409"
FT                   /db_xref="GOA:F0J127"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:F0J127"
FT                   /protein_id="BAJ79409.1"
FT                   /translation="MFIDVVPNGRSAPAVLLRESFREGRKVHKRTIANLSQMPPELIDG
FT                   LRALLAGGAVVGGADQALEIRRSLPHGHVAAALGMMRKLELPRLLGRRASRERNLALAL
FT                   IAGRVIAPGSKLSTLRGLTPQTATSSLGEILELGAIEEREIYAALDWLGAQQGRIERQF
FT                   ARRHLRDGTLVLYDVSSSYLEGRHCELAHHGYSRDHRPDRPQIVYGLLCDREGRPIAVE
FT                   VFEGNTADPATIAAQVEKLKRRFHLERVVLVGDRGMITTARIRETIKPAGLDWISCLRA
FT                   GQIQDLAEGPLQMSLFDERDIAAITSPDYPGERLIACRNAALATERRRKREALLAATET
FT                   ELARIRDATRRKRAPLHGEAAIGLAVGAVINQRKMAKHFDLTITASRFDFQRNAASIAR
FT                   EAALDGIYVIRTSVSADVMSETEAVSAYKDLSRVERAFRTLKSVDLAIRPVHHWLSPRV
FT                   RAHVFLCMMAYYVEWHLRDG"
FT   CDS             70055..70390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00630"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79410"
FT                   /db_xref="GOA:F0J128"
FT                   /db_xref="InterPro:IPR002622"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J128"
FT                   /protein_id="BAJ79410.1"
FT                   /translation="MVKVLSLDLRERVVAAIDGGMSRRQAAERFGVGIATAVRWAQLAR
FT                   EKGSPAPMKVGGDRRSERIESPVKMRTLLILPRCFSGGQYWDLQGLGDLRGKTLQNRWS
FT                   VARWSRS"
FT   repeat_region   70471..70476
FT                   /rpt_type=FLANKING
FT   repeat_region   70477..73049
FT                   /note="Belongs to IS21 family"
FT   repeat_region   70477..70502
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 26 bp inverted repeat"
FT   CDS             70596..72095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00640"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00640"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79411"
FT                   /db_xref="GOA:F0J114"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:F0J114"
FT                   /protein_id="BAJ79411.1"
FT                   /translation="MYSVEVYAAVRQFVFVEGRSRREAARVFGLNRETVAKICRFSVPP
FT                   GYRRERPAAKPKLGPFIPVIDAILEADRGAPVKQRHTARRIFERLRDEHGYTGGYTVVK
FT                   DYVRPARLRLREAFVPLSHPPGHAQVDFGQCIGFIGGVRTVMHVFCMDLPHSDAPFVKA
FT                   YPAETTEAFLDGHVSAFAFFGGVPLSILYDNTKLAVARILGDGQRTRTRAFTELISHYL
FT                   FRDRFGRPGKGNDKGKVEGLVKYTQRRFMTPLPHAVSFDALNAALEARCLARQDEHAGR
FT                   HEETIGERLLRDLAALRVLPAGPFEPCEKKPARVSSTALVRYRMNDYSVPASYAFRDVL
FT                   VKGFVDRVLVVAGAEVIARHERVYGRGEFIFDPLHYLALIEQKPGALDQAAPLQNWALP
FT                   EGFQRIRRLLEARMGNRGKREFIQILRLMEVFPETVVSTAVNDAMRLGAIGFDAVKQLV
FT                   LARVEQRPAQLDLTRYPYLPAAHVRMTSAADYGVLLSRDAA"
FT   CDS             72092..72919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00650"
FT                   /product="putative transposase-associated ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00650"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79412"
FT                   /db_xref="GOA:F0J115"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:F0J115"
FT                   /protein_id="BAJ79412.1"
FT                   /translation="MSGAIETPQVLLAHHLKALKLPTFLREYAKVAAECAKDRADHPKF
FT                   LLRLAELELLDRERRLVERRIRAAHFPAVKSLDTFDFTAIPSLNKMLVLDLARCDYINA
FT                   HDNIIALGNSGTGKTHVALALGLAACQRGLSVGFMTAAGLVHQLMEARDERRLLRLQAQ
FT                   LASLKLLIIDELGYVPLSQTGAELLFEVFSQRHERGSTIVTSNLPFEDWTSVFGAERLT
FT                   GALLDRLTHHVQILEMNGESYRLKQSRARRRKGIEKAGDDLPHDPETGEINDS"
FT   repeat_region   73024..73049
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 26 bp inverted repeat"
FT   repeat_region   73050..73055
FT                   /rpt_type=FLANKING
FT   CDS             73105..73674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00660"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00660"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79413"
FT                   /db_xref="GOA:F0J131"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="UniProtKB/TrEMBL:F0J131"
FT                   /protein_id="BAJ79413.1"
FT                   /translation="MRLARLIDWRVFEERFGSLYAEAAGRPALPTRLMVALHLLKHMDG
FT                   LSDEAICARYLDSPYVQAFCGETHFQHTLPLDRSSMTRWRKRIGPERMEALLAETLAAA
FT                   ERGGAVAEKHYKRVTIDTTVQPKAVTHPTDSKLLHSGIETLARMARRHGITLRQAGGGA
FT                   PAPWWQTPRGRGSRAQAANLAGPAGS"
FT   CDS             73634..74356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00670"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00670"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79414"
FT                   /db_xref="UniProtKB/TrEMBL:F0J132"
FT                   /protein_id="BAJ79414.1"
FT                   /translation="MRKLRTWLGRLARDITRKIAGNAEAKATFAETLGLINRLLRQKRS
FT                   DRGADKLYSLHAPEVECIGKGKARTRFEFGVKVSIATTNAAAPGGQFVLGMQSRPGNPY
FT                   DGHTLAGQIEQVERITGVAVARAYVDRGYRGHGVEADGRRIFISRQKRGITPTIRRELR
FT                   RRTAIEPVIGHMKTNGHLGRNFLLGVDGDAINAVLAGAGHNLRLLRRWLIRLLCALLAW
FT                   LSAPNRSPSLGFAHRQIS"
FT   tRNA            complement(74481..74555)
FT                   /locus_tag="ACMV_t0020"
FT                   /product="tRNA-Thr"
FT   CDS             complement(74602..75828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="ACMV_00680"
FT                   /product="5-aminolevulinate synthase"
FT                   /EC_number="2.3.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00680"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79415"
FT                   /db_xref="GOA:F0J133"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:F0J133"
FT                   /protein_id="BAJ79415.1"
FT                   /translation="MNRDHPFIAQCDKALADIRAAGRYRRFVALEKLADRFPYYKVTME
FT                   GRTQDILVWSSNDYLAMGTDPEVIEASIEAARTMGAGAGGTRNIAGSSPIHVALEAELA
FT                   ALHGKDAALLFTSGYVSNQATLTAILNSMPGWHVFSDAQNHNSMIVGIKGGKAATVHVF
FT                   AHNDLADLEARLAAAPADAPKMIAFESVYSMDGDIAPIGAICDLADKYNAITYLDEVHA
FT                   VGMYGPHGAGVSERDGVAHRLTIIEGTLAKAYGCHGGYIAGDASVIDYIRSVAAGFIFT
FT                   TALPPPTVAAALASIRRLKVDQARRDTLFERANLLKSKFDQAGLPRLPTESHIVPLMIG
FT                   NATRATEVSMRLIREFGMYATPINYPTVPAGTERLRFTPGPKHTEAMMDQLVAALRHIL
FT                   SGETGTVAA"
FT   CDS             complement(75968..76948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyX"
FT                   /locus_tag="ACMV_00690"
FT                   /product="flavin-dependent thymidylate synthase"
FT                   /EC_number="2.1.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00690"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79416"
FT                   /db_xref="GOA:F0J134"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="UniProtKB/TrEMBL:F0J134"
FT                   /protein_id="BAJ79416.1"
FT                   /translation="MAPDGHRTIAQPGTAVMPLSDSDRTEIEAARAETTPTRRATVPTL
FT                   EAMLFSAIPVLDHGFVRVVDYMGDDAAVVQAARVSYGRGTRKVSEDEGLIRYLMRHRHS
FT                   TPFEMCEIKLHVKLPIFVARQWIRHRTANVNEYSARYSVMDREFYIPSPANLAAQSASN
FT                   RQGRGDLLEGDEASEVLAMLRADAERNYNHYERMLNEGGADPSRRGLARELARMNLTLN
FT                   TYTQWYWKTDLHNLFHFLSLRADPHAQYEIRAYAEAILDIARAWVPASCRAFEDYRMGA
FT                   ATFSATMLAALRRMLAGEPVDQAQSGLSKREWAEMMAALTPPTPG"
FT   tmRNA           76987..77347
FT                   /locus_tag="ACMV_tm0010"
FT                   /product="transfer-messenger RNA"
FT                   /note="Predicted by ARAGORN"
FT   CDS             complement(77599..78039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00700"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79417"
FT                   /db_xref="GOA:F0J135"
FT                   /db_xref="UniProtKB/TrEMBL:F0J135"
FT                   /protein_id="BAJ79417.1"
FT                   /translation="MTLSGFTTISVLLAVHLGGFAMWSGLLLGLLLAGPGPGAVAIRRQ
FT                   LDAAVPFMAVTLATGWALAFAEQGPPEHWNWTVNAMQALGIVMAAVLLVARFGALFLWE
FT                   ETDSGPDEEAKAAAYRRLARLFAADLAISGVILAVAVAGRYG"
FT   CDS             complement(78036..78665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00710"
FT                   /product="putative partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00710"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79418"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J136"
FT                   /protein_id="BAJ79418.1"
FT                   /translation="MAQVIAVAQQKGGAGKTMLATQLGVALGMTRRVGLLDIDPQGSLG
FT                   AWARLRAANAKARADLAVESVSGWRLANTLDAMRRDCDLLVIDTPPVLDSDARRAIRGA
FT                   DLVLVPLNPSPPDLWAAEGTLTLAAEERRPVALVFNRAPAASKLRRRLEAEIAARRLRL
FT                   IDEALGNRAAYANSFAEGLGVAETGPSTLAGTEIAALATRLASILE"
FT   CDS             78755..80125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00720"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79419"
FT                   /db_xref="GOA:F0J137"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="UniProtKB/TrEMBL:F0J137"
FT                   /protein_id="BAJ79419.1"
FT                   /translation="MGLIDTAALSCGVSGLMLMENAGTAVARAIVRRFRPCRVLVLAGP
FT                   GNNGGDGYVAARRLAERGWPVAVAPLAPPRPASDAAAAAALWRGPVVAADEGRVQSAEL
FT                   VIDAVFGAGLARDVDPGTVALLGAARRLVAIDVPSGVDGATGAVRGAAPRADLTVTFAG
FT                   LKPGHLLFPGRALCGETVCAEIGMPAAAFARVETKTWRNTPVLWRLPAPAATGHKYERG
FT                   HLTILAGPMSGAAILAAAAARRIGAGLVTLAGPDPAGVPPGIIVSRAALDELVTDPRRR
FT                   VWLCGPGLGVEAAGQTLARLVAAGRAIVADADALTSAAGEAERLRGVAAITPHEGEFAR
FT                   VFPDLQADRLSRARAAAARIGAVVVLKGPDTVIAAPDGRAAINANAPPFLATAGSGDTL
FT                   AGIAAGLLVQGMPAFEACCAAVWLHGAAATRAGGGLIAEDLADHLPMVVENIKKFNF"
FT   CDS             80715..81815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="ACMV_00730"
FT                   /product="aminomethyltransferase"
FT                   /EC_number="2.1.2.10"
FT                   /note="protein synonym:glycine cleavage system T protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00730"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79420"
FT                   /db_xref="GOA:F0J138"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:F0J138"
FT                   /protein_id="BAJ79420.1"
FT                   /translation="MAESALLTVPLDALHRSLGARMVDFAGYDMPVQYEGIIAEHLHCR
FT                   AQAALFDVSHMGQAVLEGPDAAAALERVVTGDIRGLKPGRQRYTLLMNAQGGIVDDLMV
FT                   ANLGDRLLLVLNAGRKNVDVAHIRAHLPATVSLTPQFDRALLALQGPEAGAVLASLAPE
FT                   VAAMRFMEAREMALSGISVTITRSGYTGEDGFEIGLPAAEAEGLARALLADARVKPAGL
FT                   GARDSLRLEAGLPLYGNDIDETRDPIAAGLGFAIGKTRKMGWDFLGGDAVRAVHDAGPR
FT                   ERLVGLRAEGRAPVRAGAELRDAAGQPAGRVTSGTFGPSVNGPVALGYVRADCAGDDST
FT                   LIAGLRGRDIGITVVPLPFVPHRYHR"
FT   CDS             81827..82201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="ACMV_00740"
FT                   /product="glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00740"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79421"
FT                   /db_xref="GOA:F0J139"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:F0J139"
FT                   /protein_id="BAJ79421.1"
FT                   /translation="MTETRFSKDHEWVRLDGDVATVGITDHAQSALGDVVFVELPETGR
FT                   HVDAGEACAVVESVKAASDVYAPLAGTVTEANGALADDPGMVNAQAESGAWFFRMTLDD
FT                   RAAFDALLTADDYQAFLKTL"
FT   CDS             82216..85098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvP"
FT                   /locus_tag="ACMV_00750"
FT                   /product="glycine dehydrogenase"
FT                   /EC_number="1.4.4.2"
FT                   /note="protein synonym:glycine cleavage system P protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00750"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79422"
FT                   /db_xref="GOA:F0J140"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:F0J140"
FT                   /protein_id="BAJ79422.1"
FT                   /translation="MPDTAPQTIDDFTALLAEERFALRHIGPGPAERAAMLRALGAADL
FT                   DALIARTVPETIRSAAPLDLPAALTEGEILDDLRRYAADNEVKRSLIGLGYHGTVTPPV
FT                   ILRNVLENPGWYTAYTPYQAEIAQGRLEALLNFQTMMAELAGLDLANASLLDEGTAAAE
FT                   GVSLAHAVHKGGSTVIAVAADLHPQSRAVIATRAAPLGWTLEDVAPGDAGAIEQAKPFA
FT                   VVLQYPGTTGAVRDLSDEIAAAHRAGALAIVAADPLALTLLRPPGEMGADIVVGSAQRF
FT                   GVPMGFGGPHAAYFATRDSLKRHMAGRLVGVSVDAAGSPALRLALQTREQHIRREKATS
FT                   NICTAQVLLAVIAGFYGVWHGPEGLARIARRVHLAARLLAGAARAAGLSIRHDVFFDTI
FT                   AIEAGAGADSLMQRALGAGFNLRRVDDGCVAIALDETVTAAEIATLAGVIGGAADAAAS
FT                   PLDALGRQSAFMVEPVFHAHRSEHAMLRYLKQLEDKDVALNRSMIPLGSCTMKLNATAE
FT                   MIPITWRAFADIHPFAPMEQTRGYRALITRLSEDLARITGFAAVSLQPNSGAQGEYAGL
FT                   LAIRAFHAAREEGHRDICLIPSSAHGTNPASATMAGYRVVVIGCDRAGNIDLADLEAKI
FT                   AEHAGKIAALMITYPSTHGVFEASVRDICARVHAAGGQVYMDGANMNAQVGLTSPAAIG
FT                   ADVCHLNLHKTFCIPHGGGGPGVGPIAVAAHLAPHLPNHPLRPDAGPSTGYGPVSAAPF
FT                   GSASILPIPYAYIRMMGPDGLREATAVAILNANYIAHRLAPHYPILYTGANGMVAHECI
FT                   IDCRHFQAEAGIFVEDIAKRLQDYGFHAPTMSWPVPGTLMIEPTESETKAELDRFCDAM
FT                   IAIRGEIADVAAGALDRVDNPLKNAPHTAAEVMAATWTHGYGRDRAAFPLPHVRAAKYW
FT                   PPVKRVDNVYGDRNLVCSCAPLSAYAEAAD"
FT   CDS             85193..85768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00760"
FT                   /product="putative lipocalin"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00760"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79423"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="UniProtKB/TrEMBL:F0J141"
FT                   /protein_id="BAJ79423.1"
FT                   /translation="MTLARRSLLAAAPALLAGCTFDTSPYPQPPLRHARVDLDRFMGRW
FT                   YIIGHIPYFAEAGYVGSYAVYTRRPDGAIDDQYNGYPKSFAAKRFQFTSVDQVEPGTDN
FT                   AVWRVTLLNGLVGVPYVIMHVEPDYSVFLGGFPNRSLGWIFAREKRMDEATYRAMLDRF
FT                   YRQGYDARQFRRVAQFPDQIGRPGFERV"
FT   CDS             85852..87594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00770"
FT                   /product="putative peptidase S49"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00770"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79424"
FT                   /db_xref="GOA:F0J142"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004634"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:F0J142"
FT                   /protein_id="BAJ79424.1"
FT                   /translation="MSESAAPLRRLARLLWRAARAIVFAIGLVTILLAGAGLWGLHRLA
FT                   GRPTALPEHFILSLNLQTAPPDVAAPSALLRRATGATPTLEQTIAAIDRAATDPRVRGI
FT                   DILLGGGCCGLTTAEELHDALARFRAISHRQVVARAMSFDGAEGLGAYIVATAANRIEL
FT                   SDAGDFGVTGLALQSPFAADLLKMAGVEAQFEHIGKYKTYPELFTRSGPSAAATEMMNS
FT                   LAGSLYDSALVPIAARLKRSPDQVKALFDQAPFSAAQAKQDGLVDTVLPLSAEVAHVRG
FT                   VHVSLADYVADAAPAPAGAPKVALIVAHGDINAPDAPGRRSGIDPARLAHEIATAVADP
FT                   SIRAIVLRLDTPGGTVTGSAMVGAEVARAARLHKPLIVSMGALDASGGYWISSHGAVLV
FT                   ADPATLTGSIGVLGGKFSFGGLLARLGVSVSTASRGANALFDSAVTPWTEAQLASLQGQ
FT                   LDLDYQKFVGWVAAGRRMSPAQVNAVGQGRVWTGAQARSRGLVDRLGGYHEAFMTVRAA
FT                   LHLPADAALDIVPGNEQPGLAALLATLARQANPLEAAALPEPLRGLFALTRLHRLSMVP
FT                   VELR"
FT   CDS             87893..88351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="ACMV_00780"
FT                   /product="MraZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00780"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79425"
FT                   /db_xref="GOA:F0J143"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="UniProtKB/TrEMBL:F0J143"
FT                   /protein_id="BAJ79425.1"
FT                   /translation="MSQFLGTHRNRLDAKGRVSVPAAFRAALRREGDSQGLILRPSHKH
FT                   RCIEVWPAPVFEALATRLQGLDLFSDTHDDMAAALYADAWPLEADKEGRILLPEPLVEH
FT                   AGLRDSVVFMGLGRTFQIWEPEAADRRRAEARERARIGGLTLPAGASA"
FT   CDS             88348..89289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmH"
FT                   /locus_tag="ACMV_00790"
FT                   /product="ribosomal RNA small subunit methyltransferase H"
FT                   /EC_number="2.1.1.-"
FT                   /note="protein synonym:16S rRNA m(4)C1402
FT                   methyltransferase"
FT                   /note="protein synonym:rRNA
FT                   (cytosine-N(4)-)-methyltransferase RsmH"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00790"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79426"
FT                   /db_xref="GOA:F0J144"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F0J144"
FT                   /protein_id="BAJ79426.1"
FT                   /translation="MSGGLSHVPVLREEAVAMLAPRADGVYLDGTFGGGGYSASMLEAA
FT                   SCTVWAIDRDPAAIARGAALAARYPDRLHLIEGRFGDLLALLRDRGVTALDGAVFDFGV
FT                   SSYQLDDPSRGFSFRTDGPLDMRMGAAGPTAADIVNGYAEAELADILFHFGEERASRRI
FT                   AAAIVRRRAAQPFETTADLAAVIRTVVRPDRSGIDPATRSFQALRIEVNQELAEIERAL
FT                   EAAASLLAPGGRLVAVSFHSLEDRIVKRFMNAATGHVAAPSRHDPSGLARQAAAPRFRA
FT                   LTRGVVTPGEAETAANPRARSARLRGIERLAA"
FT   CDS             89286..90155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00800"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79427"
FT                   /db_xref="UniProtKB/TrEMBL:F0J145"
FT                   /protein_id="BAJ79427.1"
FT                   /translation="MIRPVTLVTGLLMLGSGAWLFVVKHRAGTLEHKIGGVTAQIRSSE
FT                   QRIRVLRAEWALETDPNRLARLAAMFMPQLRPMKPDQLVSWQQLADALPPPGAELPHLP
FT                   LPPPLPGDLSGAPSSAAVAAAAAPETVALATIPLPVPPRSLPAPRFAAATSQTALAAPQ
FT                   AHLAVPHPAVRPVAVRRSVVAPAQHAVVVHRPASQRHDVVARAHSPAIAAARRPQTLGA
FT                   SVLAPRPAPRPTEPPVRSITASDAVPARPQAPAPPARIMAPAARGTSVFGDYGASLAPP
FT                   RPAGGVAP"
FT   CDS             90152..92242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="ACMV_00810"
FT                   /product="peptidoglycan synthase FtsI"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00810"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79428"
FT                   /db_xref="GOA:F0J146"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:F0J146"
FT                   /protein_id="BAJ79428.1"
FT                   /translation="MTAPPPRDSLSPRVPGRGGRDAARRAGAPERGAVPRMEHVRVTSP
FT                   DLARRAAIGVLHSRLAAGFAGFVLIYLLLAARVVYVTVVHPVPPDKAAIAAQTPSTTVV
FT                   LPPPARAEITDRNGEILAVSLPAAALYANPKQVEDPGVAAREIAAVIPGLDPGFLEARL
FT                   ADRSRDFVYLDRKLTASQELAVNRLGIPGVYFENTERRHYPEGNLAAHILGGVTPDQRG
FT                   IAGVEDWFNKRLTSAPGKPLRLSIDIGAEGIVRQAIWQAMSDYDAKGACGIVISARTGR
FT                   VLAMASVPDYNADDLGSAPADARFNRCVSGDYEPGSVFKLQTLSMAINSGMIQPWDRFN
FT                   TTHPLHVGRFTVTDFEPAHIWMAVPHILAVSSNIGASRIATILGPQIQRAWLRKLGFFR
FT                   RPPIQLPEATPPMYHPKSSWKLLTTMTVSFGNGIAMSPLQLISAVVPVVNGGIWYPPTL
FT                   LDHGKRSAGVRVMSERTSLIMRKMMRNVVTAPDGTGVYARVPGYLVGGKTGTAQVVGPN
FT                   GRYLQHLNNASFMAAFPMNDPRYVVYVVVLQPHATKQMLPFCHGFTTGGYVAAPAVAQI
FT                   ISRIGPMLGIMPLSGQTLAEAQAALSIPLDPPAPPGRLALGPGHLFPPGASKYAYILAH
FT                   QTPPANMDVAAHDQALARTEMWQPLAPAAQTVSLPPAPASSAHTLGHRIMNIALPVTRA
FT                   GG"
FT   CDS             92247..93692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="ACMV_00820"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="protein synonym:UDP-N-acetylmuramyl-tripeptide
FT                   synthetase"
FT                   /note="protein synonym:meso-diaminopimelate-adding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00820"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79429"
FT                   /db_xref="GOA:F0J147"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="UniProtKB/TrEMBL:F0J147"
FT                   /protein_id="BAJ79429.1"
FT                   /translation="MDGLSRYGAPPGWILPPETVFSGITADSRAVRKGMIFAALPGARA
FT                   DGRDFIAQAVAQGAAAVLAPSGTRWPPGVPPRPLIEDPEPRRRLAEIAATLAGPLPETI
FT                   LGVTGTNGKTSTVDFIRQMAVASGRPAASLGTLGLIAPGFAPGASLTTPDPVTLSDILA
FT                   ALRAAGIGTVALEASSHGLDQFRLHGLRLAAGGFSNLTRDHLDYHGDMASYRRAKLRLF
FT                   QDLLLPGAPAVAMADLEPDTLAALRDIAQARRLDLATVGAGGDLFDLRGIIATPSSQVL
FT                   TIACGGVSREIELPLPGRFQVDNALLAAGLARAAGVSDPLDRLPGLAPVRGRLERAAVL
FT                   PNGAAAYVDYAHTPDALERLLMALRPHAAGRLVLVFGAGGDRDRGKRKLMGDVAARLAD
FT                   VAIVTDDNPRSEDPASIRAAILAACPGAREIGDRRAAIAAGLDALRAGDVLAVAGKGHE
FT                   SGQIVGDAVLPFDDAAVIRELAA"
FT   CDS             93689..95044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="ACMV_00830"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="protein synonym:UDP-MurNAc-pentapeptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00830"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79430"
FT                   /db_xref="GOA:F0J148"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="UniProtKB/TrEMBL:F0J148"
FT                   /protein_id="BAJ79430.1"
FT                   /translation="MSGLWSARDLAVATNGTWLRGEADATGVSIDSRTTAPGELFVALA
FT                   DARDGHDFVPDAEAKGAACVLVARDVGAGPALLVEDVQAALTRLGEFGRARSRARVVAV
FT                   TGSVGKSTTKEMLRRILSAFGATHAAEASFNNHIGVPLTLARLPAEADFAVVEIGMNHP
FT                   GEIAPLSAITRPHVGVITAIGSAHLGLMGSVEAIADEKAELLRGVVPGGAAVLPRGPFL
FT                   SRLARRARDGVRVVSFGAQDLAEARLIEAESDADGVAVTANILRMVVRCRLAAPGTHMA
FT                   MNAVAALAAAAALGLDPVQAAAALDGFAPLAGRGARRRVNVDGVEITLLDESYNASGNS
FT                   VRAALEVLSLLPGRRIAVLGDMLELGDYADDEHRDLADAVSGVADLVFACGPHMRVMFD
FT                   ELPERQRGAWAVDAASLAPAVRAALAVGDVVLVKGSYGSRMRDVVAAIEDKA"
FT   CDS             95044..96132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="ACMV_00840"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00840"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79431"
FT                   /db_xref="GOA:F0J149"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:F0J149"
FT                   /protein_id="BAJ79431.1"
FT                   /translation="MLYALLLPHVAAFHAFNLIRYITFRAGGACLTALVVSFLLGPRLI
FT                   RWLKSLQKQGQPIRADGPERHLIEKKGTPTMGGFLILIALTVSTLLWADLRNGYVWAVL
FT                   MITIGYGALGFADDFLKLTKRNTKGVPGRIKLVVQAVLGLGAAVWITQLMPGSIADSLA
FT                   VPVFKHLMIPFGPLFPLVAMFVMMGASNAVNLTDGLDGLAIVPTIIAAGVFTLIAYLVG
FT                   NRIFSHYLEINFVPGTGELAVFCSALIGAGMGFLWFNAPPAAVFMGDTGSLALGGALGS
FT                   VAVATKNEIVLAITGGLFVVETVSVIVQVFWYKRTGRRVFLMAPLHHHFEKKGWAEPTV
FT                   VIRFWIVAMILALLGLATLKIR"
FT   CDS             96129..97514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="ACMV_00850"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="protein synonym:D-glutamic acid-adding enzyme"
FT                   /note="protein synonym:UDP-N-acetylmuramoyl-L-alanyl-D-
FT                   glutamate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00850"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79432"
FT                   /db_xref="GOA:F0J150"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="UniProtKB/TrEMBL:F0J150"
FT                   /protein_id="BAJ79432.1"
FT                   /translation="MSAPVENWSHVFAGRRYAVLGLGVNGLPAAQALAAMGASVIAWDD
FT                   NEARRGAAAAVGITIGRPSDASKLDGLILSPGIPHALPVPHPEAAAVMARGVPIFTDAE
FT                   LLFRAVRDSGSSARFVGITGTNGKSTTTALLAHILADAGIEVAAGGNLGPAALALPRLG
FT                   DDGVYVLEMSSYMLERIVNMRFSAGAMLNLTPDHLDRHGNMAGYEAAKSRLFVGQEAGD
FT                   VAVFGIDDAATAAMATRFEDGKRRIVRISGCQRADIFARGRKLVDHSGVIADLDAAAAL
FT                   PGTHNAQNAAAAAALALALGVPREVIGRAMVSFPGLPHRQRVVASVAGVTFIDDSKATN
FT                   ADSAARALDCHERLVWIAGGIGKDGGIAPLAPWFSRVAHAVLIGRDAPEFAATLASAGV
FT                   SCEIAGTIENAVPSAFAAARRIGVDTVLLSPAAASFDQFTDYAARGRRFAELAARLVSM
FT                   EAR"
FT   CDS             97514..98677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="ACMV_00860"
FT                   /product="putative cell cycle protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00860"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79433"
FT                   /db_xref="GOA:F0J151"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:F0J151"
FT                   /protein_id="BAJ79433.1"
FT                   /translation="MPVLSRADDSVVGRWWWSVDRVMLTALLLLVGLGYVLALAATPAT
FT                   NLSLNDPNTIVMIRQIVYLLTAGILMVGVSMLDLHYVKLAALATGVVFLVLTGFTLVHG
FT                   VVVDGGRRWIALPGFTIQPSEFLKPALIIATAWLLAERRRTPGFPGMFAAIGLNSLVVL
FT                   ILLRQPDVGSTALVLATFFVQLFLDGLNTFFVGLGVAGFGAAGFAAFELIAHVHKRVML
FT                   FLHPTKDKAYQALTALSAFANGGLWGRGPGEGQVKHYLPDARADFVFAVAGEEFGMFLC
FT                   LGIIALYAVIVLRGFMRVLRETDPFVALASAGLLTSFGLQAFINMASSLSMIPTKGMTL
FT                   PFLSYGGSAVLATGLHMGFLLALTRRRIHAERVTDGLFGLGMQDRAV"
FT   CDS             98674..99780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="ACMV_00870"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00870"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79434"
FT                   /db_xref="GOA:F0J152"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:F0J152"
FT                   /protein_id="BAJ79434.1"
FT                   /translation="MRGAMLNPIIIAAGGTGGHMVPAESVADELMRRGQRIVLMTDARS
FT                   AGQKSAVFAGCERHVLAGAGLAGRSLGRRLLGVAQLARGTVAARRILAKLDAAAVVGFG
FT                   GYPSVPPVLAAATLRRRPAIVLHDQNAVLGGANRFLARFADHLALSFEGTAGVSGRARA
FT                   TVTGNPVRAAISVLAASPYEPPAETIRLLVLGGSLGARIFATLVPEALARLPEGLRRRI
FT                   ALTMQCPGEVIGAARGALDAAGIIHELAPFFSDVAPRMAAAHLLVARSGGSTVAEVATI
FT                   GRPAIFIPLAINTDQRHNADVLARRGGAFRLDQATTTPDRLAGVLESLLDDPLRLAAMA
FT                   EAAASARIEEAAARLADLVLSAIAERVR"
FT   CDS             99777..101216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="ACMV_00880"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="protein synonym:UDP-N-acetylmuramoyl-L-alanine
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00880"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79435"
FT                   /db_xref="GOA:F0J153"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="UniProtKB/TrEMBL:F0J153"
FT                   /protein_id="BAJ79435.1"
FT                   /translation="MRAMPLSIGTIHFVGIAGIGMSGIAEVLHNLGYSVQGSDLSENAN
FT                   VARLRAAGIPVAIGHDAANLGNAQVVVVSTAVPRDNPEVQAARKRMIPVVRRAEMLGEL
FT                   MRLRWSVAIGGTHGKTTTTSLVAAVLEGAGLDPTVINGGIINAYGTNARLGGGDWMVVE
FT                   ADESDGSFLRLPAVIAVVTNMDPEHLDHWGSAEAMEAGYRQFVSNIPFYGFAVLCIDHP
FT                   GVQRMIPDLSDHRLITYGLSPQADVRAERIMSDRNGATFEVRLSERVAGRERVLAPMRL
FT                   PMLGNHNVQNALAAIAIGIEMEVPEVDLRAALASFRGVKRRFTKTGEVAGITVIDDYGH
FT                   HPVEIAAVLRAARQAGARDVIAVVQPHRYTRLATLFEDFCTCMNDAGKVIVADVYPAGE
FT                   EPIPGIDRDALVEGLRARGHKSVVSLGSPDHLAEMINAMARAGDYVVCLGAGSITNWAQ
FT                   ALPNQLQALIETTRRGAGGMR"
FT   CDS             101213..102142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="ACMV_00890"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00890"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79436"
FT                   /db_xref="GOA:F0J154"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:F0J154"
FT                   /protein_id="BAJ79436.1"
FT                   /translation="MMAAPVMADWRAALPEVRGRIGFDVPLGPVTWFRVGGPAEVMFRP
FT                   ADIEDLSRFLAALAPEVPVLPIGAASNLIVRDGGIAGVVVRLVRGFADIEVQPDGIVAG
FT                   AAALDATIAEHAAAAGLTGLEFLSGIPGSLGGAVAMNAGAYGAEIRDVLDWAEIVGRDG
FT                   TVARYAAGDLALTYRHARLPEGGIVVRARLHARPGEAAAIAARMADIRASREATQPVRA
FT                   RTGGSTFRNPEGDKAWRLIDEAGCRGLIHGGAQVSEKHCNFLINLGEATAADIEGLGET
FT                   VRRRVRERTGVELIWEIRRVGLPCRGAA"
FT   CDS             102139..103044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="ACMV_00900"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="protein synonym:D-alanylalanine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00900"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79437"
FT                   /db_xref="GOA:F0J155"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:F0J155"
FT                   /protein_id="BAJ79437.1"
FT                   /translation="MKRVAVLLGGISEEREVSLASGRQVAAALRKAGYDVFEIEVGADL
FT                   GAVIAALTPAPDAVFNALHGRFGEDGTIQGVLDYMGIPYTHSGVRASSMAMDKGAAKAV
FT                   FASAGLPLAQHRIVPLDELAEADPLPRPYVIKPVNEGSSVGVFILREGDNRRADIARAW
FT                   RHGSVAMTEEYVPGRELTVSVLEDRALAVTEIRAEGFYDYTAKYAAGASRHEIPADVPP
FT                   SVSARARDVAVAAHRALGCRGATRSDFRYDDETDRLVLLEVNTQPGMTPTSLLPEQAAH
FT                   CGIDFPALCAWMVENAACRV"
FT   CDS             103032..103910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="ACMV_00910"
FT                   /product="putative cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00910"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79438"
FT                   /db_xref="GOA:F0J156"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:F0J156"
FT                   /protein_id="BAJ79438.1"
FT                   /translation="MPRVKQRKATVQDRPSPRTLLLRRLRRAGRPTAVLGVMALLLIAV
FT                   PLGLRGVLAVFRPVRAAAATVAADAGFRIAHIELSGVTPGSRAVVERALDVERGKAIFA
FT                   VSPAAVAARVGALGLVRSAVVERVLPDTLRVEVTERRAVAIWQRPDGRFALVGAGGAVL
FT                   EDRDAGAARAHDPNLRLLVGAGAPKHAQDLLDLLARFPAIDSKVVAAERIDRLRWNLIL
FT                   RDHTVVELPDSHPARALTVLMQAERKIRLLDRPVRRIDLRLADRLVVRPYPKGFVTDAA
FT                   TPSAASGKHKS"
FT   CDS             103924..105231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="ACMV_00920"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00920"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79439"
FT                   /db_xref="GOA:F0J157"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:F0J157"
FT                   /protein_id="BAJ79439.1"
FT                   /translation="MNDLSRRATLTATRAEPRQQETRRQPARSGPFGVLDIGSTKISCL
FT                   IGRAESDGRLRALGFGWQRGRGVKSGGIVDLEDAEKAIRAAVGAAEDQADMRLKSVTVN
FT                   LSCGQPESRLFNVQWPIDGRAVTEDDIRRVVREARARAASEGRGTIHALPLNFSTDETG
FT                   GVADPRGLYCDTLTAQLHVVDAATTAIKSVTACLERCELEIASMVSAPFASGLATLVED
FT                   ERELGATVIDMGGGTTTIAVFAEGQMLHTAQLPVGGNHVTNDVARLLSTQVAHAERLKT
FT                   LYGTCQESPDDARELLPVPLVGEAEHQIAKVPRSALVSIIRPRLEEIFELVRDRIETSG
FT                   LGRAAGARVVLTGGASQLVGARELAAQILDRQVRIGKPIGVIGLPDAATGPNFATMIGL
FT                   LAFASGDGQTMHDIDLTAAAPQGRLARFMNLLMRRM"
FT   CDS             105296..106864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="ACMV_00930"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00930"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79440"
FT                   /db_xref="GOA:F0J158"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="UniProtKB/TrEMBL:F0J158"
FT                   /protein_id="BAJ79440.1"
FT                   /translation="MTLNLIRQTTTQTDFTPRITVIGVGGGGTNAVNNMIALNLPGVEF
FT                   VVANTDAQQLMLSRAERRIQLGPHITQGNGAGGRPEIGKASAEEASEDLARHLDGAHMV
FT                   FITAGMGGGTGTGAAPVIARMARERGILTVGVVTKPFAFEGRRRLRSAEEGINELQQFV
FT                   DTLIVIPNQNLFKVANERTGWKEAFEMADHVLYMGVRGVTDLMVVPGLVNLDYADIRSV
FT                   MSVMGKAMMGTGEAEGEDRAIRAAEAAISNPLLEDTNMKGARGLLINITGSSDFSLHEL
FT                   DQAANRIAEEVDEDANIMVGMALDESLGGRVRISVVATGIDTPVPAQAERPRLAAVSGD
FT                   SVMVEANATVAAQPHMTAAPAAASHPAHFQPQSAPAQHQAAQAMHPQPAPGPVPARPQF
FT                   QAEGPVRAPISAPAAFRETPRAAEPPRKQSLFGRMTSSFRNAAAPQPMPQAEPRAAAPS
FT                   WPAREEPSYQAPQHLDREMPQAPAAEHASYHVPPQHHEPRAAVRLTQNEEIGIDIPAFL
FT                   RRQQS"
FT   CDS             107005..107382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00940"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79441"
FT                   /db_xref="GOA:F0J159"
FT                   /db_xref="UniProtKB/TrEMBL:F0J159"
FT                   /protein_id="BAJ79441.1"
FT                   /translation="MTIPLSLLLLAASLGAWLGVRAMQQGGVNGGGVFGRLLGPLHGVL
FT                   GAMGLTALVIALARHPVPARMGLGGFGAGAEILLGLALLLGLFVVIAAWRQRRPAGLLL
FT                   GTHATLAIAGITLVLAIASLT"
FT   CDS             107445..109538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00950"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79442"
FT                   /db_xref="GOA:F0J160"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="UniProtKB/TrEMBL:F0J160"
FT                   /protein_id="BAJ79442.1"
FT                   /translation="MDVALIAVRAAKPAAAPPPGALRSSAAYAGRIVLFLPVAMMAGIL
FT                   LYFDLRAEPPAWLAPVAIVLAAGVLTMLWRRPVGCRLAALALFALLGLGRAQWQAMLMP
FT                   PPIVVPHGVVTVTGRVSSIDLLATGRRVRIAAPRLDGGPALGRAVRIKLRRGDDVRLAA
FT                   GDSVRVRAFLFAPSRPAYPGGWSFGRDQFFSGLGAVGFAVGKLDVTRVAAPGWGGALRR
FT                   LRETIAARVLTAMPPTTGPIAATLLTGFEESIPARERQAFITAGLAHILAVAGLHIGIV
FT                   MGALFALARFCVGWSEFLLLRVPAKVIASAVAFAGGVVYAALTGFHVPIERSLAMAALV
FT                   LLGIVAGRRALSLRGLAVAAFVLMLIEPQAVPGPSFQMSFSAVLALIAGYEAVGRRFDT
FT                   EGAGWRGRLGRHIAALAFTSLLAGGASMPFAAYQFQQVQPYYILANLIAVPLTALVVLP
FT                   AGMVALVLMPLHLEALALAPMGWGIAAMLAVARFVGQLPHALIVIGPSPGWPVALLGLG
FT                   MALLGLLRGRVRLAGLAPVVIGLAGMMLGRAPDVLVSPTASLVAVRDGAVVRILETRRP
FT                   DQYTLAQWRPVFAHDRVAVARAADICAGGRCRFDHGRVLYLADATAAENGCGDARVVIS
FT                   PEPLRGACRARGRYVIDRFSVWRDGAIALRFAGGRVRLTTDRWVQGVRPWVAAWPKRWH
FT                   RRR"
FT   CDS             complement(109465..110490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00960"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00960"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79443"
FT                   /db_xref="GOA:F0J161"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F0J161"
FT                   /protein_id="BAJ79443.1"
FT                   /translation="MPSEPRLLAGTPPPGHAYDADIVILSHHRPRETIAAIRSAAAQTG
FT                   LDSHVIVLDQNSPPGMRAALATVATEFPHVALYGIGQNFGVPGGRNRVSALGHGRTIIA
FT                   LDNDAVFAARDTAARAAIRIAGTADLAAIGFRILAADGRSLDLTSWGYPKRLLPRADGF
FT                   FAATTFVGCGHALSRACFERLGGYDESLFFTWEEYEFARRAIAGGWRIEHHGDLAVIHE
FT                   VSPEARVNWNAGRWHQYVRNRLLIAHDWNGLSGFLFRAGIYLARGINASRLRPTLDAIA
FT                   EAHALARTRPRHQETAETRHYVFRNEIRHRLPGGARLIGVGATASARRPPTAAPPAPTG
FT                   P"
FT   CDS             complement(110480..111964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00970"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00970"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79444"
FT                   /db_xref="GOA:F0J162"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:F0J162"
FT                   /protein_id="BAJ79444.1"
FT                   /translation="MSQTILEPLAEPVRRMAAIPVKRAHRFRPHLGPSSGIAFLLVADA
FT                   ATVLIGPRLATRVLAPAPTMAAGPFNELVFGGLTLFALFAAGLYAVGPARAPLVHIGAM
FT                   LRALVAADVLALLRIALLRPVPATLPLDRSIAWAVGAFTFTAVLMLGERAMVAAFWRRH
FT                   GIGIPRGASALVAATPCDRMLCTRLDRMTDHRLGYVFCWGLAPTSGLRTIADAATLDAM
FT                   IRSGQIGDLVVFVQRGDGPEARGKIDALLARLADQPVRIRLAFDAVAEIGACDLATGRS
FT                   LRLVTVLDRPIRPFGAVAKRSMDVGGAALLIILLGPLLALIALALRMTGPVLFRQRRIG
FT                   LDGAPFTVFKFRTMRPQPPRQAAGPVSQAQPGDRRITRLGAILRRLSLDELPQLFNVLR
FT                   GEMSLVGPRPHAPHTTAGDFTFEQAIAFYGVRHRVKPGLTGLAQVRGLRGPTDRRDLVA
FT                   ARVAADLDYIERWSPWLDLAILLRTIPAVLIGRNAI"
FT   CDS             complement(112018..112458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_00980"
FT                   /product="putative GtrA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00980"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79445"
FT                   /db_xref="GOA:F0J163"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:F0J163"
FT                   /protein_id="BAJ79445.1"
FT                   /translation="MPALPSPIELVTNRLPARHRAAAGELLRFGLVGVFGLLVDIAAVY
FT                   ALIPSLGLYGAGMAAYLIAASCNWVLHRLWTFRARAQRPAHTQWLRFLMVNLAGFMVNR
FT                   GAYSALIASFVLPRHYPVLAVAAGAASGFLINFLLSRRLVFG"
FT   CDS             112647..113144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxS"
FT                   /locus_tag="ACMV_00990"
FT                   /product="carbon monoxide dehydrogenase small chain"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_00990"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79446"
FT                   /db_xref="GOA:F0J164"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="UniProtKB/TrEMBL:F0J164"
FT                   /protein_id="BAJ79446.1"
FT                   /translation="MPQVKLTVNGKPATADVEARTLLVEMLRENLHLTGTHVGCDTSQC
FT                   GACVVKVDGKSVKSCTMLAVQADGAEVTTIEGLAAADGTLHPMQEMFREHHGLQCGFCT
FT                   PGMVMSAIDLVESHPEGLTEQQIRDGLEGNICRCTGYHNIVKAIAAAWPLMHGRELPQA
FT                   AE"
FT   CDS             113210..115615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxL"
FT                   /locus_tag="ACMV_01000"
FT                   /product="carbon monoxide dehydrogenase large subunit"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01000"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79447"
FT                   /db_xref="GOA:F0J165"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="UniProtKB/TrEMBL:F0J165"
FT                   /protein_id="BAJ79447.1"
FT                   /translation="MNDMTQPHIVKGGIGDSPKRVEDRRFLSGRGHYTDDINRPGQAYA
FT                   VFRRSDVAHGNIRSIDAGAARAMPGVVAIFTGEDIAKAGIGGVPCGWQIHSKDGSPMVE
FT                   PPHPVLAQGKVRYVGDAVAMVIAETVDQAKDAAEALVVNIDPLPAVSNMVAATAAGAPL
FT                   VHDDAKGNVCFDWHIGDKDAVDAAFAKAFKVAKIDVVNNRLVPNPIEPRAAIGDFDQAT
FT                   GEHTLYTTSQNPHVIRLLMGAFVLQIPEHKLRVVAPDVGGGFGAKIFHYIEEAAVTWAA
FT                   AQVNRPVKWTCERSESFITDAHGRDHITHAELALAEDGAFLGLRVKTMANLGAYLSTFA
FT                   PSVPTYLSATLLAGVYTTPAIYSEVKAIFTNTVPVDAYRGAGRPETTFLLERLVDVAAK
FT                   TMGMDRVAIRRRNFIPPDAYPYQTPVALQYDSGNHEATLVRCMELADWNGFEARRAESA
FT                   KRGKLRGIGMSTYLEACGIAPSAVAGALGARAGLYEVANVKVHPTGSVTLYTGTHSHGQ
FT                   GHETTFAQLVADQLGVPFEQVEIVHGDTSKIPFGMGTYGSRSLAVGGSAIVKAVDKIIA
FT                   KGKKIAAHLMEASVDDIEFKDGKFTVAGTDKSKAFGEIALTAYVPHNYPHDELEPGLDE
FT                   TAFYDPKNFTFPGGCHICEVEVDPDTGVVSLLNFTAVDDIGRVINPMIVHGQVHGGVAQ
FT                   GIGQALLEHAIYDEAGQLLSGSLMDYTMPRADNLVSIHVGTESTMCTHNPLGAKGVGEV
FT                   GAIGSPPAVINAVVDALRDYGVTHVDMPATAQKIWSIINAASPRMAAE"
FT   CDS             115628..116422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxM"
FT                   /locus_tag="ACMV_01010"
FT                   /product="carbon monoxide dehydrogenase medium subunit"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01010"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79448"
FT                   /db_xref="GOA:F0J166"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:F0J166"
FT                   /protein_id="BAJ79448.1"
FT                   /translation="MYDFKYQKPAAVDDAVKALAADPEAKALAGGMTFIPVLKQRLAKP
FT                   SAVVDLAGLGLSGIRREGNTLVIKAMTTHREVATSKDVADAIPALAHLASHIGDRQVRY
FT                   RGTIGGSLANNDPSACYPSAVLALGATIRTTKREIAADDYFQGMFTTALEPDELITEVS
FT                   FPIPEKAAYEKFPNPASRYAMVGVFVAKNAGGVRVAVTGAGNNGVFRHTAMEQALSAHF
FT                   APDAISGVKTPEEDMSSDIHASAAYRAHLVGVMARRAVAACG"
FT   CDS             116645..116722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqA"
FT                   /locus_tag="ACMV_01020"
FT                   /product="coenzyme PQQ synthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01020"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79449"
FT                   /db_xref="GOA:F0J167"
FT                   /db_xref="InterPro:IPR011725"
FT                   /db_xref="UniProtKB/TrEMBL:F0J167"
FT                   /protein_id="BAJ79449.1"
FT                   /translation="MWTKPKLVEIAVGTEINCYACADLD"
FT   CDS             116782..117705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqB"
FT                   /locus_tag="ACMV_01030"
FT                   /product="coenzyme PQQ synthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01030"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79450"
FT                   /db_xref="GOA:F0J168"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011842"
FT                   /db_xref="UniProtKB/TrEMBL:F0J168"
FT                   /protein_id="BAJ79450.1"
FT                   /translation="MKIIILGAAAGGGFPQWNCACGNCARARCGDPAAKSRTQAALAVS
FT                   VNDSDYVIFNASPDLRGQILATPALQPRSGLRDSPIAAAVLTGGDVDFTAGLLNLREGH
FT                   RFGLYAGRRIFDLLGDSQIFRVLDAGLVPRRELPVDVPTRLANGVGQDLGITVEAFVVP
FT                   GKVALYAEDVSRADFGSSEGDTIGLRIADDHGRAFFYIPSCARVSEDVARRVRGAALVL
FT                   FDGTLWHDNEMIEAGLMPKTGARMGHISVSGPEGSIAAFAGLDVARKVFVHVNNSNPMI
FT                   LDDTPERAEAERAGWIVAHDGMEIVL"
FT   CDS             117702..118442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqC"
FT                   /locus_tag="ACMV_01040"
FT                   /product="coenzyme PQQ synthesis protein C"
FT                   /EC_number="1.3.3.11"
FT                   /note="protein synonym:pyrroloquinoline-quinone synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01040"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79451"
FT                   /db_xref="GOA:F0J169"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR011845"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:F0J169"
FT                   /protein_id="BAJ79451.1"
FT                   /translation="MTVLMSPDELEAALRAVGAARYHNRHPFHQLLHGGKLDKRQVQAW
FT                   ALNRYCYQAAIPIKDATLIARTDDSELRRIWRQRLVDHDGTQPGEGGIVRWLALAEGLG
FT                   LDRDMVISERRALPATRFAVRAYVDFVRDRSLLEAVASSLTEMFSPTIISERVSGMLAN
FT                   YDFITRETLAYFNARLDQAPRDADFALDYVKRHARTPEQQQAAIAALTFKCDVLWAQLD
FT                   ALHHAYVSPGLIPPGAFGHDGIWS"
FT   CDS             118439..118714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqD"
FT                   /locus_tag="ACMV_01050"
FT                   /product="coenzyme PQQ synthesis protein D"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01050"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79452"
FT                   /db_xref="GOA:F0J170"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR022479"
FT                   /db_xref="UniProtKB/TrEMBL:F0J170"
FT                   /protein_id="BAJ79452.1"
FT                   /translation="MTLTADSVPHLPRHVRFRFDAARNCHVLLAPEMVIMPDAIAVAIL
FT                   DAVDGIASVGAIADTLAARYEAPREAVLADCIEMLNDLARKGMIAS"
FT   CDS             118711..119832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqE"
FT                   /locus_tag="ACMV_01060"
FT                   /product="coenzyme PQQ synthesis protein E"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01060"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79453"
FT                   /db_xref="GOA:F0J171"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR011843"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034481"
FT                   /db_xref="UniProtKB/TrEMBL:F0J171"
FT                   /protein_id="BAJ79453.1"
FT                   /translation="MNDLAPATVNATRHAPAPPLAMLMELTHRCPLKCPYCSNPLAMDR
FT                   ARDEMSTETWKRVISEAAALGALQGHFSGGEPMVRDDLVELVRHAHREGLYTNLITSAV
FT                   LLDKRRMDELAEAGLDHVQISFQGSETALADHIAGLRHAHVKKLAAARLVRGAGLALTV
FT                   NAVMHRRNLHQLPAMLDLAVEAGAQRIEVAHVQYYGWALKNRAALIPTRAQLDEATRIV
FT                   EVARQKLEGVLNIDYVVPDYYASRPKACMGGWARRFFNVTPSGKVLPCHAAETIGHLHF
FT                   DTVQEKSLAEIWAHSEAFNVYRGTEWMPEPCKGCDRAEIDWGGCRCQALALTGDAAATD
FT                   PACGLSPHHAMMKELAVAESAAGAEDFAYRMIS"
FT   CDS             complement(119814..120644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmB"
FT                   /locus_tag="ACMV_01070"
FT                   /product="23S rRNA (guanosine-2'-O-)-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="protein synonym:23S rRNA Gm2251
FT                   2'-O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01070"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79454"
FT                   /db_xref="GOA:F0J172"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:F0J172"
FT                   /protein_id="BAJ79454.1"
FT                   /translation="MDKRDSHGKAGNGGRHKLPRGPHPHRRSQGDAPRDRRPASSAGGL
FT                   WLYGLHSVEAALANPARRLRRLVVTEEGEAALAGRLPHPWPIQPERIERDRLDQMLGRG
FT                   IVHQGVALQADPLVPPSLNDALKRPGPVLVLDQITDPRNVGAILRSAQAFGAAMVIAQE
FT                   RNAPEEGGALAKAASGALERIPLLRTVNIARALIALKAAGLWVMGLDAAGLSHLSRDAI
FT                   GNRRAALVLGAEGEGLRRLTRETCDELVSLPMPGGMESLNVSAAAAVALYEIIR"
FT   tRNA            120710..120795
FT                   /locus_tag="ACMV_t0030"
FT                   /product="tRNA-Tyr"
FT   CDS             complement(121689..124688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01080"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79455"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:F0J173"
FT                   /protein_id="BAJ79455.1"
FT                   /translation="MLIGAAALYGPRLISGDYHRGAIERLASGVVGRPVYIEGPITLSL
FT                   LPDPQLVAENVIIGGPHGAQVTTAVLKLDLAPGPLLLGRLRATRLALQHPYITLPWPLP
FT                   GGAEALAPPPWLGSLHATLHDGTFRIGPLRLDHANLSIFTGGPQAVISASGTTMLGKTP
FT                   AAIALRVDDTGSDGPAPMTAELKLGKDALTTLSFHGALGHDSRLEGVIDIAADKKAVSE
FT                   LLPELQKSSAPLHVTGQLAATGHLAAFENVSAQFGSAQVEGQGALALVPAPLLRITAKG
FT                   DGLDLGIAAALLARIRSVVPVAANLDVSGTVAGVPIAKANALVLADDRSLRAQSLTATL
FT                   PGNAELGFAGALGPAAAGHFSLRAPDPAATVAALRPLLPFLPSWPARAGPLDVDGRMTL
FT                   GPDGTISLDDLQGKEAATAAIPAFTGAARITPAGDRAHIVARLDLTRLTLDHLLLDHLA
FT                   VALSSAKPRYDGSVQITARQLAVPAATKGAKPEIEATDLLVDASLHDAAIGGGVHIRLA
FT                   SAHLGRGLLLGRGLRKANGDVIGARLFLAGPDAQNTMTALARILGLPDRWATHQALRQP
FT                   FSLAIAADGAEQALATTWALRLASLHAAAAPVIDLTNRSAAGPITLRAPNAVALIRSLG
FT                   GANLLGEHAGLGWPGPGSASLRAAGFFVGGHMGLSDFVASLGALTISGRINADLADGPP
FT                   QISGRIAADTLAVPAPPALEGAARAALGSGLRVNFPILSAARVERFGETVARHASFSLA
FT                   LDQGKLAPRIAVTLNRAEVVGGRLSGRAILTGAAGSTPATLSLQASLTGARASAVASIA
FT                   ATHGLALPLSGGTVDLGANLMAQGDSGRAWQRSLAGSLTASSHGITISGLDLAGVGQTL
FT                   GAAIQAPHPVGPIATAHALRGLLGKGTTTFNLLDLTATIGQRTVRLDHAALSGPAGELA
FT                   AAGDLNLAQDHLNLTLAARPAVSQAKTVPSLSMTIAGPAAHPGSRIDVAAAISWIHDML
FT                   ATTETSSATH"
FT   CDS             complement(124789..125400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncA"
FT                   /locus_tag="ACMV_01090"
FT                   /product="pyrazinamidase/nicotinamidase"
FT                   /EC_number="3.5.1.-"
FT                   /EC_number="3.5.1.19"
FT                   /note="bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01090"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79456"
FT                   /db_xref="GOA:F0J174"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniProtKB/TrEMBL:F0J174"
FT                   /protein_id="BAJ79456.1"
FT                   /translation="MDSRTALLVIDVQTDFCAGGALAVPNGDVVVPVINALARHYQTVV
FT                   ITQDWHPADHVSFASQHPGRSPFETIPLVYGTQVLWPDHCVMDSPGAALHRDLHIPHAA
FT                   VIQRKGLNRLIDSYSAFLEADRTTRTGLDGWLAARGIERVDLCGLATDYCVAWSAQDAR
FT                   RFGLEARVIEPACRGIDLDGSLAAAWQAMTAAGVARIAAV"
FT   CDS             125530..126282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01100"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01100"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79457"
FT                   /db_xref="GOA:F0J175"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:F0J175"
FT                   /protein_id="BAJ79457.1"
FT                   /translation="MAHFGRVAGKTALVSAAGQGIGRAIAEALIREGAQVIATDRDPKL
FT                   LDGLTGAETVQLDVLEDTSIRALASSLGKIHILVNAAGFVAHGSVLECSERDWAFSFDL
FT                   NVTAMFHMIRAFLPGMLEGGGGSIINVASAAGSIKGVPNRFAYGASKAAVVGLTKSVAA
FT                   DYVTQGVRCNAICPGTVESPSLRGRIAALAAARKVDEAVIEAEFIARQPMGRLGMPEEI
FT                   ASLALYLASDESRFTTGVAHVIDGGWSN"
FT   CDS             126294..128075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01110"
FT                   /product="putative dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01110"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79458"
FT                   /db_xref="GOA:F0J176"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="UniProtKB/TrEMBL:F0J176"
FT                   /protein_id="BAJ79458.1"
FT                   /translation="MSSTPKRLRSTQWFDNPDNPGMTALYLERYLNYGLTREELQSGKP
FT                   IIGIAQTGSDLSPCNRHHLELAKRVSDGIRAAGGVPIEFPVHPIQETGKRPTAALDRNL
FT                   AYLGLVEVLYGYPLDGVVLTTGCDKTTPAMLMGAATVDLPSIVLSGGPMLDGHFEGELV
FT                   GSGTVVWEARRRLAAGQLDYDKFIDMVAGSAPSVGHCNTMGTASSMNAMAEALGMSLPG
FT                   CAAIPGPYRERAQIAYETGKRIVAMVHEDLRPSKILTRKAFENAIVCASAIGASTNCPP
FT                   HVIAIARHIGVELDIKDWDRIGYEIPLLVNMMPAGKYLGESYYRAGGLPAVIGELIRQG
FT                   KFHADALTVSGRSMGEENAGKRSIDADVIRSFDDALAEHAGFAVLSGNLFSSAIMKTSV
FT                   ISEEFRDRYMRRPGDEDAFEGRAIVFEGPEDYHHRINDPTLNIDENCILVIRNCGPIGY
FT                   PGSAEVVNMLPPDALVRQGVNQLPCIGDGRQSGTSGSPSILNASPESAVGGGLALLKTG
FT                   DVIRVDLKDRSANILIDEAELAARRAALTLPDLVNQTPWQEIHRRFTGQLETGAVLENA
FT                   PQYQRVAERFGVPRDNH"
FT   CDS             complement(128130..128924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01120"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79459"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="UniProtKB/TrEMBL:F0J177"
FT                   /protein_id="BAJ79459.1"
FT                   /translation="MNRVAGWIGTRLARFLSAPTHGHAIAPATDIGQLVACLQPADVVL
FT                   VEGHSRFSIAIKYLTQSTWSHVALYVGLRRRLPDTPPEPCFIEADVVEGVRMVGLEAFR
FT                   DYHLRICRAVGLSESERQRVIDFALSRRGARYDLRNVFDLLRYMIPTPPVPVHLRRRLI
FT                   AFGAGDPTRAICSTLVAQAFQSVLYPILPMIGPNDSHAHDCDICVAEILRVRDHQLFVP
FT                   RDFDVSPYFEVVKPSLVGNPGAIEAARDALRGPDGTGRRLWR"
FT   CDS             complement(129057..129470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01130"
FT                   /product="MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01130"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79460"
FT                   /db_xref="GOA:F0J178"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:F0J178"
FT                   /protein_id="BAJ79460.1"
FT                   /translation="MTRTEITIGEAAARSGVSAKMIRHYERIGLITPPLRGEANNYRFY
FT                   DERLVHELRFIHRARDLGFAIVDIRALLSLWRDRNRPSRDVKAIAVAHIAELEAKAAAL
FT                   HSMSAELRRLVESCHGSDRPDCPILEELANPGS"
FT   CDS             complement(129495..132557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01140"
FT                   /product="efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01140"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79461"
FT                   /db_xref="GOA:F0J179"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:F0J179"
FT                   /protein_id="BAJ79461.1"
FT                   /translation="MKNLTTLFIRRPVLSIVVSAAILVLGLRALAGLPVLEYPKTENAT
FT                   ITITTTYPGADPNTIAGFVTTPIEHAIAQVNGIDYMTSQSQTSTSTIKVFLILNYNPDK
FT                   ALTEIQAQIQSVLNQLPSGTQQPQLKLQVGQQLDAMYIGFKSNVLSPNQITDYLTRVVQ
FT                   PQLQSVPGVQTAEILGAQNFAMRIWLEPAKLAAYGLTATNVYDALAGNDFISALGNTKG
FT                   TMTQDTLTASTSLHSAAAFRRLIVKQSGGAIVRLGDVARVKLGSDSYDAEVAFDGKPGV
FT                   YIGIQVAPAANLLSVISGVEKRFPEIQKQLPAGLDGAIVYNSAAFVNASIHEVVAALIE
FT                   ALLIVVLVVFAFLGTPRSVFIPVIAIPLSLIGTFAAMLMLGFSINLLTLLALVLAIGLV
FT                   VDDAIIVVENVNRHLDNGETKLHAAINAAAELANPIIAMTVVLAAVYVPIGFQSGLTGA
FT                   LFTEFAFTLVSAVTVSAIIALTLSPMLSSRLLHHIPRDGTDWEARLVHFIDKLFNTVHR
FT                   RYMRMLRSSLRTLPVTLVFGAIVLGSIYFLAAGAKSELAPQEDQGVVILSSTSAPNATL
FT                   QQKLLWDRELNRLMMSHKSVGHTFQFETPTFAIAGMVLKPWTERTKSATALQNEIQKQA
FT                   AEGVAGQQIVAFQPPPLPGSQGLPVQFVIKTTDPFSALNGVAQKVLAGALKTGKFIFLQ
FT                   SDLKIDQPQATVVINRAKAATLGLDMSQVGAAMAQALGGLYVNYFSLDNRSYKVIPQVT
FT                   QASRLNVSQLLDYPVANINGVPIPLGAIATIRNEVIPESVNHFQQLNAATIQGVAAPGV
FT                   STGEAVKVLQQIAAKDLPSGYEVDYGGPMRQFIQQQGGFVATFGFAVIVIFLALAALFN
FT                   SFRDPLIILVSVPMAIVGALIFIYLGFGLSLNIYTEVGLVTLMGLISKHGILIVEVANE
FT                   AQLAGMTKREAIEHAVGIRLRPILMTTAAMVLGVLPLIIASGAGAAARFNMGMVIAAGL
FT                   SIGTLFTLFVLPAVYMVVGQKHRTEDEVSHG"
FT   CDS             complement(132567..133751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01150"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01150"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79462"
FT                   /db_xref="GOA:F0J180"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:F0J180"
FT                   /protein_id="BAJ79462.1"
FT                   /translation="MTAPAPGTASETPEHKTKKPSILLRMIVMLVLAALVLGAIFGFGA
FT                   FRDVMIAKFIATLKNPPQTVATMVAKETPFQNTETATGSLVALQGAALSAQVAGIVNTI
FT                   DFRSGQDVNKGQLLLTLRPNNDDAVLAQLEATAKLDAITYRRDLAQYQARAVSAQTVDT
FT                   DRANLASAEAQVRSQKALMQEKRIYAPFSGRIGIRAVDIGEFLAAGTTIATLEQLNPIA
FT                   VDFYLPQTALRTIRPGMKADISVDGFPGIEFKGKITALDSAVGTATRMIQIRAVLTNPH
FT                   EELRPGMFARVSIDVGAPQNEITLPKTAIAYNPYGDTVFLVKPDKRSKTHKSAEQVFVT
FT                   LGQTRGDQVAVLKGLKSGDEVVVAGQMKLKNGTPVAINNKILPQNLPNPSVPNE"
FT   CDS             complement(133748..135271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01160"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01160"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79463"
FT                   /db_xref="GOA:F0J181"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:F0J181"
FT                   /protein_id="BAJ79463.1"
FT                   /translation="MNFSDILLHRRVRLATVLLGTTLLAGCAVGPNYHQPAAPKLHSYT
FT                   TSRLPNSTASTSGAGGTAQHLVIGQKIAGEWWTLYHSKPLDALIRKALGNNPSLESAQY
FT                   TLLAARDTARAAEGGFFPSISGSFQAERVRSGLGTTSLGSAGAGLTYSLRNASVAVSYA
FT                   PDVFGGTRRQVESLHAQAEQQRFALEATYLSLTANIVTASVTEASLTAQIEATERIIRA
FT                   EKGLLDILDRQVALGGIPETNAITQRTQLAQTEATLPPLRKQLAQTRDQLAAYEGVPPS
FT                   RFHAADFTLADLALPESLPVSLPSALVRQRPDIREAAAVLHQDTAQVGVATANMLPQIT
FT                   LSAGIGHEALDGQALFAPQTLLWNLAAGITQPFFEGGTLFYKRRAAVATMKAAAETYEN
FT                   TVVLAFQNVADALEALHYDAIALAADTAAEHDAQRSLNLIERQFRLGGVPYTSVLTAEQ
FT                   TYESAVITRIKATAQRYADTAALFQALGGGWWHRHDVKKQVETCCGVLP"
FT   CDS             135424..136152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01170"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01170"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79464"
FT                   /db_xref="GOA:F0J182"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="UniProtKB/TrEMBL:F0J182"
FT                   /protein_id="BAJ79464.1"
FT                   /translation="MFLRWEKKARNWLMGIVTRVCRRRDAADAARQRRDALIETAERVF
FT                   LRKGYHAATMDDIAAEAGMSKRTLYQLVDSKEDLFTALLERRRRPLDVSGIETEGRPVD
FT                   DVLNDMLRLWAHHVLSPSIIALARLIMAEYMHGRTLSRLLDREGAKPCRDALRDYFSAS
FT                   AASGSLAIDDPEEAAHMLYGMAIGNIHIEMLLGVGKARSRAEIDARIARAVGLFLGGAR
FT                   PSGRVGSDVPAQVRETMAQS"
FT   CDS             complement(136108..136977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01180"
FT                   /product="PaaX family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01180"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79465"
FT                   /db_xref="GOA:F0J183"
FT                   /db_xref="InterPro:IPR011965"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="UniProtKB/TrEMBL:F0J183"
FT                   /protein_id="BAJ79465.1"
FT                   /translation="MNHHVAALVARLHEQPSHTGSLIVTLFGDALLPRGSAIALATILD
FT                   LFESLGIGPGVIRTAISRLAADGWLVASRRGRSSYYRIGPSRRGEFIRAARHIYGRPRG
FT                   TAARSLIIALPEPGPGREPARERFNRLGFASWQGILLAPDRPLPRSLEAGSIVLRATGG
FT                   PESLRRLAARAWRLDALCDHYKGFLAIFGGLTADAPAFDPRDALLARLLLIHDYRRIVL
FT                   RDPRLPATFLPEEWAGDGARRLCAQLYEALLDASELWLSHNGATETGALPTADSTLRHR
FT                   FADLRGHV"
FT   CDS             complement(137184..138065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01190"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01190"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79466"
FT                   /db_xref="GOA:F0J184"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:F0J184"
FT                   /protein_id="BAJ79466.1"
FT                   /translation="MTRTEIARQRYCRAGLRYASDLTDAEWALIKPFMPLPPHRGRPRT
FT                   VALRRIMEAIFYMLATGCQWRRRLKVPPAEQVECRRRWQIPKEFAPFTTVQGYFYRFCR
FT                   DGTLDRINHVLVMQAREVAGRGPSPTAGVIDSQSVKTTEAGGPRGFDAGKKIKGRKRHI
FT                   ITDTIGHLVGAVVHHAGIQDRDGAPDVLKSVKSLYPWLRPVFADGGYAGPKLKGRLTKI
FT                   GKWTIQIVKRSDAASGFVLLPRRWVIERTFAWLSRCRRLAKDFEATVTSATAWLFLVVW
FT                   QHGYNTGGRTRN"
FT   CDS             complement(138338..138574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01200"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01200"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79467"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:F0J185"
FT                   /protein_id="BAJ79467.1"
FT                   /translation="MRLFLHIGAYWLMWSLRSLMPRRSRWRGIQFDTLHLRLIKLAVRL
FT                   ETLKRSIRLHLPRSMPDQAILGYALARLPRLVS"
FT   CDS             complement(138706..139683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01210"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01210"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79468"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:F0J186"
FT                   /protein_id="BAJ79468.1"
FT                   /translation="MPATVETTPCLPGLSPVAGKPVLARFDGEMLSSDGGLLALREVEK
FT                   RLGIAAQLAACIDDPRTPEGVQHGLDEIIRFRMLMIAAGYEDGNDADWLRNDPMFKLAM
FT                   ERLPEAGDLCSQATVSRTENLPGPRALLRMGLAMVEHYCASFRTIPNRIVLDIDDTFDA
FT                   AHGAQQLCLFNAHHNEYGSQPIVVFDGDRRMLAAVLRPACRPKGAQIVKWLRRLIDAIR
FT                   GHWPRTAIMLRGDSHFCTPAVLRFCRARRLDYIFGVARPRRCANTSSRWRPAPRRARNR
FT                   LRERKSGGSKSSMMAQQAGTASSGSSPASRPGRWGAIPASSSPA"
FT   CDS             139816..140238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01220"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01220"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79469"
FT                   /db_xref="GOA:F0J187"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:F0J187"
FT                   /protein_id="BAJ79469.1"
FT                   /translation="MVDGLKGGPEAITAVFPETIVQTCIVHLLRNSMDFVSYKDHKAVA
FT                   TALKDIYRTGPLMPKPPRQLSPPSTPVHGGQKYPDIGQSWRRVWQEVIPFFSFPGEVRR
FT                   IIYATNAIEALNSKLRRAIPARGHFPAMRPRPSCSI"
FT   CDS             complement(140312..140650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01230"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79470"
FT                   /db_xref="UniProtKB/TrEMBL:F0J188"
FT                   /protein_id="BAJ79470.1"
FT                   /translation="MVVLDLVETTPDLTLVEVQERLMKERSERFGISTIWRFFGGHRIT
FT                   LNKKIGHAVEQDRPDVLKRRREWFEDQVDLEPERLIFIDEAGGVRNSLYGWRLNIRPAG
FT                   PLRSDCRR"
FT   CDS             140655..140954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01240"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79471"
FT                   /db_xref="UniProtKB/TrEMBL:F0J189"
FT                   /protein_id="BAJ79471.1"
FT                   /translation="MALDPFRAAVAAHLHWCRRTPLPAQLHPAYRRRNPNPEAFSRQTV
FT                   RHAAINRRYDAYTNPAKLPSPYACQPPSPANIVNHLSPDTGIPTRFFGSEAALK"
FT   repeat_region   141124..143321
FT                   /note="Belongs to IS110 family"
FT   repeat_region   141124..141142
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 19 bp inverted repeat"
FT   CDS             141240..142280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01250"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01250"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79472"
FT                   /db_xref="GOA:F0IY11"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:F0IY11"
FT                   /protein_id="BAJ79472.1"
FT                   /translation="MDIMILGIDLGKNSCSVVGMDAAGRVVLRRRLRRGTLESFVGELG
FT                   SCIVAMEACCGAHHLGRIFAARGHEVRLMSPEYVRPYVKAQKNDDLDAEAIAEAATRPT
FT                   MRFVPVKSQDQSDLQALHRARERLVSERTALINHLRALLLERGIVVPQGRRKLEAELET
FT                   LAEDGGFAALSPRIRTLIEDLRAEWRSLDQRITGFDAEFVQLARDDVAVRRLTKIPGIG
FT                   TINATALAAAVGEAHAFKRGRDMAAWLGLVPRQMTTGGKPRLLGISKRGNRYLRKNLIH
FT                   GARAALPYLVERDTPLGRWARGLLDRAHKNVVVVALAAKLARIAWAVLAHGCDYDAQFE
FT                   AAAAAA"
FT   CDS             142554..142901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01260"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01260"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79473"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:F0J191"
FT                   /protein_id="BAJ79473.1"
FT                   /translation="MERFVLTDAQWARIEPHCLGKASDPGRCGRDNRLFLEAVLWIVRT
FT                   GSPWRDLPSMFGNWSTAYRRFNDWRRADVFKRIFDAVSDEPDMEYAMVDATIVKVHRHG
FT                   QGAKGGLKARP"
FT   CDS             142919..143305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01270"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01270"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79474"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:F0J192"
FT                   /protein_id="BAJ79474.1"
FT                   /translation="MTTKILALTDALGNLVRFRLMPGNRYDSIEVPPLIDNVEFGGLIA
FT                   DKAFDSNALVAELNERGARIVISQHPARALKLKIDHETYKWRHLIENFFCKLKEFKRIA
FT                   LRACKTDQSFQPMIHLAAAVINSR"
FT   repeat_region   143303..143321
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 19 bp inverted repeat"
FT   CDS             complement(143324..144529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aatA"
FT                   /locus_tag="ACMV_01280"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01280"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79475"
FT                   /db_xref="GOA:F0J193"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:F0J193"
FT                   /protein_id="BAJ79475.1"
FT                   /translation="MIQFSACVGRTRPAATFAMAARARALRAAGHDVISLSIGEPDLPT
FT                   PPHVVDAAHRAALGGQTRYPPIAGTDALRCAAARKFERDQGLPATPADVLVTNGGKQAI
FT                   FDAVMSVIDPGDEVLIPAPCWAGYIQVVEFAGGIPVFIDCPAEAGFRVDAATLAAAIGP
FT                   RTKLLVLNYPNNPSGAIADAAMLIGIADVLRRHPHVLTISDDIYEHLIFEGAYLTLAAA
FT                   APDLAGRVLTMSGVSKSYAMTGWRLGFCTGPRDWLAAMTLVQGTATAGVSTISQAAAVA
FT                   ALDGPQDLLEERRTIYRRRRDLVLGALAGAPGLTCSRPEGAFYAFPSITSLLGCRTPSG
FT                   RILGNDEDVANALLDEALVATVPGSAFAMPGHIRLSTAASDALLEEACERILRFCITTC
FT                   NH"
FT   CDS             complement(144561..146762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01290"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79476"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:F0J194"
FT                   /protein_id="BAJ79476.1"
FT                   /translation="MLDQVASAPALHENMTNAADVIAAGVALDAGNTRECARKLFQQAS
FT                   ELAPSWDEPLIRLAQSYRADGHVAEAKELYIQASIRNRWRIEPLLAYGILALQSNDPHD
FT                   AVGYLSRATDLNPTNHQAWHGLALALGALGLQGAALRAMANAGNLAPDILHYAITYNEL
FT                   RDTVDHDLILQIREPKWTTAIELCLEANAALRRGGAEEAIALLETAIDVEPDASDILAL
FT                   LGNAYLANQMPEMAELHLRKALLRAPENIDIANDLAVALGRQYRFGDASDILNKLDIPA
FT                   NASSTILLNRATIRASAGDLAGSARDIKAATPKANDRSRLRAECSLIPYQSNATAELLL
FT                   DSTRKLAATLPEDCEPLMKPSVVDPDRPLRIGLLSHSLRQHPVGWLTFAGLENLDRDAY
FT                   ELYCFGHFAAGDPFAQRLARRAHKWQDRITKYEAEIASNIADCNIDILIDLSGFGDNGL
FT                   IGSLAYRPAPVQIKWVGSQASTTGMKRVDWFITDRWETPEGFDQYYTEQLLRLPDGYVC
FT                   YSPPPTSPPVSNLPALANGHVTFGCFNNLTKLTDETLSLWGRILEQVDNAHLLLRCPQF
FT                   SEDGIPERFISRAHALGVDTSRVELRGRAPHPEFIEGYKDVDIALDPFPYSGGLTTCES
FT                   MFMGVPVITLAGDFFAARHSVSHLSNVGLTDCVTESPEQYIDRAVAMSSDLEALAARRA
FT                   RLREQMLTSPLCDAKRFGRNLGAALRYAWQDYCRNGCRA"
FT   CDS             complement(146755..147546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01300"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79477"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:F0J195"
FT                   /protein_id="BAJ79477.1"
FT                   /translation="MSDLHSNSQLQPAVRGDNSSVNRVLFARVRQLIDQGQVNAASLLL
FT                   PTLEKRGENPGTIVALSAAIEFVKGRHARAKEIVSDGLAAFPENSIILCFSAEISLEEK
FT                   NWVEAAKAASEAVVADPRNSTAKSILGRALLELGHIDDAATCLREVLDEMPANFLALAG
FT                   LCRSAPAEAEDTLRNILRDGDEEHSDRPQDDLRLRHLLISVLIERGAYTEATDQIRRLV
FT                   AEGRADLDTSLLAVQAAVGTGNWDEATLLFSDNTRSLPRHA"
FT   CDS             complement(147612..148523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01310"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79478"
FT                   /db_xref="InterPro:IPR010626"
FT                   /db_xref="InterPro:IPR023157"
FT                   /db_xref="UniProtKB/TrEMBL:F0J196"
FT                   /protein_id="BAJ79478.1"
FT                   /translation="MDLAGEHISRRHLMSSTLSPNIATLFTSSVNTTSSSIASILEASY
FT                   GGATSGTVTSSQNPIIALRIAQQNETKDIQAEAKSPQVQRDIAAFTKAVNSAKTAKQLL
FT                   QNPTVLKVLLTANGLGSQVGFPALAQKALLSNPSDPNGLANQLSSTNSQWLSTAQIYQF
FT                   ATKGLSIIQKPSSISTLTNAYAEVLWRQSLDKQTPGLSNALYFIQNAQKFTNATQILGD
FT                   SVMRSVVTTALGVPQQIAFQPLLAQEQAITSRLDVSKFQNKQFVQSFADRFLAVTQASN
FT                   MNAYGSSSSLVGLAAQARSLIA"
FT   CDS             complement(148858..149256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flbT"
FT                   /locus_tag="ACMV_01320"
FT                   /product="putative flagellar FlbT"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01320"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79479"
FT                   /db_xref="GOA:F0J197"
FT                   /db_xref="InterPro:IPR009967"
FT                   /db_xref="UniProtKB/TrEMBL:F0J197"
FT                   /protein_id="BAJ79479.1"
FT                   /translation="MSVLVLELRQGDIMILNGAPIRFRTKSRIELTAKARFMFGKQILR
FT                   PDEVNTPAKQIYFALQTAYIGTDEERQSALVRARELIEQFKEATTSALAREILDRALEC
FT                   AKSDDCYEALKLSRRIMRHEAAVLQSCQ"
FT   CDS             complement(149328..150212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01330"
FT                   /product="flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01330"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79480"
FT                   /db_xref="GOA:F0J198"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:F0J198"
FT                   /protein_id="BAJ79480.1"
FT                   /translation="MSGVVSSIITNSAAMVGVETLNSINTSLNNVQNQISTGYSVSSAV
FT                   DNGAAFAVAQSVRTNMAGLTAANQQLGDTQGLLATTNTALTNISNLMQSMDATLVNLSS
FT                   STISTSQKSQYVAQFSSQLQNLQYYIKGASYNGKALIGASSGTLASSSSSFTSKALQVS
FT                   SDASGGQIKIAAQSMTTVYLALSKIGTSLGTASAGSTTITNWMTAGGTFSTQVSNVGSY
FT                   LNTYGNLTNQVDAQITYNQNKMDALSNGLGALVDANMAAESAKLQSLQIQQQLATSALS
FT                   IANQQPSILTKLI"
FT   CDS             complement(150308..151369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01340"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79481"
FT                   /db_xref="GOA:F0J199"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:F0J199"
FT                   /protein_id="BAJ79481.1"
FT                   /translation="MSTSIASLSTGNFGLIQQLAADSSITSQKLAQLTIQSQTGYVATT
FT                   YAGLETAQPGSAGQTLILNSSIATLNNTISNLKIAQGQMGVQQNAIQTISDIASKALTQ
FT                   FEGVNSLSGSALSTAAATARSAVTQIASLLNSQDGTRYIFSGQDSTIPPVPNATSFTSA
FT                   AFYVSIQSATNSLSVSGVFAAASNTTNSPFSSTLASNPGVPSVLGAGGVPITTGIAANA
FT                   NQFIGPSVGTNTTGSYMTDILATLSAIGSLQPGQLSNSGFTNFANAISTSLGNAINTMA
FT                   QDAGALGNNQALVNTQITDLQQTSNAFTNQVAGFDQVDMTKTLSQLSATQTQLQASYQL
FT                   IAAVKTMSLTQYI"
FT   CDS             complement(151366..152823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="ACMV_01350"
FT                   /product="flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01350"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79482"
FT                   /db_xref="GOA:F0J1A0"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1A0"
FT                   /protein_id="BAJ79482.1"
FT                   /translation="MSVGTGLAIASSGLSAIDQQLAVVSQNIANANTSGYSVETANLSS
FT                   ATAGGQGSGVISAPATRQVNTSIQTQVNNSIAQQSYQAVISTTLSGIDQVMGTPGQGND
FT                   LPSLLANVQSGFQTLMTDPSNVVQQNTVVSAAKTLTGQINSIASTLQSASQSAASTITE
FT                   DLKKLNSTLSTIGSLNAQIVNLAQQNKSTADLANQRDAAIQTIASLTGAKALTQTNGSI
FT                   ALFTVNGIQLPLNGSSPITATTTTNSTSYSIGGTPVTFGGELGGAQQLNNATLPQIQAG
FT                   LDSFSQALSSRFAGAGLSLFTDPIGNVPTAATKGLSAVITVNPAVISNPALVRDGNVTV
FT                   TNASGTPIPPNPAGGPAGYTALIQNVLNSAFGTTTVGGSAQPPAITAYTDATGTVSLPY
FT                   SGSGSLSAIATNFTANEASISSAALTQVSNVGNLVTALKAQASSTSGVNIDQQMSLLVT
FT                   LQNAYAANAKTVTIAQQMWQAVQAMVQ"
FT   CDS             complement(152866..154143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="ACMV_01360"
FT                   /product="flagellar hook protein FlgE"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01360"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79483"
FT                   /db_xref="GOA:F0J1A1"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1A1"
FT                   /protein_id="BAJ79483.1"
FT                   /translation="MSIFGALDTSVSGLQAQSSAFTNISDNIANSQTIGYKGVNTHFTN
FT                   YLVQSTASNNGPDSVVANPEYTNTVEGTITQSSNPLSLAINGNGYFNVSLPGPTTTTAG
FT                   KTTQTFDAQQYYTRAGDFTLNSSGYLVNGAGAYLDGWSVNPTTGTVNTSSLAPIQVSQG
FT                   ASPPVPTSNVTLSATLPTTPSSTPVTTQVDVYDSLGNMQPLNLSWSPVTGSANTWTLNV
FT                   SSPNATPSTVGSATMAFNTNGTLSSITAGTGATSPAAGQLQISPSYNGSAQPITLDFGA
FT                   PGSTAGLTQYAGTSLNLQGVSQNGSPSGAFSNLSIDTQGNITANYTNGFSKQIAQIPLA
FT                   SFASPDALQNKSGQIETATQASGAATINAVGGSGGALVTGSVENSNVDIATQFTDLINA
FT                   QQAYTANTKVVTAAQQILTTTVNMVQ"
FT   CDS             154328..156085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01370"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79484"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1A2"
FT                   /protein_id="BAJ79484.1"
FT                   /translation="MDIALQILPACLRECSASRLSSRIFVWPISCMWGGMSIGTAISAV
FT                   PATSTASAAAGATSGCGTAAPASTSAVPTSDSSGPASVSGTRTISAGQGSADCGAGKAA
FT                   SGSFSAALAGASASSSQHAAGNASQSPSSTTDAKSASDPHAHHGNGNGTSSAALMRDRT
FT                   ASPPGAAYANAQGMAPVATEHGKAPNKSGHHDLARANAGPSSGQAQQAQAVQTSQPTPV
FT                   SAGLSAQASAALAVQALSSHQVADIAPQSDSHAPVVPGLARQVTPATDAKAQSVPVEGS
FT                   AGSPGSATTGSSSQLAASSGSTTSGVPHSTIDSLAREAIGRLQSAAGGQAHHTAAAGPS
FT                   SSATAHASAETRISATSANSTVARQVQPAMSSAGPAPVVSISSSAVPALPGGGETNGAA
FT                   SSASSNSVSGQIAAALVGVSQIQPPQGSSSATPGTRLTIALAPPAIGTVTLQIDRHADG
FT                   SLTVAIGASHADTLQQLQNDRNTLNQVLTQAGLPDTHRTVTFDLIAPHADASGSHQASV
FT                   GAGANGFGGGFSLAGGGPNGGSSGSEGSGRLPVYVRSPAAAAGIAPAVDTVSSVPAVTL
FT                   RRFGVNVVA"
FT   CDS             156134..156895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="ACMV_01380"
FT                   /product="putative flagellar hook capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01380"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79485"
FT                   /db_xref="GOA:F0J1A3"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1A3"
FT                   /protein_id="BAJ79485.1"
FT                   /translation="MTSSVASVAYQQSQLTAAANAAAAGIGSSTSSSGTSGASGTSSTS
FT                   GTSGNSTTSALGALSSNYNDFLTMLTTQLQNQDPTSPMSSSQFTSELVQFSQVEQQIST
FT                   NQSLTQLLQLTQAGDLTQASSMLGSKVTATSSQLPLQNGTGTLNFTAPTSGPVAIAVYN
FT                   GAGQQILDTSMNATAGSNSWTWNGKDASGTTVPDGAYKVAVVEGGANGSTTTLPFTVTG
FT                   TATGVTSGSNSVSLQMGGVSVPFTAVTNVTK"
FT   CDS             complement(156989..158440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01390"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79486"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1A4"
FT                   /protein_id="BAJ79486.1"
FT                   /translation="MRNISNQAGDVPARSATRKLRRAACAAGVISLFGLAPLAHAQSLG
FT                   DALRQTTFQGMIGAIHFDYANNGHTSKSTHSFAIGGHLIAHTGSFNGFSVGLGGYTAQS
FT                   LGLYSKNDTHYYSELTGSYFGIQSFRQAYLQYQTPKVEIRFGRQLIQTPYANQDYNTFN
FT                   PRAFMGVAGVVNVLGNGSDKVDAGALSLEDNPAAFSVFMTRMFDYESRYSSSFTAANRY
FT                   SGTKPTNGFIAIGARYHGDVGSMQLTAQAWYYDFYQYAQMVYGQLDVVQPLSNGQAIFG
FT                   AVQALTEGNSAGNSNNIAALTNNNVGSVNAHVYGAKLGYSFGDGSIALVGDYAPTEYNS
FT                   FHHGGVVHPYNDNTGTSFTDTMQTGIANLGPGYAYGVTTSYAFLNKKLKVDVSYIRYLA
FT                   RYGFGGDSRNYTYGGAYGFSSTNYIPNQQLWALDASASYDLSSVLKGLSVAEDTDIAQA
FT                   ENRAGYTQYNHNPYFSSRFYLEYNF"
FT   CDS             complement(158440..158751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01400"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79487"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1A5"
FT                   /protein_id="BAJ79487.1"
FT                   /translation="MTLKTLLSSGFLKSKNNSCKRARGSAAQKSNGDGTMPTSATEAHH
FT                   AVCTISRATQFPRVFHVAWPGAVNAPVYPLQMAKQRAGSARKARISPAKKSFNMEVQP"
FT   CDS             158767..160014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01410"
FT                   /product="transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01410"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79488"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1A6"
FT                   /protein_id="BAJ79488.1"
FT                   /translation="MASRLGRRDDSAGEGARMTRARVNSALVRRINSARLFHMIRQNPG
FT                   ISQQKLSQISGIDPATISIIINNLESGGIVRRDTDAPTGRAGRPTTALSLDPRAGYLAG
FT                   ISVEPDAIRIVISTIDGTACADLAVPGSTAPEAAIAAARSGVTAALRSLRATRATLLAA
FT                   GVAMPALVSTGGRIVFAPNIGWRDLDVAENLAQKLKVPVRVENDVKAAALAEHLFGASR
FT                   DIADFVYVMGRSGIGGGLYLMGELYRGPHGLAGEIGHMKIVPGGRACGCGGQGCFEAYV
FT                   SEKAILSDLAARGHGARDVASVRKACEAGDPVARAVLAEAGRHLGLALANLINIISPRR
FT                   IVLGGSLAQLAPFLLPAAMETLEANALAAIYRDVEIVVSEMSGSAAAMGGIALALQQFL
FT                   DDPPVRLDRARPTPSL"
FT   CDS             complement(160370..161602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01420"
FT                   /product="amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01420"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79489"
FT                   /db_xref="GOA:F0J1A7"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR017830"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1A7"
FT                   /protein_id="BAJ79489.1"
FT                   /translation="MTRVHVIGAGMAGLSAATTLAARGRRVVLYEAAKWAGGRCRSYHD
FT                   AALGCRIDNGNHLLLSGNRSTMTYLRRIGAEETLTGPSHPLFPFIDLISGDAWTLRLNR
FT                   GRLPWWVLRRGWRVPGTDALDYLALRRLERAAVTDTVAGMLGGLGTLYDRLLEPLAIAA
FT                   LNTKPETASAAPMAAVVRESLARGGAATIPRMPKIGLSESLVDPALAFLRASGAELRFG
FT                   ARIAGLTMTDARVTGLVGPNVDEIVGSDERVILATPPWVAAELLPGLTVPDAHEAIINL
FT                   HFRAGIDPGPAGFYGLIGGAAEWVFEKPEVVSVTISAANDRLEQETDRLAAEVWSDLRR
FT                   GFGLPRAMPPWRVVKEKRATFAATPEQLARRPGSSTRLVNLRLAGDYTATGLPSTIEGA
FT                   IRSGESAAQHI"
FT   CDS             complement(161599..162471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01430"
FT                   /product="putative squalene/phytoene synthase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01430"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79490"
FT                   /db_xref="GOA:F0J1A8"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017828"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1A8"
FT                   /protein_id="BAJ79490.1"
FT                   /translation="MFIPANAARFADDAATVAAATRAAGTSFYRGMSVLPAPRRTAMYA
FT                   IYTFCRIVDDIADEEAPLAAKREGLDAWRRRIDALPEGGDDPVTRLLRDASLRYALRRE
FT                   DFHAIIDGMEMDAGAPIIAPDMATLDLYCDRVASAVGRLSIRVFGEVSAQGDRVAHHLG
FT                   RALQLTNILRDVGEDAARGRIYLPREALEAADAAANPATLLADPGLKRAMAEIAGLAEQ
FT                   HFAEAAAAMRGCDRRAVLPARMMADAYRPLLGVMRAAGFAHPERRPSLPAWRKLRLAAE
FT                   LLIRTDRHR"
FT   CDS             complement(162471..163307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01440"
FT                   /product="putative squalene/phytoene synthase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01440"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79491"
FT                   /db_xref="GOA:F0J1A9"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017827"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1A9"
FT                   /protein_id="BAJ79491.1"
FT                   /translation="MSAAASIEHASGKDRGDENFPVGSWLIRAGLRRHVHAYYAFARNA
FT                   DDIADHPDLAPAEKIARLNAMEAVLDGDDPTRSPSAARLRESLAETNVDPVHARELLVA
FT                   FRQDATKTRYASWDELMRYCRYSAAPVGRYVLDLHGESRQSWPASDALCASLQVLNHLQ
FT                   DCAKDFDTLDRSYIPGDWLQAVGLGPDAVTAKATPPALRSVFDAMLKRTAELNAKAARL
FT                   PGFVVARGLRVETAIIVGLARRLHRRLLREDPLAGRVKLRRNDAISAVLAGLPRLL"
FT   CDS             complement(163304..164431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01450"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01450"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79492"
FT                   /db_xref="GOA:F0J1B0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR017832"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1B0"
FT                   /protein_id="BAJ79492.1"
FT                   /translation="MTLLALLALLAWIYLYLLHGQFWQSGPELAPARPATAVPVDIIVP
FT                   ARDEAETIGAVVQSLLAQDYAGPFRVILVDDGSTDRTGDIAIRAANGDPRFALLRGGEK
FT                   PAGWSGKLWALEQGVAHGAAPVLLFTDADIVHDPRHLATLAARLVTPERGARLDMVSEM
FT                   VRLNCESAAERALVPAFVYFFQMLYPFARVNDPLDGTAAAAGGTVLIRREALERAGGLA
FT                   AMHGALIDDVTLAGRVKRGGAVFLGHSGLARSIRPYPRLAEIRAMISRTAFTQLHYSGL
FT                   LLALTLAGLAVVWLVPPLALLFGHEVAALCGLIASLLAVLSYQPTLRRYGRGWYWGLAL
FT                   PLIALVYMEATLASALRYWRGTGAAWKSRDYGADA"
FT   CDS             complement(164428..165513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01460"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01460"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79493"
FT                   /db_xref="GOA:F0J1B1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017829"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1B1"
FT                   /protein_id="BAJ79493.1"
FT                   /translation="MAGMSSDSSSPLETVARPIADDRPVLVTGATGFVGAAVARALVRH
FT                   GFRLRLMHRASSDMRNLAQLPGERVVGDLTDPNSLAQAVEGCSHIFHVAADYRLYVPDP
FT                   AAMRAVNIDGTIALFRAAQADGACRMVYTSSVAALGLTHDGSPADEATPHAAEDHVGPY
FT                   KRSKYEAELAVKKLVAEGLDIVIVNPAAPVGPGDIKPTPTGRMVLDAARGHMPAYVETG
FT                   MNIVHVDDVAEGHVLALTRGRRGESYILGGENLMLSEIGRMITRLAGKPPPRVKLPIGP
FT                   LMPVAALMEAWARISGHEPLMTRDMLTMARKRMFYSSEKAVRELGYHARPAEEAMRDAL
FT                   ADFCRRGLLPSLAFEPDGATA"
FT   CDS             165661..166710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01470"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79494"
FT                   /db_xref="GOA:F0J1B2"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1B2"
FT                   /protein_id="BAJ79494.1"
FT                   /translation="MKSSVRILSCPSLLAERRVVIRRLGIWPAVFALVGLLLFTGTIAW
FT                   LGWGDVIRALERISLPGFIAYLGVQMVIIAGLALAWRLLLRRRYGGSFLLLYWGRMVRD
FT                   SAGEFLPFSHVGGFVIGGRAIALGGVSFADAAASTLADVTLEFLAELVFVGIGVILLVA
FT                   LVPDSALVLPMSIGLAMALVAGLSFLLMQKGMSRLFSGLAMRIAGQSADAASIGIQRLQ
FT                   SALDTIYARRGRLIAAGAMHLLCWFGTGVASFVAFRALGQNISLRDALAIEALLHAILS
FT                   TGFFVPGRLGVQEAAYTLLGAVFGIPPDIALSVSLLRRARDLLIAVPVLLAWQGIEARR
FT                   LQPVSGDLG"
FT   CDS             166780..167034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01480"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79495"
FT                   /db_xref="GOA:F0J1B3"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1B3"
FT                   /protein_id="BAJ79495.1"
FT                   /translation="MHLIGFIILGLIAGWIASQIVDNGGKGPILDIVLGIVGALVGGQI
FT                   FLALGFAPGGGFLYSLFVSVVGAVIILVAYHALLGRRRL"
FT   CDS             167078..168259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01490"
FT                   /product="putative acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01490"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79496"
FT                   /db_xref="GOA:F0J1B4"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1B4"
FT                   /protein_id="BAJ79496.1"
FT                   /translation="MVAREEGSAIGRLIRLDGLRGVLAIYVLVGHLVPFLPLPPLAMWA
FT                   AQGLVSHGLAAVDLFFALSGLVIVQSMTRFGRRPGSFLVARARRLLPVYMIVLVGSTLL
FT                   MLKGGSPFATMPWLAPGDPAADIWPAGPPQHPVFEILAHLVFLHGALPHRLLPDGPFAL
FT                   LGPAWSLSTEWQFYAVIALVALRCDGRDGTLVRLSLALIGLAVLARIYAACIPAPWRFS
FT                   RAFLPNEAAYFALGVAASRFWSGDRVGAWRLFVIMLIMTMALGASHGAGWGRLAKLLPP
FT                   LAWAIAVAAQRVPAWRPFRLLARCLGSPPVLWLGLISYPLYLVNEPVGRALALALGPIL
FT                   SGSPLLFGLCWGGATVAGSIILAAMLHYGIERRFLRRRRIVRPPVAVPATGGA"
FT   CDS             complement(168219..169403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01500"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79497"
FT                   /db_xref="GOA:F0J1B5"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1B5"
FT                   /protein_id="BAJ79497.1"
FT                   /translation="MLRAFRFALVAITLLGIAWFLAGLQGHVTVEIGTYAATASTPVAI
FT                   LLLVLLIVVVVLVLGLLRGALSLPRRISVRRGRARRDAADSAALRALSALAAGDTEAAA
FT                   GHARTARRHAPEAPLTLYVSAETARQAGDAAGAEALFSNLAKHGDAGFLGWRGLLTARP
FT                   LPQDDPDRLARSAEQARQAAASYPNSAWLREQRVRIALGQGRFSEAARLATDPAARAAL
FT                   AIMASREVAGEPLAIDWARDAVRLAPGLPEAHLALFEARAKAGQAWRAKRALKRGWRIA
FT                   PHPDLADAWLAALTSPLERATAAAKLAELNPGHPESEALLARTARAANLVGEAERHERH
FT                   GGGKGVWVCATCDTEHEAWQPTCRKCGAIGSLGWLRRTNPESTPRLLPAPQPAA"
FT   CDS             complement(169403..170356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01510"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79498"
FT                   /db_xref="GOA:F0J1B6"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1B6"
FT                   /protein_id="BAJ79498.1"
FT                   /translation="MTEHDPNQTPTAPSATGEPALAAAPEPQAADPATAQAATDVPRHR
FT                   RTALGLVTVAILALAVGEVFLLRAQFDAAGQSARIAQLSTRIGALRNRVASLEQKLTTV
FT                   AAEAKKPVPAEPAPALPADLAARIGKIESSIAALSTTTLADHAAVTRLRQQSGDLPALA
FT                   AKAKTLALIAQASLNLQNGLPLGNIPGAPAALAAYATAKPPTLAGLKASFPTYAEAATH
FT                   AAGDAAPQGGFWQRTKARVESLVTVRHGDKVLIGSLAEGILGKAQAALGRDDLKATLAV
FT                   LAKLPPDAATAMKPWTEKASGLLAARTALAGMAEKA"
FT   CDS             complement(170353..171132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="ACMV_01520"
FT                   /product="putative uroporphyrinogen III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="protein synonym:hydroxymethylbilane hydrolyase
FT                   [cyclizing]"
FT                   /note="protein synonym:uroporphyrinogen-III cosynthase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01520"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79499"
FT                   /db_xref="GOA:F0J1B7"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1B7"
FT                   /protein_id="BAJ79499.1"
FT                   /translation="MQRDWGRNSVPRCGATARPTSFLTDTGATEPLTVLVTRPEPGGSA
FT                   TAAALRAAGYVPVLAPCLEIEPLPGALPTLVDGIVIASTQALPGLPPALRAVPLFAVGD
FT                   ATAARARAAGFIDVASAAGTARELAALLGERLAPGARLLLACGAGHSMDLAADLRGRGF
FT                   RVTRRVVYRSRPARQLDAAAQAALEAGEIDRVMVFSPASARRFVTLITEAGLDGALAGA
FT                   IAVAISPAAAAPLTRLPFRDIRSAVSPDQDHMITILA"
FT   CDS             complement(171059..172066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="ACMV_01530"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01530"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79500"
FT                   /db_xref="GOA:F0J1B8"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1B8"
FT                   /protein_id="BAJ79500.1"
FT                   /translation="MKMHQESSSGSKVAPHSGRRLPLRVGTRGSPLALRQTDMFLAALR
FT                   EICPALGFAPDAFAPEIISTTGDRVTDRPLAEIGGKGLFAKEIHEALLDGRIDFAVHSL
FT                   KDLETALPDGIILACTMKREDARDALILADGLGPVNDGDIWSSLPKGARVGTSSVRRQA
FT                   QLLHARPDLQIGLLRGNVRTRLDAARIGTFDATLLALAGLRRLGFEEEVAAAIDPEAMV
FT                   PAACQGIVGITVRAADSRLAELLAAIENHEAKAVSKAERALLAALDGSCRTPIGGHARL
FT                   LPDGNLHLTGLTARPDGSFLLKRSEVANAADAARLGAELGASLRRDSPADIFLD"
FT   CDS             172084..173175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01540"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01540"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79501"
FT                   /db_xref="GOA:F0J1B9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1B9"
FT                   /protein_id="BAJ79501.1"
FT                   /translation="MERKAASGDALGHDSLILGIESSCDETACAVLDGAGRIRAEFVAS
FT                   QIADHAPFGGVVPEIAARAHLALLPDMIHRALAATGTTPSGLVAIAATAGPGLIGGLIV
FT                   GANTARGMALAADVPFIAINHLEAHALTARLPDTGGNPPNFPYLLLLVSGGHTALIAVE
FT                   GVGRYRRLGTTLDDAAGEAFDKVAKLLGLPYPGGPALERLAAEGQGGRFDLPRPMLGRP
FT                   GCDFSFSGLKTAVAQLVARQPEGGLPRDFAADLAFAFQSAVVAALADRLRHALAMLPGA
FT                   TAVVVAGGVAANKAVRAALADIAAGAGLPLAAPPLRLCTDNAVMVAWAAIERLRAGDAA
FT                   DPLGVRCRPRWPLEHVRNMQIAG"
FT   CDS             173330..175846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="ACMV_01550"
FT                   /product="glycogen phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01550"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79502"
FT                   /db_xref="GOA:F0J1C0"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1C0"
FT                   /protein_id="BAJ79502.1"
FT                   /translation="MSNVSTRDHSDLPASGRAPGPAVPLALAPIRSVADWRDAILAKLV
FT                   YALGRDQRTASDRDWFEALALALRDRVVAHALDSDNLTRAAGHKRVYYLSLEFLVGRLL
FT                   VDTLTNLDMTGLTRAALGELGADFERVRAAEPDAALGNGGLGRLAACFMESAASLAIPT
FT                   CGYGIRYENGLFRQEIRNGVQVELPEDWLAAGNPWEIRRPERDCDIGFGGHVEQVGDDD
FT                   GATRCVWHPAELVRAVAHDTPVIGWRARHANRLRLWSARAVAPLRLDAFNAGDYLGAVA
FT                   DDVRARSVSRVLYPSDTTPAGQELRLRQEYFFSAASLHDILRRHLAEGYDLSRLPDMAA
FT                   IQLNDTHPAIAIAEMMRLLVDRHGTAWNEAWRITCGCFSYTNHTLLPEALETWPVALME
FT                   RLLPRHMQIIYRLNADHLEAARAKGAASDSLQASLSMIDETQGRRVRMGTLAFVGSHRV
FT                   NGVSALHTGLMRETVFHDLHVLHPDRITNVTNGITFRRWLFEANPRLTGLLVDVLGDAV
FT                   LDDPSVLAGLRGLAGDPGLRARLIACRRANKVALSNLVGEQLGIGLDPDALFDVHVKRL
FT                   HEYKRQLLNILEAVSLWQAIRARPAAGWVPRVKIFAGKAAASYAQARLIIRLINDVASV
FT                   INSDPVTSDLLKVVFLPNFNVSLAEIIIPAADLSEQISTAGMEASGTGNMKFALNGALT
FT                   IGTLDGANIEIRDHVRADNIFIFGLTAAEVAVRRLDGWHPEFSIVASPALAGAIEAIGR
FT                   GTFSPGEDTRFAPIVDELRRTDRFLVTADFDSYAEAQRRVAALWRDRDAWWRAAVLNTA
FT                   GMGPFSSDRAIGEYAEKIWHVTGLER"
FT   CDS             175905..177176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgC"
FT                   /locus_tag="ACMV_01560"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01560"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79503"
FT                   /db_xref="GOA:F0J1C1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1C1"
FT                   /protein_id="BAJ79503.1"
FT                   /translation="MNGRTERTTPLSRSAMAYVLAGGRGSRLHELTDRRAKPAVQFGGK
FT                   WRIIDFALSNALNSGIRHIGVATQYKAHSLIRHLQLGWAFFRRERNESFDILPASQRIS
FT                   EQNWYLGTADAVYQNIDIIESIGPEYIIILAGDHIYKMDYEVLLQQHVAQQADVTIACV
FT                   EVPLADARGFGVMHVDESDRIIDFLEKPANPPPIPGREGVALASMGIYVFQRAFLFDVL
FT                   RRDADDPHSKHDFGGDIIPALVREGRAFAHHFARSCVRSAQEPEPYWRDVGTIDAYWEA
FT                   NIDLTDFVPALDIYDRTWPIWTHTEGTPPAKFIHDEEGRRGQAVSSLVSGGCIVSGASL
FT                   RRSLLFTGVRVNSFSQVSDAVILPGADIGRHARLANVVIDRGVRIPEGLVVGEDPEDDA
FT                   RRFRRTAQGVCLITQPMLDRLMTA"
FT   CDS             177179..178618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgA"
FT                   /locus_tag="ACMV_01570"
FT                   /product="glycogen synthase"
FT                   /EC_number="2.4.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01570"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79504"
FT                   /db_xref="GOA:F0J1C2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1C2"
FT                   /protein_id="BAJ79504.1"
FT                   /translation="MRVLSVGSEIYPLVKTGGLADVMGALPAALSSEGITVRSLVPGYP
FT                   AVTAALDRAESVLRIPDLFGGAAEIRAAAAGRHDLFVLDAPHLYARPGNPYIASNGADW
FT                   SDNAQRFAALCRAGALLARGAVGGFVPDLLHAHDWQAGLVPAYLHYEGHAAPPCVFTVH
FT                   NLAFQGWFPAHLLGGLGLPASAFVIDGVEYFGGIGFLKAGLQFADAITTVSPRYATEIA
FT                   TQDGGMGLDGLLRKRGSAVHGILNGLDTATWNPATDEHLAARYDVANLAARAVNKRAVQ
FT                   ARMGLAPDPRALLFGVVSRLAGQKGIDLIIEALPVLDALGAQLAVLGTGETGIEASLRE
FT                   AVAARPGRVAAIIGFEESLSHLIQGGADAILVPSRFEPCGLTQLAAQRYGAIPVVSLVG
FT                   GLVDTVIDANPVAISAGVATGIQFGPVSEAGLSDGLRRAAALFADPDKWSRMQRNAMAL
FT                   DVSWTEPARNYAALYRSLTSR"
FT   CDS             complement(178626..181718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01580"
FT                   /product="efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01580"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79505"
FT                   /db_xref="GOA:F0J1C3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1C3"
FT                   /protein_id="BAJ79505.1"
FT                   /translation="MNVSSIFIRRPIGTTLLALGILIAGALAYLQLPVAPVPSIPIPAI
FT                   VVFASDPGASPAIMASTVAAPLEHALGTIPGVNDIRSQNSVGSTSVVLLFNPGPDISVY
FT                   AHAVQAAINAALPNLPASMPRRPYYKEFNPASRPVMSLALTSDTMSLAQIYNVADTVLD
FT                   QRLAQVPGVAQVGIYGGGSPAVRIRLNTQALAAAGLTSADVYNAVRSANVTQPLGVIEG
FT                   PHRAWTLVANGQLTSATQYRDIVLKSASGALLRLSDVASVIDGVANTQLAASANGKPAI
FT                   TIEITKTADANVIKTVEGVRKLLPDIRTWLPPSVKLSILNDRTTTIRASVADIQITLLI
FT                   TILLVLAVVTLFMRRMTPTIAAGVTVPLSLAGTVGVMWALGFTLDNFSLLALTICVGFV
FT                   VDDAIVMIENIVTQHERGLSGIEAALVGARQIGFTVISITISLVVVFLPLTLMGGVIGD
FT                   LFYEFAMTLSVAILISGAISLTVTPMVCGHFMGRTPKVGRDSRIARGIDRLYRRSLDAY
FT                   ARSLDWALAHRWLMLASFALTVALTIFLYIKVPKAFIPEQDSGLIISHTMAPSDVSFSR
FT                   MKRLEARVVAAILKNPAVDTVSSRIGVANGFSTANRGQMFIQLKPLSERTASAQEVVRQ
FT                   LQARLARIPGITTFMFVAQDLFFGGQSNGGEYSFSVVDPSLAGLDQVTTEIERKLRTLK
FT                   QVDNISTDQNKAQTQITVEIDRNAAARLGVSIAAIDGVLQNAFAQQQISRIYEAENQYS
FT                   VILKVPEGLDRSPVDLQHIYVAGTKGPLPLSAVAHYVRATAPLSVTHLDGLPAGTISFN
FT                   VAKGTSLGQAITAVKQAIASLPLPASVKISFGGNARYFMKSVSDEPLLILAALIAIYIV
FT                   LGVLYESLVQPLTILSTLPSAGVGALLALLVTGTPLSVIGIIGIFLLMGIVKKNGIMLV
FT                   DFALNAEREHDMTPAEAIRAACLERFRPIMMTSLAAALGALPLAFAVGTGEQLRRPLGI
FT                   AVIGGLIVCQALTLYTTPVIYLALTGFGRRRARRLATLPAE"
FT   CDS             complement(181722..184919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01590"
FT                   /product="efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01590"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79506"
FT                   /db_xref="GOA:F0J1C4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1C4"
FT                   /protein_id="BAJ79506.1"
FT                   /translation="MNISAPFIARPVATSLLAIALLLIGAMGYRALPVSSLPQVDFPTI
FT                   QVVTKLPGASPDTASKLLTAPLERQFGQIAGLAAMSSISSQGTSAITLRFDLSMPMTTA
FT                   AQDVQAAINAASGTLPPNLQYPPTYSEVNPADAPILTLALTSRTLPLDAIADAAQTRLV
FT                   PKLSQVKGVGKVTVEGGLTKAIRIEVNPARLAAYGVSLEDVRNAIANANQSGAKGALDG
FT                   HNQAYTIGANDQITMPAQYRDLIIAYRNGAPVRLSAVGTVSPGLENDLQSASYDGTPAV
FT                   VVDIQRQPGANIVSTVADVRAALAGLRAAMPPGIDVKVVADRTGTIRASVRDVQITLIT
FT                   AALLVVLVIFLFLPNPRAVLVPAVALPLSIVATFAVMNELGFQLDNLSLMALTVASGFV
FT                   VDDAIVMIENIVRFIEQGESPLRAAYLGSAQIGFTIVSLTVSLVAVFIPLLFMPGVIGR
FT                   LFSEFAVTLSIAVVISAVVSLTLTPMMSARLLRGAEASQPGRIARAAEAALASVRERYR
FT                   AGLAWSLRHQRLMLATFGATVVATGILFAIIPKALLPQEDTGAIVAVTEGAQSISLDAM
FT                   TRLQDRAIRAIRADPAVAGVTSLLGSGLTNPTPNTGRLGITLKPIGQRPAIDTVMSRLQ
FT                   ARLAGIPGLHAYMQPVQDITLSSRVSPTQYQYTLTDADQTELDAWAPKIRAALAALPQI
FT                   TDLASDQQNQGLETYIDVNRAAAARLGISMATIEATLYDAFGQRQVSTIYTQNAQYRVV
FT                   LGVDPAYARSPQALASIYVPTGSLSASVSSTALGPGGSVSGNSTTATGAAGSVSTSVAG
FT                   EVPLLEVAKIDQRYGPLAITREDQFPSVTLSFNLAKGASLGAAESAIRSAEQKLGVPDT
FT                   ISGRFSGAAAEFETSLAQEPWLIFAALVVIYIVLGVLYESTIHPVTILSTLPSAGIGAL
FT                   LALMLFGADFTLVALVGIVLLMGIVKKNGIIMVDFAIEAERTRGLSPEAAITEAAILRF
FT                   RPIMMTTMAALLGAVPLVLEGGAGAELRAPLGITIIGGLLVSQLLTLFTTPVIYLAMDR
FT                   LRPARREAPAAQTGPAE"
FT   CDS             complement(184916..186076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01600"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01600"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79507"
FT                   /db_xref="GOA:F0J1C5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR022824"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1C5"
FT                   /protein_id="BAJ79507.1"
FT                   /translation="MAKRRGRIIFGLVALALVGAVAYRLAHRTKPAHGGGATAIPVEVA
FT                   KATRQNVPVYLDALGTVVAYHTVTVQPMITGPLTRILFTPGQFVKKGDLLAEIDPAPYR
FT                   ATLDQAEAKLAQDKASLANAEMQARQYASLVKQNYTSKLQAATALATAAEDRALVKQDE
FT                   ASIETDRINLGYTRITAPISGRTGILQVNAGNIVSPSTTSGIVVINTLQPISVQFSLPQ
FT                   QDLPAIIAAMKRGKVDLLATEEGDPQTAKVLDHGTLAVLDNTVNANTGTLTLKGTFANP
FT                   DLTLWPGAYVNVRTLVRTIDNAVTVPPVAVQQGPSGSFVFLVKPPAKKGGSFTVIDQKV
FT                   TLGVQTARVVVVTSGLVPGDEAVTEGNSRLKGGSAIHIVTGSAGAP"
FT   CDS             complement(186079..187587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01610"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01610"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79508"
FT                   /db_xref="GOA:F0J1C6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1C6"
FT                   /protein_id="BAJ79508.1"
FT                   /translation="MRQTSKNTSGLKSYRDEKTGAERPEARDTTTNHRMRRLRLAAAAL
FT                   LTPGLAGCAVGPAFNMPQTNVPARFSATADAKPAWPKPGWWRHFGSPELDRLVEAAKAH
FT                   NFSVIEAIDQLEAANAQAQIAGAPLLPAITGSGSGSFQQIQANAGNGLQAVDTRSFTAT
FT                   FQASYQLDFWGKNYDALRAAQANAAAAEFNAATVALTAEASVATVYFQVLAYQDQLGIA
FT                   QRNLKAAEGLLAQLRAELRAGIVDAPTVAQQAALVASERANIPNLVSQMRQEAIGLGIL
FT                   TGRAPEFLRVRGGSLGALTVPALAPGLPAGLLERRPDIAEAKANLIAANANVRGAIAAF
FT                   FPSITLTGSGGWQSKALNLLFAPGSTLISAATSIAQPIFEGGTLTGQLRVSRATYREDV
FT                   AKYEQAVVQAFTDVETAMTALRYATDQEALQQVAVARARAALDGARAQLRAGVVDIGTV
FT                   LNAEQTLLSDETTLVTTRLTRLDAAVNLYKAMGGGWTAGAGKDH"
FT   CDS             complement(187616..188170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01620"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79509"
FT                   /db_xref="GOA:F0J1C7"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1C7"
FT                   /protein_id="BAJ79509.1"
FT                   /translation="MILLRHGQSEFNLHFTATRRDPGIEDPGLTEHGHAQAEAAASALE
FT                   GHSLRRLIVSPYTRTLQTAAPVLARRPLDVEISAEIRERFHFTCDIGSPPDRLAERFPD
FT                   HDFAHLPTRWWPDETETEEAVIERANRFRAAMAARPDWRETLVVSHWAFILALTGQSLT
FT                   NGSWINYDPTSPPPSALRWRP"
FT   CDS             188297..188962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01630"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01630"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79510"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR016985"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1C8"
FT                   /protein_id="BAJ79510.1"
FT                   /translation="MHTGFPVDIVLLALVAGFLVLRLRSVLGRRTGYERPPMPEPTAAG
FT                   GMQRPGGPVIEGVAEPPRSTRPVPAPHTVVGQTLARIAQAERGFDPARFLDGAEASFRR
FT                   IVLAFAAGDLAALRPLLTPGVFATFEQAVAQRAEAGETQHTEIVRIVEATIDEAELLGG
FT                   EAVIVVRFVSDQQNYTRDRQGQVIAGTEAMTEIVDLWSFEKSLGAADPTWRLAAARSG"
FT   CDS             188966..190168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01640"
FT                   /product="putative transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01640"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79511"
FT                   /db_xref="GOA:F0J1C9"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1C9"
FT                   /protein_id="BAJ79511.1"
FT                   /translation="MHRSTLRGLAAPFTAITLLAGCALPPAGAPKADHAGLTPVPFATL
FT                   PGWSVEAAVAGLPSFQRSCKVIAVMPVDQTLGGVGVAGALGGKAGQWRAACAAAEAVPP
FT                   DDAAAAQHFFEAWMVPYAASGATRITGYYEPVYPGSEIRERGYDVPIYGRPRNLVNANL
FT                   SAFRDSSGKRRIVGRLRYGTMVPYYTRAQIEAGEINREAKVVAWVKNPVDAYMIQLQGA
FT                   ARLRLPDGTLIDLGFDGTNGRTYTPIGKLMVEKGYLKPDQVSITSIRAWLLAHPVEARG
FT                   LMDANKNYVFFKRIRGVPDDLGTPGALDVPLAPEGSIAVDEKAIPLGAPVYVATKSLAR
FT                   LTTAQDIDVGAHGTSAAQIFFGIGNEAAAQASAQDGTGRIFIFLPRQPAAAPTSAKGAS
FT                   S"
FT   CDS             190165..190956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01650"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79512"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1D0"
FT                   /protein_id="BAJ79512.1"
FT                   /translation="MSESAAAAPRVALFVTCLADLYRPSVGFAAIRLLEAAGCTVEVPR
FT                   AQTCCGQPAYNSGDHETARALAEGLLTALAGYDYVVAPSGSCAGMLRKHMPGLFEADPD
FT                   LRFKADVIAAKTFELTSFLVDVMGFAGLDVALPQRATYHDSCAGLRELGVKDQPRVLLS
FT                   RVEGLEIVEMDTPEVCCGFGGTFCVKHPDISARMVSDKTADIAATGAELLLAGDLGCLL
FT                   NMAGRLTREGKPVAVRHVAEVLAGMTGEVAPIGRGRDGSAA"
FT   CDS             190953..192845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kup"
FT                   /locus_tag="ACMV_01660"
FT                   /product="potassium transport system Kup"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01660"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79513"
FT                   /db_xref="GOA:F0J1D1"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1D1"
FT                   /protein_id="BAJ79513.1"
FT                   /translation="MSESATPHGSPGEKLRLAGLIGVLGVVYGDIGTSPLYAVQASLSY
FT                   FPGNKLQESDVLGLLSLIFWALIITVTIKYVLLIMRADNEGEGGTLSLMALAQRVTQSD
FT                   RTKWIIGIIGICGAGLFFGDATITPAISVLSAVEGMEVVSPGLKEFVLPIAIAVILVLF
FT                   FVQRFGTARVGGAFGPIMVIWFVVIGALGLHQIFIHPNVLRALVPVYGAAFIMRHDLLA
FT                   FIALGSVVLAVTGAEALYADMGHFGAKPIRVSWLFFVLPCLLLNYFGQGALVIRDPHAA
FT                   SNPFFFLLPHALVVPMVILATIATVIASQAVISGAYSVARQSTQLGLLPRMPIRYTNET
FT                   EQGQIYVPPVNSFLFVVVVLLVLGFGSSSALASAYGIAVTGTFLSTNALAAFVYCRHFN
FT                   WPLRRTVLVFGAIGLVDFAFFSSNVLKVFDGGWVPLAIGFSLITVMTTWRRGRALLHQR
FT                   WQQDSLPLASFLGRLPQSRIVRVPGVAVFMTGNPEYTPSSLLHNLKHNKVLHETVVFVT
FT                   VRNPGVPFVGDARRAKVEELSEGVYRVLLSFGFMESPNIPRALDLLREQGLPFNPMQIS
FT                   YFLGRETIVAATVPKLGFIRRAIFLFMLRNAISATEFFKIPSDRVVELGVRIAI"
FT   CDS             192851..193348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01670"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79514"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1D2"
FT                   /protein_id="BAJ79514.1"
FT                   /translation="MAVAIPRAVAADGTELHLVPIPPARLPRVQKRDLEQAWEAAHRAA
FT                   RAGAEGPRRGFRFAGGPDVVLRDRDARVWASSVDHIADLSTAHGVSVCLRLLGLVALLA
FT                   GGGWTARFVRFDRGAAELDGALLGAAARTGLTDTGALDENALRAQLLPRESEENPPCRA
FT                   PS"
FT   CDS             193330..193674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01680"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79515"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1S9"
FT                   /protein_id="BAJ79515.1"
FT                   /translation="MPRPILTLALLILPLAACTFGAPPPASPAEQADIAACTQQANAYE
FT                   RARDYAYLSRTDQFATPFQGTPDQGSRFDRLAEIHARRDMISRCVRNANPAYVGSGASL
FT                   PEPTIVGPAR"
FT   CDS             193796..196354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01690"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01690"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79516"
FT                   /db_xref="GOA:F0J1T0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1T0"
FT                   /protein_id="BAJ79516.1"
FT                   /translation="MKPLGYSIVNRFDPEALFAPKTIMLSGGDTAVGRSLRASLDAAGF
FT                   PGDVREPGEGAQTVDLALIADPPEAVPGVIAGLAGRLRGAAVVYAAVDGLREAALAARV
FT                   RVVGPRSFGIAAPGARLNALRSHIPPPPGRVALLGQSPALARAVIDWAAPNGIGFSHVV
FT                   GIGGNADIGFGRVLDHLSRDPGTGPILMEIAGLRDPRLFLSAARAAARLRPIVAIVPGA
FT                   RLGDPSGIALAGFEAALRRAGVMLTTSLGEFLAAAETLTRARPARSDSLAIIGNSVGAC
FT                   RLAADTALAAGIGLAALSDETRRVLGLLLGASPEPAGPIALQDAPGTRLADVAAMLAAS
FT                   PEVGGVLVIHAPSGPADDAAIAGLIACSGSIKAPLLAAVLGETTAAPQRRRLAEAGVAA
FT                   FATPERAVEGFGDLLRHRAIRAAARELPPSAVLDVAPDRAAVHAALSLARNGGRTALPQ
FT                   DAGFAILRAYGIETAATRIVDTPEHVAAAASSLGFPVVVKVSHPDLARRRPEGSVSLDL
FT                   PDAASASAAATLITARLRRRGEFPEGARFLVQRQLPRARELRILVGEQPFVGPTIGFGP
FT                   GGGDAADTSRLAFDLPPLNLKLAEGLILRAGGNALLRPARGLDEADRAAVAGTLVRISQ
FT                   LVVDWPEIERLEIDPLFATGAGVIAANVRITLHAPGERRQPLPITPYPAHLAHTMTLKG
FT                   RGFQIRPIRPEDAAAHQRLFSRLAPEDVRFRFFSAVRQLTPEQVVRLTEVDYGRELALI
FT                   AVETATGETVGVARLVRSDTDGTEGEFAVLVEGAAKGVGLGSALMRDLIDWARDEGVVD
FT                   IIGQVLADNHPMLAFIRHLGFAIAHVPGEEDVVEARLRLT"
FT   CDS             196391..197290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01700"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79517"
FT                   /db_xref="GOA:F0J1T1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1T1"
FT                   /protein_id="BAJ79517.1"
FT                   /translation="MEAMSDIARPSSPVSGFLSRPNAPVLVLLSVTVIWGWTFLLTRLS
FT                   LPFIGPYAFVGWRFGVAALAVVLVTRPHPASFNRMEITGGITIGLVLFLGYGLQADGLR
FT                   TVASGESAFLTALYVPMVPLLEFLIFRRRPGLFATAGLVLAFVGLVLVSGMTGLSLAFD
FT                   RGQWLTLGGALGAALEIVLIGHSALAADPRRIAIVQLATVSVISFAVEAVRGGIMITTR
FT                   AFPFAAMTGMGLATAFVLVAQNWAQRSIPANRATLIYTLEPVWAGLVGAAFGEIFAPAQ
FT                   VLGGVLIIASVVLSQWKS"
FT   CDS             complement(197358..198233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01710"
FT                   /product="putative 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="protein synonym:beta-hydroxybutyryl-CoA
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01710"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79518"
FT                   /db_xref="GOA:F0J1T2"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1T2"
FT                   /protein_id="BAJ79518.1"
FT                   /translation="MEIRTLGVLGAGAMGNGIAHVAALSGLDVVLVDTAQAVLEKSMAT
FT                   MRKNLERQVQKGTIDAAAEAAALARVSPMTTHDAFAKCDMVIEAVPEREEIKRAVYAQV
FT                   IPHLAPHAILASNTSSISITKLGRASGIAERFVGMHFFNPVPMMKLVEVISGLETTDAT
FT                   VAAVEDLAKRMGKITIAAQDMPGFIVNRILVPMLNEAIFALHEGIGDVVSIDNGMKLGA
FT                   GHPMGPLTLCDLVGLDVALEVMRVLHAGLGEDKYRPCPLLVNYVEAGWLGRKTGRGFYD
FT                   YSTNPPTPTR"
FT   CDS             complement(198317..199252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="etfA"
FT                   /locus_tag="ACMV_01720"
FT                   /product="electron transfer flavoprotein alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01720"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79519"
FT                   /db_xref="GOA:F0J1T3"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1T3"
FT                   /protein_id="BAJ79519.1"
FT                   /translation="MAEVLVLIEHDGAHVKQPARSAVAAAAKLGTVHALVAGENVGGAA
FT                   QEAAAIAGVDKVLVADSKALAHALAEPLADLIVKLAGNYTHVLATSTATGKNVMPRAAA
FT                   LLDVQPISDIAGVVDADTFVRPIYAGNAMATVKSADTKKLITVRAASFDPAPAEGGAAA
FT                   IETIEVGVDAGGSSFVGAELSKSERPELTAARIVVSGGRGMQNGENFGKLLDPIADRLG
FT                   AAVGASRAAVDAGFVPNDYQVGQTGKIVAPDLYMAVGISGAIQHLAGMKDSKVIVAINK
FT                   DEDAPIFQVADYGLVGDLFTVLPELQKELG"
FT   CDS             complement(199255..200004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="etfB"
FT                   /locus_tag="ACMV_01730"
FT                   /product="electron transfer flavoprotein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01730"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79520"
FT                   /db_xref="GOA:F0J1T4"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1T4"
FT                   /protein_id="BAJ79520.1"
FT                   /translation="MKLLVPVKRVVDYNVKVRVKSDGSGVELAGVKMSMNPFDEIAVEE
FT                   AVRLKEKGVATEIVAVSMGVSACQETIRTALAMGADRGILVETEAELQPLAVAKMLKAL
FT                   VTREQADLVIMGKQAIDDDMNATGQMLAALLGWPQGTFASKVAIADGTVTVTREVDGGL
FT                   ETVALKLPAVVTADLRLNEPRYASLPNIMKARKKPIETVKPEDLGVDPAPRLTTLKVAE
FT                   PPQRKAGVKVGSVAELVEKLRNEAKVI"
FT   CDS             complement(200109..203183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01740"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79521"
FT                   /db_xref="GOA:F0J1T5"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1T5"
FT                   /protein_id="BAJ79521.1"
FT                   /translation="MRRRLRQAGRVAGHVGHHGARLAGTLVLVALLLLGGAAWRLGQGP
FT                   VDLPPLAARIGAAVSAAEPGLTVTVGRAGLAWEGFRRGGAPIDLRLADIAIRNRSGVVA
FT                   ARISTLRVTLSLAALIKGAITPIRIIAHDPAIVLRPALQAPGGLAAPPEAVGELLALIS
FT                   QSPRTGLLDLSALRAIRIADAHVAIEPVGALPELVATDGALVFTRHPGGRMGGAASADF
FT                   HNGGEVIPLGLTIAGNAGAGRVTALLGPFDPGRLMKPGSPFTAVDLPVMLAASWPVGRF
FT                   TTPELDLGVSAAAGGIAAGTGQVPIAGLQAHAVATRNEVLLSDARIDLAGPNGTAGPAV
FT                   RLRGRIALRGALPAAIDATVDQVSATDLTRYWPQGLLRDARHYVTRHIKAGVARDGRFH
FT                   AVFDLATGKLAPGAVTGEFAASGVTLDWFPGAPAMTALAGKLHFAADDSLDIDATAGRL
FT                   DGLALRGNMRITTLSRHDQTATIDAHATGGLADALGLLRKPPLRLKTTALKLDRATGQM
FT                   AATIHASVPLKRRLALADIAIRADAALTAVHLPLPFAGLALEDGSAALEVDPHHLALHG
FT                   NGRVAATATRFTAAMTLPGGPLTLEAKANATRLALARMGLPVAAWRSGAAPLTVTYRDQ
FT                   AGGGVLEIGADLTGATLAAPAFGWHKAAGQPGRATLRIGLSGGGPFGGLEAAHVEAPGL
FT                   LFDGVRRAGRFAVAMARLGQLRARGSVAPPARLGAPWRISLSGGTLDLSALIAQARAQA
FT                   GTAAAAPRPASGPVWALNGTFAQLRLHAAPAPLLGATQLAATGDGDRLTGLEATLVQGP
FT                   RQTGRLTYRRAGGVTRIRLDAPDAGALLAATGATGGVNGGTLTLDATRQGGLTKGRLGI
FT                   DDFRLTEVPVMAKVLQALTIYGMPAATSGPGLAFTRLVAPFTMSGEVVTLGGARAWSPS
FT                   LGFTTTGQIDLARKRYDLSGTIVPAYALNTLPGRIPLIGRLFSPEKGGGLFAARYTVVG
FT                   PFGAPRVVVNPVSALAPGFIRDLFGIGPPEAPAKP"
FT   CDS             203201..206110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="ACMV_01750"
FT                   /product="glutamate-ammonia-ligase adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="protein synonym:glutamine-synthase
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01750"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79522"
FT                   /db_xref="GOA:F0J1T6"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1T6"
FT                   /protein_id="BAJ79522.1"
FT                   /translation="MNEFLALASGFPPPADTRAAASFVADFAAIGAAARRFADAAPGRA
FT                   LLDCLGGNAPHLANLALRESDIPPRVLAEGAGPVMDEALALLREADPLATRAAIGRILR
FT                   EVKRRAALAIALADLSGAWGVEQVTAALSDLADASIGLALRHLLRHLHERGTISLPDPA
FT                   DPERASRFAVLGMGKLGARELNYSSDIDLVLLFDPSSSVYRDDSQSAMARLARDLVPLL
FT                   TERDADGMVFRVDLRLRPDPAATPPVVSLAAALSYYESQGRTWERAAFSKARPVAGDRD
FT                   FGASFLEQIRPFIWRRNLDFAAVAEIHGMKRRIDQRRRDAPGRIAGRDVKLGRGGIREI
FT                   EFIVQTLELVWGGHEPALRIPATLPALRALAAAGHLPRAAARDLAAAYRALRQVEHRLQ
FT                   MVEDRQTHTLPETEAGLARFATFMNMPDAARFAAWLDAVCETVNAIFADFFDTDPGSGK
FT                   DGAPDPGESGAAPDAFAGQAQSLGFADPQHLAVRLRLWRNGTLPALRTARARELLDSIM
FT                   PALLRALGRQTDPDLAFRRFDRMLERQSAGVSLLSLFQHNPALLDRLATVLGAAPPLAD
FT                   HLASHPGALDALLAPVARFTRPGPALRRLLRDAADLETALDTLRRFVRREEFHLAVATL
FT                   ERRIGADQASLWRTDLADAALAALLPRVMADFAARHGRVRGGRFAIVALGRVGAREMQP
FT                   GSDLDLMLIYDHPPEAAAARLPPSQYFLRLAHALVAAITAPGAEGAIYAVDMRLRPSGN
FT                   KGPVAVSLAAFRRYHAEEAWTWERLALTRARVLAATRGFAPVVDAEIRAALARDIPPAT
FT                   TCADTVAMRARLARDAPPAGPFDLKHRAGGMMELGFIAEALQLVHFRGAPSRFRQRTAE
FT                   ALAELEACGALDPAEAGALAAADRWYRAVQAMRRITGLADPRPDSPKSALAPILAAAGA
FT                   LDFDGIIATMEAQAAVVRTSFVRHLGDPRGITNPRGDTA"
FT   CDS             206107..206580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01760"
FT                   /product="putative alkyl hydroperoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01760"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79523"
FT                   /db_xref="GOA:F0J1T7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1T7"
FT                   /protein_id="BAJ79523.1"
FT                   /translation="MSVAEGDQAPDFTLPATGGRTVSRAGYKGRPFILYFYPKADTPGC
FT                   TKEACAFQEALPVLGGIGIDVIGVSKDKMPALEKFAAKYNLAFPLASDESGAVVEAFGA
FT                   WVEKSMYGRKYMGIDRSTFLVGADGRIAKAWRGVKVPGHAKAVMDAAAALPKA"
FT   CDS             206577..207152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01770"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79524"
FT                   /db_xref="GOA:F0J1T8"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1T8"
FT                   /protein_id="BAJ79524.1"
FT                   /translation="MTPPGGATGATDRDARLAPRRIARRQPLRHIRSMTSHRRYGLFLA
FT                   LAAFAALGTAYFAQDVLRMIPCPLCYIERWPWRIAAALGILAAILPRLPARVLIGLAAL
FT                   ALFVNVAIAFVHVGAEQHWWKSPLPECNAPPPSFGANLPLRPSASCDAPVFLIPGLPIS
FT                   FATMDLIWSLVVALAASAHIFRDRRSNA"
FT   CDS             207149..207697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01780"
FT                   /product="putative ubiquinone biosynthesis protein Coq7"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01780"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79525"
FT                   /db_xref="GOA:F0J1T9"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1T9"
FT                   /protein_id="BAJ79525.1"
FT                   /translation="MSKDIDYLPGDRPPRAEIARMIRVDHAGEFGAKQIYAGQLAVLGR
FT                   GRHGDTLRHMKAQEQVHLDTFSRLIGERRVRPTALLPLWRIAGFALGAATAAMGPRAAM
FT                   ACTVAVEETIDAHYAAQRDRLGDAEPELSATIETFRQEELEHRDIGLANEAEQAPFYRL
FT                   LSGTIRAGCRAAIAISERI"
FT   CDS             207767..208420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01790"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79526"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1U0"
FT                   /protein_id="BAJ79526.1"
FT                   /translation="MSSTERFEQDLVRAAFELGAAQGWRRVSVAAAARHGGLDLDRARR
FT                   SFACSGMILARFGRLADMHALHGAATDGAVRDRLFDLIMRRIDFLQQHRAGVIALMRHA
FT                   PTDPLLACWLTRANLAAMGWMLEGAGISSAGLRGAIRKRGLLAVWAWTLRAWLRDESED
FT                   LSATMAALDVALMRAEQAALQFAGLPRAPVAADPAGDAPFTPDPDLSDEAADNA"
FT   CDS             208504..208977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01800"
FT                   /product="phasin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01800"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79527"
FT                   /db_xref="InterPro:IPR010127"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1U1"
FT                   /protein_id="BAJ79527.1"
FT                   /translation="MAESPKSKHGAEHNPMSAFMPDFDFTKAFSSIKVPAMADAEVVLA
FT                   AYRRNLEALSEANRVALEGAQAVARRHMEIMQKTMADLSEQLRNLSSVSTPQDRAAQQA
FT                   ELLKHAYESAVANMRDLGDLIQRSSHDAVETLNKRFSEAMDEMKHLVEPKKKS"
FT   CDS             209006..211192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="ACMV_01810"
FT                   /product="UvrABC system protein B"
FT                   /note="protein synonym:excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01810"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79528"
FT                   /db_xref="GOA:F0J1U2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1U2"
FT                   /protein_id="BAJ79528.1"
FT                   /translation="MTATIAAPRLPFIPERQGARPMHKPLRVVSEYEPSGDQPGAIADL
FT                   VRGVRQGERDQVLLGVTGSGKTFTMAKVIEQVQRPALILAPNKTLAAQLYAEMKSFFPE
FT                   NAVEYFVSYYDYYQPEAYVPRTDTYIEKDAQINEAIDRMRHAATQALLERGDVIIVASV
FT                   SCIYGIGSVETYSQMVVRLEVGGSIDRDRLAKALVELQYRRNDAAFQRGTFRLRGETVD
FT                   IFPSQYEDRAWRVTLFGDEIESIAEFDPLTGEKVTDLPAIAIYANSHYVTPRPTLTQAI
FT                   GKIKVELQQRLHEFTETGKLLEAERLQQRTTFDIEMMETTGSCKGIENYSRYLSGRNPG
FT                   DPPPTLFEYLPDNALLIVDESHVTVPQIGGMFKGDFARKSILSEFGFRLPSCIDNRPLK
FT                   FEEWESFRPQTVFVSATPGPWEMERTGGVFAEQVIRPTGLVDPVIDVRPVEHQVDDLLA
FT                   ECRATSQAGGRVLVTTLTKRMAEDLTEYLTENGVRVRYLHSDVDTLERIEIIRDLRLGA
FT                   YDVLVGINLLREGLDIPECMLVAILDADKEGFLRSATSLVQTIGRAARNVDGRVILYAD
FT                   TMTRSLKYAIDETERRRAKQTAWNEAHGITPQSVKKQIGEIMHSVYEQDYVTVAPIRDS
FT                   GATEFVGKDLKSTIAELEKRMRNAAADLEFEEAARLRDEIKRLEALELGLTPPPAPSSS
FT                   PQRRPRNRTPEPLGPGGGGYDPDKRRGGRRKRGP"
FT   CDS             211189..212016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01820"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79529"
FT                   /db_xref="InterPro:IPR015000"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1U3"
FT                   /protein_id="BAJ79529.1"
FT                   /translation="MKPVLTAALLAALALPAVAAAASPIHLVGQNATYTLALSKVRGHS
FT                   VTGATGRLEFDVRNTCDAYTVTQKMTLLIRNQDGTLSRTTSDYDTWEAKNGHRFTFLLR
FT                   QGDGKKMEVQDQGTAVMGPKGGEVTYLVPKGRTEKLPPGTLFPMAHTRAILEAAEAGKP
FT                   YIDPPLFDGTSTHGAEHTFVAILERQAAHHDRFAHLSKLPSTLVDIGFWPRTEKDDEPD
FT                   FRTQMRYFTNGVSRDVRLDFGNFVMDGKLTALTILKDTCPSGKAVPSAPTPKG"
FT   CDS             complement(212117..212644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01830"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79530"
FT                   /db_xref="GOA:F0J1U4"
FT                   /db_xref="InterPro:IPR005819"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1U4"
FT                   /protein_id="BAJ79530.1"
FT                   /translation="MTTVKAVAKKPTATKAAAKPPAKAAKPAAKTAAPKAAAKPATKTA
FT                   TAKAAPKKAAAAKAAPAKTPAKTAAKAAPKKAATAKAAAKPAAKATAVKAAPKKASAAK
FT                   STTAAAPKAKRTAATTRKTANGKPTSAARPTPTRRTAKPVVAKTPARRTRKSAEPAPAP
FT                   VPTATEGGEGSN"
FT   CDS             213333..213809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01840"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79531"
FT                   /db_xref="GOA:F0J1U5"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1U5"
FT                   /protein_id="BAJ79531.1"
FT                   /translation="MVPDLAVGMPAVVEDTEINWIASRQRTRSAVAMPGWRTAIGRGIR
FT                   MRCPSCGKVSAFEGYLRVRRECPICAAPLGRVPCDDAPIYLTLVIALHIVILSMVLADE
FT                   DGGMSWVESLVIFVPLALALLLLLLRPVKGATLAIMLKVNLLRPAAIRATPGNG"
FT   CDS             213802..214290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01850"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79532"
FT                   /db_xref="InterPro:IPR008321"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1U6"
FT                   /protein_id="BAJ79532.1"
FT                   /translation="MADGAAEIRGRLRRVVLDEDIGGALSPMQEADRNQAIADLAADNR
FT                   FALGTHPDAVTILHLSVQDGRLVFDVRDEADETLQTLVLAPGPFRSMIRDYQMLLDSYA
FT                   TAVAEGREARIQAIDMGRRGLHNEGAELVMARLDGKVLLDFDTARRLFTLICALHRRA"
FT   CDS             214414..215517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnA"
FT                   /locus_tag="ACMV_01860"
FT                   /product="methylthioribose-1-phosphate isomerase"
FT                   /note="protein synonym:S-methyl-5-thioribose-1-phosphate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01860"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79533"
FT                   /db_xref="GOA:F0J1U7"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1U7"
FT                   /protein_id="BAJ79533.1"
FT                   /translation="MKIDGTPYRSIWVDDADRWSVRIIDQTKLPWAIEIPRLTTPEQIA
FT                   HAISAMLVRGAPLIGATAAYGVALAMRADPSDEALETVVPMLAATRPTAINLRWALMRM
FT                   QRALSAHPPAERADAAYAEAAAICDEDVATNRAIGEHGLGLIRARAQGRRRVNILTHCN
FT                   AGWIATVDWGTALAPIYMAHDAGIDVHVLVDETRPRNQGFSLTAWELGKHGVPHTVIVD
FT                   NAGGHFMQRGEVDMVIVGTDRVTRAGDVANKIGTYLKALAARDNGVPFYVALPSSTIDW
FT                   TIADGLGSIPIEERAPAEVTTITGRALDGSMLTVRIVPKDSTAANPAFDVTPARLVSGL
FT                   ITERGICAANERALAAMFPDQALQTAA"
FT   CDS             215514..216326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01870"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79534"
FT                   /db_xref="InterPro:IPR014545"
FT                   /db_xref="InterPro:IPR019262"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1U8"
FT                   /protein_id="BAJ79534.1"
FT                   /translation="MSTAALRRLGLVAILAALAGCAARPDAHAPPFANKPYAAFSRGAA
FT                   IRIAEGEWRYWGSPVIDGPADDEPVLSPPALQERDNAGWQEVGLYWWIGMNAGHPEDRW
FT                   TGKHDAAGRVFPRAVNGSYAWSAAFISYVMRMAGAGPRFPYAADHARYIDAAWCAAHDG
FT                   AKHPELLAENPETHAPAPGDLICAGRASAAHITYADLPTSGYFPAHCAIVVAATPSELS
FT                   VIGGNVDNTVALTHVPLTASGTLLHRDGTIVDPRYDWFVVLRVLYRRD"
FT   CDS             216341..217675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rarA"
FT                   /locus_tag="ACMV_01880"
FT                   /product="replication-associated recombination protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01880"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79535"
FT                   /db_xref="GOA:F0J1U9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1U9"
FT                   /protein_id="BAJ79535.1"
FT                   /translation="MARTPSPDGDLFGEAATAQTSAPRGAVPLAERLRPHELAEVIGQP
FT                   HLVGPDGTLTRMLERGSLASLILWGPPGVGKTTIARLLADRAGLVFVQISAVFSGVADL
FT                   KRVFEEAARRRRTGARTLLFVDEIHRFNRAQQDGFLPVVEEGTITLVGATTENPSFELN
FT                   GALLSRCQVLVLRRLDDDALEQLLRRAEAVTARKLALTDAARAALRAMADGDGRAILNM
FT                   AEQLFAANPSAPLDEAALATIIARRAALYDRDREEHYNLISALHKSMRGSDPDAALYWY
FT                   ARMLAGGEDPRYIARRLTRFAVEDIGLADPGALTQAIAAWEAYERLGSPEGDLAIAQLV
FT                   LYLATAPKSNAAYRAFGAARRAAQATGSLMPPAHILNAPTKLMKNLGYGAGYEYDHDSE
FT                   EAFSGQTYFPDGMSRETFYRPAGRGAEQEIKRRLLHWAKLREDRE"
FT   CDS             217672..218646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01890"
FT                   /product="pseudouridine synthase"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01890"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79536"
FT                   /db_xref="GOA:F0J1V0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1V0"
FT                   /protein_id="BAJ79536.1"
FT                   /translation="MSVRIVTVGPDQADMRLDRFLRSLHPGLTQGAIQKFCRTGQVRVD
FT                   GKRAEASTHLAAGQAVRIPPVPETPAPKPRQTVVANEWDVKELNARILHRDADVLVIDK
FT                   PAGLATQGGKGIARHLDGMLDALRFDAAERPRLVHRLDRDTSGVLVLARNAFAANRLAA
FT                   AFRGRDMEKTYWAIVVGLPIPMEGQIDLPLARIGGAQGARTRPADRDDEDAAKAITDYR
FT                   TLDHAGRKFSWLELHPLTGRTHQLRAHCAAIGTPILGDAPYGEHLAFAEGFPRQLHLHA
FT                   RRLVLPHPRGGRLSVEAELPAHMKTTFATLGFTAPHATPARRG"
FT   CDS             218704..220647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01900"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01900"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79537"
FT                   /db_xref="GOA:F0J1V1"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1V1"
FT                   /protein_id="BAJ79537.1"
FT                   /translation="MHMPLSPEMMEERRFRSVKRGFPRIPPGFVHVMGLAVAAGALVPV
FT                   PTVRAADPQPYDVTFVPTGDAPLDKLIRQSSSLETLRRKLEVGPFALIARARADRKTFL
FT                   TVLESEGYDSGKVTITIDGHTLSDPALPDLLRKAPASPPARVRVAIAKGPLYHVGAVST
FT                   PGLADPAAAAALGVSPGEPATAAPLVGAAVRLETRLRNLGYAFAKVSPPVAEADDATHT
FT                   LSVTYPVSMGPRVDVGSITFTGMQRMNGRFMARHIALKPGQRYSQKALDASRDQLLGLG
FT                   VFSSVTASTAAAPRPAGQVPVTFTVRERKRHTVALGASYSSDLGIDANVSWTDRDLFGE
FT                   AQSLTLSLGATGIAGSGRSQTATFGKHTYVVAPGYDAKATYRVPDFIRPGQSLVATIEA
FT                   LKQYLPAYSRTAFLGSAAIAHPLAPHLTLDYGAGFVFEKVNQQGVSRTYRLLQLPVTLS
FT                   YNTANSLLNPTHGVKLALHVTPTLALGAGAKPFVITELTGSTYINLEAPGRGVLALHGV
FT                   LGRIFGASQFQIPPDQRFYAGGTGTVRGFTYQTVGPLFPDGIPEGGTAIDALETEFRQR
FT                   IGKHFGVAPFIDAGQVSANGTPFTGTLRVGAGLGLLYYTGIGPLRVDVGVPLNRAPGSS
FT                   SFAVYIGLGQAF"
FT   CDS             220647..224606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01910"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79538"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1V2"
FT                   /protein_id="BAJ79538.1"
FT                   /translation="MRRVFKVILWIVAILIALPVLAVLALDIALNTGAGRNFATHEINA
FT                   LSGGTVRITGLAGHFPKYIAARRIAIADRKGRYLVIDDAVLRWSPFSLLHRMIDISDLT
FT                   AKRIDILRQPVPAAAKPKPKPSAASGIPKVALVLGHLEIGRLAIAKPVLGHALALKITG
FT                   HARAKSLETIAAEIDATSLAGPGTYRLAATLDANRVNAHLTVHEPPGGPIAAFAGIASQ
FT                   PDLAKKPVDLSLTIAGPRDHAALRFASALGDLKARGTGTVDLSQTAPGGDLTITIPELA
FT                   PYAALGKQTLGGRTVLHVVAKHQRGATTLHFDDTVEITKATKPVPVLVGKRAMLAGDFT
FT                   LAGGKTTIHSLTLDMAALKVKLAGTATRLHVALKGTLIQPDIGLVDPQLAGHVTENLAI
FT                   DGPTDNLALHGTVDGLVTAKGVKSGPFHVTIDATHLPGAPQGNLTGTGSLYDSPLSLSA
FT                   AFARSAAGAVDLDLKTLSWKSLRGQGRITRAPGAMLPDGAMHLAMARLADLAPLLHMKL
FT                   AGAFTADFTHKSGQPAAIALTASHLTDGRTASLRAARIDATIDHLAQTPAIDATATLTG
FT                   VDTKAAAGNLTLTAKGSETALAVTAAGRFARLAGKPAQLDLGAMLDGKTRTIRLAKLDA
FT                   AARGVTARLLGPATISAGTTTSIRHLALALGGLGGAARITADGTIRPSLDLAAKITNLP
FT                   AGIARAADPKLAATGLLDATAHLTGTLAAPTGTIALQGRGLGLATGPGAKLPRATLAAR
FT                   ETLRGHALRGTIAATLGSARLSLDGTAPLALTGPMDLSFRLDNLSASLLHAADPKLAAS
FT                   GIITARARLTGTPRAPRGTVDLAAKSMRLLTGPASSLPPADLTAHETLLGQSVRGTARL
FT                   ALGNRADLTLAGTAPLSAAGKIDLALNGRTDLRLVDPLTAAGGTVVGGILTPDLRVTGT
FT                   LAAPGAAGTLTLAGGRVQNIASGLDLSAIDATITAAGRTIRLDRLSAKAGVGTIDGSGT
FT                   FGLAKPMPVDLRIAFHHASPIASDILTERLGGALSLTGDIDTGTRLAGTIAIETANIQI
FT                   PQGLPPSVVKLDIRRKGARPPPPTAPAPPVALDLTVDARNEVFVRGKGLFANLGGRLHV
FT                   GGTLASPQPTGGFHLIRGYFNLGGQTLNLSRGTVRFNGNGMMPVIDLEVSGTASDGTVS
FT                   TLALTGEASAPKITLSSSPSLPSDEVLAHLLYGSSTQNLSALQAASLAASLAELAGIGG
FT                   GGPDVVGGLRSALGLDQLSIGGGTSAPTINAGRYVAPGVYVGAQQSATGGGTGAKVEIN
FT                   LYKGLKLKTEVQSNSGTGGTTGPGESVGLTYQFDY"
FT   CDS             complement(224719..225996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="ACMV_01920"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01920"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79539"
FT                   /db_xref="GOA:F0J1V3"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034390"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1V3"
FT                   /protein_id="BAJ79539.1"
FT                   /translation="MSAIADITAREILDSRGNPTVEVDVILDSGAMGRAAVPSGASTGA
FT                   HEAVELRDGEPARFGGKGVQRAVEAVEGEIFDAIGGMDASEQVAIDETMIDLDGTPNKS
FT                   RLGANAILGVSLAVAKAAADEIGLPLYRYLGGVYARTLPVPMMNIINGGKHADNPIDIQ
FT                   EFMIQPVGAASIAEAVRMGSEVFQALKKILHDAGHNTNVGDEGGFAPGLKSAEEALGFM
FT                   TRAVEAAGYRAGEDIAFALDCAATEFYKDGRYHLEGEGKVLDAGGMTDYIAALAKSFPI
FT                   ISVEDPLSEDDWEGWAHFTSTLGGAMQVVGDDLFVTNPTRLRRGIAAKSANSILIKVNQ
FT                   IGTLSETLEAVELAQRAGMTAVISHRSGETEDATIADIAVATNAGQIKTGSLARSDRVA
FT                   KYNQLIRIEAELDIAGRFAGRTILRG"
FT   CDS             complement(226054..226515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01930"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79540"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1V4"
FT                   /protein_id="BAJ79540.1"
FT                   /translation="MDIRARLAENGITLPPAAKAVANYVPVVVAGGMAIVSGQLPLAGG
FT                   KLVVTGKLGDGVTVEDGTAAARACFINVLAQIEAHVEGGLDAVAQVVRLGGFIAATADF
FT                   AEHAKVMNGASDLAVEIFGEAGRHARSTVGVASLPLNAAVEVEGMFLLR"
FT   CDS             complement(226519..228045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01940"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79541"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1V5"
FT                   /protein_id="BAJ79541.1"
FT                   /translation="MRKDPASRHRPTPHRAWRGIRLKRVEIGIDPDAAPEPAIIPADWS
FT                   DQAAAGLVALRADRSMIGVDQAADAWIAPLAAAAERLGRGEDVASTLHRLVATRRAAPS
FT                   PGIWQGRAEPVPGFVFNLPQFLDESGMFDAAAFGEAVEHAVLALSLAQPSAQRLALGMA
FT                   DLALLLARLDIDYASPTARDVAATIGALLAAHADIASAGLLARGIAPGCAITPVPVPAS
FT                   CAQPGLRAALLDARERALACGLRQHRSLTGLLPPGPVEMLLDVETVGIAAPLSALDSEG
FT                   GLARWARARLAASGRTAESALAASLAGADPFGVTDAAGIAAMREAIAPVCAILPEVPSL
FT                   PAPRAASAGRGKLPARRGGYTQKVSVGGHRLFLRTGEYPDGRLGEIMISLPKDSATLRG
FT                   MAEAFAGAVSIGLQHGVPLDEFVDEFAFTRFAPAGAVEGDAMISQATSLLDYVFRHLAA
FT                   TYSQRPDLAALDLADDAAGVDAAAPLLPLDLPETGTGRPKRQRPVLKLVS"
FT   CDS             228155..228643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01950"
FT                   /product="putative NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01950"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79542"
FT                   /db_xref="GOA:F0J1V6"
FT                   /db_xref="InterPro:IPR007763"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1V6"
FT                   /protein_id="BAJ79542.1"
FT                   /translation="MPARGWTDPTVSCIAGGMNEHRDTADASTVPTLASLGGLRRLIAN
FT                   PGLTLHTLRHGLMVGQDSFGNRYFEERRASRPDGRKRRWVIYAGGAREASLVPPEWHAW
FT                   LHFTTDAPLSEASRRPWQKPHQPNLTGTPGSYRPRGHDYRGGTRGMATGDYESWTPEG"
FT   CDS             228681..229181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01960"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79543"
FT                   /db_xref="GOA:F0J1V7"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1V7"
FT                   /protein_id="BAJ79543.1"
FT                   /translation="MKNRVSEIIAGLVVIVAAAVFLAYAASRTRTVGGTGYDLRASFGS
FT                   IGPLTVGSPVKIAGVTIGEVTRTSLDPQTYAAIVQFRIQPDVKIPKDSSAAIESASLLG
FT                   SDYLSISPGGSETMLKPGQAITATQSAINIESLLGKFVFSAANLATSTAKANGGGTSAP
FT                   APK"
FT   CDS             229178..229759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01970"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79544"
FT                   /db_xref="InterPro:IPR019225"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1V8"
FT                   /protein_id="BAJ79544.1"
FT                   /translation="MSLRRAGAVVLVVAMFAALPGRGLAQSGQSVVTVPEAPPVASAPS
FT                   PAMPDGALPAPDLPNAPTLPGDQGGAFAGPPTPKGSQATPPAPPKQVKPIWDPRQAAIL
FT                   DVLEKADGAVNRIIAPVGSSFTEGALRVTIGACVVRPADMPPDAAVYMTVRHGMAAPDL
FT                   FRGWLIRSEPGATVVGDAAVTFRLIGCSAG"
FT   CDS             229910..231004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01980"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01980"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79545"
FT                   /db_xref="GOA:F0J1V9"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1V9"
FT                   /protein_id="BAJ79545.1"
FT                   /translation="MTHRSILCTACCAAALALGMQAARAANPPPVTGPYVDLGIGTNLM
FT                   QNQKYDFAQPNGARGGNLLFRPDYAGQLGVGYGLGNGFRVELDTNFFRNNAVKADDNVE
FT                   GKNRAYGGVNTYGFMVNGYYDIPTGTNFVPFIGAGLGYQWQKFQHIGVADPSGDVYGGT
FT                   YGSLAYDLSAGVAYDLPQVPGLAVTAQYQYMSLVHNRKYNDTGAVPNTQINVGQSGNHT
FT                   FLIGLRYELFPPAPPAPAAAPAPTPVAAPAPAPARTYLVFFNWDKANLTPRAQQIVSEA
FT                   AKASQTTKVTRLNVNGYTDTSGAPAYNMKLSLRRAHNVAAQLVADGVSKNDIVIKGYGE
FT                   THLLVPTGPNVREPQNRRVEIILH"
FT   CDS             231261..232346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_01990"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_01990"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79546"
FT                   /db_xref="GOA:F0J1W0"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1W0"
FT                   /protein_id="BAJ79546.1"
FT                   /translation="MKLRTTLLAATIIAAPALVPAAAMAQPVTGPYVSLGLGYNIMGSR
FT                   KVKSISTPYGDFASGARTLFHNGFTGEASVGYGFGNGFRVELEGDYFHNQAAKVDGNGA
FT                   QAVVSGTEQKYGFMANALYDFDVGVPYVYPYVGAGIGYQWLQWRNAGVTGARFNGTPGA
FT                   FAYQAIAGLAFPIPAAPGLSATVEYRYMRTMGSDNYRATVGATPVTMKVGDEGNNMLMV
FT                   GLRYELFPPAPPAPAAAPAPTPVAAPAPAPARTYLVFFNWDKANLTPRAQQIVSEAAKA
FT                   SQTTKVTRLNVNGYTDTSGAPAYNMKLSLRRAHNVAAQLVADGVSKNDIVIKGYGETHL
FT                   LVPTGPNVREPQNRRVEIILH"
FT   CDS             complement(232399..233166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02000"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79547"
FT                   /db_xref="GOA:F0J1W1"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1W1"
FT                   /protein_id="BAJ79547.1"
FT                   /translation="MTTLANAPNFRDVGPLPLTGGGTLRPGRLFRSGQLSGLDEADLKR
FT                   LEALGIRLVCDLRSSGERKRFASRWPTLAPARIIEMPASTDSAAGMQTLILRLAGQPGA
FT                   AGARRAMLDLYASLPALLVATISAATEAMASGWGVPVLLHCHVGKDRTGVATALLLTAL
FT                   GVRREAILADYEETGRRIDIVEETRHIARSLNKLLGHTVDPGALDALGRTDPAYLDSAF
FT                   TAIDRDWGGIDAYLAASGITTSRRERLATLFHA"
FT   CDS             complement(233174..233668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02010"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79548"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1W2"
FT                   /protein_id="BAJ79548.1"
FT                   /translation="MRRIAPLLFAAAFITGNASACVTPQNQEALDIIGLKSTLMVSALT
FT                   CGQRSQYDQFMTRFHPYILREQHVLDAYFRARHGRAYQHYEDSYVTNLANAQSTAGIHQ
FT                   GSDFCAASQHLFDQVLGQPDQTALVTFARQNPAAQPIVVLTCGIVESDEFRRMEQYTPR
FT                   H"
FT   CDS             complement(233775..234086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02020"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79549"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1W3"
FT                   /protein_id="BAJ79549.1"
FT                   /translation="MIAITVLYPKTATSTFDTTYYHDKHMKLVGDRWGSMGLKGATVLH
FT                   GVNGPDGAAPPYAVITTLQFESLEAFGKAVQAHGPEVMGDIANFTNVQPVLQFSEIAA"
FT   CDS             complement(234149..235573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="ACMV_02030"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02030"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79550"
FT                   /db_xref="GOA:F0J1W4"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1W4"
FT                   /protein_id="BAJ79550.1"
FT                   /translation="MASRLRRHRRTKIVATIGPASSTPEILSQLFETGADVFRLNFSHG
FT                   THEDHLARLQMIRALERKFDRPIGILADVQGPKLRVGQFRGGRVQLQTGAEFQLDLNPA
FT                   PGDTRRVNLPHPEIIEAASIGATLLLDDGKLRLRVLRKREDHLLTEVVTGGPLSDRKGV
FT                   NVPDVVLPIPALTKKDRADLAFALEHGIDYIGLSFVQRAADVLEAKEIAAGRALVMTKM
FT                   EKPQALDNLDEIMDATDAVMVARGDLGVELPPEEVPIVQKRIIRAAQQRGLPVVVATQM
FT                   LESMISAPAPTRAEASDVATAVFDGADAVMLSAESAAGQYPREAVNMMDRIVARVERDD
FT                   DWRRTIDAKRPDPEPSSADAIARAAEQVAHTIGARAIVAFTSSGASALRVARERPDCPV
FT                   IGLTPSLDTARRLAAVWGVHAVVTQDVGSMTEAVALSAKVARQEGFAQPGEEIVVVAGV
FT                   PFGQSGTTNALRVARV"
FT   CDS             235718..236032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02040"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79551"
FT                   /db_xref="InterPro:IPR023163"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1W5"
FT                   /protein_id="BAJ79551.1"
FT                   /translation="MDNDRFDDATRTELEAAAFRRLVAHLRERTDVQNIDMMNLAGFCR
FT                   NCLSRWYREAAEARGLELSDPDAREIVYGMPYKEWQARHQTPASDAQKAAFEVASRQGH
FT                   "
FT   CDS             236090..236365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02050"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79552"
FT                   /db_xref="InterPro:IPR018753"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1W6"
FT                   /protein_id="BAJ79552.1"
FT                   /translation="MAFDAAETQEDNASHGNIAADRLRSIVERIERLEEERKALGSDIK
FT                   DIYAEAKSAGFDVKVLRQLIRLRKQEPAEVEEQEMLIDVYRRALGM"
FT   CDS             complement(236415..237410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="ACMV_02060"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02060"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79553"
FT                   /db_xref="GOA:F0J1W7"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1W7"
FT                   /protein_id="BAJ79553.1"
FT                   /translation="MITGSFPTTRLRRNRRDGWTRRMVAETTLSVDNLIWPIFVRAGDG
FT                   EPTPVATMPGVVRVGLDRLAAHVEPAARLGIPAIALFPATPPELKNPEGTEALNPDNLI
FT                   CQAARLLKREFPELGLIGDVALDPYTDHGHDGVLREGYVANDESVEILERQAVNQALAG
FT                   IDVIAPSDMMDGRIGSIRAALDSEGLIDTRIMSYAAKYASAFYGPFREALGSNAALKGD
FT                   KKTYQMDPANTDEALREVAMDIDEGADMVMVKPGMPYLDIIRRVHERFAVPTFAYQVSG
FT                   EYAMLATAMEHGLLDRERGILETLMGFRRAGAAGVLTYFAVEAATLLRRG"
FT   CDS             complement(237492..238565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02070"
FT                   /product="tartrate dehydrogenase/tartrate
FT                   decarboxylase/D-malate dehydrogenase"
FT                   /EC_number="1.1.1.83"
FT                   /EC_number="1.1.1.93"
FT                   /EC_number="4.1.1.73"
FT                   /note="multifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02070"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79554"
FT                   /db_xref="GOA:F0J1W8"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1W8"
FT                   /protein_id="BAJ79554.1"
FT                   /translation="MKTYRIASIPGDGIGPEVIGAGLDVLDALARRDGGFALDVKAFDY
FT                   GSDYYRRHGVMMPDGALERLKAFDAIYFGAVGAPDIADHVTLWGLRLAICQGFDQYANV
FT                   RPTRVLRGLDSPLRACAPADLDWVIVRENSEGEYAGQGGRSHRGHAEEVATEVAIFTRA
FT                   GVARIMRFAFALAASRPRRHLTVVTKSNAQRHGMVLWDEVAAETARDFPEVTWDKMLVD
FT                   AMTVRMVHAPASIDTVVATNLHADILSDLAAALAGSIGIAPTANVNPERNYPSMFEPIH
FT                   GSAFDITGKGIANPVGAFWTASQMLEHLGEADAARRLMAAVERVTAAGIRTRDLGGDAT
FT                   TAEVTAAVIDAIEGGNA"
FT   CDS             238718..240013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02080"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79555"
FT                   /db_xref="GOA:F0J1W9"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1W9"
FT                   /protein_id="BAJ79555.1"
FT                   /translation="MKTDAGMIALGHTGFAAWLILVGLGFFFGLAYEDFNARAGRSRPG
FT                   GVRSFPLLALAGGVLYALDPAPPLLLGVGLAVLGLWLGLYYWRGMEELAPDGSRNVGLM
FT                   APLSNVLAFLIGPLALAGPFWMAVGLTVAATLLLTARETLHSLARGIDLAEIVNAGRFL
FT                   LITGLVLPLLPDRPVTTITSVTPYEAWLAMVAVSSISYASYLLRRYVVPRGSGLLVAFL
FT                   GGIYSSTVTTVVLARRAAAEAAAVVEAQSGIVLANAVMYPRLLVVILLFDPAMALSLAP
FT                   WMLGVGALGGLIALVWYRLRNHAATAPPAIADVSNPLGLGTAATFGVLFVVVSILASVT
FT                   MRAYGSSGLYTLAGIVGVTDINPFIISLATHGAGAAPDPVEMEAVLIATGSNHVFQAIY
FT                   ASAYSRFRTGAPLVAFMALMAAASLGAAILMH"
FT   CDS             240078..240965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02090"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79556"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1X0"
FT                   /protein_id="BAJ79556.1"
FT                   /translation="MAESGTRHAAAAAKAHPPRLRTRTAWRRIVAARCAELGRDDVDDV
FT                   ESVHRRRVAIRRLRSVLALFAPCLDRAERRRFDAALRELGRAYSPARDWDVACLRSFPA
FT                   AMKGEVDAAAAAAVLAASDAARRQAHERLAASGAVSECADLARDIARWAAGPSIIAPDA
FT                   TSRPIDVLAPELLRRLDRRVRRRGRRIARLSDKELHALRKALKRANYAAEALEGVAPGL
FT                   ALGDFRAAAAAVLDQLGRFNDAGVAHDLAEELAADDVPVASLVRRWATRRARKAKRRLE
FT                   PAWRDYRAASRPWK"
FT   CDS             241065..243350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02100"
FT                   /product="vitamin B12-dependent ribonucleotide reductase"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02100"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79557"
FT                   /db_xref="GOA:F0J1X1"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1X1"
FT                   /protein_id="BAJ79557.1"
FT                   /translation="MDIPADFSASLSSVIDTMAPISAQIWDAKYRLKDEAGEPVDRTVE
FT                   DTWRRVARALAETEREPSSWEAPFYEALRDFRFVPAGRIISGAGTARRVTLFNCFVMGD
FT                   IEDDLGRIFAHLREAALTMQQGGGIGYDFSSIRPKGAAVRGVGADASGPLSFMDVWDSM
FT                   CRTIMSAGARRGAMMATMRCDHPDIEAFIAAKREPGRLRNFNLSVLVTDDFMRAVEADA
FT                   AWDLVFEGKVYRTLQARALWEAITRATYDYAEPGVIFIDRINKRNNLYYCETIHATNPC
FT                   GEQPLPPYGACLLGSINLARLVRDPFGSGARIDEAELAELVTIAVRMLDDTIDASGFPL
FT                   EAQREEAVAKRRVGLGMTGLADALMMCGLRYGTPEAAARAGDWARQIERAAYLASAALA
FT                   AEKGAFPLYDAAQYLAGETIAGLDEDVRAAIAAHGIRNALLTSVAPTGTISLLSDNVSS
FT                   GVEPVFALAYTRKVLQRDGSRREEEVTDYALRLFRAKFGEGAPLPAHFVTAQELTPAEH
FT                   VRMQAAVQRHVDSAISKTVNVPEDIGFEDFQEVYLDAYRSGCKGCTTYRPNAVTGSVLE
FT                   VAPPADAKPAVAAPATTAAGLLVRADKLIGATYKLRWPDSEHAMYVTINDIEQDGMRRP
FT                   FEVFVNSKNLEHYAWVVALTRMISAVFRRGGEVAFVAEELKQVFDPRGGQWSGGRYVPS
FT                   LVAAIGDVIERHMVETGFLVPPSSQQRVAEAPATTPLGALCPKCSQPGLVREAGCLSCL
FT                   HCGWSKCG"
FT   CDS             complement(243368..244375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02110"
FT                   /product="LacI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02110"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79558"
FT                   /db_xref="GOA:F0J1X2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1X2"
FT                   /protein_id="BAJ79558.1"
FT                   /translation="MAVSIKDVARAAGVSPATVSRTLGGGPVSAALRDKVEEAVRRTGY
FT                   RPNLSARRLRSQESQTVGLIVADISNPFFTAVARAVEHAAYRAGLRVILCNTDENPEKE
FT                   AMYLQLMEQERVTGVIFAPTRASVERLDQGPRPSFPMVLIDRAGRASAQDAVVLDNFAA
FT                   GSMLVEHLAGQGYRRIAGLFGNASTTGVERRDGYEAAMLRAGLSPSSRFIAPSIEAAEQ
FT                   EIARWFAKGNLPEAVIASNGLLLMGVVRALRATGRRMPEDLAIAGFDNESWTDLVGPGI
FT                   TVIEQPVAQIGEEAMRLLLERLDAPEAPVRKTVLGGRCVIRGSTARRALDEAAE"
FT   CDS             244569..247082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruB"
FT                   /locus_tag="ACMV_02120"
FT                   /product="multiphosphoryl transfer protein"
FT                   /EC_number="2.7.1.-"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02120"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79559"
FT                   /db_xref="GOA:F0J1X3"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1X3"
FT                   /protein_id="BAJ79559.1"
FT                   /translation="MPVSTQNDLLRRDRVRLGASPASKAAAIEEAAQLLIASGCVEPGY
FT                   AQSMLRREAVANTFLGHGVVIPHGMGEDRHMVRRDGIAVVQVPGGVEWGTGQMAWLIVA
FT                   IAARGDAHIAILRRLTALMQDGEKLAALAVAEDVDEIVAALAGEAPRAAPAAPEADLAH
FT                   RFDFVVDYPAGLHARPATAWVEAVRQSGLRVQVRHGDEVADGRNLVALLQLGLRAGDRV
FT                   VVSAEGDDAAAGLARLRARMDSLTAQEVADAAKAAARGTDATRGWTPPGPLAAIEGIGA
FT                   SPGIAIGRLHVVAGGAVEIADVPVSLAEGGARLEAALAATRQQLAALVDDTARRLGAAD
FT                   AAIFRAQAELLNDGDLITLTCQLMVEGHGPAWAWNQAIERMAASLSALGNPVLAGRAAD
FT                   LRDVGRRVLALLDPSAVPGSLRDLPAAPCIVVAEELSPSDTAGLDLTLVVGLATAQGGP
FT                   TSHTAILARTLGLPALVAGGGALLAAASGQMAILDGAAGRLYLDPPEPAIASAIAWREA
FT                   MRARQAEAAQQRGAPAVTRDGHRIEIAANVNRPDQVRTALEAGGEGVGLMRTEFLFLER
FT                   GATPDEDEQEAVYRAMIAALEGRPLIIRALDIGGDKQVAHLGLPREENPFLGVRGARLL
FT                   LRRTDLLEPQLRAIYRAAMAGGDVSVMFPMVTSASEIVRLRAACERIRAELGAPVLPVG
FT                   IMIEVPAAAVAADRLAAQCDFLSIGTNDLTQYALAIDRQNPELAAEADSLHPAVLRLIA
FT                   QTVAGAAKHGRWVGVCGGIAGDPFGAALLAGLGVNELSMTPRDIAAVKARLRDSRFDEL
FT                   RALAARALDAATADEVRALDAGAQR"
FT   CDS             247079..248032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruK"
FT                   /locus_tag="ACMV_02130"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /note="protein synonym:fructose 1-phosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02130"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79560"
FT                   /db_xref="GOA:F0J1X4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR023314"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1X4"
FT                   /protein_id="BAJ79560.1"
FT                   /translation="MSPVITLTLNPAIDETILLDRLSPGTVHRARSVAFHAGGKGVNVA
FT                   SCLADWGGIPVIAAGLLGRANEAPFARLFALKAIRDECLRVPGETRTNVKLAHAGETTD
FT                   INLPGLEVTAESVRAVRERLLGLAAPGSVVLLAGSLPAGVDEGLYAELTASLAARGARV
FT                   LLDSSGPPLARALAGGTPPWCIKPNRAELEALAGRRLPDAVTVRDAARGLLGRGVALVA
FT                   VSLGAEGALFVTGEDCLHAALPPMRAASTVGAGDAMVAGIIAGIHAGEGIEGIARLGTA
FT                   FAAAKLRAPGANLPERAVVEALAGAVIIQYEGVNAA"
FT   CDS             248029..249723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruA"
FT                   /locus_tag="ACMV_02140"
FT                   /product="phosphotransferase system fructose-specific EIIBC
FT                   component"
FT                   /EC_number="2.7.1.191"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02140"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79561"
FT                   /db_xref="GOA:F0J1X5"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1X5"
FT                   /protein_id="BAJ79561.1"
FT                   /translation="MSDIVAIIAGGEGTVTRVLAAEALRRAAREAGHDIEIEVRTGEGV
FT                   LDPLAASRIAVAGVAIEVGGSEAGDPRFAGKATIRATLADVLADAAAVLGRAAGTMPPG
FT                   GRRIVAITSCPTGIAHTFMAAEGLLQAAKALGHEIRVETQGSVGAGTPLTEDEIAAADI
FT                   VLIAADRQVDLGRFGGKRVFQSGTKPAINDGKALIARALDEAELQGGTARPAARTGARK
FT                   PRTGPYKHLMTGVSFMIPFVTAGGLLIALAFAFGGIHATDAAQAHSFAGALFEIGAKSA
FT                   FTLFVPVLGGYIAYSIADRPGLAPGMIGGLLASLTGAGFLGAILAGFIGGYATRWLNEI
FT                   LRLPRGLQGLKPVLLLPVLGTLFTGLLMIYVIGRPVAELLHLMTHVLRSMQGSSALALG
FT                   LLLGAMMAFDMGGPVNKAAYTFSVGLLSAQVYTPMAAVMAAGMTPPLGIALATRLFASR
FT                   FNTLERESGLSTGVLGLSFITEGAIPYAAEDPFRVIPCTMTGSAIAGAISMVADVKLRV
FT                   PHGGVFVLPIPNAVTHLGLYVVAIVAGSMVTAVMLGLVKKPAGEADG"
FT   CDS             249794..250234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02150"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79562"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1X6"
FT                   /protein_id="BAJ79562.1"
FT                   /translation="MPDTTPPLPGIDQLRALMESDVTLAMGRTLGFHLVEIGEGRVVFE
FT                   GTPGREVYNPLGTVHGGYAATLLDSACGCAVHTMLTAEQAYSTLELKVSYHRAMTAETG
FT                   TVRAVGTVISLGRRAGFSEARLTDASGRLYASATSTLIIMQR"
FT   CDS             250246..251163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02160"
FT                   /product="putative 2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="protein synonym:ketopantoate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02160"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79563"
FT                   /db_xref="GOA:F0J1X7"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1X7"
FT                   /protein_id="BAJ79563.1"
FT                   /translation="MRILVVGAGSIGGYFGGRLIEAGADVTFLVRPARAAALAETGLAI
FT                   RSAKGDFHEPAPKLVTADRLGPAFDLVLLSCKAYDLKEAVAALAPAVSQRTLILPLLNG
FT                   MRHLDVLDARFGAESVLGGQCVISSVLDAAGRVLHLNDAHMLTFGPRSAGQEARARAIA
FT                   ELFGQAAFTTRLSDAIMQDMWEKWVFIASLAGITCLMRASVGAIVAAGGAGIALDLAAE
FT                   CAGIAARHGFELRPAAAARLKEWLATEGSPMTASMLRDMEQGGRIEGEHIIGDLLRRGE
FT                   TASCPLLAVANTHLRAYEIRRAGA"
FT   CDS             complement(251136..251771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02170"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79564"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1X8"
FT                   /protein_id="BAJ79564.1"
FT                   /translation="MATRVSLPVIVVFSRIPRLGVGKRRLARTVGDRAAWRLSRIMLSG
FT                   LLREMRRLRGVVRHLAATPDHHARLATPGFIRTGQGRGDLGARMLRVFRRHPRRPVIII
FT                   GSDIPGITAADLRGTLRRLRGAQAVFGPATDGGYWLIGLAGRRPAAPFRDVRWSSPHAL
FT                   ADTLRNFPRHRVALLRPLTDLDDAESLGVHARPAASRAIRQAPARRIS"
FT   CDS             complement(251756..253873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02180"
FT                   /product="putative mercuric reductase"
FT                   /EC_number="1.16.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02180"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79565"
FT                   /db_xref="GOA:F0J1X9"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1X9"
FT                   /protein_id="BAJ79565.1"
FT                   /translation="MSTTTVGRAGRRGTARALGFAALALALVALVVALQRQGLGIARLE
FT                   GDLAGLRGMVAAHPLAGFLLYFGLYVAATSLSVPGAAVLTLGAGALFGVAEGTVLVSFA
FT                   SSIGASLAFLAARFLLRDFALARFPALFERIERGIARDGAFYLVSLRLAPVVPFFAVNL
FT                   LAGLTSLRLRSFYLASQIGMLPATLIYVNAGASLATLGGHGPILTQRLVIGLLLLAALP
FT                   LAAPRLRDALATRRLYARFRRPKRFDRNLVVIGAGAGGLVAAYVASAVKAKVTLVEAGE
FT                   MGGDCLNSGCVPSKALLHAARAGKDFRAAIADVRAAIAGIAPHDSVARYEGLGVEVRRG
FT                   RAVIESPWCVAVDGVPITTRAIVIAAGAEPFVPPIPGLAEAPHATSETLWDIEDLPRRL
FT                   VILGGGPIGCEMAQAFARLGSAVTLVEMAERLLVREDDEVSAAMAAALARDGVAIRTGD
FT                   RAEAVTRTEAGFALVAASGVQTIELPFDRLLVAIGRRPRVSGYGLEALGIPLTPARTIE
FT                   TDDGLRTLYPNIFACGDVAGPYQFTHMAGYQGGYAALGALFAPFWRFRPSYRAVPAVTY
FT                   TSPEIARVGLNAREAAARGIEAEITRYDFAELDRAIAEGDTEGFVTVLTRKGSDRILGA
FT                   TIVGPQAGELLTGFTLAIQHGLGLKKLMGTIFPYPTRSEAIRAVAGQWRQAHASARGLA
FT                   ILERFHRWRRG"
FT   CDS             complement(253881..255620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02190"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79566"
FT                   /db_xref="GOA:F0J1Y0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1Y0"
FT                   /protein_id="BAJ79566.1"
FT                   /translation="MLDMAGSAPAIGPETVPVIEADGPVLVFGGCYSNLQATRALLEAA
FT                   RAHGIPPERMICTGDVVAYGADPQACAALIRDHGIATVMGNCEEQLGAGAADCGCGFTE
FT                   GSSCDRLAAAWFAYAVARIDDATRRWMAALPRRIDLVIGGRRLAVVHGAPSRINRFLFA
FT                   SDPDLVLEREIGITGCDGVIAGHCGIGFTRRIGDLVWHNAGAIGMPANDGTPRCWYSIV
FT                   SPTDAGLEIVLHPLDYDHHAAAAAMRSAGLPEEYAGTLESGIWPNLDILPHAERAATAT
FT                   RLECAPAADATVALEGLETLWFNTGTLCNLACEGCYIESSPRNDRLAWLRLDGFRRVLD
FT                   EAANRHPELREIGLTGGEPFMNPDIEALIGMALDRGYRVLVLTNAMTPMRHHMAAISGW
FT                   RGRDLHLRVSLDHHTEAGHAALRGERAWGPALEGIGALFASGFQPSIAARFDPAVEDEA
FT                   ATRAGFARLFAAQGWEIDAFDPEHLVLFPEMDVPAAAAGVSASAWAALRPRGADAMCRT
FT                   SRMVVQRKGAEALSIVACTLLPYEARFDLGATLENASRAVTLDHPHCARFCVFGASSCM
FT                   SAR"
FT   CDS             complement(255631..256938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02200"
FT                   /product="putative major facilitator superfamily
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02200"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79567"
FT                   /db_xref="GOA:F0J1Y1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1Y1"
FT                   /protein_id="BAJ79567.1"
FT                   /translation="MLLFGLGWALDAFEVTLIGNVLGALRQHFGLGSNAMSVILAAWFV
FT                   GLMIGAAGFGALSDRLGRRRVFLASLVLYGVATLATAFAPNLAALLVLRLLGGIGVGAE
FT                   YSAINAAIAELVPSRSRGRAAAIVLNFWPLGSFIAALLAWLVLSSLPPDLGWRVVFGLG
FT                   GVVALSAAWFRRHLPESPRWLIDADRAEDARAIVAGIEAGLTTLPPASAVPVVHRIRRE
FT                   AGQFGRLVRQYPGRLLLGAALDFAEAAGYYGLFAFLPIVVLPVLHLPADRLPLFYLAGS
FT                   VGAAVGGLAAASLLDRIGRSWTVGGFYLATALGLVLFALVTGLGAGPIMLGFALVNLLA
FT                   TGSWIAAYPTFSELFPTALRATGIGASVAVGRVGAALSPFLVGYVGARSMPAALVMLAG
FT                   FWALGAVAILIWRLRGGIEARGLALEQLSAASARGV"
FT   CDS             257350..258273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02210"
FT                   /product="putative dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02210"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79568"
FT                   /db_xref="GOA:F0J1Y2"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1Y2"
FT                   /protein_id="BAJ79568.1"
FT                   /translation="MTFDRDTFRARLAGISGILATPFDGNDRLDTARLRPVVERAVAAG
FT                   VHILTANGNTGEFYALTTDEAERAVHAAAELVAGRVPLIAGIGRSIGDALALTRASRAA
FT                   GASALMVHQPPDPFVAPRGVVEYVRRVAEAGQGLPVVIYLRNDGIGLDAIGDLCAIPEV
FT                   VGVKWATPAPMRLAAAMKRADPALVWVGGLAETWAPAFYAVGARGFTSGLINVWPAHSL
FT                   AIHAALEDGDYAKARALIEVMEPFEALRAEEGNGTNVSVVKAALALMGEDCGAVRPPGV
FT                   WPLAERQQAELHRNLVTWGLLKEHAA"
FT   CDS             258270..259838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02220"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02220"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79569"
FT                   /db_xref="GOA:F0J1Y3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1Y3"
FT                   /protein_id="BAJ79569.1"
FT                   /translation="MTAEIDIAEGITLLGAGLVKTGGVAFHGRTAATGEPRAPGFGEAG
FT                   AAEVALACARAEAASVAFADSTPEARAAFLEAAAANIMALGDRLVEAACAESGLPRGRI
FT                   EGERGRTCGQLRMFAGVLRAGRFADLRIDTAQPARQPLPRPDLRLRNIPLGPVAVFGAS
FT                   NFPLAFSVAGGDTASALAAGCPVVVKAHPAHPLTSALVGHAVADAVASCGLPEGVFTVL
FT                   FGAGNELGGALVADPRIKAVGFTGSRGGGLALAAIAARRKEPIPVYAEMSSINPVLLMP
FT                   GALARRGAGLGTAFVGSLTLGAGQFCTNPGLLLAIEGEGLQAFLDAARAGLAAAAAQTM
FT                   LTGAIRSACERGIEARAAERGVEEVARGPGGALFATDAATFLATPSLAEEIFGAAGILV
FT                   RCRDAAELRQVIVGLEGQLTATLHLEPEDHAAARDLLPLLERKAGRILANGWPTGVEVC
FT                   EAMVHGGPFPATTDSRTTSVGSKAIERFLRPVCYQDLPADLLPTALADGNPLAMPRLVD
FT                   GVMRD"
FT   CDS             complement(259867..260580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02230"
FT                   /product="putative aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02230"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79570"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1Y4"
FT                   /protein_id="BAJ79570.1"
FT                   /translation="MLKPDTREKLTRVSTATLATALYKRGLRQQFIQGALPLSPPERSM
FT                   VGEAFTLRYIPAREDLNPITVFRDRDHKQRQAIETCPPGAVMVIDSRKDARAASAGGIL
FT                   VTRLMQRGAAGIVTDGGFRDSAEIAALGFPAYHVRPSAPTNLTLHQAIAINDPISCGDA
FT                   PVFPGDVIVGDADGAIVIPAHLADELADEATEMTVFEDFVTEQVKAGATILGLYPPTDP
FT                   ETETRFAAWRARTGR"
FT   CDS             261064..261927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="ACMV_02240"
FT                   /product="putative protease HtpX"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02240"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79571"
FT                   /db_xref="GOA:F0J1Y5"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1Y5"
FT                   /protein_id="BAJ79571.1"
FT                   /translation="MPNLIRTGLLMAALTALFVAIGYWIGRGAGAAIALAFAAAGNFVA
FT                   YWVSDRAVLAMYGAQPANQAAFPRLVAQVDRLASKAGLPPPRVYVIDNDQPNAFATGRN
FT                   PQHAAIAVTTGLLGALDEAELAGVIAHELSHIRHRDTLTMTVTATLAGAIGMISNLAIF
FT                   FGGSDERRSSPFAGIAGLLLLLLAPLTATLVQLAISRTREYAADARAASLTGQPLALAR
FT                   ALMRIDEMARWVPNDDAERNPATASLFIVNPLSGTTFDTLFATHPPIRERVARLRHMAQ
FT                   FDASKN"
FT   CDS             complement(262009..262539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02250"
FT                   /product="small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02250"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79572"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1Y6"
FT                   /protein_id="BAJ79572.1"
FT                   /translation="MPSTQVEPRPKAAEPERRPQAAPEFWRPFESLRREVNRLFEDFDG
FT                   GLLRRALPTSLPFEPFLSRGLGAPAVDIVEQEKAFVITAELPGLTEKDVEIKATDDTLA
FT                   IAGEKRTEQETSEADYQLCERRYGKFERRFSLPAGADASKIEARFANGVLTITLPKRPE
FT                   AIRAERKIEIKAG"
FT   CDS             complement(262793..264082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02260"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79573"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1Y7"
FT                   /protein_id="BAJ79573.1"
FT                   /translation="MTAPDSHTARARRVVALLIAALLSLGLPVARAQGAGGIGGTGIEQ
FT                   ETGGIGGTGIGEETGGIGGTGIQRAPGGIGGTGAPIVGYGPIQRFGSVFVNGREYRIDA
FT                   DTLVTIDGHPATVASLRVGDIALVRGVAIGAHGGFARSIATWQAIIGPVSHVADGGHVI
FT                   TVLRQTVTLGASVRPPRLRPGQVVGLSAQRLANGEWVAHRVTVLPPTHAFRLEAAVNTA
FT                   GAGHVTIGRLTLRADPAQIAGLHAGERVVASGIIVNGHPVLTTLEPRPIQLGAPGTRVE
FT                   VRNYFRSTGNGRLLAADGMEATERAGRQRLSGLYPVEVVGEIAENGEISATEVTPEVPS
FT                   LPQSEPPATKAGPSGSTTKSSTAAEVRTNEGPAGNPGTAHASGDVEPPEVGETPDTEAA
FT                   EVEAPEIEVPSPQTPEPDIDAPEVEPPADQ"
FT   CDS             complement(264069..264902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02270"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79574"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1Y8"
FT                   /protein_id="BAJ79574.1"
FT                   /translation="MESDIEHMLRRLLRPLVAYLMRRGLGYIAFRDLLKRVYVDEALRG
FT                   HEGDEAPTDSQISVVTGINRREVKRLREIATHPDTAEPRDRMAGVNAAARVVGTWVSAA
FT                   AFRGPDGAPLPLTTRGEGDDPGFDALLRAAKVDVRARTVIEELERAGVVERLADDRLRL
FT                   LRTAFTPTEPREKLLFLGANVGDHMRSAFHNLAGETPVFIERALFHNGIGASRLNAARP
FT                   VLSDMADRLLRQCNEQLLEGNLASTDAAGGDPEREALRRLRLGVYYYETDADDRP"
FT   CDS             265080..265892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02280"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79575"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1Y9"
FT                   /protein_id="BAJ79575.1"
FT                   /translation="MTTGAGVRAKGRGRGRGVLLPALAALATAQWPVLVHAASPAGFTI
FT                   GLEPSYFTGRFGTRHTIHIYDLPLSITYRHRNLRLRIELPYIAVTGAGIVAGQSIIAST
FT                   GSGAVRSGPGDMWLKAEYRLDRARGVRPSFEPYVKVKVPVASYAKGLGTGRFDEEAGLR
FT                   MVWRAGTRVFPYLQLGYRIVGRLPALHLQNVVTFEPGVAVAVAPRQFLSVIVIGHTPIQ
FT                   KRRTAVASAILAYNLRMNFRWELQVYATRGLTSQSAAFGAGFGVMAHF"
FT   CDS             266052..267476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02290"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79576"
FT                   /db_xref="GOA:F0J1Z0"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1Z0"
FT                   /protein_id="BAJ79576.1"
FT                   /translation="MRDVQVVELDNGPGGAGAVWRQGWMPGRDPRDAEAGDRDPAPSER
FT                   RHQGNARRARLRPLIPCAGRVGPAVVFLYSHDTFGLGHLRRNLAIAERLLEAGQFSVHL
FT                   LTGSPVIAQWRLPSGLHVHPLPPVVKTGAETYAAREAGHSFGLVKGYRAALILTLALRY
FT                   RPDIFLVDHAPAGMNGEILPTLAMMRRDLPDTRVMLGLRDILDSPDTVRATWAEQEILP
FT                   LLEQAYDDILVYGSRKLFDVVDAYGIAGETAARVRYCGHVVAADLLRPDAEEGTPCWSA
FT                   ARAAGRKVVLVTAGGGGDGFALMEAYLHGLSRMAPGACHSVIVTGPLMSVDQRAALTAT
FT                   AAGREDIDLVDYITDPLPSLRAADLVIAMAGYNTSVELIAARKRTILVPRPAPRAEQRL
FT                   RAHLLARLGLVRAIEQGPDLADRLAREIPAALAAPPPSSVAWAQLDFNGAERVAAHLAT
FT                   AIEARSAASGIAGEFV"
FT   CDS             267476..268840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02300"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02300"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79577"
FT                   /db_xref="GOA:F0J1Z1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1Z1"
FT                   /protein_id="BAJ79577.1"
FT                   /translation="MPAFAYLDLAGEPDLADAPIAYVMKRYPRLTETFILNEIRAMERL
FT                   GTKLHIVSLLPPEPPPHHPMVAEVEAPLHPVPAASARAGRREIAHAHARAIAAAPLRYL
FT                   GAVARAALWCTRSPTPLSVWKQFLRGGVIATLCRTHGIRHIHAHFANAPAASAWFASMM
FT                   TGLPFSFTAHAKDLYLTPPEVIRKRGQAARFVATCTGYNVRYLASLLGDQADKIHLVYH
FT                   GIDLGLFGARKVAEAKPAEGRLILSVGRLVPKKGHDDLIAACALLRDRGIAFRCRIVGE
FT                   GPLRAELQAQITASGLEGIVTLDGAMTHADLITLYGTADAFALAPRITEDGDRDGIPNV
FT                   IAEAMAIGVPVVSTSVSGIPELVRDGETGRLVPPRDPAALATAIEATLADRAQARRLAA
FT                   AGRARLEGEFDLWKTTRRLHALFGCAECEEAPPKGGSRFRAEGLAAQPSLAEVAP"
FT   CDS             268837..270036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02310"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02310"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79578"
FT                   /db_xref="GOA:F0J1Z2"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1Z2"
FT                   /protein_id="BAJ79578.1"
FT                   /translation="MKILYLNLDRGIPVEGDKGASVHVREFVTAAAALGHEVTLACTTR
FT                   GAGNPPPPARILQFGAPPTDMSIGNEIERRERVRLDHDGLVADRICSTLARLGIEPDLV
FT                   YERHALFHRAGVSIAARLGVPRILEVNAPLVEEQRRFRGLYLVDEALEAEEASYRGADA
FT                   IIAVSRQVAAHVAGVIGRTDRIHVVPNGVDLARFANVDAIGAVIRARLGLAGRRIAGFI
FT                   GSFKTWHGVPFLIEAIAAAAAWHPDLHLLAVGDGPERDAVAALVAKLSLADRVTLPGRI
FT                   PHGEIPGWLGAMDFTVAPYLPQPDFYFSPLKIFESLAAGRAVVAPEIGEIDGIVAHGET
FT                   GLLYPAGDGIALQAALSRLLADQAACQTMGWRGRQRLAGRDWRDVVRLCLALAPVRLPA
FT                   "
FT   CDS             270033..271841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02320"
FT                   /product="putative ABC transporter permease/ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02320"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79579"
FT                   /db_xref="GOA:F0J1Z3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1Z3"
FT                   /protein_id="BAJ79579.1"
FT                   /translation="MTGPGGAWLRAYLRSEWRALSAGASVMAARAGILLMLPWPLKFII
FT                   DNVIFQRRLAPWLHGVLPDPLTQRMALLDTLGLAMLGLGIADALLVYLGNRLFLDAGQR
FT                   IVFAIRADLFAHLQRLSLAFHRRQRAGELMARLTGDVRQLQDFIVAVGIDLLPHGLTIL
FT                   GMATVMLLIDWRYALIALSVAPLLFWIARVYAGRLRHALRQVRRHETTLSGVMQEILGS
FT                   VQVVQAFGREPHEDGRFGAHAGRSLEAGLHASAVQAQFSPVMNLAIAVATGAIAWYGAA
FT                   TVIRGTLTPGELLIFLAYLRGIATPARQLAKTGRVFGRASVAIERIGEYRAERSSVAEA
FT                   PEALPFAGRASRIEFREVGFGYRDDHEVLHGVSFALEAGRTIALVGATGSGKSTIASLI
FT                   PRFYDATSGAVLLDGQDIRGLRLADLRRQVALVLQDPVLFQASVWENIAYGREGAGRDE
FT                   AIAAARAVGIDAMVEGLPDGFDTMVAERGQSLSGGQRQCIAIARAMLCDAPIVILDEPS
FT                   SSLDAGTERRVMAALDRLAANRAALVIAHRLSTVRAADEILVLDDGRIVQRGTHEALLA
FT                   EGGRYKALWQALRDDSPSPQLRLVAQ"
FT   CDS             271838..272680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02330"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79580"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1Z4"
FT                   /protein_id="BAJ79580.1"
FT                   /translation="MTRFVPAVPRLLAGIVAGAALAVPLRAARADPWIPAAGDGVVKPM
FT                   VRLFHGNQAFPAGGFTTNALRGSSESSKQYRVTGVQGIGHDLSIEYDLRGGRVRSFADR
FT                   HHIPTASVSSGLQDEEIGLNYGLIQTARFADSITLNVIVPAGRTKPSPALGTGRWSVEP
FT                   DFQAGISRPWGSLTMVAGARMFLDGAATQLRATIDLSLHLTRRLAFTGEVFAVKTIRQS
FT                   GTIPPGAQGEIYNLVRPAVGLTWRLTKAVRPFLLYEVNVAGEGIHAGSRVELGVAVHY"
FT   CDS             272637..273293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02340"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02340"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79581"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1Z5"
FT                   /protein_id="BAJ79581.1"
FT                   /translation="MPAAGWSWALRCITDPRAGGRALLLARHGRTAWTGEGRYQGRSDQ
FT                   PLSPEGWADAAVLAAALGDEPLASIYSSPLLRARQTAGCIAARRGDVAVIVDDRLAEIA
FT                   FGDWEGRTQAEIRAATPEALRRWKRDPGGMRFPGGETLAEARARLHGFLADLPDQGGAV
FT                   LAVTHAGMIRLACLDAEGRGDDGFRGIRIAPGAVRRFSLGGAAVAAPPFHHETVE"
FT   CDS             273298..274659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rkpK"
FT                   /locus_tag="ACMV_02350"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02350"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79582"
FT                   /db_xref="GOA:F0J1Z6"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1Z6"
FT                   /protein_id="BAJ79582.1"
FT                   /translation="MRIVMIGAGYVGLVSGACFASMGTEVIVVEKDPCRVAALQAGRIP
FT                   IYEPGLDRLVADSVRAGRLRFEVALDRALPGADAVFLAVGTPSRRGDGHADLSHVFAAA
FT                   AELAAALPAPTVLVTKSTVPVGTGRRLAALMREIRPDLDVPVASNPEFLREGSAIEDFM
FT                   RPDRIVVGTDSVQAEAVLRALYRPLNPAGVTLLCTGLETAELIKYATNAFLAMKITFIN
FT                   EMADLCEQVGADVHELARGMGLDRRIGPKFLHPGPGFGGSCFPKDTQALMRIAQDAHAP
FT                   ARLVETVVSVNEARKAAMAGRILAAFGGTVRRRRIAVLGLTFKPETDDMRDSPAIPIVH
FT                   RLVELGAEVVAYDPAGMEQARRDLPAEVVYASGAASALAGADGAVLVTEWNEFRALAPD
FT                   WLRATMRGRVVVDLRNVFDPAAMRAAGLDHHAIGRPAPHRALAGEAELALAAAD"
FT   CDS             complement(274656..275357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02360"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02360"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79583"
FT                   /db_xref="GOA:F0J1Z7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1Z7"
FT                   /protein_id="BAJ79583.1"
FT                   /translation="MAKERVLVTGGAAGIGAASVARCREEGYEVVVIDRIGDGIVADLS
FT                   DPAATEAALAEALRGGPITRLVNNVGTVRPAPVEAQTVADLDAVVSLNLRCSLQCVQAL
FT                   LPGMKAAGFGRIVNIASRAALGKEDRTAYAATKAGLIGMAKVWALELGRFGITANAIGP
FT                   GPIRTELFDRVNPPDDPRTTAIIEGIPVRRIGTPADVAHAIAYLLDQRSGFVTGQVLYV
FT                   CGGMTVGAAGA"
FT   CDS             complement(275459..278146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnA"
FT                   /locus_tag="ACMV_02370"
FT                   /product="aconitate hydratase"
FT                   /EC_number="4.2.1.3"
FT                   /note="protein synonym:citrate hydro-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02370"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79584"
FT                   /db_xref="GOA:F0J1Z8"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1Z8"
FT                   /protein_id="BAJ79584.1"
FT                   /translation="MSMIGRDSLQVEKTLSVDGKDYAYFALNAAAEKLGDISRLPRTLK
FT                   ILLENVLRFEDGSACTVDDAKALVEWTAQAHSDKDVPFRPARILMQDFTGVPAVVDLAA
FT                   MRDGILRLGGKAEKVNPLVPVDLVIDHSVMVDVYGRKDALEKNVDIEFERNGERYEFLR
FT                   WGQEAFDNFRVVPPGTGICHQVNLEYLAQTVWTSAANGKNYAYPDTLFGTDSHTTMVNG
FT                   LGVLGWGVGGIEAEAAMLGQPIAMLIPDVIGFRLTGSLREGITATDLVLTVTQMLRKKG
FT                   VVGKFVEFYGEGLDHLPLADRATIANMAPEYGATCGFFPVDGITLDYMRLSGRDEHRIK
FT                   LVEAYAKAQGLWREGADPVFSDTLELDLSTVEPSLAGPKRPQDRVALSQASSAFEAELT
FT                   KGLGVPADKAGVTAEVKGKNFSLTHGDVVIAAITSCTNTSNPSVLIAAGLVARKARALG
FT                   LTPKPWVKTSLAPGSQVVTEYLNRAGLQDDLDALGFETVGYGCTTCIGNSGPLDDAIAD
FT                   AIEDNRLVAVSVLSGNRNFEGRVHPNVRANYLASPPLVVAYALLGTMRKDITKDPIGKD
FT                   RNGNDVFLKDIWPTTAEIAAMVQSSLTREMFLDRYGDVFKGPKQWQAIAVEGESDTYRW
FT                   SDSSTYVKNPPYFEGMTKEPAPVKDITGARILALLGDSITTDHISPAGSFRKTTPAGEY
FT                   LLERQIQQKDFNSYGSRRGNHEIMMRGTFANIRIRNEMLDNVEGGYSKHFPSGEQLSIY
FT                   DAAMRYKKEGVPLVVFAGREYGTGSSRDWAAKGTVLLGVKAVIAESFERIHRSNLVGMG
FT                   VLPLVFKDGMTRKTLALKGDETIDIVGLENLSPRMDLDMVIRRANGTTDKVSLLCRVDT
FT                   RDEVLYYQNGGILHFVLRNMAKAA"
FT   CDS             278177..278869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /locus_tag="ACMV_02380"
FT                   /product="cytochrome c-type biogenesis ATP-binding export
FT                   protein CcmA"
FT                   /EC_number="3.6.3.41"
FT                   /note="protein synonym:heme exporter protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02380"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79585"
FT                   /db_xref="GOA:F0J1Z9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J1Z9"
FT                   /protein_id="BAJ79585.1"
FT                   /translation="MRCAAAKPGFAPLKSRCGARVHVPRRSLAMLEAKGLAAIRGERLV
FT                   FRDISFRLERGGALVLVGPNGAGKSSLIRLLAGLTPPAAGEFVWDGENALDDPPLHATR
FT                   LCFVGHMDAIKPGLSVAENLGLDRKRQRENVLTALASVDLERFADLPARLLSSGQRRRL
FT                   ALARLALSDAPLWLLDEPTTGLDASSVRRLEANIAAHRDRGGMVIAATHLPLDLPGAIP
FT                   FDLAKAAA"
FT   CDS             278866..279519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmB"
FT                   /locus_tag="ACMV_02390"
FT                   /product="cytochrome c-type biogenesis protein CcmB"
FT                   /note="protein synonym:heme exporter protein B"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02390"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79586"
FT                   /db_xref="GOA:F0J200"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:F0J200"
FT                   /protein_id="BAJ79586.1"
FT                   /translation="MTHFFSLIRRELILALRHAGDSVASLLFFVIAASLFAFAIGPSAN
FT                   VLSGIAPGVVWVIALLAALLPLNRLFAADFEDGSLDQLMLSGLPASAVALGKIVGHWLT
FT                   TGLPLLVIAGPVAIMLRLDGGAVPQLLATLLPGTMLLSLVGGMSAAVTLGARGGTVLLP
FT                   LIALPLMIPAVIFGAAGAVAQSPFAEFAMLGGLLALFLPIAPLAAGAALRASVS"
FT   CDS             complement(279512..281281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02400"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /EC_number="3.4.11.9"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02400"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79587"
FT                   /db_xref="GOA:F0J201"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR028980"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="UniProtKB/TrEMBL:F0J201"
FT                   /protein_id="BAJ79587.1"
FT                   /translation="MMKTQFDSLRNALHDQGLDGFIQPRNDEFLGEYVPESASRLAWLT
FT                   GFTGSAGLAIVLADRAAVFSDGRYTLQLAEQTDPATWERRHIVETPPVEWLKSAAPGAR
FT                   IGYDPWLMTANAVATYADAGFTMVPVDNPIDKLWADRPAPPASPALAHPPEFAGESAES
FT                   KRSRIAEAIARDGADAVMLTDPHAVAWLFNLRGADLPHTPIVLCFALLRRDGSAIIFID
FT                   PARVPPATRAHLGAGVEIVPRAAMERSLATLRGKRVLLDPATAPIRFSQLLGDAGAITV
FT                   SGGDPCVLPRAIKNPTEQEGARAAHRRDGVALCRFLAWFAEASPAGGQTERSAAAQLFA
FT                   FRSTAPEFHGESFPAISGAGEHGAIIHYSVTAASDRPIRHDEVYLIDSGGQYPDGTTDV
FT                   TRTLWTGPGEPPPTLRDRFTRVLAGHIALARARFPQGTSGPQLDALARAPLWDAGLDFD
FT                   HGTGHGVGSYLSVHEGPASFHRLAKPIPLAPGMILSDEPGYYEPGGYGIRLENLLLVVP
FT                   SPVGAAKPFLEFEPLTLAPFDRRLIDPTLLGPAARAWLDAYHARVLTMIGPHLDGATCT
FT                   WLEAACAPLQEVN"
FT   CDS             281445..281714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02410"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79588"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:F0J202"
FT                   /protein_id="BAJ79588.1"
FT                   /translation="MSSTTHNKHSLPVANSMAAHAAAIDAALADSARRAANSFARVSAW
FT                   FAERRAAREAYRELQSLSDRELADLGISRADIRAVVNGTYQRPI"
FT   CDS             complement(281760..282677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="ACMV_02420"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02420"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79589"
FT                   /db_xref="GOA:F0J203"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F0J203"
FT                   /protein_id="BAJ79589.1"
FT                   /translation="MARGGVEMLERVTVTVPEEALESFEAALETCCRSVGFFLDEANGT
FT                   WIVEGLREPGSADGDLAAALLLAEAASGVSPAVERALVPAGGWLARSYEGFPEQMIGHR
FT                   FAIRGTHVTTPLAAGRITVLLDAGLAFGTGEHGSTRGCLLALERLAKRRAPGRILDLGT
FT                   GSGILAITAAKIWGKPVLATDIDQRAVRVASANAALNGVAPLLRVIGSDGWSAPMLARR
FT                   APYDLVFANILARPLVAMAHELSAHLAPGGTAILAGLLGRQARWVMSAHRRHGLVLKGR
FT                   IDDGEWTTLILGKGRTTPDGKNPG"
FT   CDS             complement(282677..284863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="ACMV_02430"
FT                   /product="DNA helicase II"
FT                   /EC_number="3.6.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02430"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79590"
FT                   /db_xref="GOA:F0J204"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:F0J204"
FT                   /protein_id="BAJ79590.1"
FT                   /translation="MSDYLDRLNPAQREAVEAVDGPVLVLAGAGTGKTRVLTTRFAHIL
FT                   LTRRAFPNQVLAVTFTNKAAREMRERVSALLGEPAEGLWLGTFHALAARMLRRHAELVG
FT                   RTSNFSILDPDDQLRLLKQVMEARRMDVKRFTPQGLMGTIQRWKDRGLLPDQVPRELDI
FT                   DWGAESARDLYAAYQERLQALNAMDFGDLLMLATDLLKREPEILAQYHRRFRYILVDEY
FT                   QDTNLVQYYWLRLLAQASKNICCVGDDDQSIYSWRGAEIENILRFEQDFPGAKIVRLEA
FT                   NYRSTAPILRAASALIAHNEGRLGKTLHAGRNDAEGEKVEVLAFWDSDEESRAVASRIE
FT                   GLRADGHKLAECAVLVRAGFQTRGFEERFITIGLPYRIVGGLRFYERAEIRDAIAYLRL
FT                   LAQPADDLAFERIVNTPKRGLGDTALRTLHERARADGVPLAEAASRVVAEGGLRGKARD
FT                   GLRTLLAQFAEWRETLRLDGHVVALSTLLDASGYIAMWQEQKTPEAAGRIENLKELVRA
FT                   VAEFETLGGFLEHVALVMDNDNEPDDDKVVLMTLHAAKGLEFDTVFLPGWEEGVFPNQR
FT                   ALDEGGGRALEEERRLAYVGITRAKQRAIISHCANRRIYANWQSSVPSRFIEELPEDAI
FT                   RTGGSAALEQRNAPPVFATARPLVAARRASGEHADAWAATPRPPRTDRITEGTRVFHQK
FT                   FGYGVVIDAEDDRLDIRFDNAGEKRVLDRFVERA"
FT   CDS             complement(284860..285792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="ACMV_02440"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02440"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79591"
FT                   /db_xref="GOA:F0J205"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:F0J205"
FT                   /protein_id="BAJ79591.1"
FT                   /translation="MSHTPPRAVLERWLSGPRVDPLPTPALRAPAPAISFEFFPPKTET
FT                   LEAQLWACIRRLEPLAPRFVSITYGAGGSTQERTHATVTRLVRETTLVPAAHLTCVGAS
FT                   RGEVDDVARRYWDAGVRHIVALRGDPPGGTAYAPHPEGYAYAADLVAGLRRVADFEISV
FT                   AAYPETHTQAPSPQADLDNLKRKLDAGATRAISQVFFETGHFLDFLDRALAAGITAPII
FT                   PGIMPVSNFGQAKRISEMAGTHVPAWMGEMFDGLDDDAETRKMVAASIAAEQVRTLQAN
FT                   GIDEFHFYTLNRADLTYAIARILGVKPAR"
FT   CDS             286019..286819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02450"
FT                   /product="putative VacJ family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02450"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79592"
FT                   /db_xref="GOA:F0J206"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:F0J206"
FT                   /protein_id="BAJ79592.1"
FT                   /translation="MKTSILPLVAASVLLAGCATPPPRSNKAAFEAYQQQNDPLKPANK
FT                   VFYHFDNVLDTYVLRPVAVGYSHITTPAIREHVSDFMQNMDGPAELLEFMAAGKPRDAG
FT                   TTLVRFIVNSTVGIGGIFDPASAIGYKRVYTDLGLTLAGYGVPEGPYLYLPFAGPSDVR
FT                   DASVLPAGFFLTPTVAAPPSTGLTIFNYSSDALDVVNKRANLLGTISNIKKSSLDPYAT
FT                   FRSLYRQHRAAQLRTINERDIATPPAWYPAKEREAMKPRPYGSP"
FT   CDS             286857..287483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02460"
FT                   /product="putative toluene tolerance family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02460"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79593"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:F0J207"
FT                   /protein_id="BAJ79593.1"
FT                   /translation="MASSVRRVLLGAFAVLPVLGALPATALAAAPAASVAQNFIKQSGD
FT                   HLVAIVNGPDSTKVKADKLRELVDRIVAVDQIGRFVLGRYWRVATPAQQQEYLRLFHQT
FT                   LAYNITNQIRAYKGVQFAVDGTKPGPEGEMVSTTVTRPGQSPADVQWVVDTVGGKPRIV
FT                   DVVVEGTSLRITERSDYSSVINDNGGQVSALLDAMKKQIARMEAG"
FT   CDS             287621..288145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02470"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79594"
FT                   /db_xref="GOA:F0J208"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="UniProtKB/TrEMBL:F0J208"
FT                   /protein_id="BAJ79594.1"
FT                   /translation="MNDTRPQHTGLEGRIAELIAPGLESIGYELVRVAIMGKQTPTVQI
FT                   MADRADQTPLSLDDCERISHLVSAVLDVDDPISSAWTLEVSSAGIDRPLTRVKDWNRYA
FT                   GHLARIDLDVPTASGRKRLTGTVLGADEAQARVKLDSGETVDLPHAHIRRAKLVLTEEL
FT                   IKATETPPAAN"
FT   CDS             288171..289691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="ACMV_02480"
FT                   /product="transcription elongation protein NusA"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02480"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79595"
FT                   /db_xref="GOA:F0J209"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="UniProtKB/TrEMBL:F0J209"
FT                   /protein_id="BAJ79595.1"
FT                   /translation="MTMDTAIARPELLLVADAVAREKQIDREEVLEAMEQAIQKAGRAK
FT                   YGHEKDIRATIDRKTGDVRLSRWTEAVETVENEETQIPIHIARKFKPDIEVGGHLVDPL
FT                   PPIDFGRIAAQTAKQVIVQRVREYERKRQYDEYKDRVGEIITGVVKRTEYGNLMVDLGR
FT                   SEALLRRDETIPRENLHNGDRVRAFIYDVREEPRGPQIFLSRTHPGFLAKLFAQEVPEI
FT                   YEGIIEIKAVARDPGSRAKMAVISRDSSIDPVGACVGMRGSRVQAVVAELQGEKIDIIP
FT                   WSPNPATFVVNALAPAEVSKVVLDEEAGKVEVVVPDTQLSLAIGRRGQNVRLASQLTRW
FT                   DIDILTEAEESERRQEEFRRRSGLFVEALDVDDVIAGLLVTEGFEGVEDLAATPVEELA
FT                   AIEGFDEGIAAELQRRAEVALERKATELEDKRRALGVADDLAGLEGLSPAMLVALGEKG
FT                   VKTLDDLADLASDELIEIVGADAMDEDAANAIIMAARAHWFEGEEDAG"
FT   CDS             289633..290424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02490"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79596"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:F0J210"
FT                   /protein_id="BAJ79596.1"
FT                   /translation="MPSSWRRALTGSRERKTLADPDFSADLADDDAAAESGPLRRCLVT
FT                   RERQQREAMLRFVVAPEAVAAEALVFDVAATLPGRGMWLSARRDVIEKAMKANIFSRAA
FT                   GRRIALPSGLVELAGRALEKRIGELLGLARRAGDAVCGFEKVKERIAAGQCALLVEAAD
FT                   GSLAEQDRLIQHRKTNVVRPISAARLGAVFGRDRVVHVAIGPGRLAGMIEADSLRLAGV
FT                   LGAEPSARRLQAPQGAGRENADLGGREARPPADMTQTKTQN"
FT   CDS             290441..293104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="ACMV_02500"
FT                   /product="translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02500"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79597"
FT                   /db_xref="GOA:F0J211"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J211"
FT                   /protein_id="BAJ79597.1"
FT                   /translation="MSDEQDQGETKGRLSLRPVNRGELGRTVDAGSVRQSFSHGRSKVV
FT                   QVEVRKKRGGAAGAETGRPSAPSRASGGAAAPRGLTAAEQAARQRAVVEQQREAARLEA
FT                   ERREQEKISILSAAEEARRKAEEEARAAEEAERLRAEEEARRREEEEAERRRAAEASQA
FT                   TAAPPAPAAAASPRAAMPAPTAAPARPGAAPARRTAPVPPATSASETLRLRAARTGRDE
FT                   EEEASRPARRPGSGAAPSRKPSVPAPKKVGDDRRRGARIDVQAALSGDDERVRSLASVR
FT                   RQRDRERRQAELERLRSDQVRVVREVVLPETITVQELANRMAARVPEVVKSLMKLGVMA
FT                   TATQTIDADTAELVVEEFGHRSKRVSESDVELGLEGQEDSETDLKVRPPVVTIMGHVDH
FT                   GKTSLLDALRSTDVAAREAGGITQHIGAYQVTLESGAKMTFIDTPGHEAFTAMRARGAS
FT                   VTDIVILVVAADDGVMPQTVEAIRHAKAANVPIIVAINKIDRPDANPNRVRSELLQYDI
FT                   AVEAMGGETQDVEVSALKRQGLDALQEAILLQAELLDLKANPNRSAEGAVIESSLDRGR
FT                   GPVATVLVQKGTLRQGDIVVAGTEQGRVRAMLDDHGQPLKDAGPSTPVEILGLSGVPGA
FT                   GEVFVVVENEGRAREIAEFRQRKLREHAAAAGAAARGTLDQMLARIQAGEQKEVALVIK
FT                   ADVQGSAEAIQATVQKLGNDEVRVRVLLAGVGQITESDVQLAKASDAIIVAFNVRANAQ
FT                   ARTLASRDGVDIRYYSIIYQVSDDIETMVKGKLAPIEREKFLGYAEIRQVFNITKVGKV
FT                   AGCYVTEGLVKRGAGVRLLREGVVIHQGELSQLKRFKDDVREVARGYECGLSFAGFSDL
FT                   REGDVVECYETETVPA"
FT   CDS             293074..293496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="ACMV_02510"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02510"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79598"
FT                   /db_xref="GOA:F0J212"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:F0J212"
FT                   /protein_id="BAJ79598.1"
FT                   /translation="MLRDRNRSGVRGGAEGPSQRQRRVAEDLRHRLAELFARTEFRDPE
FT                   LAGVHITVAEVRMSPDLKHATVFVSRLGATDIDRYLPALKRIAPFLRGEIGHGLRMKFV
FT                   PDLHFQPDHALDEATRINELLHRPEVMRDLLKPDEE"
FT   CDS             293493..294461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02520"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79599"
FT                   /db_xref="GOA:F0J213"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:F0J213"
FT                   /protein_id="BAJ79599.1"
FT                   /translation="MTERLAADAAGIARAAELLRAGELVAFATETVYGLGADATNASAV
FT                   AAIYEAKGRPRFNPLISHFPDADAAFRHAAADARAREAAQAFWPGPLTLVLPRRDESDI
FT                   AALATAGLSSVAVRVPGHGIARALLAATGRPVAAPSANRSGRLSPTRPAHVIAGLEGRI
FT                   AAILESGACEVGLESAIVDLTGATPVLLRPGGISREALEAVLGPVSIASEMGAAVKAPG
FT                   MLASHYAPVLPMRLGATAPEDGEAWLGFGIEPPTLPPVSRNLSPAGDLVEAAARLFDSL
FT                   HELDAAAGLARLRRIAVARVPERGLGAAINDRLARAAAPRS"
FT   CDS             complement(294487..297756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02530"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02530"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79600"
FT                   /db_xref="GOA:F0J214"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:F0J214"
FT                   /protein_id="BAJ79600.1"
FT                   /translation="MRIVIDVQGAQTSGSAFRGIGRYTMGLAQGIARWRGLHDVIIATS
FT                   DAFPDSLPLLRATFAPLLPPGHFRVWQCPRGISAADDTNHARRRAAACVREAYLAALRP
FT                   DVVLVSSLFEGLIDDAVASIGTLHDIPTAAVLYDLIPLIHRETYLSHHAVIEKWYEAQL
FT                   DHLRRADLLLAISASSSKEAKDHLGFPAGQTVNIGAAADPQFHRRNLPLSTLDTVRARY
FT                   GLNLPFVMYTGGIDHRKNLDRLVTAFARLPAHLREAHQLAIVCKADDDAQDRLRTLARR
FT                   EGLGASTLMFTGFVPEDDLIHLYHACTAFVFPSWHEGFGLPALEAMACGAPVIASNASS
FT                   LPEVVGLDEALFNPLNPDSIANSLQQVLEDRRFRERLVSHGLEQATRFSWDITAQRAVK
FT                   ALEALHLRHALLPQRRRTQTPRPKLAYISPLPPEQSGISDYSAELIPELSRFYEIEIIA
FT                   SRPDIGPEWLRSQFPIRSPDWLSANPSSYDRVLYQFGNSAFHQHMFDLLREVPGVVTLH
FT                   DFFLSGVAWWMEGDVGRAGHLARALYRSHGYAAAEQRYKRGDINSVIWDFPCNADVLSD
FT                   AIGIIVHGPNAVRLARQWYGPDTARDWAIIPLLRAPAFGFHRSEARRRIGLPEDAMLTC
FT                   SFGGLNATKLNHVTLEAWLASAHADRPDAYLAFVGGHSNDDYGRALLATARNSRAAERI
FT                   LITGWTDQSTYRDYLAATDIAVQLRTLSRGETSAAVLDCMNYGVATIVNANGSMADLPA
FT                   DTVWKLPDKFERAQLAAVLDVLARDSGKRKALGQRARERILRTHAPRACAAAYHEAIEV
FT                   AYRQADATTRGAISSIGRSASGLTAADLAQISGCLAQNGAQPITRQFLVDVSGLLAPDS
FT                   KDRIQSSPRELLLELLRRPPAGFRVEPVHASVKVNGYRYARRWTMNLLGVPSEGFEDEP
FT                   VDAHAGDVFLALYPSHRAGSGQADLYRRWRTLGVRTAFIIDDQPPARVPRQVSHDGEKP
FT                   RTDWLEIVAEADNALCVSRSVADDFRAWLDEQGARRSMPIEIGCIHRGGDVNNTAPSRD
FT                   MPAARIAATCTLTLTESVDMLVQALGLPPRQSALPGGTATV"
FT   CDS             complement(298085..299059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02540"
FT                   /product="methyltransferase FkbM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02540"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79601"
FT                   /db_xref="GOA:F0J215"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F0J215"
FT                   /protein_id="BAJ79601.1"
FT                   /translation="MWGLMAPEAGSERQFISYAQNFEDVMLWRALGHVSPGIYIDIGAQ
FT                   DPIIDSVSLAFYERGWRGVHVEPNPAYAERLRVARPDENVIEAAIGATSDTIDFYEIAD
FT                   TGLSTGDASLADEHRQRGFSVNRIKVPCRPLSDILDEMTDQVIHWMKIDVEGMEREVIS
FT                   TWAPSAVRPWIIVIESTKPNTKNPTFSDWEEIISKLGYKFVYFDGLNRFYISIRHLELQ
FT                   SYFCYGPNIFDNFSLSGLASAPFCRQMLAVIQAREQEAEQRMEREKALRHDAEQQANQA
FT                   ASRLREAERLIMEIHASRSWRVTSPFRAAMNFIRRMSRQTHEG"
FT   repeat_region   299268..300707
FT                   /note="Belongs to IS110 family"
FT   repeat_region   299268..299290
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 23 bp inverted repeat"
FT   CDS             299395..300429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02550"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02550"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79602"
FT                   /db_xref="GOA:F0J216"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:F0J216"
FT                   /protein_id="BAJ79602.1"
FT                   /translation="MEHYAGIDVSLESSAVCVIDATGRVVCEGKVATEPETLIDWLRQS
FT                   DVAFARIGLEAGPLSQWLYAGLREAGFPIELLETRHVRAAFRTMPVKTDRKDARGIAQL
FT                   MRLGWFRPVHCKSMAAQELRAILTARKLVQGKLHDVEMSLRGILRGFGLKVGPTTRRTF
FT                   ADRVRELVAGHPTLQMIAEALLSASDELGRQLGQFEAQVRSLARRNPKARLLMSTPGVG
FT                   AVVALTYVAAIDDPARFRSSRTVGAHFGLTPRKYQSGETDVTGRISKIGDVGVRTALYE
FT                   AANVILTRPVKGSTLKSWAMRVAARAGMRKAKVALARKLAVVLHRMLAGGTAFDATMAA
FT                   APRA"
FT   repeat_region   300685..300707
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 23 bp inverted repeat"
FT   CDS             complement(300969..301202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02560"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79603"
FT                   /db_xref="GOA:F0J217"
FT                   /db_xref="UniProtKB/TrEMBL:F0J217"
FT                   /protein_id="BAJ79603.1"
FT                   /translation="MVADIISGPKGTVAAIFLASRILSIDPLGGKGLKLAAIAAAVIGI
FT                   ASLYSGHGSIIGTLFSAFVTMFIGNGLNLLNV"
FT   tRNA            complement(301555..301644)
FT                   /locus_tag="ACMV_t0040"
FT                   /product="tRNA-Ser"
FT   CDS             301843..302157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="ACMV_02570"
FT                   /product="50S ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02570"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79604"
FT                   /db_xref="GOA:F0J218"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="UniProtKB/TrEMBL:F0J218"
FT                   /protein_id="BAJ79604.1"
FT                   /translation="MFAVIRTGGKQYRVVPDAVLKVEKLEAEAGSTVTFTDVLAIGGEQ
FT                   GVTLGKPVVEGATVTATVIAQDKLDTVIIFKKRRRQNSRRKNGHRQPVTVLRVSGINAA
FT                   "
FT   CDS             302173..302442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="ACMV_02580"
FT                   /product="50S ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02580"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79605"
FT                   /db_xref="GOA:F0J219"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:F0J219"
FT                   /protein_id="BAJ79605.1"
FT                   /translation="MAHKKAGGSSRNGRDSEGRRLGVKKFGDEQVIAGNIIIRQRGTKV
FT                   KPGANVGVGRDHTIFALVDGRVKFSRKAEGRVHVSVEPLPLAAE"
FT   CDS             302505..303503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cgtA"
FT                   /locus_tag="ACMV_02590"
FT                   /product="GTP-binding protein CgtA"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02590"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79606"
FT                   /db_xref="GOA:F0J220"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="UniProtKB/TrEMBL:F0J220"
FT                   /protein_id="BAJ79606.1"
FT                   /translation="MKFLDQAKIYVRSGDGGNGVVAFRREKYIEFGGPDGGNGGRGGDI
FT                   VFEAVENLNTLIDFRYTQHFRARKGGNGAGSDRTGAAAPPVVIKVPVGTQILDDDRETL
FT                   LADLDAPGKRIVLLRGGDGGHGNAMFKTSTNRAPRRADPGWPGEERWVWLRLKLIADAG
FT                   LVGLPNAGKSTFLSVASAARPKIADYPFTTLHPQLGVVRLSMTEEFVLADIPGLIEGAH
FT                   DGAGLGDRFLGHVERCAALIHLIDGAAGDVVDAWRTIRGELEAYGGGLADKPELIVLNK
FT                   MDAMTPHQIAGRRSALERASGCKVMVISAAAHQGVDAVLRETLRMIREQRQ"
FT   CDS             303500..304651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="ACMV_02600"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02600"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79607"
FT                   /db_xref="GOA:F0J221"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:F0J221"
FT                   /protein_id="BAJ79607.1"
FT                   /translation="MSPGLPDPGSARLLVVKIGSALIVDPDAAAPRTAWLASVAADIAA
FT                   LRARGVGVIVVSSGAIALARRQLGLTQKRLRLEEKQAAASVGQIRLAQAWSEALSAHGL
FT                   VAAQLLLTMDDTEDRRRYLNARATLRTLLELGAVPVINENDSVATGEIRFGDNDRLAGR
FT                   VAEMVEADQLVLLSDIDGLYTADPRRDSAAAHLPVVAAITPEIEAMGGAPPPGYSSGGM
FT                   RTKLVAARIATQAGCAMAIALGGVAHPLASLEAGARCTWFLPQPGGRSARKRWIAGSLA
FT                   PLGRLHVDAGAARAIRRGSSLLPAGVVRVEGRFERGDAVEIAGPDGAALARGLAAYPSE
FT                   DAMLIAGHRTDEIEALLGWRGRDELIHRDDLVLVAGPLPSVSS"
FT   CDS             complement(304667..305773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02610"
FT                   /product="putative MscS family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02610"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79608"
FT                   /db_xref="GOA:F0J222"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:F0J222"
FT                   /protein_id="BAJ79608.1"
FT                   /translation="MTRSAPGNPIAHAAGNLTIVLHGWPPLVTTAILAAAAILVAIVFH
FT                   AILFRLLPRPLRDRGRATGALVARVRAIVLAFLIVLMLTTVVPQAPLGPGLRFGVLHAL
FT                   SAGLVILIGWAVLLAIDIYTTRQLSHRPDNIQADAIARKHVTQWQVLRRASHVLTIIIT
FT                   TAAALMVFPAVRDYGVSLLASAGAAGLVVGLAARPVLSNLIAGIQIAITQPLRVEDAVV
FT                   INGQWGWVEEITSTYVVVRIWNWQRMVVPLAWLLEQPFQNWTRDSSELIGEVHWSLDYT
FT                   VPMDVLRRKLDEIVHATPLWSGKVVVLQVTHALETTLTLRALVSARNSGEAWDLRCFVR
FT                   EQMITFLQKEYPYALPRRRVDLERTEAA"
FT   CDS             complement(305895..306452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02620"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79609"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:F0J223"
FT                   /protein_id="BAJ79609.1"
FT                   /translation="MMTIETARMPKENAMNRSALAIGLATATLFGASAASAAAPPKPVY
FT                   IHMNGANEFLERLVFVRPGQKVVFVNEDTGAHAILGYSPQTGAASKTFDAPALAGTPGK
FT                   GHKVHTYSISFRHQGPEWYYCPVHAELAKAPGGVWLPKVRPGVHGFGTPMAGLIIVTTD
FT                   PALLKDNPATSASKILPGYFGG"
FT   CDS             complement(306508..307296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ate"
FT                   /locus_tag="ACMV_02630"
FT                   /product="arginyltransferase"
FT                   /EC_number="2.3.2.8"
FT                   /note="protein synonym:arginine-tRNA-protein transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02630"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79610"
FT                   /db_xref="GOA:F0J224"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017138"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/TrEMBL:F0J224"
FT                   /protein_id="BAJ79610.1"
FT                   /translation="MTVPGRPPQFFYATAPLPCPYVAGRTERKVVTELTGADADALHNR
FT                   LSRGGFRRSHNIAYAPVCAGCRSCIPIRIVSDRFRQSRTHRRIIAANAGLRAYEMPPRA
FT                   TAEQFKLFQRYQQARHGEGDMAGMSFYDYRAMVEDTPIETWLVEFRDGADELVGACLTD
FT                   RLADGLSAVYSFFAPDLTRQSLGTRSILWLVERTRELGLPYVYLGYWVPESPKMAYKAR
FT                   FRPAEILLGGTWTELTDSLAAADDPPSWPLHLAPVQQCGP"
FT   CDS             complement(307293..307787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02640"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79611"
FT                   /db_xref="GOA:F0J225"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:F0J225"
FT                   /protein_id="BAJ79611.1"
FT                   /translation="MSQSLPFDAEAARDAWLTRDVWPRRIIAFLVDMVLLAVLSVAVWW
FT                   VIVVLGIATFGLGFLLLHFTWAVPPLYYILWLCSSAAATPGQRLLGLTLRQDDTLEASV
FT                   ALRPSFAQALAWTVLLGVSFMLGMVPFLLVLVTRRRRAGHDLLSGLTVVHTSALGRPAA
FT                   P"
FT   CDS             307946..308878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="ACMV_02650"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02650"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79612"
FT                   /db_xref="GOA:F0J226"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:F0J226"
FT                   /protein_id="BAJ79612.1"
FT                   /translation="MKIVACNSNLPLADAVSKALHLPLTNAIIRRFADMEIHVEIQENV
FT                   RGEDVFVIQSTCFPANDNLMELLITLDALRRSSARRVTAVIPYFGYARQDRKTNPRTPI
FT                   SAKLVANIITEAGANRVLTLDLHAGQIQGFFDIPVDNLYGAPLFARDIQDRFAGRDIMV
FT                   VSPDAGGVARARATASRLACDFAIIDKRRPRAGVSEVMNVIGDVEGRHCIMIDDIVDSG
FT                   GSLCNAAEALIRHGAASASAYVSHGVLSGQALERIGASPIETLTITDSIHLDPARNPPS
FT                   NLQVLTIAPLLAEAMRRISDETSVSSLFD"
FT   CDS             308906..309526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="ACMV_02660"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02660"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79613"
FT                   /db_xref="GOA:F0J227"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:F0J227"
FT                   /protein_id="BAJ79613.1"
FT                   /translation="MKLFYAPGACSLGIHVLIEELGLPHEGVLVNLRDGQQFSDDYKAI
FT                   NPKAKVPAIVLDDGTVLTEWIAIANYLAATNPAAQLVPSSPVEAARCNELVAYINGWMH
FT                   PQGFARIFRPERFAPNPEDKEAVREQGRKIFAEGFDLIEPVLADGREWLLGAFSIADAA
FT                   LFYVSFWAEGRQTIPLPPNVSAHYARMKARPAVARAMEQERLS"
FT   CDS             309526..310110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02670"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02670"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79614"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:F0J228"
FT                   /protein_id="BAJ79614.1"
FT                   /translation="MTLPRAPFWFLRHGQTDYNAQGLSQGAIDIPLNETGRAQARAAAP
FT                   LLLGRGIVGIVASPMQRARETAEIVNETLGLPLAFEPDLREVVFGGMEGQPLEPWFGDW
FT                   IEGRLTPPGAESFADITARAGTALRSILARPGPLLLVSHGAFFRAVRGLLGVSLEGRTA
FT                   NAAPILCAPDGEGWRTAMAAELDEAVAPGAM"
FT   CDS             310157..311320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02680"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02680"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79615"
FT                   /db_xref="GOA:F0J229"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:F0J229"
FT                   /protein_id="BAJ79615.1"
FT                   /translation="MEMGFFAPRHMDIGGGAAARIAVLLGRFGLSRPLIVTDPVMVKLG
FT                   LVRRITDPLEAAGIVCTIFSDTVPEPVDTVVEAGVAIARGGAFDCLIGFGGGSPIDTAK
FT                   AINILLAAAPSARMRDFKVPVAADTAALPLIAVPTTAGTGSEATRFTVITDTETDEKML
FT                   IAGLGALPLAAVVDYELTMSVPPRTTADTGIDAFTHALEAYVSRRANPVSDAYARSAMR
FT                   LIGANLRKVWQTPQDRDAREAMMLGATLAGLAFSNASVALVHGMSRPIGAHFHVPHGMS
FT                   NAMLLPAVTRFSLNAALPRYAESARLAGFARADDADQLAGARLIEALEAINAELEVPTP
FT                   QGFGVARADWDALLPKMAEQALASGSPGNNPAVPDAAEIVKIYEEIF"
FT   CDS             complement(311392..312561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02690"
FT                   /product="putative amidase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02690"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79616"
FT                   /db_xref="GOA:F0J230"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="UniProtKB/TrEMBL:F0J230"
FT                   /protein_id="BAJ79616.1"
FT                   /translation="METRHPLSEAPDLGLIKSLDIRGNPHGPLAGLDVVVKDLFDIAGE
FT                   VTAFGNPDWGRHFGPALSHAWIVSQLLEAGARVTGKTTTVELAFGLEGRNTHYGTPLNP
FT                   AAPDRLPGGSSSGSVAMVASGRAHVGVGSDTGGSVRIPASYCGLYGLRPTQGLLSLAGA
FT                   APLAPSFDTPGWFTRDAETMLRVGEALLPPAPPLAAQFLMIPAAFANADPDVVAALEPA
FT                   LARLGPMGEADPVPEGLDRMLAWQNAVRGRETWLTLGGFIETVKPLLDPVTAGRIAATR
FT                   GFTAEAAAEGRVARRAHTARMHALLAGGAVLVIPTSPCPAPPVAAEQAVYEDVRTRTLR
FT                   VGIIAAFAGLPELTIPVGKVNGAPVGLSLIAGPGRDLALLELAADLALA"
FT   CDS             312668..313618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02700"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79617"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:F0J231"
FT                   /protein_id="BAJ79617.1"
FT                   /translation="MNATAITADAATIEAADKAARHWVSPDPGPLKPGSEAHKRAVCAM
FT                   FHETFNPYKPSVIEWPKLDPETLHKITSLPIWDIAVQTEGKARLRMAAYARIIADPDMS
FT                   KTIELNGWEENRHKEVLSKLVEAYDIPLEPEPEYRQPKDPEWAYLVTGYSECVDSFFAF
FT                   GLFELAKRSGFFPAELVETFEPVMQEECRHILLFANWVAWHRARLPLHRRIWFELRVAA
FT                   VWAFLGWERIGIARGMDDGGKDKPKAQDNNFTVTGSKSVSAEDISVPELMRICLEENDR
FT                   RFAGYDRRLLRPTTMPTLVRIALKFMPKPRQKAAA"
FT   CDS             313615..314469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02710"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02710"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79618"
FT                   /db_xref="GOA:F0J232"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F0J232"
FT                   /protein_id="BAJ79618.1"
FT                   /translation="MSGGGTAGGNERQIAYWNEVAGPKWIRVQAAMESRLTAVEDRLLE
FT                   RAAPRAGERVLEVGCGTGTTTARLAGLVGEGGHVTAVDVSRPMLEAARARLAGLAQVTL
FT                   MEADAAFATFAAPFDLVTSRFGVMFFEDPAAAFANLRASLVPGGRLVCAAWGPIADNPH
FT                   WSVPLEITVARLGPPKPRRPHAPGPLAFADRDHARTVLTQAGFAEIAIEPERVMLSGRS
FT                   LDDEAEMAGTMGPAGALIDEKEADAQTRAALRVAFREALPGYADADARLPATIHMITAR
FT                   NPA"
FT   CDS             complement(314479..314784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02720"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79619"
FT                   /db_xref="UniProtKB/TrEMBL:F0J233"
FT                   /protein_id="BAJ79619.1"
FT                   /translation="MRLRWVRGRDSLLTETGARAREWLGLDDAGNAVARVIHLDGPMTT
FT                   ARGRFHAVALDDEARLIRLLPRPPADGDWLALIGGRVVGRAAAPLAAVRHAEAALQ"
FT   CDS             complement(314821..316908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="ACMV_02730"
FT                   /product="elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02730"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79620"
FT                   /db_xref="GOA:F0J234"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="UniProtKB/TrEMBL:F0J234"
FT                   /protein_id="BAJ79620.1"
FT                   /translation="MSGTSLAKIRNIGITAHIDAGKTTTTERILYYTGVSHKIGEVHDG
FT                   NTTTDYMEQERERGITITSAAVTCEWKDHRINIIDTPGHIDFNIEVNRSLRVLDGAVFI
FT                   IEGVAGVQPQSETNWRLADRYNVPRIIFINKLDRTGADFYRAFDTLKEKLDIVALPLQL
FT                   PIGIEDQFVGVVDLVEMKAIVWEGGELGAKFHDEEIPADMLEKAKEYRQNLLDTALSVD
FT                   DAGMEEYFEKGDVATETLKRAIKTGTISGAFRPVLCGTAFKNKGVQPLLDAVLDYLPSP
FT                   VDIEGIKVAPPEGEEEDPSANRRVIPANPDAPFAGLAFKIINDKYGTLTFVRVYAGTLR
FT                   SGDTVLNTTKGHKERVGRMFQMHADKREEVKEVHAGDIAAFVGLKDTGTGDTLASSDDP
FT                   VVLERMAFPVPVIDISVEPKTKEAVEKMTLALQKLAGEDPSLRLKTDQETGQTILSGMG
FT                   ELHLDIIIDRLRREYGVEANVGAPQVAYRETITREHTETYTHKKQSGGSGQFAEVKIIF
FT                   EPQERNEGILFENKVVGGAVPKEYIPAVEKGIKVQADTGVLAGFPTVDFKYTLVDGKYH
FT                   DVDSSALAFEIAAKACFREGMKKAGPVILEPIMDVEITTPQDHVGDVVGDLNRRRGMIQ
FT                   NQESSGSTVIVRAQVPLKEMFGYISNLRSMTKGRASFTMQFHHYDPVPRNIADEIMTKS
FT                   A"
FT   CDS             317120..317410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02740"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79621"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:F0J235"
FT                   /protein_id="BAJ79621.1"
FT                   /translation="MGQPAARLTDMHVCPMVDVLVPHVGGPIIGPGAPTVLIGGMPAAR
FT                   VGDMAVCVGPPDSVVVGAFTVLIGGQPAARMGDSTAHGGTIILGMPTVLIG"
FT   CDS             complement(317457..318725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacC"
FT                   /locus_tag="ACMV_02750"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02750"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79622"
FT                   /db_xref="GOA:F0J236"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:F0J236"
FT                   /protein_id="BAJ79622.1"
FT                   /translation="MPLAMPTVRTSATMKRRLSLLTLALFTATSYAAGRTPAPGKGAAH
FT                   ATAATTAPQDAGPAPVAPLAIPGVPMPPTLPQQASYVLMDADTGAVIAAKAPDQPWPPA
FT                   SLTKLMTAYLTYQAVAHGSLKMDQTVPVSVSAWHTGGSRMFISPGMTVTVDQLLHGLII
FT                   DSGNDAAVALAQAVAGSRSGFVGLMNHEAKALGLKSTHYTNVDGLPNPDLRTTAMDVAK
FT                   LSRDIVRTYPQFLKISVKKHFTFDKIRQRSWNPVLFHDPTVDGLKTGRTKEAGHCIDAT
FT                   ALRNGRRLIAVVLGGPSWTVSTHDIEALLDYGYQFYANAKVAVAGKPAGTLKAPLYRTT
FT                   AVAVGPAHSITMTIPALAAKTLKTSVALDPPPAAGVHRGQTVGTITVSAGGKTLATVPA
FT                   VALADDPPAGFVTRMMRKLKAAL"
FT   CDS             318856..319614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="ACMV_02760"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02760"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79623"
FT                   /db_xref="GOA:F0J237"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="UniProtKB/TrEMBL:F0J237"
FT                   /protein_id="BAJ79623.1"
FT                   /translation="MAQTKDSVAGSIREWVVTLVYVVVIAVFIRSFLFEPFFIPSGSLT
FT                   PTLLPGDFVLVTKWNYGYSRWSFPFGEPDFKGRIFGSLPKQGQIAVFALPRDPSIDYIK
FT                   RVIGEPGDTVQVTDGQLYINGREVPRTPAGTYVETPLDSGEGVPIKVRLYREHLPDGVT
FT                   HLIAKATNQGFANNTPVYHVPPDHLFMMGDNRDFSEDSRYLDAVGYVPLANFVGRARII
FT                   WFSIRLDHPWWEFWYWPVDIRWDRLFTVIH"
FT   CDS             319611..320276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="ACMV_02770"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02770"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79624"
FT                   /db_xref="GOA:F0J238"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:F0J238"
FT                   /protein_id="BAJ79624.1"
FT                   /translation="MSEAAEALLGHRFARPDLLAQALTHRSAVGQGGLGSNERLEFIGD
FT                   RVLGLLIAEWLIERFPHEREGGLGPRLAHLVSRQSLAEIAEHGGIAGLLSVSPGESRRG
FT                   VRNRATVLADALEALIGALYLDGGLEPARLFIRRIFAPRIDGQPSAPPKDPKTALQEYA
FT                   LARGPVLPAYELVERTGPSHAPRFRIRVTVAGRAAEGLAGTKREAEQNAARDLLEQLQ"
FT   CDS             320273..321160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="ACMV_02780"
FT                   /product="GTP-binding protein Era"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02780"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79625"
FT                   /db_xref="GOA:F0J239"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:F0J239"
FT                   /protein_id="BAJ79625.1"
FT                   /translation="MTTRCGYVALLGRPNAGKSTLLNQAVGAKVSIVTPKAQTTRFRIS
FT                   GIVMRGGDQIVLVDTPGIFAPKRRLDRAMVAAAWEGVAGADLACLIVDAAKADPDDLAE
FT                   PIEALAATGRPRWLILNKIDLLPRDKLLPLAETLARQGGFAEVFMISALKRDGVDRLLD
FT                   ALAAAMPEGPHLYPEDELTDQTERMLAAELVREQIFLQLRDEVPYGASVETESFSERKD
FT                   GSVRIDVTVYVARAGHKKIVLGEGGARIKSIGSRARRDLERQLERRVHLFLNVKERPGW
FT                   DEEAARLRALGLDG"
FT   CDS             complement(321199..322317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02790"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02790"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79626"
FT                   /db_xref="GOA:F0J240"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniProtKB/TrEMBL:F0J240"
FT                   /protein_id="BAJ79626.1"
FT                   /translation="MDFDFTEEQRLLRDSVGKLFASRYADFEKRKAYAKLPEGFDRAVW
FT                   AEYAEAGLLALPFDEAQGGFGGGPVETMIVMEEIGKALALEPYLAAIVFAGAVLRHGSS
FT                   AAVRDEVIPALAAGETIVAVAHTERSSRHDLEDVTTTAKRDGDHFILEGEKSVVLGGDT
FT                   ADWLIVSARLAGSRRDRDGIGLFLVDAKAEGVSRRGYPMQDLLRGAEISLASVRVPAAR
FT                   QIGDLAVLERARDETIAALCAEAVGAMEALVGLTVDYMKQRKQFGVAISVFQALQHRAV
FT                   DMYVALEQARSLAIFAALSVADDDAEARGKAMALAKAGVGKALHFVGQQAIQLHGGIAM
FT                   TMEYKAGHYFKRLTMIDTMFGNADHHRRRLAA"
FT   CDS             complement(322328..323539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02800"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02800"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79627"
FT                   /db_xref="GOA:F0J241"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR017617"
FT                   /db_xref="UniProtKB/TrEMBL:F0J241"
FT                   /protein_id="BAJ79627.1"
FT                   /translation="MELSFSPEEIAFRDEVRAFIRDNLPGDVQKRLIEGREIGKQDIVD
FT                   WQRKLNAKGWAVPHWPRAWGGQDWSPVQEFILLDELQSAPAPSPLPFNVSMVGPVIATF
FT                   GNDEQKRKFLPATANLDIWWCQGFSEPGAGSDLAGLKTTARREGDHYIINGQKTWTTLA
FT                   QYADWIFVLARTDPGAEKKQQGISFILVDMKTPGITVRPIQLIDGGHEVNEVWFDEVKV
FT                   PAENLVGEENKGWDYAKFLLGNERTGIARVGASKQRLRRIRELAAIERAGDAKLIDAPW
FT                   FREKLADVEIDLKALEITQLRVLAEARKSGKHGRPDPKSSILKIKGSEIQQATTELLLD
FT                   VVGPLAMPFQGSTDPDDDGNAMPIGPDDAAEAAPTYFNWRKISIYGGSNEIQRNIIAKA
FT                   ILGF"
FT   CDS             complement(323642..325345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="ACMV_02810"
FT                   /product="long-chain fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /note="protein synonym:acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02810"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79628"
FT                   /db_xref="GOA:F0J242"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR017618"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:F0J242"
FT                   /protein_id="BAJ79628.1"
FT                   /translation="MNARPFPWERNYPPGLGWDIDIPAETIPAMIARSIAENAAQPALE
FT                   YRDRETGFAELGVAIGEVAAGLASLGHAKGERIALYLPNVPAHPFCFYGALTAGLVVAH
FT                   LSPLDAERELAHKLHDSGARTLVTTNLGAMLGMALKLLDAGHVERLVVADDAAFGEIPG
FT                   MAHPPIPTGDPRVMTLDALRARGRAFEFEPPAIAPGDLALLQYTGGTTGLPKGAMHTHA
FT                   TLRAAVAIYATFFDGQNRFPPGQKFRAICVLPLFHIYALVVLCLLQLSRGSTLLLRLKF
FT                   DAETTLRDIEVKKASYFPGVPTMWIALANVPDLDRRDLSSLRLVGSGGAPLPVEIGQRF
FT                   ERLTGMRLGGGWGMTETASAGTGNLLDGLFKFGSAGMPLPGIKLDVVALDDPSRVLPYG
FT                   ETGEIRIRSPNTFIGYWQNPEETARSFVDGHFLTGDVGYIDEDGMVFLVDRKKDMILSG
FT                   GFNVYPTVIESAIYEHPDVAEVIVVGVPDDYRGQSAKAFITLKPGAAEFTIESLRDFLA
FT                   DKLGKHELPAAVEFREALPKTSVGKFSRKELAAEERERHASARASGAAAP"
FT   CDS             complement(325342..327438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02820"
FT                   /product="putative fatty acid oxidation complex alpha
FT                   subunit"
FT                   /note="multifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02820"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79629"
FT                   /db_xref="GOA:F0J243"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:F0J243"
FT                   /protein_id="BAJ79629.1"
FT                   /translation="MSEQKVGLEIANGVAVISIDNPPVNALGHAVRAGLVEQLAAAEAD
FT                   ASVRAIVLACKGRTFSAGADITEFGKPPRAPGLHEVIERFDNCRKPVIAALFGTTLGGG
FT                   LELALGCHYRVAVESARMGLPEVKLGLLPGAGGTQRLPRLIGPEKAVAAIVSGKMIGAK
FT                   AALADGLIDAIVSDPVQGAIDFAHTVDPAKLVRVRDRSDKIAAAKADPSAFEAAAAEAT
FT                   KRLKGVEAPAACVEAVRNSFTLPFDEGARAEQQAFMRLVVGDQSRAQRHVFFAEREAQK
FT                   IPGIGPEVKGAKIGRAVVIGGGTMGGGIAMNFANAGIPVTIVETDEAALSRGLDRVRGT
FT                   YDVSVQRGALPAGTTEKRMALFSGSTDWGVMAEADIVIEAVFEELGLKKEVFARIDGIA
FT                   RPGALLATNTSTLDVDAIAAATKRPGDVLGMHFFSPANVMKLLEIVRGKESSAQSIATA
FT                   IAVGKTLGKVPVVVGNCDGFVGNRMLARRTIECERLMLEGALPQQVDAVVKAFGFPMGP
FT                   FAMGDLAGLDVGWRIRKHRGATAPVSDALCEMGRFGQKTGRGYYIYENGSRVPTPDPEV
FT                   EALISEKATALGITRRAISDQEILERMTYPMINEAARILEEGIAIRPSDVDVVWVYGYG
FT                   WPVWRGGPCFHADLVGLKEIAARLEHYAQAVGDETLAPCALLRRLAAAGQGFADFAQDA
FT                   KAAS"
FT   CDS             complement(327537..328535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02830"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79630"
FT                   /db_xref="UniProtKB/TrEMBL:F0J244"
FT                   /protein_id="BAJ79630.1"
FT                   /translation="MHRLAPLVLACLLGMPFAAHAASLTLYSRLDYAPAVARAFTAKTG
FT                   IAVRVRRPPPTGLADRIEREGAHPRWALAWFAGTPNAVALDARGLLARHLPVPAGLSPR
FT                   AAALIPADGSAIPTGLELGGVVLMSKSAPFTPPLHWHGLLAPARRGLTGMADPTTDDAA
FT                   WGGLASLLATEGWPDGRRFVTALGGAGLHIYATTADTVAALRSGAIQLALVRSAVAFHV
FT                   ASRIDPSLEAVVPAPAVLMPSLIVMPRHMTPALRRGAAAFIAFACSPAGQRAALASDDM
FT                   DSAFWPVNATVPPPPGLPDLAALAPRDPAAVAANPLPAIAWFAREMVGPGL"
FT   CDS             complement(328535..329908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02840"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79631"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:F0J245"
FT                   /protein_id="BAJ79631.1"
FT                   /translation="MSAAPQPTAKITVGEVLAEITALERDGRLEDAESLAERAVAASPG
FT                   HPHILHLSGIVAYRRGNIPRAIERIEKSLVLAPEVAIYPRNACEIYRGAGRLDDALAMA
FT                   LRAVELAPEERAAHFNLALIRYERHELDAGIEAADRAIALSPDFAEAHFERAELLLIGG
FT                   RLTEGWESYEWRFKLKQADGMLPKTDKPQWDGSPMPEGRLLLVADQGFGDCIQFGRYIP
FT                   WVAARAPKPVIACGGDLMPLLRQFTEVGRFANSWAAAGEYDAFMPLSGLPRLAGTTIPT
FT                   IPADIPYLRADPRKVEAWRQRLAALVPPGLKRIGLVWAGRPTHKNDRKRTVRLERFAPL
FT                   FARPDIAIVTVQKGDRIDEVGGYFGPAPLVNLGPSIFDFTDTLAILQCLDRLVTIDTSV
FT                   AHLAGASGVPTSIILPYAPDWRWLLDREDTPWYPSLRLFRQERPSDWSGVVERVAGSL"
FT   CDS             complement(329905..331785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02850"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79632"
FT                   /db_xref="GOA:F0J246"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR026634"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J246"
FT                   /protein_id="BAJ79632.1"
FT                   /translation="MSAASPSPAPRPDPAPCACGSGLRARRCCALDGGGPPDPAHHALV
FT                   APQVEQARAARTAGRNREAERLLLQVLDLAPLHREALRLLYEIRHAERRIPAAIALVAR
FT                   IAALPPETPAAHVQHAQLLIGQGRHAEAEAPARRALLLAPRDPSVHHLLGMIQTETGRP
FT                   TSGERHYRMAEALIEAPNPTLLGNLAWNLRQQGRLDEAAAVYGQALSGTVRPVRALAGL
FT                   AQVEAGRGRFDAAEALLAEAVTSAAAPGDRMVAALIALSRLRAGDAEAALDRIAATEAA
FT                   IAPQPLLTTELAMRGRALERLGRHDEAWAAYLAGRDFQRERARRRFDPAPIEARLAGIR
FT                   ETFRADRLAGLPRPAPVANAPVPVFLLGAPRSGSSLLEHLLAQATEIDPADNRAPLPGL
FT                   GRLLPRLVEGFGGPTLDFPAALEGTVAGEAQDIPAILASRYVALIRAAGIVGPQARFVT
FT                   DRHPELPWLLGLANTLFPGAPVIHVLRHPLDVVLSGFAQDRLYEGNAGVTLASLARLYD
FT                   AQMNAIAHVRGQTTMRYLPVRYEDLVTDTEATLRRVLDFIGLAADPAAMITAPPRAVPR
FT                   VPAYRAELEPPHRRGVFRHRRFGDVFGEAMPVLAPWIERLGYAATPEGAA"
FT   CDS             331917..332873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02860"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79633"
FT                   /db_xref="GOA:F0J247"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR017040"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:F0J247"
FT                   /protein_id="BAJ79633.1"
FT                   /translation="MRNFSELSDREILALAIGAEEEDGRIYADIAESLRTDYPASAKVF
FT                   SEMAAEESEHRRSLIDLYQQKFGDHIPLIRRQDVRGFLARKPVWQLPTPSINDVRKLAE
FT                   SMEAETQNFYRLAASRTSDTATRKLLGDLAEAEADHERLADRLARENLTEEVRSAEDDT
FT                   ARRNFVLRYVQPGLAGLMDGSVSTLAPVFAAAFASGSPWQAFIVGIAASLGAGISMGFA
FT                   EALSDDGSLTGRGSPLMRGAITGAMTTLGGLGHTLPFLIPNFWTAMVLAFAVVVVELAA
FT                   ISWIRTKYMDTPPLQAALQVALGGAIVFAVGVAIGSS"
FT   CDS             332905..333861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02870"
FT                   /product="putative 2-nitropropane dioxygenase"
FT                   /EC_number="1.13.12.16"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02870"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79634"
FT                   /db_xref="GOA:F0J248"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:F0J248"
FT                   /protein_id="BAJ79634.1"
FT                   /translation="MSAAQDLRNRLAIPVIGSPLFIISNPKLVIAQCIAGIVGSFPALN
FT                   ARPASQLDEWLAEITETLAAWDRDHPDRKAAPFAVNQIVHRSNARLEQDLELCVKYRAP
FT                   LVITSLGARPEVNQAVHGYGGIVLHDIINDRFARKAVEKGADGLIAVAAGAGGHAGTLS
FT                   PFALVQEIRTWFQGPLALSGAIATGRAVLAAEAMGADFAYIGSAFIATEEANAASAYKQ
FT                   AIVASGAEDIVYTNLFTGVHGNYLRPSIVAAGLDPDNLPQSDASAMNFHEGAKAKAWKD
FT                   IWGSGQGIGAVDAVLPAGERVARLIAEYRAARAALCG"
FT   CDS             complement(333869..334534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02880"
FT                   /product="glutathione S-transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02880"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79635"
FT                   /db_xref="GOA:F0J249"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:F0J249"
FT                   /protein_id="BAJ79635.1"
FT                   /translation="MIVVHHLEASRSQRVLWLLEELGLEYEVQRYDRDRKTRLAPPSLR
FT                   AVHPLGKSPVITDGGITVAETGAIVEYLIGTYGKGRLIPPEGTDERRRYTYWLHHAEGS
FT                   AMPFLVMKLVFDEMPKQAPFVLKPLMRAIGNKVGDAFLDPNLGANIRFWEDALANSAWF
FT                   AGDAPTGADIMMSFPIEAANTRGLLRGNYPRLNAFLAAIHARPAWQRALERGGPYPFA"
FT   CDS             complement(334531..335358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02890"
FT                   /product="putative aminomethyltransferase"
FT                   /EC_number="2.1.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02890"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79636"
FT                   /db_xref="GOA:F0J250"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="UniProtKB/TrEMBL:F0J250"
FT                   /protein_id="BAJ79636.1"
FT                   /translation="MPVMTTIAYLPARGVIGIEGPDRVAFLQGLVSNDVTKAEPGRAVW
FT                   SALLTPQGRYLAEFFILTDGESLLLDAPGVAVPDLIRRLSRFRLRSQVALRDRSDEFAV
FT                   HAAWGGAPSAPGAIVAADPRLPAAGHRLLAPAPLAGAADETAYRAHRLALGLPDHDDLE
FT                   PEKTLLMEAGFGDLHGIDWDKGCYMGQELTARTRYRGLVKRRLVPVDAEADLPAAGAIT
FT                   AGEREVGTLRTSLGRRGLALLRLDALDARLSLDGIALTPDIPSWMTLPETATP"
FT   CDS             335407..336303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02900"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02900"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79637"
FT                   /db_xref="GOA:F0J251"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:F0J251"
FT                   /protein_id="BAJ79637.1"
FT                   /translation="MRILFITSSRIGDAVIASGAMERIRHDHPGARLTVACGAASAGVF
FT                   ARLPGLERLIIFEKQRQDRHWLSLWSRLVRDRWEVVVDFRGSALAYTLRAGRRIVVRGG
FT                   RRPGRRYRQIGASCGFDPAPLPVVWTAPQDRAIATGLLPEGAPVLGLGPTANWDGKIWP
FT                   AERFVALARALDYRRIAVFGGPGEAEAARAAPVLAALPGAIDLVGRVSVVEAAACLARC
FT                   ALFVGNDSGLMHLAAAAGTPTLGLFGRSRASEYAPAGRCAGFVAAPGLEGEAPMEGLSV
FT                   ESVIAAARELAARVGTA"
FT   CDS             336300..337325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpsE"
FT                   /locus_tag="ACMV_02910"
FT                   /product="lipopolysaccharide core biosynthesis
FT                   glycosyltransferase"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02910"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79638"
FT                   /db_xref="GOA:F0J252"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:F0J252"
FT                   /protein_id="BAJ79638.1"
FT                   /translation="MRVAQLMAGAANGGAELFFERMTLALHEAGEAVLPVIRPDPARMN
FT                   LLRAAGLDPVGLRYGGPLDCLTRPRAGAALRGFGAEVAMAWMSRAAFHAPRGDWALVGR
FT                   LGGYYPLKYFRRCDHLVGNTRDIVRWIGEQGWPRERIAYLPNFVADFAAEAPAAREGLG
FT                   VPAAAPLVLALGRLHEVKGFDDLIRAIEPVAGAHLVIAGEGPERAALEALVAARGLGGR
FT                   VHLAGWRRDVGALLRTADLFVSSSRHEPLGNMVLEAFSAATPVVAVAAEGPREIIRDGV
FT                   DGALVPLGDTQSLSAAIAALLADPARRADLAAAGRARFEAEFAAPVVMATWRDYLAGVR
FT                   R"
FT   CDS             337325..339070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="ACMV_02920"
FT                   /product="asparagine synthase"
FT                   /EC_number="6.3.5.4"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02920"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79639"
FT                   /db_xref="GOA:F0J253"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:F0J253"
FT                   /protein_id="BAJ79639.1"
FT                   /translation="MCGIAGLALKPGARIAPETLAALARALAHRGPDGAGTHVSERAAL
FT                   VHTRLAIVDLATGDQPLFGAGAALIGNGEIYNNRELRAALPLVPFRTGSDCEPPLHLAR
FT                   AEADFVPLLRGMYALAIDDSERGVVTLARDPFGIKPLYRCAADQGTAFASEPQALLAAG
FT                   LATRRIDTARLVELLQLQFTAGTATVFTGIERVPPGALLTLRDGAEAALLDHPPIEPGE
FT                   APRDEDAALVALDAVLAQSVELHQRSDVPYGMFLSGGIDSAAILALMARLNETPVLAFT
FT                   AGFDRATVADERDDAEATARAVGARHERIEITETMTWRHLPAIVAAMDDPAADYAIIPT
FT                   WFLARHARGSVKVVLSGEGGDEMFAGYGRYRAAARPWPFARPMRARGAFDGLDLLRDRG
FT                   EGWRAGLLRARQAASGSGLARAQREDVATWLPDDLLLKLDRCLMAHGVEGRTPFLDREV
FT                   ARFAFALPDRLRARRGLGKYLLRKWLEANLPAARPFARKQGFDVPVAAWIAGQGQRLGE
FT                   LVARAPVIAEVADPARVRDLFARAADRRAGVACWRLLFLALWHHRHGLGGAVDGDVFEI
FT                   LGERA"
FT   CDS             339067..340395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="ACMV_02930"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02930"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79640"
FT                   /db_xref="GOA:F0J254"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:F0J254"
FT                   /protein_id="BAJ79640.1"
FT                   /translation="MTERYDLIIENGTLILPWGEATGRIGVRDGRIATLAATGDAAETI
FT                   DARGLHVLPGLIDPHVHFRDSGSGELPAVETMETGTRGAVLGGITAIFDMPNTGTPATG
FT                   QAALAAKRESLAGRAWCDVGLYVGATKDNIGELAALEAESGVCAIKVFAGSSTGNLLVE
FT                   DDASIERVMRAGRRRIAFHSEDEYRLQARRGEFSTGMAYANHAIWRDPECAALGTRRIM
FT                   ALARRTGRPAHILHVSTEEEFAYLRDFRDVASVEVLVNHLTQMAPDAYDRLGAYAVMNP
FT                   PIRDRRHVEAAWRAVADGLVDTIGSDHAPHPRAAKERPWPETAAGLTGVQTLVPVMLDQ
FT                   VAKGRLKLTRLVDLMAAGPARIYGAVGKGRIAAGYDADFTLVDLRRQQRIEAGWLASPC
FT                   GWSPFEGERVTGWPVMTIIRGQVAMRDGAVQGSPAGRSVTFRS"
FT   tRNA            complement(340925..341001)
FT                   /locus_tag="ACMV_t0050"
FT                   /product="tRNA-Pro"
FT   CDS             complement(341049..341639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02940"
FT                   /product="putative MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02940"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79641"
FT                   /db_xref="GOA:F0J255"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:F0J255"
FT                   /protein_id="BAJ79641.1"
FT                   /translation="MTDEPHRHESTPDEHGRNRVRKSAEAYRTISEVADELHVPQHVLR
FT                   FWETKFPRIKPLKRGGGRRYYRPDDVLLLQRIADLLYIQGYTIKGVQRLLRESGGLLHD
FT                   EIPPASEEERAASAAERARADIPAPPAPRPDRLPELPIDPAPATSNPGHAPAAMPDADS
FT                   APLERARAATALLRAAMASVLAELEDLRASLDK"
FT   CDS             complement(341636..341950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ihfA"
FT                   /gene_synonym="himA"
FT                   /locus_tag="ACMV_02950"
FT                   /product="integration host factor alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02950"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79642"
FT                   /db_xref="GOA:F0J256"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:F0J256"
FT                   /protein_id="BAJ79642.1"
FT                   /translation="MSTLTRAGLAESIYAAVGLSRNESAALLEAVLDRMKQALAEGESI
FT                   KISGFGTFSVRQKGRRIGRNPKTGREVPILPRRVLVFRPSQILRDAVDTGQVPSAAGQS
FT                   "
FT   CDS             complement(342032..342994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="ACMV_02960"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.180"
FT                   /note="protein synonym:beta-ketoacyl-acyl carrier protein
FT                   synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02960"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79643"
FT                   /db_xref="GOA:F0J257"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:F0J257"
FT                   /protein_id="BAJ79643.1"
FT                   /translation="MQRTVLEGVGSYLPERIVTNDELATRIDTSDAWIRERTGIGQRHI
FT                   AAAHETATFMGAEAARRALAAAGASADSVDAVIVATSTPDQGFPATAVSIQAAIGMTRG
FT                   FAFDLSAACSGFVYGVSVADAMIRAGQCRSALVIGTEVYSRILNWEDRSTCVLFGDGAG
FT                   AVLLRAGTGEDDRGVISTHIHSDGRYGDILFIDGATGQDDRPQHLVMNGREVFRHAVSK
FT                   LAGAVDEALAANDLTQADIDWLVPHQANRRIIDAMGKRLGLAPEQVVVTVDRHANTSAA
FT                   SIPLALDEAVRDGRIRRGHLVLIEALGGGLTWGSALIRF"
FT   CDS             complement(343000..344073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="ACMV_02970"
FT                   /product="phosphate acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="protein synonym:acyl-[acyl-carrier-protein]--
FT                   phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02970"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79644"
FT                   /db_xref="GOA:F0J258"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:F0J258"
FT                   /protein_id="BAJ79644.1"
FT                   /translation="MPILAVDAMGGDSAPGMVIAGLDIAAERHPNARFEVFGDAVQIDE
FT                   LVRLSKRLRNRVSIRPTTEIIPNELKPTAALRLRDASLRRAIDAVANGEAAGVISAGNT
FT                   GAMLALAKIVLKTMSGIDRPAMAAIGPSARGDVVMLDLGANVVCDARNLVEFAVMGELF
FT                   ARTVLGLPHPTIGLLNVGSEEMKGDETLRRAAEALRESPIGPQFRGFIEGHDIAGGTVD
FT                   VVVTDGFTGNVALKTGEGALRLVGDLLRRVFSANIASRLAYLLARPGLTRLREWLDPRR
FT                   YNGAVLLGLNGVVVKSHGGADAEGFAHAVDVAMDMIVNRFNDRIRDDLGRHADRERLAS
FT                   DAFRATPPASATSVTTG"
FT   CDS             complement(344230..344433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="ACMV_02980"
FT                   /product="50S ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02980"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79645"
FT                   /db_xref="GOA:F0J259"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:F0J259"
FT                   /protein_id="BAJ79645.1"
FT                   /translation="MAVPKRKTSPSRQGMRRSHHALGQQAHAECSNCGELKRPHHVCGH
FT                   CGHYDGREVVAAGKDLKGTVRV"
FT   CDS             complement(344589..345110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_02990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_02990"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79646"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:F0J260"
FT                   /protein_id="BAJ79646.1"
FT                   /translation="MTDAPPFPLSRHFDLARLGDAAQEVTIDADAEARAAIARQFGIPA
FT                   VEALSGRFHISRIGPDQAEARLELAAHVIQSCVVSLEPVEQTIAERTSFRLLAGGEPDD
FT                   AGSLDPDAPDDIVADGTVFDLGALLVEQLALALDPYPRRPGAEPPAASGTGAKDEAHPF
FT                   AALARLRRPD"
FT   CDS             345193..345690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03000"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79647"
FT                   /db_xref="GOA:F0J261"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="UniProtKB/TrEMBL:F0J261"
FT                   /protein_id="BAJ79647.1"
FT                   /translation="MRRLATKLRPLFPLLLLPALAGCALFTAQPRYRGTAVTEAQLKQL
FT                   TPGVSTEADATALLGSPTLRETFHDHDWLYVSQVTKPRIGQTLGVEKQQVVVLDFTGNG
FT                   VLKSIRRVGGKQAVHVAMAGGRTHAPGGHASFLQQLVGGVGHYNPGLGAGSAGGLGGGS
FT                   GF"
FT   CDS             345695..347284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03010"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79648"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:F0J262"
FT                   /protein_id="BAJ79648.1"
FT                   /translation="MIGRRGVMAGSVAALAMAGAARASTSVLGTAEPVTSLPPGSEAPQ
FT                   LNDVVAPGWRRDVLIRWGDAVLPSAPPFRPGEVTLAAASQQFGWDAIIAGLVKMPPADD
FT                   GVRRLLMVVTHPDVQMRMAFPRGRGAATVAGKMQGASVLNLAMQNGRWVVVAGGYQSRR
FT                   ITDGTLCRIAGPAAASVGQTVQGVLAPSIGGVTPWNTVLLPEGHTAGWIRRLAGHAPGF
FT                   GSPTVGAGFGWVVELDAANPMSFPVKRTALGRLSRAGVACGLAADGSAVVFMSEDGPMG
FT                   RLFRFKGAAPAGTGEGALDAGTLAVAVIEHSHIVWHDLPAGLPSLTATASAGRRGSGFD
FT                   APSGMAIAPDGTLYLACRGNPGRGISQIDPLNPRAGNGAGHILAFAPEGGDPGARRFAG
FT                   RVVLLGGNPAHDSSSRYAPGSTAWLRAPSTLDLDGSGRLLIGTDQRGAVTDTADGLFAM
FT                   HPHGGLDLLYSAPVGGAVGGAAADPAGKTLFTVARHPGATREADFADPATRWPTVRPGM
FT                   PPQTTMVSLAPD"
FT   CDS             347346..348824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="ACMV_03020"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03020"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79649"
FT                   /db_xref="GOA:F0J263"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:F0J263"
FT                   /protein_id="BAJ79649.1"
FT                   /translation="MLNTTGTVRLKDPALLREANYINGEWVQAESGKTLDVLNPATGEL
FT                   VGRVPAMGAAETRRAIEAAGRALAGWRAMLAKERAAILRRLYELMMANQDDLGAIMTAE
FT                   QGKPLAEAKGEIAYAAGFIEWFAEEGKRIYGDTIPQNAPGRRIIVQKQPIGVFAAVTPW
FT                   NFPSAMITRKAGPGWAAGCTGVIRPASQTPFSALALAVLAERAGMPAGVCNIITGPSGP
FT                   MGAELTANPIVRKFSFTGSTEVGAKLLAQCAPTIKKTSMELGGNAPFIVFDDADLDAAV
FT                   KGVIDSKFRNAGQTCVCANRILVQDGVFELFAEKLKVAVEALKVGNGMEPGVTQGPLIN
FT                   REAVEKVEAHIADAVAGGARIVTGGTRHERGGNFFTPTVIADVKHDALIFREETFGPVA
FT                   PLFRFNTEAEAIAMANDTEFGLASYFYARDVGRIFRVAEALEYGIVGINEGLISTEVAP
FT                   FGGVKSSGLGREGSKYGIEDYLEIKYLALGGLGG"
FT   tRNA            348838..348927
FT                   /locus_tag="ACMV_t0060"
FT                   /product="tRNA-Ser"
FT   CDS             349072..350295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03030"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03030"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79650"
FT                   /db_xref="GOA:F0J264"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="UniProtKB/TrEMBL:F0J264"
FT                   /protein_id="BAJ79650.1"
FT                   /translation="MVRVVNKLSPLKVAKLTAPGLYGDGNNLYLQIAPSGAKSWSFRFM
FT                   IRGRAREMGLGPVALMSLAEARMRAIECRRLLLDGIDPIEHRQTQREAKTIRGKTFATC
FT                   AEAYIEAHQAGWSNAKHAGQWRATLATYAYPVFAETPVGAIDLDLVVKALKPIWTDKPE
FT                   TASRLRGRIESILDYATTKGWRQGDNPARWKGLLENVLPAKGRIARVAHHPALKWRDLP
FT                   PFMAELAQQEGVAARALAFTILTASRSGETIGATWSEIDLAAKIWTIPEWRLKKRQGDH
FT                   RVPLTDPVLAILATMRAAAGTPAPAAFVFPGGKTGTGLSNMAMLILLRRMGRENITTHG
FT                   FRSTFRDWAAEATDYRHEVVEAALSHTVSDKVVAAYRRTDFFDRRRDLMVDWARYALSS
FT                   ADSEGSAS"
FT   CDS             350292..350930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03040"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79651"
FT                   /db_xref="UniProtKB/TrEMBL:F0J265"
FT                   /protein_id="BAJ79651.1"
FT                   /translation="MTRDEDEQAPKPRNRRPRAPRIKTLPESMRDPRHNPDAALAEIRA
FT                   VLKEGGRPLSLDEAKAWLGRVDLRHFEAEIDPQTGAARSPERAECDKDGRLRFREPGEK
FT                   HGPGRLRMRSEQAIEQAEADFARAVNEVEQVSTLLHWQSTAASRSASVRSLQATEIADR
FT                   VCQLYDTLSLPARNRASVITKLLARDGHAITVQRVRQILATHRPRPTRK"
FT   CDS             351192..351524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03050"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79652"
FT                   /db_xref="GOA:F0J266"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J266"
FT                   /protein_id="BAJ79652.1"
FT                   /translation="MAGRAAGTEDRRVGYEAAAWGVGLMNAPLIFGQSASPEIDSATKQ
FT                   HSAESASGTQFMTLRDVADILDVSPSTLRRRIAEGALRVHRIGRAIRISQTDLAAFLAA
FT                   SRGAES"
FT   CDS             351521..353578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03060"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03060"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79653"
FT                   /db_xref="GOA:F0J267"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:F0J267"
FT                   /protein_id="BAJ79653.1"
FT                   /translation="MIAEQLEFTGFRPNTGHRHTQYGEPLPADAVPNERNRMRTHSGER
FT                   RRARVMQDDLFGALCAETSDLASKTGIREPMAAEHSACNDGGGALDEPVDGAIIDPTTI
FT                   SLPANARARVAGDTVVCATPPATFAEALELLAASDTLPAARLKDLRRDVAWIEDHCPRN
FT                   RDGSVAAPLPCDPAALRPILKSLKFDRKKTGPKRFYNIKSSLAAIQRKTGWLPPRAPRR
FT                   PITTTAWASLLGMMSDGDLSRATMRRFAVFCEERNVAPGDVALEHLDAYHDALAATNAK
FT                   APDQTVTTIKSRWNRLCREQESFPGQELPARRNPNTIRDDANGIPPSFMADLNAYIAKL
FT                   RKPGPFEKGFTGPAAKSTVRTRGDILALAPHRLVKRGWPAATLTSLAAILTPTAVEAIL
FT                   TDYWDTNCAESGWTLGAEATAQALAAAARQWGKLPVAELEQVLDICREVRAKHRGFTAK
FT                   KLERLAQFDDPKIERRFLQLPETLWRKALRFAKAGKMKRAADTAKYALALAILFDKPLR
FT                   VADLSILDLALDFARDAKGKITGVKIAYGRASKRAPMVEGALSSQTVRMLETYVTRFRP
FT                   TLLHDESTSLFPGQEAGHLVSKSMATQIRALIGRELGVDVNSHLVRSYVGTVILDEDPR
FT                   AVALAQRVLGHQNATTTLKFYAAQRGRAANRHYAELIERRRRRLRMNVED"
FT   CDS             353583..354665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03070"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03070"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79654"
FT                   /db_xref="GOA:F0J268"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:F0J268"
FT                   /protein_id="BAJ79654.1"
FT                   /translation="MTTIPPTPRPDAVPGNKEQHRSLPLATWPPEDRARWQRVKEKQGL
FT                   FDRQAILHDLKTPTVRGLEQSVGRFLAYLLHVRAMTPAASIGTLLSPELVNDYVGVMRK
FT                   CLRAGSVHEELRRLRAGLGIMLPGVELGWMNSLPLKPTRAEVLASRKPIDRPDAARVLA
FT                   AAYRAFDALPVMQRDTDTSQAARNALMVAFCDLFGLRLSDLARIRLGEHLRQHGSRWRL
FT                   MFPCGVKNDALLLFDVPPELAQRLETYLGAWRIALLGNRLDHGFLWIARGGKPPLEKMI
FT                   AMGIAKFGRLHLGRSLNSHVFRHAFAVTTVLRNPADADLAAAALGHTSEQMVHGTYTRS
FT                   GDQEISRLWLRKLTRKRRGL"
FT   CDS             354738..355040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03080"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79655"
FT                   /db_xref="GOA:F0J269"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:F0J269"
FT                   /protein_id="BAJ79655.1"
FT                   /translation="MPIMNPAKQASAPSSRRDTLNLRIKSDDRGLIDRAAALTGKTKTD
FT                   FVIDAARRAAEDALLDRTLFLATPDAFDAFRARLDEPPLPNARLQRALKTTPPWE"
FT   CDS             355042..355533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03090"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03090"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79656"
FT                   /db_xref="GOA:F0J270"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:F0J270"
FT                   /protein_id="BAJ79656.1"
FT                   /translation="MALTPPEPLAEHHDISGFNCGIASLDDWLRRRARANQAGGATRTF
FT                   VVTESGRVVAYYAIASGAISPNGTSGRFRRNMPDPIPVAVLARLAIATSAQGQGLGRAL
FT                   FRDATLRILNAAETLGIRGIVVHAISDQAKAFYLALGFEASPLDPMTLMVTLKDVRAVL
FT                   "
FT   CDS             355848..356162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03100"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79657"
FT                   /db_xref="UniProtKB/TrEMBL:F0J271"
FT                   /protein_id="BAJ79657.1"
FT                   /translation="MKQTGLEVRPMYHWSPRRIEAHVRLCVLALQIQRSAELRCGLPWA
FT                   RIAHILAGLKAVRYQIAGRTIVQRTKISPEAAEILKNLGISKPKKLLTVIEPPQAKAAS
FT                   "
FT   CDS             356229..356771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03110"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03110"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79658"
FT                   /db_xref="GOA:F0J272"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:F0J272"
FT                   /protein_id="BAJ79658.1"
FT                   /translation="MNANPGVTERLNLVNRQIKTVLQRIDGLVEQLAGPETEPGQDTEQ
FT                   RDAAILRSLPGVGRIVLATLLAEAHQALQARDYQALRTLTGVAPVMKRSGRSCRVEMRQ
FT                   ACSGRPRTVVYHWARVATQHDARSRSRYAALRGRGHSHGPALRTVADRLLGIACVMLTN
FT                   RTMFDPEKMPTDRPKSA"
FT   CDS             complement(356827..358449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03120"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79659"
FT                   /db_xref="GOA:F0J273"
FT                   /db_xref="UniProtKB/TrEMBL:F0J273"
FT                   /protein_id="BAJ79659.1"
FT                   /translation="MHRITVSFGRIRPVASVIIGMTVLLTNAAVVCIIARSLGADINWD
FT                   LLNYHFYNGYLWAHGKLIQDSLCTEQSYLDPRLNFFYYLLIKNFAPLTVNLIIAGFQSL
FT                   GISAAWLLCFHLLKIYNIRTRLILSSVAAISAIIGPIFWSEIGGTMGDTLLASPIILAI
FT                   FFSLISQERDRLIYLFFAGLLVGFVAGLKFTNMIYAVGFVFAFILTTLYRYKFNIRRLV
FT                   IVETIFCFSFLSGFVLLYFNIGYLLFLTYKNPIFPYFNNIFHSPYIGNYAIRDERWFPQ
FT                   NLIGYITLPFEFVVRHHPKPNQQHIIGMEIPFRTIFPALYFIISPSILLYLYFKKIKNN
FT                   ELYDIFFVLSFFAGSFFVWEEVFSYYRYFAAAEMIFPTILLVLLVRWGRLIMHWRHHSM
FT                   TYVAAALLVATAAAYSLPDSNWGREAFSSSYFGASKREFKSYNNALLIVGFRPLGFILP
FT                   YFPLDDRIIGLPEHLGITQKFQKKYLRPLLDYKNIYYLTDAAEIKNDRELPAHYGVTVN
FT                   YENCSIYKTSIYPVAVCPVQHTP"
FT   CDS             358604..358801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03130"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79660"
FT                   /db_xref="UniProtKB/TrEMBL:F0J274"
FT                   /protein_id="BAJ79660.1"
FT                   /translation="MRYARDLTDAEWAFIEPLERLSTGLNREGFPLALISDSESVLVKE
FT                   AGMDGPTTIDGSSSAAFGGD"
FT   CDS             358749..359150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03140"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03140"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79661"
FT                   /db_xref="GOA:F0J275"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J275"
FT                   /protein_id="BAJ79661.1"
FT                   /translation="MGQPLSMDLRRRLLAAIDEGMSCRAAAARFGVAPATAIRWRAQRR
FT                   DTGSFAPKPQGGDTRSRRVEERRADILAIWETRKDISLAELRLALIEVGLHVSVAGLHR
FT                   FFIGSVRNSVYGRRLNIRPPGLLRSDRRR"
FT   repeat_region   359062..359069
FT                   /rpt_type=FLANKING
FT   repeat_region   complement(359070..360389)
FT                   /note="Belongs to IS256 family"
FT   repeat_region   359070..359100
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 31 bp inverted repeat"
FT   CDS             complement(359110..360333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03150"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03150"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79662"
FT                   /db_xref="GOA:F0J276"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:F0J276"
FT                   /protein_id="BAJ79662.1"
FT                   /translation="MARRRAPAIPDELLDQLLAGGDAGAALNSGDLVNALKKALAERAL
FT                   SAEMDYHLSDEAEAENSRNGYGRKSVSTGTGKIEIAIPRDRAGSFDPQLIAKCQRRFPG
FT                   FDDKIISMYARGMSTREIAEHLREIYGMDASAELISTITDAVLDEVTSWQQRPLDPVYP
FT                   LVFFDAIRVKIRDEGEVRNKAIHIALGVMADGTKVVLGMWIEQNEGAKFWLRVMNELKN
FT                   RGVEDILLAVVDGLKGFPEAITAVFPETIVQTCIVHLLRNSMDFVSYKDRKAVATALKD
FT                   IYRAVDARAAEAALADFEAGPWGQKYPAIGQSWRRVWQEVIPFFGFPGDVRRIIYTTNA
FT                   IEALNSKLRRAIRARGHFPSDEAAAKLLYLILNRSEKEWVMPPREWAMAKAQFAVIFGD
FT                   RFVRALAA"
FT   repeat_region   360359..360389
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 31 bp inverted repeat"
FT   repeat_region   360390..360397
FT                   /rpt_type=FLANKING
FT   CDS             360550..361023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03160"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03160"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79663"
FT                   /db_xref="GOA:F0J277"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:F0J277"
FT                   /protein_id="BAJ79663.1"
FT                   /translation="MTRSHGRCARGERLRMGFPHGHRKTTTLVAGLRMTGMVAPMVLDG
FT                   PLNGDWFEAYVTKVLTPELRPGDVVIMDNLSSHKRDAVRERIEAAGATLRFLPPYSPDF
FT                   NPIEKAFARLKAILRKIGERTVSGLWDLIGRLVDSFQHRECANYFSSCGYDPE"
FT   CDS             complement(361299..361823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03170"
FT                   /product="perosamine synthase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03170"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79664"
FT                   /db_xref="GOA:F0J2M5"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2M5"
FT                   /protein_id="BAJ79664.1"
FT                   /translation="MVVCKDEVLARRLKTVKGQGQSPTQRYWHVELGFNYRMTNICAAI
FT                   GLAQIERLPTILARKRAIGDLYRRLCAERLGNIVSFQKLSANVVSSDWLVSLLLPEGTD
FT                   RTKVMGRMQENGVDTRPVFYCAHQMPMYSNSEHFPVSEAIAAHGISLPSYPTLSSADVA
FT                   RVVETLANALV"
FT   repeat_region   361828..361836
FT                   /rpt_type=FLANKING
FT   repeat_region   361837..363285
FT                   /note="Belongs to IS4 family"
FT   repeat_region   361837..361859
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 23 bp inverted repeat"
FT   CDS             361888..363276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03180"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03180"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79665"
FT                   /db_xref="GOA:F0IXG8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR014737"
FT                   /db_xref="UniProtKB/TrEMBL:F0IXG8"
FT                   /protein_id="BAJ79665.1"
FT                   /translation="MILRLMEKMVALRAGDLGYFGDARRAAMGSTLVERVVETGSLVIR
FT                   KLGGTRAREIAIHRFLSAPSVTCAEMVETLADRTAAACRGRRIVAAQDTTEINFSGREA
FT                   RRRGLGPAGDGVSAGFFLHPVIAIDSETEAVLGLVDAKIWTRSDEFDATPARERALEDK
FT                   ESMRWLDGAARAAGRLSGAASVVVVADRESDIYAGFARRPASVDLIVRAAQDRVLDDGR
FT                   RLFTAPAAWPELTRTSVRVAPSRTGVAARIATVALRAGTVTIRRPRHASDTEGPEHLSL
FT                   TMVEAREVDGNGESVPLLWRLLTTIETIDADGAAEIVRLYRLRWRIEEVFRSLKSDGLR
FT                   LEETQMQDAGRLFKLALIGLAAATRTVQLVDARDGSNRPATDVIDPGLLPAADAIAPTL
FT                   EGKTPRQKNPHPPRSLAWLAWIIARLGGWNCYYKPPGPKTMRAGWARFASMATGFFIAA
FT                   QSNP"
FT   CDS             complement(363261..363860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03190"
FT                   /product="perosamine synthase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03190"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79666"
FT                   /db_xref="GOA:F0J2M7"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2M7"
FT                   /protein_id="BAJ79666.1"
FT                   /translation="MSVDFLPVYRPDLSGNEKLYVNQCLDTTWISSIGDFIDRFEAGFR
FT                   EITGAPYAWCVSNGTVALHLAIHCLDIGPGDEVIVPTFTYIASVNTIAQTGAKPVFVEC
FT                   RSSDWLIDIDDVEAKITPRTKAIMAVHLYGAVCDMPALSALAKSRGLHLIEDCAEALGS
FT                   TYDGKHVGLFGDVGTFSFFGNKTVTTGEGYGIHGFD"
FT   repeat_region   363263..363285
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 23 bp inverted repeat"
FT   repeat_region   363286..363294
FT                   /rpt_type=FLANKING
FT   CDS             complement(363883..365220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03200"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03200"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79667"
FT                   /db_xref="GOA:F0J2M8"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2M8"
FT                   /protein_id="BAJ79667.1"
FT                   /translation="MEWTRHHMATHHRETSHVRNGPMRILWGTPYNVKSAIARYSRMVT
FT                   RALVADGHTVEILRLEDKTALDHDILDHNLPVHPPYTFDFARLRHDYDVCVINYGDYFP
FT                   FHAGALDLAAATPAVAVFHDANLEGFLGGARQIHPKLDALLNRWPPPGLTLPEKCTLPK
FT                   QDLSFFAALASGCVVHGSHYVDDVVATCPGPTVQMPLCYPDVGAVPPAPDGSGAFIVTC
FT                   FGMINPNKQPERILRALAVDPKLRTHGRMHFVGAIDEGYRTRLAALAADLGLAAPEFTG
FT                   WVDDAHLCASLAQAHLVCCLRHPMTEGHSASIITALYAARPIVVNDVGSYAEIPDGLVH
FT                   KIEAGDAPAPLAAVMAEIARDPQAAEAAAAGAAAWARVRYSAASYVGGLIPLLEAAITC
FT                   RPGLEAGRGMARHLTNLGVTFDDSATGLPRKFLACAGRPLMPPMSE"
FT   CDS             complement(365166..366203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03210"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03210"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79668"
FT                   /db_xref="GOA:F0J2M9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2M9"
FT                   /protein_id="BAJ79668.1"
FT                   /translation="MKVIVLNNASPFTWGGAEELADHLVRNLLASGAQAELLRIPFAWN
FT                   PPERLIEQMVMNFSFRLDQADRVIPLKFPAYLIPHRDKVFWLLHQYRQAYDLWDAGQSN
FT                   IPNTPEGSKIRAAISAADTQTFAAATRIYTNSRVTGKRLLDYNGFDSEVLMPPLNDPEI
FT                   FVNQGDEGYLLAAGRVNAGKRQTLLVDALAYLPPSIRMIVAGPPDSPADAQELVRRVAA
FT                   AGLQDRVKLDLRFLSRRELADYVGRARAVAYVPFDEDSVGYVTMEAFQASKPVVTTTDS
FT                   GGLLQIVHDDHTGTVGAPTPRALAEAIAKLMDDPARAAKLGQAGHKEWNGLGITWPHTI
FT                   EKLLT"
FT   CDS             complement(366200..367249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03220"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03220"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79669"
FT                   /db_xref="GOA:F0J2N0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2N0"
FT                   /protein_id="BAJ79669.1"
FT                   /translation="MKIALVSSVEPFVNGGYRNIVNWLVEPLQAAGHQVETIWLPFYDE
FT                   SNPLEQMWAYRLMDLESSCDRIVCFRPPAHLIPHTKKIVWFIHHFRIFYDLWGTPYSPI
FT                   SDTPSTRALRDAVMRMDEAALAEARLTFANSHVVADRLKRFSGVEAKVLFPPVESPECF
FT                   HCQDYGEEIVSVCRFESHKRQHLLAEAMALTRTPVRLRLCGRSQNDSYFASVRSAAGSA
FT                   ADRVTIEARWISEAEKVERLAGALASVYAPFDEDSYGYPTIEAAHASKATITTTDSGGV
FT                   SEFVIDGANGMIVPPTAEALAHAFDTLYADRALARRLGEAARARVAELGINWPSVVAAL
FT                   TAPLPGDAP"
FT   CDS             complement(367246..367890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03230"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79670"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2N1"
FT                   /protein_id="BAJ79670.1"
FT                   /translation="MSTLLLVGGGGHAKVVLDIAHAAGFSVVGFLDPDPAAPPIGEVRR
FT                   LGDDATAAALRAQGLTLAFVALGDNRLRRKIGERLRAEGFRLATLVHPSAVVSPSASIG
FT                   EGTVIMPLAVVNAAARIGEYVIVNTGAIVEHDCVLGDGVHVAPRSALGGCCTLGEEVFF
FT                   GLGACARPLSRIGAGAIVGAGAVVVGEIMANIVVVGAPARPLPGVDSEAVL"
FT   CDS             complement(367887..368660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03240"
FT                   /product="methyltransferase FkbM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03240"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79671"
FT                   /db_xref="GOA:F0J2N2"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2N2"
FT                   /protein_id="BAJ79671.1"
FT                   /translation="MLASRNCYGFLVLPTADLANVGYLSNGTLPEQGSRAVLDKLLAPG
FT                   DVFIDLGANVGLFTLAGARRVGPAGRVHAVEPAPDLVTALRLMTALNQIANCVTIHPFA
FT                   AGAAEGETELFLAHTSGHNSLFAEEEGLAAIKVRLAPLDALIAPGATVSVVKIDVEGAE
FT                   LQALAGMARIISDNPQIVILSEFSPSIIRRVGGTLESWIASVHNMGLDILEIDEAAGTL
FT                   APLRAEGLEELVWINLVLHRPEGRARLAPLLPGAA"
FT   repeat_region   369134..369142
FT                   /rpt_type=FLANKING
FT   repeat_region   369143..370543
FT                   /note="Belongs to IS256 family"
FT   repeat_region   369143..369185
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 43 bp inverted repeat"
FT   CDS             369239..370510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03250"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03250"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79672"
FT                   /db_xref="GOA:F0J2N3"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2N3"
FT                   /protein_id="BAJ79672.1"
FT                   /translation="MNENSTITSFHQPGSIMDPLTDIAREGARQMLMAALKAEAASFVA
FT                   QFSEELLPDGRQRVVRHGAGPERAVQTGIGPVPVQRPKVRDRAPGVSAETRIRFTSAIL
FT                   PRWARRSKSLDALLPVLYLRGVSTGDFQEALTALLGADAPNLSPAVISRLTAGWQEEYD
FT                   RWQRRDLSARRYVYVWADGVYLQARMEPQAECMLVIIGATPEGRKELLGFQVGFRESAQ
FT                   SWRELLVDLKARGLAVPPELAVGDGALGFWKALDEVFPGTRHQRCWFHKIANVLNHFPK
FT                   SMQPAVAADLREISHAETRAAALAAIDTFKAKYAAKYQRGVACLTKDTEVLLAFYDYPA
FT                   EHWEHLRTSNPIESVFATVRHRTVRTKGALSQKTAKLMVFTLIRAASKKWRKLNGTSQL
FT                   PRVIEGVRFNDGVAQSDATQSRAA"
FT   repeat_region   370501..370543
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 43 bp inverted repeat"
FT   repeat_region   370544..370552
FT                   /rpt_type=FLANKING
FT   CDS             372125..374485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03260"
FT                   /product="putative TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03260"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79673"
FT                   /db_xref="GOA:F0J2N4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2N4"
FT                   /protein_id="BAJ79673.1"
FT                   /translation="MQLSLMALLLSTSCLIPAAAYAQTVSAGEVSASSALSLPGVTTAP
FT                   SQKKVFKSGNTTRVLNRKLLEAAGPVAGAAQMLSYAPGVQITGYGNTGASKYTVTLNGV
FT                   QQGWGGFGGFTGDGAIGVTLDGVPVVDPGSDLWQSNMIPQSGMIQSVTTTYGPGNAADR
FT                   WYNNLAGTIEFTPVQPTAKPGGDINLTYGSYGQKNIEFDLRTGNYHGWSTVIAGGAGDG
FT                   NSFRKSPDGFQSPSNDYSIYLKTVKNFSAGNFAFGGYFARSAGYRVPVIPTSPIPGVTI
FT                   SGNAGAPLYSQQTSGFYSAPPYNYYEKFDTDALWMVFARENIELDDSTTLHNLTYYENF
FT                   TRTHSRLYDFGSVGPQRYEYNNPYTNVIGDKLWLTEKLPFNTLNFGGYYIHTLYNSRNN
FT                   FYNTVLGGNKGVVNAGGKIRSSYFNVDNFAMFLQDDIHPVRALHIIPGIRFVSFQTSYS
FT                   DSALQDFAFAPGVGLSTHCVLDGSTATSGTTQATDQGSSCGSHVSRNGVEPSISANLQV
FT                   MPWMALYGSYGEALRTPSVGGGGGLFQKINPTTGYQLELGQYYDIGAKFHVENGRFLHH
FT                   FAAGVDYFHLRYAKQSLSTQLANGNALFASGSSIYQGVNMFADDNPLYNLYVFGNASFI
FT                   DAKYQTYITGGTSYGGRHVPYVPSVNFNIGAYYDIPIGSMLLEPRMWYQYTGSQYMFNN
FT                   NTGAPSNRKMPGYGTLNMSAKLTVPVTLPYVGHKSMDVSLTALNITNNQYNAYEYIGTG
FT                   GYFNYSGTVPASGFTYAYPGAPFTIYGSVGFHF"
FT   CDS             374687..375412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03270"
FT                   /product="TonB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03270"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79674"
FT                   /db_xref="GOA:F0J2N5"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2N5"
FT                   /protein_id="BAJ79674.1"
FT                   /translation="MNPLPEGRLSFPIALVAALIVEVVLVVLVASMPPNPVPAARHPQV
FT                   TRIRMLAPPPKPKPVPPKPLPPPPKPVQPPKPHVPPPPPIPKPPLPVPVPKPLPKPVPK
FT                   PRPKPVVHHRPAPRPKPVAHQVPRPVAPTPPKPQPVPAAVQENALEAYAGSVHAAVQGD
FT                   LKVPEMVKMLHLSGVTELALRIAPSGQLLGVSVIRSSGAPPIDRAALAAVRATRFPPFG
FT                   ATMPHHPITVDISIRLRTN"
FT   CDS             375579..376601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03280"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79675"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2N6"
FT                   /protein_id="BAJ79675.1"
FT                   /translation="MRRVIAAGFGVAIIIIAAVLLWPAPARGLVLYAALDYAPAIGKAF
FT                   TKKTGIPVRVIRLSTGALLARITAEGHHPDWDIGWFDGATAAVSLDTAGLLAHGLRPPV
FT                   PLTATGRSMLPPDGAYIPTGFTLAGVFVMNKASTLKPPKTWNDLTAPLYHGVVGMNDPA
FT                   ISGPTYPALAGMLKQAGGWPQGKGFVAALKANGLQVFAKNDATLAALRNGTIKLAIVQS
FT                   SAAVNVARNIDHHLTVIYPRPAYVLPNVIVLPKGLHGRALREAKAFIAFVESPAGQAIR
FT                   KREGEGDSYYWPVTALPAPRHALPPLTTLDLATLDAARWGAREKTVLAWFAHAIDGAGS
FT                   "
FT   CDS             376609..378183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03290"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03290"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79676"
FT                   /db_xref="GOA:F0J2N7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2N7"
FT                   /protein_id="BAJ79676.1"
FT                   /translation="MRNRLPMRVGAAGLRAAIMAGLIATFFVYPLLRLLVMPFLSGHGA
FT                   AGDWPAFAVSLLLSVGTAIVAAPLGALFALFTTTAAGPVARAATLTLWGLFLTPSYMLT
FT                   TGWMIIFSGHALRATLAGQAFFGVGGLLMLYVVKALPFSALVARATLAAADSAPAEAAA
FT                   IHGVPFIPRVRIGLRLLAPAMAVGFAIAVIETMQEFGIPATLGVTSHVPILTYAIYQHL
FT                   AETPTDFAGASILCWRLIAVAAVFGGLAMACRRQGAAIQHGRMRPPARQRPARRRELAF
FT                   AALTCLFALVGIVIPVAALFVRALQPLTASMPHPGAVLRSLGFGMVGATMSLGVAVLIL
FT                   RLRAAGARRMTAVLDVALVANMAVPGLVLAASYIVAFNNDLLPLYGTRLLLLIGYTAGM
FT                   APLALRMMQGALDDLDPNLVAAARLHGLPRLTRLVDIEGMLLIRPFTYAYLLVAAAIMF
FT                   ELPVSELLYPPGATPLGVAIVTLDQMSDYAASARLALFGLGAMAGLALLLAAGVALLAA
FT                   PRRLRPA"
FT   CDS             378180..379229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03300"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03300"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79677"
FT                   /db_xref="GOA:F0J2N8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2N8"
FT                   /protein_id="BAJ79677.1"
FT                   /translation="MSAALAIDGVAVQRGGRLVVEEASLGLAPGECVVLAGESGSGKTS
FT                   LLRVIGGLDRPARGTIRIGGAVVDDAAATFVRPESRGLGMVFQDFALWPHLSVLENVAV
FT                   VIRDRAGRDRKALALLDRFGVASCAGRLPATLSGGQQQRVGLARALAAAPRLLMLDEPF
FT                   SSLDVETRETLRTELRALIVESGLSALCISHDPADIARLADRVAVLEDRRLTACTTPDA
FT                   MFARPATPYAARLAGLCGGVRVPARGEGSDAAIALGGAQLAIPGGAARLAGAAQALLFW
FT                   PRGALSLAAEGVPATCIGAHFEAGHWQALLRLDGLAAPVPVQCAAPPPRGAVALRVAAD
FT                   RLHLFPFSG"
FT   CDS             complement(379230..380453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03310"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03310"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79678"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2N9"
FT                   /protein_id="BAJ79678.1"
FT                   /translation="MRPFVRRIVIWGVLAAAVGAGIVYSFRPRPVAVDVATVARGMLRV
FT                   TIDDDGETRVRHVYTLQAPLTGDLDRITADPGDPVTAGRTVLARIVPAPPSMLDTRTMA
FT                   EREAAVGAALAAKAQAAAERDRAETTLVFARTERDRARRLLPRRAISQREADDAERAFR
FT                   AAEAGLAAARAALELRDQELAAARARLLPRDAARRAAPAGEVVRVTAPVSGVVLRVIRR
FT                   SAGIVAAGAALLDIGDPHQLEIVIDPLSEDAVRMRQGEAAIVTGWGGPDLHAVIRRIDP
FT                   VGRMKVSALGIEEQRVDVVLDLTDPPARWQALGDGYRVDVHVITFQGDVLRVPLGALVR
FT                   MGDGWAVYVDDRGVARRRAVTVGARGGLEAEIRAGLAPGQRVVLYPGERIRDGTRIAIR
FT                   PAGAEDGS"
FT   CDS             complement(380460..382835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03320"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79679"
FT                   /db_xref="GOA:F0J2P0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2P0"
FT                   /protein_id="BAJ79679.1"
FT                   /translation="MVAPVSSLDRKLLRDLWRLRLQALAIALVIASGVALMVMALTTTE
FT                   SLEATTSAYYERARFADVFARLKRAPDSLEARIAAIPGVRVVETRIVESGLLDVAGYRE
FT                   PVVATLVSLPKSGPQRLNALVLRAGRLPAPGRLREAVVGEPFAEAHHLRPGDTIGAVLR
FT                   GRRVALRIVGTALSPEFVYAIPPGGLMPDDRRFGVIWMGRDELAAAFGLKGAFDDVSLA
FT                   LSPGQRPQPVIARLDALLARYGGTGAYDRAEQVSNWFLSNEIAQQKNMSRLMPAIFLGV
FT                   AAFLTNMVMARLVATERREIGLLKAFGYGGGAIFWHYAKLVLAIAAGGIVLGAVLGAAL
FT                   GNWNTRLYREFFRFPFLLYQPGPRSFAIAAAVSLVTSLAGGMGAVGRAARLPPAIAMQP
FT                   APPAVYRRSRLGPAALGRFLDGPSRMIVRRLLRWPLRAFLASAGLALSVGVLILALQWV
FT                   DAVNALVETHYERGQRQDATITFNDLRPRGVLDDIRHLPGVLAAEPFRIVPARLARGRA
FT                   EQREPVIGVPAGARLAPVHDVARGPIDMPADGLVLSRQLAGLLHAGIGDPVRVQLLEGR
FT                   RAVLMVPVVRLFDTYIGKPAYMNLAALNRRMGDGSVLSGVHVTLDEPRRAAFLARLRTL
FT                   PGIAAIQFRRAAIDTFHRTMGETIDIFLGFFIGFASALSVGVIVNAIRIALSERERELA
FT                   TLRVLGFSRAEVAYILLGEIGLLVWIAIPLGCGAGTLLAWYFGKAFETELFRVPPVIYP
FT                   STYGTAALIMIATAAIVAAWLRRHLDRLDMIAVLKTRE"
FT   CDS             complement(382829..383581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03330"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03330"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79680"
FT                   /db_xref="GOA:F0J2P1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2P1"
FT                   /protein_id="BAJ79680.1"
FT                   /translation="MEPVAGGVALPDEERAAPVALVARGLAKIYRMGAVEVPALRDVDL
FT                   TLREGELVVLLGPSGSGKSTLLNILGGLDTPSAGEVLFRGQPIAQGGERGLTRYRRRHV
FT                   GFVFQFYNLIASLTARENVALVTEIAEAPMAPEAALELVGLGDRLDHFPAQLSGGEQQR
FT                   VAIARAIAKSPDLLFCDEPTGALDSRTGILVLEAILKVNGELGTTTALITHNAVIADIA
FT                   DRVLSFADGRIVGTRVNPVRHSPAGLVW"
FT   CDS             complement(383685..384017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03340"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79681"
FT                   /db_xref="InterPro:IPR003793"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2P2"
FT                   /protein_id="BAJ79681.1"
FT                   /translation="MSDMEEQVTLVRIALSETDHGRRRHLMEDILTRLRDDFDLDGVSV
FT                   FRGIAGMNGQKIIHAADLLHFDVDLPLMIEFCCAPDTAISVIDSLADLVPDGHIISWPA
FT                   TRHRRA"
FT   CDS             complement(384010..384537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="ACMV_03350"
FT                   /product="CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03350"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79682"
FT                   /db_xref="GOA:F0J2P3"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2P3"
FT                   /protein_id="BAJ79682.1"
FT                   /translation="MTPVSIRQPRRDRRARFRHFRSGHGRQASALPRRHPLDIPDISAT
FT                   TRRRFMIKTLAAIAFFGSLGCWARYGQTIFMQNLFGRGFPVAVLSINVLGSFLIGFLFV
FT                   LTAERVAIDPAIRTGVLTGFLGGYTTFSTFELETLMLVENGEIVKSALYVLLSVVLGFI
FT                   GAVLGVYIARNV"
FT   CDS             complement(384642..385886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03360"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03360"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79683"
FT                   /db_xref="GOA:F0J2P4"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2P4"
FT                   /protein_id="BAJ79683.1"
FT                   /translation="MHGDLFGSWQPAATVAIFALTYAGVALGRLPFFRLDRAGIAFVGA
FT                   VLMVASGALTLRQAVAAIDFDTIALLLGMMILAAALRRAGFFERITGAVLSRASGTDAL
FT                   LALTVAMAGLLSAVLVNDTVCVVLTPLVLEASRAGRKQPLPYLVALATASNVGSVATIT
FT                   GNPQNMIIGSLSGIGYAAFAGALVPVALLGLPIVFLVIRLLHRAGFEALTPPPPSAARR
FT                   RPHGGLIGKSVVLLVLFVIACLGGMRPAEAALVAAALIMLTPGVKSQRLLAGVDWSLLL
FT                   MFAGLFVVVAALQREVIGAAVIGRVAALHPGRPAVLVPLTAILSNLVSNVPAVLVLRPF
FT                   IAHLADPRQAWLIVAMASTLAGNLTLPGSVANLIVAERARAAGVRIGFGDYLKFGLPIT
FT                   VLTIALGTAWLVGLG"
FT   CDS             complement(386047..388176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="macB"
FT                   /locus_tag="ACMV_03370"
FT                   /product="macrolide export ATP-binding/permease protein
FT                   MacB"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03370"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79684"
FT                   /db_xref="GOA:F0J2P5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2P5"
FT                   /protein_id="BAJ79684.1"
FT                   /translation="MPGAVPGAVIELRGVSRTYRSGDVEVQALREVDLVIGPGEFVAIM
FT                   GSSGSGKSTLMAILGCLDRPSRGEYRFESVDVARLEEPELARVRSARIGFVFQSFNLLA
FT                   RTSALDNVALPLFYASDGPVKGGSRTARALRALGQMGLAGREGNTPSQLSGGQQQRVAI
FT                   ARALINAPRLLLADEPTGNLDTRTSHEIMETLAALNRERGTTILVVTHEPDIAAYADRV
FT                   LTMRDGRIVGDERREKARGEAAPPAAVAEAAPDAAPNETPDAAPARRRAGIAWAFGAMI
FT                   VGAAVQALARNRLRSALTMLGVFIGVAALITMVAVGQGANQAIRKQIESLGTNLLVVLP
FT                   GATTAGGARAGFGSASTITVDDARAILREDPAVSRIGYLIRAAGQVRYASQNWTTAIAG
FT                   VSIDYPAMTNWRVAEGRPIGAQDERNGALVGLIGQTVRQQLFAPGEDPVGATILVKGTP
FT                   IRVIGVLAGKGQTAFGTDQDDIVMLPFSTAEQRVLGTATPSRQDAPLNWAYPAWPNPYG
FT                   LQLRLTGYVNQLFAQAVSPDAVAEAMEQISGTLSVRHRIQPNGLKDFSVRNLSQIAAAA
FT                   QGSSRIMSLLLAIVASISLLVGGIGIMNILLVSVTERTREIGLRMAIGARRLHVLLQFL
FT                   AESVFLSVTGGLGGIVLGVALSGGITLFAGWPAPVSLLAVAGGFLFSVAVGVAFGFYPA
FT                   RKAARLDPIEALRYE"
FT   CDS             complement(388190..389428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="macA"
FT                   /locus_tag="ACMV_03380"
FT                   /product="macrolide export protein MacA"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03380"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79685"
FT                   /db_xref="GOA:F0J2P6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2P6"
FT                   /protein_id="BAJ79685.1"
FT                   /translation="MTASPNPPANTQRPPPSAPPEPAAAPRRRRRRVAVLAALAVGVAA
FT                   AIAIGWRTVGAPPPVHYVTAKVGRGDITRAVTATGTVNPILTVIVGSAVSGIIQDISCD
FT                   YNTIVKLGQICARIDPRPYQAVVDQDRAAVAVDQAQLRKDEASLDYARGNYRRLASLVP
FT                   QRYASENAADSAKATYRQLEAQAALDRAVIRQDEAKLAAAQANLGYTDIVSPVNGIVVS
FT                   RNVTIGQTVAASFQTPTLFLIATDLTRMQVDTNVSEGDIADIRKGEAARFTVLAFPGET
FT                   FDGTVTQVRQSPQTVQNVVTYDVVIEVDNRDLKLKPGMTASVRIITAARAGVLRVPDQA
FT                   LRFTPRLAKAAPAGGGARVWVLRQGKPAAVPVVTGLDDDTNTEIVSGGLRDGDEVITGE
FT                   RRARAATPFVPRF"
FT   CDS             complement(389545..392601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03390"
FT                   /product="efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03390"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79686"
FT                   /db_xref="GOA:F0J2P7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2P7"
FT                   /protein_id="BAJ79686.1"
FT                   /translation="MMGGFAAFLGRQQKAILFLMASLALAGAVGALSLPVGLFPRTSFP
FT                   RVRINIDSGARPAHEMMLQVTQPVEQALRAIPGVRGVRSTTSRGSMQAFIDFDWGTNMR
FT                   AATLEVDAALAQQLPDLPKGTRYVVRRMDPTVFPIIAYALISHSISEAELRTIARYRIV
FT                   PVLERIPGVAKIGVQGGDTPEVHVIVDPAKLAAMHVTLASVEQAVSRSNVLASVGRLAD
FT                   HDSLYLVVQQNTLRTMAQVRRIVVGGGPDGVVRLGQVARVEMGRVPRYDLVSENDHRAV
FT                   TLQVFQQPSGNAVQVDAAVRRALAAYETRLPAGVRLVKWYDQSTLVTAAAGSVRDAIAI
FT                   GVVLAGLVLIGFLRSWRVTLIALLVLPASMATAVLILTLLGMSFNIMTLGGLAAAVGLV
FT                   IDDAIVMIEHVARRAGRAGGIAARGAVLAAAEEFLAPLAGSSLATLIVFVPLAFLSGVT
FT                   GAFFKALSITMASTLIASWLFSAFAVPVLARWLIDFDKWHDPVAGGGARESVLARAHGR
FT                   LLDLVVARPAWLLVALIPFVLAGAYAYAVVPTGFMPRMDEGGFVINYQARPGTSLAEGA
FT                   REIRQVGDILRADPAVATWSTRLGAGLGGDLNEPYQGDIFVQLRPLGQRAPIWTVMDRI
FT                   RRRIIDRVPGIDFDESQLMSDLLGDLVSQPEPIEIELHGDPARLDETAKRVAAAIGRIP
FT                   GVVGVQDGVVIAGDSIDIHVDPAKAAMFGFDPAAVERMVATALRGSVVTALPGQERFTG
FT                   VRLELPRDAFAQTGDLLRLPLAAPSGALVPLGAIATLRTVSGRPEIDRDNLRQIVAVTG
FT                   RISGGGISAAIASVRRVLARPGLLPPGMSYRLGGLYRQQQKAFIGLARVFVAAVLAEFV
FT                   LLLFLYRSFVIAGAIVATALLSSLAVFIGLDLSGVALNITALMGMTMIVGLATEMAIFY
FT                   ISEFRSLAGYQDRREALVVASRNRLRPIAMTTLAAILTLLPLALGIGQGSGMQQPLAIA
FT                   VISGFVVAFPLVLFGLPALLRLVLRGPEP"
FT   CDS             complement(392598..393647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03400"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03400"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79687"
FT                   /db_xref="GOA:F0J2P8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2P8"
FT                   /protein_id="BAJ79687.1"
FT                   /translation="MTRFFGSGARRLGLLLVAGAGFAGHAALAGEPSVLVTTAPVTQGA
FT                   LERSVTAYGRIAPGAGAARTLATAYAATVTAVEARPGMSVRRGQVIARIETAPATRAAY
FT                   AQAVATRDETLRVLAHTRALLARHLATRTQLAQAEQAARAALAALDALKREGADRAMAA
FT                   VEAPFAGIVTAISAAPGAALPAGTAIATVVRRAGLVAVVGVDPGDARRLAAGQAALVQV
FT                   LGGAALRGRIDMVAGEVDPRTGLVDATVGLGGAPALVGAMVRARIDTGTVRGVIVPRDA
FT                   ALPAEGRDVIWQVRDGHAVRVVVRVLASARGRSIVAGRIDPALPVVVSGNYQLRPGIAV
FT                   RIARPGQGG"
FT   CDS             complement(393652..395013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03410"
FT                   /product="putative outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03410"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79688"
FT                   /db_xref="GOA:F0J2P9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2P9"
FT                   /protein_id="BAJ79688.1"
FT                   /translation="MIRSPLVRLRRLAGLGALLGLSACARFHPAPLALRPSPAASLAAL
FT                   DRALPGGGTIAARGALTPGAYAALAVLNDPALAAGREEVRLASARQFAAGLLPDPQVSG
FT                   GFAALLGGPGIAPSISGGIAQDIAALATRGPRLSAARARTAAAAARLEWQEWQVAAKAE
FT                   TLAIGLWGEQRRLAALARARDALAGLDRASRAAIKQGDLALGAGAAAAASLAGIETARD
FT                   AIARREQADHAALAALLGLAPGAALPVSEPDSAPLPARLVAALVGSLARRRPDLIALRY
FT                   GYRAADADLRAAIRAQFPLVSLAVNGGTDTTRVASLGPTITLDLPLFDGHRGAIAVARA
FT                   SRRQLAAAFRAALDQAAGQAEAAQQALTLLRAEYRRAVRRAAIARRDAAAARRAYAAGL
FT                   IDARAEADLIDAAANRRAEAIDLRARIAAGRVSLRTLLGAGLPVIRSLSASGKD"
FT   CDS             395111..395845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03420"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03420"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79689"
FT                   /db_xref="GOA:F0J2Q0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Q0"
FT                   /protein_id="BAJ79689.1"
FT                   /translation="MILRFVHDRTDAMTQPCLAILLVEDDELTANLVRAALGAEGHLVA
FT                   VAADGRDGLLRAAAGHEGRAWDLLIVDRMLPGLDGLALVRTLRGAGLTMPALFLTALGG
FT                   IDDRVEGLRAGGDDYLVKPFAAAELAARVAALARRGEMRPSGPVLRVEDLELDRLTRAV
FT                   TRAGRRIDLKPREYEVLEYLMRHAGRVVTRTMLLEDVWNFHFDPRTSVVESHVSRLRAK
FT                   LGAGRELLHTVRGAGYRIGDPA"
FT   CDS             395842..397251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03430"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03430"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79690"
FT                   /db_xref="GOA:F0J2Q1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Q1"
FT                   /protein_id="BAJ79690.1"
FT                   /translation="MTRRWPASGQPAILRTSGVRLAALGAAVAAMGAVIVFVVIYYGTL
FT                   GSLRQTLDASVTNEIGEILPQGPATPPAVAAIAIRAALAQRPSRIFYALAGPNGAPLAG
FT                   NLRFPPPAPGWHTLDAPEADAFAPGVTELRVLVVRLRGGASLLVGVDGTMIRRLNDLIR
FT                   RSFLIGFGLTLSLGLAAGIGFGRKALARVNAVSLASREIMAGDLSRRIPLAGTGDEFDR
FT                   LAETVNAMLDRMQHLMENLGAVGNDIAHDLRSPLARLRETLELALRDPDPAAAGAAIAE
FT                   AIAQVDGALALCGAILRLAQIETGARRASFSDIDLTDLLDRLVETYETVAEEAGHRLAA
FT                   HVPRGLAIRGDAQLLNQMFANLIENAITHAGSAARIGLVARADPAGVTVRLTDDGPGIA
FT                   PDRRGAALRRFGRLDPARHRPGYGLGLPLSAAIADLHDARFTLDVAAPGADRPGLAVTL
FT                   VFPAGGVPRPG"
FT   CDS             complement(397276..398175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03440"
FT                   /product="Xre family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03440"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79691"
FT                   /db_xref="GOA:F0J2Q2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Q2"
FT                   /protein_id="BAJ79691.1"
FT                   /translation="MPAPEISGMIGAMKDDNRFGAYLKSRRARLDPASLGLAAGRRRTA
FT                   GLRREEVAQRAHISATWYTWLEQGRGGNPSAEVLDRIARALLLTEIEREHLFLLGRGHP
FT                   PEARYRGGDAITPRLQRLLDALPFSPAIVRTATWDVVAWNRAAAAVFTNYAALPAGQRN
FT                   ILRMIFTDPRVRAAQFDWAAMARAVVGAFRVDAARAGADAEVAPLVDELCRASPEFAAM
FT                   WNENEVMPQGDGAKRLRHPVIGPIALEYSSFAVDGRPDLSMIVYNPATPDDAGRVRALL
FT                   ASRADPAGPDAVLDAVDK"
FT   CDS             complement(398175..398636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03450"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03450"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79692"
FT                   /db_xref="GOA:F0J2Q3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Q3"
FT                   /protein_id="BAJ79692.1"
FT                   /translation="MADARLTDEDYEMLASFRFALRKFIAFSEAAARRDGLTPRQHQAL
FT                   LGIRAMQGQGAASVSDLAAFLILQHNSTVELVDRLVAAGFVARATDPEDGRRVRLALTG
FT                   SGEARLAALSQTHLDELEQIGPELRRLLARIQRYRRRVRGSARCGDAGG"
FT   CDS             398722..400551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03460"
FT                   /product="putative chloride channel"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03460"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79693"
FT                   /db_xref="GOA:F0J2Q4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Q4"
FT                   /protein_id="BAJ79693.1"
FT                   /translation="MSPSPSLPPPVRLGDFTTDRGIFRLIGFGACAGLFGVIAGWILLR
FT                   MIGLINDLAYYGVWSTRMLAPGGAAPGGHPALWTILVPAGGAVLIGLMARYGSEKIRGH
FT                   GIPEAIEAILLGGARLDLRVAILKPISSAISIGTGGPFGAEGPIIMTGGAAASLMAQCF
FT                   TLTDAERKTLLVAGACAGMTAVFGTPVAALLLAVELLLFELKPRSIIPVGVACITAAIL
FT                   RRFCMTPAPLFPYAGGVIVDPLHAFGWLGLGLAAGLGSALLTVLVYAAEDGFETLPIHW
FT                   MWWPVLGGLVVGIGGVFDPAALGVGYPDIARLLAGTLAGGAAIRLVLVKGVIWSVALGS
FT                   GTSGGVLAPLLIIGGALGAVLAPVMPHAAPGFWAVLGMAAMMGGTMRAPLTSTLFAVEL
FT                   TGNHRILLPVLAASMASMAVTVLLMKRSILTEKIARRGHHLTREYSIDPLAVTRIRDIM
FT                   ATKVDTLAADLPVGAAIERFLSHAAAHRAFPVTAPDGLVLGLVSRADILDWIGDEVRRD
FT                   LPLRAMIAGREVTTAAPDEMADTIAVRMLTRNAPRIPVVDAEGRLLGIVSRADLLRVHQ
FT                   RVMLAETRRERFFPFRRRAAAKEAQKPEPLAVP"
FT   CDS             400642..401850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dpaL"
FT                   /locus_tag="ACMV_03470"
FT                   /product="diaminopropionate ammonia-lyase"
FT                   /EC_number="4.3.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03470"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79694"
FT                   /db_xref="GOA:F0J2Q5"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR010081"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Q5"
FT                   /protein_id="BAJ79694.1"
FT                   /translation="MLILNPDPAHGAPLDAADAALLGADAADELARYLAHRPDHRPTPL
FT                   IALPCLAARLGVAALHLKDESTRFGLGSFKALGGAYAVVRLVLEEAARRLGRPVGYADM
FT                   GAPEVRNIAATMTFACATDGNHGRSVAQGAAMLGSRCAILVHAGVSPARVAAIAGLGAE
FT                   IIRVDGTYDDSVEEAARLSAARGWTVVSDTSWPGYERIPGLVMQGYVAMVDEALAAMPA
FT                   PPTHVFVQAGVGGLAAAVAGHLAERLGARRPTLVVVEPDRAACVLETARAGRPVRIAAG
FT                   APTVMAMLECYETSLVAWRILARAADAFMTVSEEDAVAAMNRLARPEAGDMAVVAGESG
FT                   GAGLAGLLRVAGDAGARQALGCGAEARILVFNTEGATDTARYRDLVGLDPALVAGAGSA
FT                   PDQ"
FT   CDS             complement(401844..402839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03480"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79695"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Q6"
FT                   /protein_id="BAJ79695.1"
FT                   /translation="MKLRMSFASAAAIAAALFCGTAAAAPQHKLGAGLTMYFQMGGSPG
FT                   DASTLPRELGAKAAAKALGVRLISQYSDWQPEKMIEQFRQAIAAGPQCAEIMGHPGNAA
FT                   FAPLVSKAEAQGMVVTAGNVPLPKLEAKYRTNGFGYVGTYLVQGGETTAAAMVKAGHLK
FT                   PGDEALEYGVFAEGIRGESDEGLVMGLKKAGLKVYKLNISNAVNADPALSVPILVAFIE
FT                   RHPKLKAIGTQQGLVTSFIPKALQEAGKKPGQIVVGGIDLAPTTIAGVKSGYIAATLNQ
FT                   QLYMQGFLPVVQCVLTKRFDLEGMNVNTAAGTDDKALLDKIEPLIKKGYY"
FT   CDS             complement(402889..403923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03490"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03490"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79696"
FT                   /db_xref="GOA:F0J2Q7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR035568"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Q7"
FT                   /protein_id="BAJ79696.1"
FT                   /translation="MSGSDVSTGRPAAPKSSPRWHAHLGAVPIIVVFFALIGIYIGFAP
FT                   EVFLRWPIYNSFLVTIPPMLVLSLGLTLVIAAGEIDLSFPAVIALSGFLFAFCADKLHM
FT                   PWLGLVAAIGGGALVGVINGWLVAALGIPSIIITIGTSFFWSGVATVLSGGLSYALNDL
FT                   TGTVIARVFSGTLLGVPVEALWAVAVAALIWAILNRHRFGEHLLFIGDSREVARVVGIN
FT                   TVRERIKLFTLMGALAGFASFLMTVANLSYFSTQGQGLLLSALAAVFIGGSSVFGGSAT
FT                   VVGSFFGAMIIGMLDAGIVATGVSGFWVEVIVGLVFVAAVVLHTGLGDPARVKALQRRL
FT                   MQRE"
FT   CDS             complement(403920..404768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03500"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03500"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79697"
FT                   /db_xref="GOA:F0J2Q8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Q8"
FT                   /protein_id="BAJ79697.1"
FT                   /translation="MGATGNAIAASGGGTPNEDRRAAGGWSDIVRAEKLCVSFGKVRAL
FT                   DNIDLAIGRNEIVGLIGDNGAGKSTLIKALTGVVRPSSGRLYIRDEAVDLYNYSVRRAH
FT                   SLKFETVYQEKSLGEKQPLWRNFFVGRQIVNRFGFINVREQRRIANEILQRQLGFRGVG
FT                   IDADSTVAKLSGGERQGIAIGRAMHFDSDLIILDEPTTALAISEVQKVLDFVRSIKRSG
FT                   RAAIYIEHNLAHVHALADRLVVLDRGRIVANIRPAEMTLEDLTRFLIDLQHGTPATGGH
FT                   A"
FT   CDS             404949..405389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03510"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79698"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Q9"
FT                   /protein_id="BAJ79698.1"
FT                   /translation="MNEMPPGITRADEGIGGVVWNVLGQTYTLKQESEHSMAWHAVFPP
FT                   GTFVPPHIHPTQDEFIYMLEGKFDLWLDGQDLSAGPGDLVRMPMNRPHGIFNRSDADVK
FT                   CVFWVAPSRSLRALFERIHNLADPAEVVRIAAEHEVHFLPPG"
FT   CDS             405397..406641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03520"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79699"
FT                   /db_xref="GOA:F0J2R0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2R0"
FT                   /protein_id="BAJ79699.1"
FT                   /translation="MRVLIAGGGIGGLTLALMLHRRGIECQVLEAAPAIRPLGVGINIL
FT                   PHAVRELAALGLLPALDEIGLRTRALSYLNHRGEVIWTETRGLHAGHDVPQFSIHRGKL
FT                   QDMLWRAARERLGEGALRPDARVAAAAEADGAVAVTLTNAAGARETIAGDALIGADGIH
FT                   STLRPLLLGADPPMRWNGIQMWRGALDWPAFGTGDEMIIAGNATAKLVFYPIGQPAADG
FT                   TRLTNWVVYARTGAEGTPPPARESWSRRGAWEEFAPLVAGFALPFVDVGRLARATSEIF
FT                   LYPMCDRDPLERWTRGRITLLGDAAHAMYPVGSNGASQAILDARCLADTLAESADIPAA
FT                   LAAYEAERRPATAAVVRSNRVGGPERVIDLVAARAPDGFARIGDVARPDELEAIVRGYA
FT                   TLAGFAAPQPAGSAP"
FT   CDS             406638..407453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03530"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79700"
FT                   /db_xref="GOA:F0J2R1"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2R1"
FT                   /protein_id="BAJ79700.1"
FT                   /translation="MTEPSDPVFQYLAGQMRPGHPALIEAFLREGEAAIAARAPRLDIP
FT                   YGPHERERFDLFAAPGAAATLLYLHAGYWQGRDKAQFRFLAPPFVDAGFNVALANYPLC
FT                   PDASLAALTDSVRRAVPAVLRAAGTGGLVAIGHSAGAHLAAELALTDWDGPSPITAVVG
FT                   LSGVYDLDPLRATPLNDRLGLDAAAARAASPVHRVKPRMPPAIFAVGGDETPAFRAQTG
FT                   AMHAAWRAAGNIAREIIVPGADHFSLLRHLADPASPLFAAIAPLAAPRR"
FT   CDS             407541..408308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqqC"
FT                   /locus_tag="ACMV_03540"
FT                   /product="coenzyme PQQ synthesis protein C"
FT                   /EC_number="1.3.3.11"
FT                   /note="protein synonym:pyrroloquinoline-quinone synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03540"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79701"
FT                   /db_xref="GOA:F0J2R2"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR011845"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2R2"
FT                   /protein_id="BAJ79701.1"
FT                   /translation="MMRADLLAEAPPADDGRAPWSHAEFEAKLREAGSAYHIHHPFNVM
FT                   LNTGKATPEQIRMWVANRFYYQIAIPVKDAAILSNCPDREIRRGWIRRLLDHDGFDYEL
FT                   PDGSRLRDEGGIEAWLRLGIATGLAREEMLDLRHLLPGVRFAVDAYVNFARRAPWQEAV
FT                   CSSLTELFAPDIHRQRLATWPGHYPWIESEGLDYFRNRTSQAPRDVVHGLRITLAHFAT
FT                   RPMQERALQILKFKLDILWTMNDEMGRHYGVAA"
FT   CDS             408375..409004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudK"
FT                   /locus_tag="ACMV_03550"
FT                   /product="GDP-mannose pyrophosphatase NudK"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03550"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79702"
FT                   /db_xref="GOA:F0J2R3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2R3"
FT                   /protein_id="BAJ79702.1"
FT                   /translation="MPSDRPHNLADRVRLRAEALLAAGWGRLTKVTFDWRRSDGRWQTL
FT                   TREVYDVGNGAAILLYDPARRTVVLVRQFRYPAFAESGDGLVLEAIAGKLDAAHPEARI
FT                   IAETEEETGYRITGIRPVFSAYMSPGALTEKLFFFVARYTPADRVAPGGGCPEEGEDIE
FT                   TVELDIDDALRRIDTGEIHDAKAIMLLHYAALHLFPPAAPCQEPSP"
FT   CDS             409001..409840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03560"
FT                   /product="phenazine biosynthesis PhzC/PhzF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03560"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79703"
FT                   /db_xref="GOA:F0J2R4"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2R4"
FT                   /protein_id="BAJ79703.1"
FT                   /translation="MTRPFRLVDVFGTAPFTGNPLAVIADADGLSTAEMQAITRWLNLS
FT                   ETTFLLPPADPAADYRVRIFSLSRELPFAGHPTLGTAHAWAEAGGIPKRNGVIVQECGA
FT                   GLVTIRRDADRLAFAAPPLLRGGPPDEADIAEVVAVLRIDRAAIVDAAWVDNGPGWICA
FT                   MLASAADVLAIEPARHHGRPIDIGVVGPHEPGGAAAFEIRALFTNPEGVLVEDPVTGSL
FT                   NASVGQWLFASGRASGAYVAAQGTRLGRAGRVHVEQDAAGQVWVGGAVRTLFAGHAL"
FT   CDS             410062..410289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypC"
FT                   /locus_tag="ACMV_03570"
FT                   /product="hydrogenase expression/formation protein HypC"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03570"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79704"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2R5"
FT                   /protein_id="BAJ79704.1"
FT                   /translation="MCLGIPMQVVAIDGFNAVCEAQGVRRAVSLFMLGAGEVAPGDHVM
FT                   VHVGYALRKMTEGEARSAWELLAVLGEAAP"
FT   CDS             410303..411397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypD"
FT                   /locus_tag="ACMV_03580"
FT                   /product="hydrogenase expression/formation protein HypD"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03580"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79705"
FT                   /db_xref="GOA:F0J2R6"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2R6"
FT                   /protein_id="BAJ79705.1"
FT                   /translation="MSGEAEARLWLDRIRALPPGPPVAIMNVCGGHERSLSMLGLRALL
FT                   PEGVRIIPGPGCPVCVCPEEDLADAIALAMAGGVTLVAFGDMLRVPINAPKGEVASLAA
FT                   ARAAGADVRPIAAPQDAVAIARAAPSRPVVFFVAGFETTTAPVAAMLAEGVPDNLSVLL
FT                   AARLTWPAVAMLLAEEDNALDALVAPGHVATVMGAEEWRFVAERHALPVAVAGFSAESL
FT                   LAAIYSVLRQKREGRAFLDNCYPELVRPEGNPTARRLLDEVMEVTDAAWRGIGVIPRSG
FT                   FALRGDWRAHDARARHVIAAPPRRRAGEMPPGCDCASVVLGRRQPDQCRLYGRACTPRH
FT                   PVGPCMVSDEGACHIWWQAGVRAH"
FT   CDS             411408..413672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypF"
FT                   /locus_tag="ACMV_03590"
FT                   /product="hydrogenase maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03590"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79706"
FT                   /db_xref="GOA:F0J2R7"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2R7"
FT                   /protein_id="BAJ79706.1"
FT                   /translation="MPALRIELGGRVQGVGFRPFVYRLARRHGVSGWVRNGLGTVEILA
FT                   AADPAILDRFTAALLAEAPPTARPGLLGVTPVAEAVEPGFSIRDSAATEGARPAFPPDL
FT                   APCPDCLRELADRSDRRAGYPFINCTQCGPRYSLIRRLPYDRANTAMAGFPLCPACRAE
FT                   YADPLNRRFHAEPVACPDCGPHCRFEAAGAPSAAGEAALAACLAALRRGLIVAVRGVGG
FT                   YHLLCDAADQAAVAALRHRKSRPDKPFAVLFPDDARTLDSCVAADAAARAALRGPARPI
FT                   LLLPRRPGAPLAPAIAPGFGTIGAMLADSPLHHLLAEGFGAPLVATSANRSGEPMLTDP
FT                   DAAAAALAGIADAFLHHDRPIERPVDDSVLRIIDGAPRILRAGRGLCPIERALPFRLAE
FT                   PVLALGGHMKSTIALGFADRVVISPHLGDLDDPAALAGLARMAADLQSLYGIAPRRLLV
FT                   DAHPGYASTRWARAEARARGLDIVPVWHHHAHASALAGEMAPGAAPLLVLTWDGVGLGP
FT                   DGTLWGGEALLGRPGAWRRAARFRPFRLQGGDAASRAPWRSAAALCWAAGIDPPAGLLP
FT                   EEGAALARAAWARELNCHRTGAAGRLFDAAAALLGLCRVASFEGQGPALLESLADTADD
FT                   ITGPAPGLPLADAADGVVEADWSAALPALLDASVPAARRAAAFHATMAATALAIAETVR
FT                   RRHGVAAIGLAGGVFQNRNLVERLAPALRAAGFATLFGEAIACNDAGLSFGQIIEYGGR
FT                   A"
FT   CDS             413669..414685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypE"
FT                   /locus_tag="ACMV_03600"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03600"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79707"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2R8"
FT                   /protein_id="BAJ79707.1"
FT                   /translation="MIEDTHVSLAHGNGGRLMRALIEEVFARHLADPALDTGADAVPVA
FT                   LPAGEIVVTTDGFTVQPLSFPGGDIGALAVHGTVNDLAVAGARPLYLTLAALIEEGLEI
FT                   ARLESIVASLAGAARAAGVRVVAGDTKVLPRGQGGGIYLALTGIGVRPPGCGLGLGRIE
FT                   TGDAVLVSGPVGDHGIAVMLAREEFGLSGDVVSDAASVLPLTAAIAVLPGLRFMRDPTR
FT                   GGLATVAHEIARGAGRAVELDEAAIPVRGTTRAVCDMLGYDPLYLASEGRVVAVAAPAA
FT                   AAAILAAWRALPEGEGAAIIGAIGAAAPADAPVLLRTRIGGARTLPELESDPLPRIC"
FT   CDS             complement(414692..415579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypB"
FT                   /locus_tag="ACMV_03610"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /note="protein synonym:hydrogenase nickel incorporation
FT                   protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03610"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79708"
FT                   /db_xref="GOA:F0J2R9"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2R9"
FT                   /protein_id="BAJ79708.1"
FT                   /translation="MMCGICGCGDTGEHHHEHEHEHGHGHGHGHGHDHGHAPEHAHAHA
FT                   AGLAPARMVRVEQDIMAANQRHADANRTYFAERGIFVVNLVSSPGSGKTSLLVRTVAAL
FT                   KAEMPVAVIEGDQQTEFDAERIRAAGAPAWQINTGKACHLDAHMVGHALEHLPALEGGI
FT                   LFIENVGNLVCPAGFDLGEAHKVVILSVTEGEDKPLKYPHMFHAADLMLVNKIDLLPHV
FT                   ACDMELILAGALRVNPAIGSVAVSAATGEGFGAWLDWLRQGRERARRAQHGAMQARREA
FT                   LRRELASIDATLAG"
FT   CDS             complement(415576..415917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypA"
FT                   /locus_tag="ACMV_03620"
FT                   /product="putative hydrogenase nickel incorporation protein
FT                   HypA"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03620"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79709"
FT                   /db_xref="GOA:F0J2S0"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2S0"
FT                   /protein_id="BAJ79709.1"
FT                   /translation="MHEMALCEGLVQALEAQAGAAAFSRVHAVELEIGALAAVECEAMR
FT                   FNFGIVTRGTLAEDARLDIVEVDGRAWCMQCGTTVTLRRFGDPCPHCDSLQLQVLDGKQ
FT                   IRIRQIEVT"
FT   CDS             complement(415910..416107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03630"
FT                   /product="putative rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03630"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79710"
FT                   /db_xref="GOA:F0J2S1"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2S1"
FT                   /protein_id="BAJ79710.1"
FT                   /translation="MSGTAELSRYECRICWHVYDPAAGDEVWQIAPGTAFADLPESWHC
FT                   PNCDAERHQFLPLDAEDGDA"
FT   CDS             complement(416104..416934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03640"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79711"
FT                   /db_xref="InterPro:IPR006894"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2S2"
FT                   /protein_id="BAJ79711.1"
FT                   /translation="MDPFALPARSGTAEAGPDYLALPTEMHVFRAPSLPDDPAARVRCR
FT                   TWLQRIGAALEAAASGAAVGQIVLDEASAADCASLDEILLDGEVSALVLGAPEWQIGET
FT                   AYTGLWRLRARDAATGRRLDRLEIGPIPAVVAARAAASWGLMELPAPEAIPPEMVNAPH
FT                   VLAELRARSAAFRPGGAAHVINLGLLPLAEAELTWLVRTLGEGPAIILSGGYGTCRIRS
FT                   TRLAGTWWVQYYNAADALILNTLEIAAVPAVACAAQDDIAESASRVRALEAAYP"
FT   CDS             complement(416937..417335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupG"
FT                   /locus_tag="ACMV_03650"
FT                   /product="hydrogenase expression/formation protein HupG"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03650"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79712"
FT                   /db_xref="InterPro:IPR010893"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2S3"
FT                   /protein_id="BAJ79712.1"
FT                   /translation="MAGSAALARLAAAEGVRELGGDGLEAALAEGTTLVLFTGDPTRHR
FT                   EIDDVAVIVPELAKAFAGRFRCAMVDPDRERAAAARFRVVVRPTLVLVHEGAMIGSVAR
FT                   MRSWAEYLEAIGGMLDRIGAPAAAAMEA"
FT   CDS             complement(417335..417910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03660"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03660"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79713"
FT                   /db_xref="GOA:F0J2S4"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004419"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2S4"
FT                   /protein_id="BAJ79713.1"
FT                   /translation="MSRGATVLGIGNVLWADEGFGVRAVEALNAGWTCGPEVRLVDGGT
FT                   QGLALLPVVGEAGLLVILDAVDFGLAPGTLMVAADDEVPRYLTAKKLSLHQTSFQDVLA
FT                   LAQISGRAPARMVLVGVQPCDLDTYGGGLSAPVAARIGEAVDIVRAHLAGAGFALAPRA
FT                   AGEEAEPLGPAAVAMTFGGPAAQIAEAS"
FT   CDS             complement(417907..418641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03670"
FT                   /product="putative Ni/Fe-hydrogenase b-type cytochrome
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03670"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79714"
FT                   /db_xref="GOA:F0J2S5"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2S5"
FT                   /protein_id="BAJ79714.1"
FT                   /translation="MTADTRTTPTDLAQGATARRVSAPVYVYELPVRIWHWVMALSIVI
FT                   LSITGFLIADPLWPLQVGQPSQHFLMGDIRTIHFITGDVFAVAMLVRIYWAIVGNRYAR
FT                   EIFAPAVWRRSWRREFARTIRWYLFLERETSKEIGHNPLAQLAMFAMFTLGVLFQIVTG
FT                   FALFGEGTGHGTWAFALFTSWVMPLFGNSQAVHTWHHLAMWYLILFAMVHVYMSVREDI
FT                   MSRQTMISTMINGWRFFKDDRE"
FT   CDS             complement(418675..420471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03680"
FT                   /product="Ni/Fe-hydrogenase large subunit"
FT                   /EC_number="1.12.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03680"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79715"
FT                   /db_xref="GOA:F0J2S6"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2S6"
FT                   /protein_id="BAJ79715.1"
FT                   /translation="MTSVSTPNGFTLDAGGKRMVVDPVTRIEGHMRCEVNLDENNVIRN
FT                   AVSSGTMWRGLEVILKGRDPRDAWAFCERICGVCTGVHALASVRTVEDALGIRIPANAN
FT                   TIRNLITASLWAQDHLVHFYHLHALDWVDVVSALKADPKATSALAQSISPWPNSSPGYF
FT                   RDVQTRLQKFVDSGQLGPFMNGYWGNPAYKLPPEANLMAVSHYLEALDFQREIVKIHTV
FT                   FGGKNPHPNWLVGGMACAINLDGPLAAGAPVNMVQLNLVSSIIDQTIAFIDQVYIPDLK
FT                   AIASFYKTWQYGRGLAGRNVMSYGEFPFEANAWTDRNLMIPRGAIVNGNLAEIHEVDAR
FT                   DPGQIQEFVDHSWYKYPNESVGLHPWSGITDPDFRLGAKTVGTRTDIRQLDESEKYSFI
FT                   KAPRWRGHAMEVGPLSRFTIGYARGMAEFKEPVDRLLKDLGLPFEALFTTLGRTAARGL
FT                   EASWAAHAMRRLHDQLMDNLKAGDLATASTAKWEPASWPAEAKGVGLVEAPRGALGHWI
FT                   HIRNGKIEAYQAVVPTTWNGSPRDPAGNIGAFEAALLNTPLANAEQPLEILRTLHSFDP
FT                   CLACSTHVMAPDGGELVRVQVL"
FT   CDS             complement(420468..421589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03690"
FT                   /product="Ni/Fe-hydrogenase small subunit"
FT                   /EC_number="1.12.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03690"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79716"
FT                   /db_xref="GOA:F0J2S7"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2S7"
FT                   /protein_id="BAJ79716.1"
FT                   /translation="MPDESRTFYELMRAQGTSRRSFLKFCSLTAAALGLDPVYATRIAH
FT                   AMETKPRIPVLWMHGLECTCCSESFIRSGHPLARDVILKMISLDYDDTLMAAAGHQAES
FT                   ILDEIPRKYKGRYILAVEGNPPLNEDGMYCIVGGKPFVEKLKAVAADAMAVIAWGACAS
FT                   WGCVQAARPNPTAATPIDKVITGKPIIKVPGCPPIAEVMTGVITYMVTFGRLPELDARG
FT                   RPLMFYGQRIHDKCYRRPHFDAGEFVEAWDDEGAREGYCLYKMGCRGPTTYNACSTTRW
FT                   NGGVSFPIQSGHGCIGCAEDNFWDNGPFYQRLSHIGAGFGIEATADEVGAVVAGAAGAG
FT                   ILAHAGASVVKHMRGKPPSDDAARHSGDEGDRP"
FT   CDS             421742..422137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03700"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79717"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2S8"
FT                   /protein_id="BAJ79717.1"
FT                   /translation="MDNRMPDRSPSHLADAAKVFAAIDRQDAAAFASLFANNGMFVFGN
FT                   AAPVIGPAAIRAAVTAFFAAIRELRHDIIDVWHVGDSVITQLTVLYRRRDGSVVSLPAA
FT                   TIWRVSDLGITDYRIYADLAPLVAPSD"
FT   CDS             422147..422593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03710"
FT                   /product="putative polyketide cyclase/dehydrase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03710"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79718"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2S9"
FT                   /protein_id="BAJ79718.1"
FT                   /translation="MASCRIERRLAIPVAAAYDLIADIESYPRFVPFWLSATILERTAR
FT                   RMTVRQAVSIMGLRMDFVSAATLDPPHRIAIRSASLPFRDFALSWSLREMRPAATLIRA
FT                   ELAVEFDSRPLDAMASRLVPVLLWRVVAAFEREARGRAAHPARR"
FT   CDS             complement(422575..424113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03720"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79719"
FT                   /db_xref="GOA:F0J2T0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2T0"
FT                   /protein_id="BAJ79719.1"
FT                   /translation="MDQFGAMRLGGNAERASADQALTAQLFDKARRMVIAGAIDGNPSA
FT                   TPLLCARDGEDIVFAAHRASRLAALLSINPRAQAIVETDDPLFSLLLEVTGFCVELREA
FT                   AARGRVLAALHGGAGPDDAAAREFACYRLRPTRLALVDRMATPRFAWQALPQNRRSDAR
FT                   LALEDLGGWMRLWIRTVRAPFFTAAIVPVLLGGAVARFAMARAGTGADWPWALFLWCIA
FT                   GVLLAAAGTNLINDYGDHETGADEGNEVGGNPFTGGSRAIQLGMVAAWKVLLGSAICFG
FT                   GTVAIGLHINAALAGHALAPTPLLGFGVIGCALGIMYTMGPFRLSYRGLGEVAVPLGFG
FT                   PVIVLGTAYVLASAMHVPVPWLAGLLAALPVSVFVLLILWINQFQDAPADAAAGKRTWV
FT                   VRLAETAGGDIDFRRPFRAYLALDAAGFGLIALLGLIGRADPALATRYAFLALLPLPLA
FT                   LVAARKGSLWVRRWRAAPGERARLPFELLGVNAITIGVHLATGLLLALAYLLAG"
FT   CDS             complement(424144..424794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03730"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79720"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2T1"
FT                   /protein_id="BAJ79720.1"
FT                   /translation="MARTPKHAPLLSLLTAAAAAVPPLPTALVVMAPAGAALAAAPGAS
FT                   TTLAQAIARGDTQIAPAGVRALIMAQRRDFTLIDIRAPKEFAAGHIRDARNVPISQLAL
FT                   PQEINRLRRSPQVILYGNATDKAAEAAVMLRASGVMARAMTGGLAAWGQALEAAAARPD
FT                   QAAMVRALNLCPEIVATPIAPAPAAPEAAPAAPQAAPKAPAGTAPVNLNGMCG"
FT   CDS             complement(424811..425848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psrC"
FT                   /locus_tag="ACMV_03740"
FT                   /product="polysulfide reductase chain C"
FT                   /note="protein synonym:sulfur reductase chain C"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03740"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79721"
FT                   /db_xref="GOA:F0J2T2"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2T2"
FT                   /protein_id="BAJ79721.1"
FT                   /translation="MREEVLASVLANPRVEPHLAIWGWQIATYLFLGGLAGGMMLCSGA
FT                   VILGRRDEDAPFAARRAPLVALVLLAVGLGALFLDLERKINVWRFYTVLHVTSPMSWGS
FT                   WILLLVMPALALMALGGIDAGFPPLARWLRGLPAIGALAGRVIGLSVAARRAVAAVNVA
FT                   LGIALCVYTGVLLSGFNARPFWHSALLGPLFLVSGMSTGAAVIVLGARTAKERHLFGRI
FT                   DLGLILAEMALIGLFLIDMLNGNALQQAAVALLLGGALTGLFWVGFMALGLALPLLMEA
FT                   ASWRRPIALLAGTASVLVLVGGFLLRDIVVTAGQQTGWRSFHNQFNAALLDRLRHDGEN
FT                   PNGRF"
FT   CDS             complement(425876..426418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psrB"
FT                   /locus_tag="ACMV_03750"
FT                   /product="polysulfide reductase chain B"
FT                   /note="protein synonym:sulfur reductase chain B"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03750"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79722"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2T3"
FT                   /protein_id="BAJ79722.1"
FT                   /translation="MPHFAMVIDTKTCIGCTDCVDACRMENNVPEGLCYDWVVEITEGR
FT                   YPELKTEFRSERCNHCSHATCVDACPTGASQYWNGSNIVVVDATRCTGCKACIAACPYD
FT                   SRLIMEPQGYIGKCTFCVHRVQYGEDPACVATCPAHAMHFGLLDDPGSAVSRLLATRAH
FT                   YVLAPETGNQPNVFYLR"
FT   CDS             complement(426418..428613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psrA"
FT                   /locus_tag="ACMV_03760"
FT                   /product="polysulfide reductase chain A"
FT                   /note="protein synonym:sulfur reductase chain A"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03760"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79723"
FT                   /db_xref="GOA:F0J2T4"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2T4"
FT                   /protein_id="BAJ79723.1"
FT                   /translation="MQRRDFIRMSSAVASAALLGPTLAGCSRPAEWQRMMTEAPATETP
FT                   TVCNICFWACAAKVHTRGERLWKITGNPEDAHCEGRLCTRGTGGVGAYYDPNRLVRPLV
FT                   RMGKGADQRFEVASWDNALGLVAERMEKIAREHGPDRLAALVHGPGAAHFSHLVRAFGS
FT                   DSIAEPAFAQCRGPRDTGFFLTFGQGFGSPEQTDMAKARCIVLIGTHIGENLHNSQVRT
FT                   FTDGIRNDATIIVVDPRFSVAAGKANHWLPIRPGTDIALLLAWMNVILAERRYDAGYVA
FT                   RNTVGLEALCAHVAPFTPEWAYGETGIEPAQIRETARLMAAAAPATVVHPGRHSTWWGD
FT                   DTQRARAMAILAGLLGIWGREGGYYLPESVALPAYPVPAYPVPKTSWREIALPVFPLAG
FT                   APVTNVILDNAHGADAHYKGLIVYDTNLPMTMPGIRRTLDAAAQSLELIVAVDVQPAEV
FT                   TGYADVVLPECSYLERHDPLRNSGERYPALALRAPALPPRGESKPGWWIAREIGTRLGL
FT                   GRYFPWTDYTEVIDWQLRQVGSSLKELETTGIRAFPRRTPAYFAPGETPRFATPSGKIE
FT                   LFSATLQQAGFDPLPRYTRPEAPPADHFHLNYGRAPQHSFSRTQNNPVLYQLMPENLVW
FT                   IHPTAARRFGIRNGTYVRLVNQDGVVSNKVRVRVTERTRPDSVWLVHGFGHTAPGLSLA
FT                   RGRGADDSALMTRVLYDPIMGGTGMRGNFVTFRKENA"
FT   CDS             428905..429906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03770"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79724"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2T5"
FT                   /protein_id="BAJ79724.1"
FT                   /translation="MNMQTRTAALATARPAAAIMASLSAAALGIAVLGLAATAPARAAP
FT                   ASSAPPLVDAAWLRAHLHDRGQVILEVYDTATQRPAYEAGHIPGAVFTGFLNDGWRVPR
FT                   DGIPGMLPPPEQIAGVIGHFGIGNATRVIIVPAGRARGDFNAAARVFWTLRMEGADNAS
FT                   ILNGGDRAWFADPADPVARGNVPLRPAVFVPHPTTEYLATMPMVRATLDSHAAQLVDAR
FT                   PPAQFEGRVRAPVDARAGTLPGARNLPFSAVLTADGEGVRPMPELAQALHRAGVERGAP
FT                   SITFCNTGHFASTDWFVLREVLANPRVRLYDGSMSEWSRNPALPMVPGHSAF"
FT   CDS             429921..430445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03780"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79725"
FT                   /db_xref="GOA:F0J2T6"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2T6"
FT                   /protein_id="BAJ79725.1"
FT                   /translation="MKPGPRPVWNPHAAGAALGVLLFVTFLATGHGLGVTGATTYATAS
FT                   ALAAASPRGLAPHSYLAAYARAGLDQWIVWEAGGMLLGGLAGAALGRRLRPRIDGPRLA
FT                   ASPVRLALALLGGTASGFGARMAMGCTSGMGLSGSAPLAVAGFVFLIGFFAAGLLAGRL
FT                   VAPLWGGEGGR"
FT   CDS             430442..431011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03790"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79726"
FT                   /db_xref="GOA:F0J2T7"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2T7"
FT                   /protein_id="BAJ79726.1"
FT                   /translation="MIHLPLGWTGSLSGLLIGLAFGAILEGAGFADPARLTGQLRLVDW
FT                   TVFKVMFTAIIVAGTLLYLFRDLGLLPFGRIFVPSLYLWGTLLGGALIGIGMAVGGYCP
FT                   GTAAVALASGRLDGLVFLLGIGAGTILFNGAYTAIGGWAYARTGKAALTLPQLLHLSPW
FT                   IILPALLALLVAVVRLTAAPAGRASS"
FT   CDS             431008..431715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03800"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79727"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2T8"
FT                   /protein_id="BAJ79727.1"
FT                   /translation="MTAPAPPLAAASLAAPSLAAVAEAVVGQIAAWAARGESAPARLLG
FT                   PGGEFVEWAHYPQPDAIAPASAWRFFYHAHAARQRPAAEHGHFHIFVPPPAGSAGFSHL
FT                   AGISVDARGLPLRLFTTNRWVTGEVWQPAPALIARLRRPGLHDAEPSDVARWLDGLLIL
FT                   FADEIAALLLARDRRLAGPSGAADPARLDDHRLRLPSRRRISLAARLRRLAPRSAPPGR
FT                   AGSRPATAPPASA"
FT   CDS             complement(431618..432613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupN"
FT                   /locus_tag="ACMV_03810"
FT                   /product="hydrogenase nickel incorporation protein HupN"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03810"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79728"
FT                   /db_xref="GOA:F0J2T9"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2T9"
FT                   /protein_id="BAJ79728.1"
FT                   /translation="MAAKRQAGPGADASARRVLWGLGAANVAAWIWAAAAFGGAPRLLG
FT                   MAGLAWLFGLRHAMDADHIAAIDNAVRRLAGRGRAASLAGLFFSLGHSSVVVLLAAAVS
FT                   FGAGALRGHLDAVTRDGAWIGTIVSVGFLALIAGANLVALRAETRGGAAPGGVLSWLAR
FT                   PLFRLVRRSRDMYAIGFLFGLGFDTATEIGLLALSAAGTAHGIAAWRLMALPALFTAGM
FT                   SLVDTADSALMTRAYGWALRDGRARRRYNVTLTAVSAAIAVVVGGAELLGLAGDGVGTG
FT                   VARVAAMLDAHWSGLGMIITLMLAGLWLAAIRRGRAGRIAERASSAAPPG"
FT   CDS             432773..433345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03820"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79729"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2U0"
FT                   /protein_id="BAJ79729.1"
FT                   /translation="MDVAARFAALIETLCGAVAARGAKGAFGAANGALVVLLWSRLRRA
FT                   VRRFAILVAGAPPPRRRASRPRHRAARTPAVALPRRAAWLLAPVPEASAVAGRLRDLLE
FT                   TPEARALIASEPRAGRLLRPLCRALGLRLPACLRLPPRSRPAVAPAKARAAAPTTATPH
FT                   PAPAPRLSPRRPVRPGPLHTRAPPVPS"
FT   CDS             complement(433464..434144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03830"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79730"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2U1"
FT                   /protein_id="BAJ79730.1"
FT                   /translation="MRRLALAGIVLAPLALSACATEAPAPTTFARLDYSYLPPITLKVA
FT                   SIRIRDDYRPGPDAAKMIDLAPEPPARVLERMAHERLVANGSPGSASFVIRQASLHQVG
FT                   DTLVGTMTVDLNVRTSNGQRVGYAEATVSRSETAPTNESPDRMRAALYDLTKTMMSSMN
FT                   VELQYQIQRSLPDWLAYSPAGEVGGMAAPHYSPDQGISAQPLPNPDAGQNGPASGTNLG
FT                   GSND"
FT   CDS             complement(434141..435139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="ACMV_03840"
FT                   /product="33 kDa chaperonin"
FT                   /note="protein synonym:heat shock protein 33"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03840"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79731"
FT                   /db_xref="GOA:F0J2U2"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2U2"
FT                   /protein_id="BAJ79731.1"
FT                   /translation="MAKRAQCLYLTAMTELPPFLDRTRPDVPDIAVPRGVTPFFLPNQP
FT                   VRGRLVRLGPLADALLTRHDHAPDVRALLGQALALVASLATALKFTGSFSLQAKGDGAV
FT                   PLLLADCTDGGALRGYARLSDEIALPEEATARAMMGDGYLAFTVDQGPDMERHQGIVSL
FT                   EGESLADMAHHYFETSEQLPCQIHLAAAETPAGWRAAALVIERIAGAGGIDPAVSEAEQ
FT                   EEAWRTAKILAATITDEELLDDTLPPERVLYRLFHGEGVAVDRPRPLAYGCRCSRARLS
FT                   DVLGGFSGDDLDHMTIDGDITMTCEFCNVDFRFPRGEIAAAASAGEPGGAS"
FT   CDS             435248..436708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hldE"
FT                   /locus_tag="ACMV_03850"
FT                   /product="D-beta-D-heptose 7-phosphate
FT                   kinase/D-beta-D-heptose 1-phosphate adenosyltransferase"
FT                   /EC_number="2.7.1.-"
FT                   /EC_number="2.7.7.-"
FT                   /note="bifunctional protein"
FT                   /note="protein synonym:bifunctional protein HldE"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03850"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79732"
FT                   /db_xref="GOA:F0J2U3"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2U3"
FT                   /protein_id="BAJ79732.1"
FT                   /translation="MAEHDDGDLIAAIRGLARANVLVVGDLMLDRYAYGRVERISPEAP
FT                   VPILTVTREIAMPGGAGNVVRNLTALDAAAAFVSVVGDDQEGSDLTALIGGQPNVEPWL
FT                   LVETGRATTVKTRYIAAGQHLIRADRELVMPLTDKLGERLLKIASDAMAATSVTVLSDY
FT                   RKGVLAPTIARNLIASARSIGRTVIVDPKGADWSHYAEADVITPNRRELAEAVGRDLPD
FT                   EAAIVGAAREVIGRFGFGAVLCTRSEDGMSLVTVDTVRHYPAEAAEVYDVSGAGDTVVA
FT                   VLAAGLASGLPLEIAARLSNIAGGLVVGKVGTAVARPDDLVDAVKPASGALRKVVTRQA
FT                   AAEAAERWRQRGWRIGFTNGCFDLLHPGHVHLLEQARAGCDRLVVGLNADSSVRRLKGA
FT                   SRPVQPEAARAAVLASLASVDLVVIFEEDTPLDLLSAIRPDVLVKGADYTHDTVVGARE
FT                   VESWGGRVMLAELLPGHSTTATVTRLRS"
FT   CDS             436889..437761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03860"
FT                   /product="putative polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03860"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79733"
FT                   /db_xref="GOA:F0J2U4"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2U4"
FT                   /protein_id="BAJ79733.1"
FT                   /translation="MAVNSRQFRIHPSVPVDLSSWPTAIDPLFDSKHDYRAELDDHIKR
FT                   LSEMQQLLYASNRHAVLIIFQAMDAAGKDGAIKHVMSGVNPQGCQVFSFRHPSAMELQH
FT                   DFLWRTTRNLPERGRIGIFNRSYYEEVLIARVHPEILANEGVPEPPSGVGSIWEHRYRS
FT                   INDLERHLSGNGTKIVKIFLHISKEEQLRRLIARIDDPSKNWKFSTADVEERKFWNDYM
FT                   AAYQDCLNATSTVEAPWYAVPADDKRNARLIISNILLETMQELDMNYPEVSSKRKKELA
FT                   RIREDLAKS"
FT   CDS             complement(437769..438491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03870"
FT                   /product="branched-chain amino acid ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03870"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79734"
FT                   /db_xref="GOA:F0J2U5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2U5"
FT                   /protein_id="BAJ79734.1"
FT                   /translation="MSLLEIADLKVNYGQIEALKGVSLRVETREIVAILGANGAGKTTL
FT                   MRTISGLLTPRGGSIVFEGTDITRLGADRIVRLGIAQSPEGRRVFGTLSVMENLRLGAF
FT                   TRPAGEVAGSLDFVLQMFPRLAERRSQLAGTMSGGEQQMLAIGRALMAKPRLLLLDEPS
FT                   LGLAPIIVQGIFRTLREIANSGVTILIVEQNARSALKLADRGYVLEVGRFVIEDNAKTL
FT                   LTSPEVQAAYLGGERRKA"
FT   CDS             complement(438488..439273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03880"
FT                   /product="branched-chain amino acid ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03880"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79735"
FT                   /db_xref="GOA:F0J2U6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2U6"
FT                   /protein_id="BAJ79735.1"
FT                   /translation="MSALLELHGVGIRFGGLRAVDRLSFTVDKGQIVALIGPNGAGKTT
FT                   VFNMITGVYRPTEGSIRFEGQDITARRPHLVAAAGIMRTFQTIRLFPEMSVLENVRAGC
FT                   HLRVRQQWWQGLLSLPSQRREEAELAERAHDILRRLDLDRFAHDRAVSLPYGVQRRVEL
FT                   ARTLAADPKMIILDEPAAGLNDNESAALSETIFGIRDSGITVLLVEHDMNVVMSVADKI
FT                   VVINFGQKIAEGGPDDIRNDAQVIEAYLGRDDDEEEGVS"
FT   CDS             complement(439270..440196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03890"
FT                   /product="branched-chain amino acid ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03890"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79736"
FT                   /db_xref="GOA:F0J2U7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR035568"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2U7"
FT                   /protein_id="BAJ79736.1"
FT                   /translation="MSASATRNTGIAVWILGLFLPLALNSAWVSVAAIFAIYGIVALSE
FT                   DIILGRAGMFDMGHAVYFGIGAYVTAILNVTFDWPIFLTIPFAILLAAAFGALLAAPLI
FT                   RLRGDYLLVASIGFNAIFVLAMQNNLFGLTGGSDGITGIGVPSLFGLPIESQSAMYWLD
FT                   WVVLGIVLVLMRNLDGSEFGRALRYLKQDELAATTIGVNPRKVKTLAFAIGAGLAGLAG
FT                   TLFAVQLSTVSPSSFKFTESVTLFAIVIVGGQGSIPGVLLGTALMFVLPQVFRDFAQYR
FT                   YLVFGFAMILVMVLRPQGLWPRRGARA"
FT   CDS             complement(440196..441098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03900"
FT                   /product="branched-chain amino acid ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03900"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79737"
FT                   /db_xref="GOA:F0J2U8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR035568"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2U8"
FT                   /protein_id="BAJ79737.1"
FT                   /translation="MGTFIQQVFNGLTVGGIYALIALGYTMVYGVMRLINFAHGDLCIL
FT                   GAFIGLTFLTSLGGAGHPGAALLILAFVAAIVVVAVAGVVLELAAYRPLRKADRLAAVV
FT                   SALGASLLIENGIMLIWSPQVSVFPSGLLPTTTYHIAGASISFVQVMIIIVSFLLMAAL
FT                   YLFVNHTRFGTAIRAAAIDQDAARLMGINVNRVIASVFIIGPALGAVGGLFIGVYYREV
FT                   YFTMGWTYGLYAFIAAILGGIGNIPGAMLGGILLGLFNAFAAGYISSSWQDAITFALLI
FT                   GILLVRPSGLLGERVAEKV"
FT   CDS             complement(441130..442275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03910"
FT                   /product="branched-chain amino acid ABC transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03910"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79738"
FT                   /db_xref="GOA:F0J2U9"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2U9"
FT                   /protein_id="BAJ79738.1"
FT                   /translation="MIRKMGIGLAAAVALAAPYGIAHAASGPIKIGVQAPITGTYADEG
FT                   QGIEKAVKLLADQQNAKGGLLGRKIEVKVCDDEGKASQAAICARQLVNDGVIAVIGSYT
FT                   SGAALAAEPIYARSNVIQTSDGTSNKLLSRGYKTWFGNAAPNSAEAKFTAKYLIDVRHF
FT                   KRIAVLTDHSSFATGLADAVIKNIKADHGKVIDKAFITAGSQNFTPVLTKLKALKPDAI
FT                   YFSGYYSDGGLIKAQMAQLGITATFVGGDANQNVAFGKIAGSAAKGAIIVNVPGPEQLP
FT                   YPTAKAFVAAYKAKYHQSPPSVFTLTNADGMRAVMQAIEQTRSVKPAKLEHYLHTMKSF
FT                   DGLTGQFRWNDKGERVGSPFTAFEVQADGSYKIVYPAPKAG"
FT   tRNA            442686..442760
FT                   /locus_tag="ACMV_t0070"
FT                   /product="tRNA-Gly"
FT   CDS             443118..443792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03920"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79739"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2V0"
FT                   /protein_id="BAJ79739.1"
FT                   /translation="MCGRYASFLSPDAIARLFHTAGALPNVAPSWNVAPSQQAMVVRRQ
FT                   PETGEPHLDLLTWGLVPHWTKDLRAARRPINARAETVATSPMFRDAFARRRALIPAQAF
FT                   YEWQRTENGAKQPYAIARRDGEALAFAGLWEGWRSSEGEVLRSFAIVVTAANATMAPIH
FT                   DRMPVIVEPPDWPLWLGETEGDAAALLHPAAEDTLLVWPVSTRVNQPANNAADLLAPLP
FT                   AA"
FT   CDS             443805..444707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03930"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79740"
FT                   /db_xref="GOA:F0J2V1"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2V1"
FT                   /protein_id="BAJ79740.1"
FT                   /translation="MTEHQAPWPDGEVLAGIVERVTFHNAESGFAVLRVKARGHRDLVT
FT                   IVGHAAAIAAGEWITATGEWVNDRTHGQQFKARFLKTSAPTTAEGIERYLASGMIRGIG
FT                   PVYAKKLVRGFGEAVFDIIEGAPQRLREVGGIGEVRAKRIVDAWAEQKVIREIMVFLHS
FT                   HGVGTARAVRIFKTYGADAIQVMSENPYRLARDIRGIGFKTADAIAARLGIEKTAMIRV
FT                   RAGIGYALSEAMDDGHCGLPVAELVPLAERLLEVPEALIRTALDLELADGAVIADRVGE
FT                   ADCVFLAGQGGAPAGDRGG"
FT   CDS             444739..445431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03940"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79741"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2V2"
FT                   /protein_id="BAJ79741.1"
FT                   /translation="MTLAESQRHAVGLALASKLLVITGGPGVGKTTIMRAILAILAAKG
FT                   VRILLAAPTGRAAKRMSEATGFEARTIHRLLEVDPRTGGFRREPDHLLECDLLVIDEAS
FT                   MVDVQLMHALSRAIPAAAALLVVGDVDQLPSVGPGQVLADLIGSGAVPVVRLTEIFRQA
FT                   ASSRIITTAHRINRGEMPDLTRAEAIGEVIPGFFRSVPMGPFGRIPHSDTNLSRHARLR
FT                   SHTSRDEV"
FT   CDS             complement(445400..448024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03950"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79742"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2V3"
FT                   /protein_id="BAJ79742.1"
FT                   /translation="MAFVPYVLKAAASEIDESGEALPPGKRLVVFPGIELTLGVPCQAI
FT                   LLLDADFPEAWFGQVLTALHLTPPADDQPRNGNVTRLDSVHSFLDLKQQLDRHSWLKDK
FT                   YIIFPNVTGEGEYSLLRTGQMGKYIEMPCVGGYVDGSLSKMKPGRRSILDGHNKAWGNK
FT                   RIACFQTSDNRHEDHRDLGTSTTWVKWATPTAEALRQACLAQESRVSQETPLLPALVIA
FT                   SISVSNSLFLGPIDLELNSQYNALIGGRGTGKSTILEYLRWALCDQPPGIEDVETPNYQ
FT                   ARRHRLIEQTLKPLAATVEVRFEVNGVPHIVRRSSTDGLILLKIAAGEMRPCAEDEVRS
FT                   LLPIEAYSQKQLSDVSVRIDELTRFVTAPIRGELNRIDRDLADHAERIRQSYATRRRRR
FT                   ALEQTIQKRELEAKSLTEQADALRAGLTGLADEDRALLDRGKLFDAANQLVEGWRDGIR
FT                   LIGQAAAALQRTVGLSLTQLAPPPPDPPSTALAAAHAEYRGLLDEAKVALTALSDRAAK
FT                   LLDTHGGGAPVTPWQQWNTELAIFKASYDAAVQKSSSHTEKLQQLQAIEAQALKLNREV
FT                   AQLKEELRALSETEASYLVDRQAWQELLGERDTLFDAQCASLTANSGYSIRARVKRFAS
FT                   ADDFTAVFRQALSGSRLQGNKIELPGESIVAAPKPGDQWNAILNDLEKLAEHEPERDGA
FT                   ERRPETPTLTSIGLSSGDLDRIGRTLKPEQWLTLSLTPIKSVPMFEYRSREAEYIPFGN
FT                   ASAGQQATALLETLLTQGTFPLIIDQPEEDLDNPVMLEIVAKIWQAKQRRQIIFASHNA
FT                   NLVVNGDAELVAWCHYRAMGDQSRGTIGGTGAIDMPDVREAIKKIMEGGEAAFKLRREK
FT                   YGF"
FT   CDS             448824..449534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03960"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79743"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2V4"
FT                   /protein_id="BAJ79743.1"
FT                   /translation="MSRSSARARPGQDRASLYAEITDKIIAELEAGRLPWVQPWGASAT
FT                   GAAIGMPKNAATGRRYSGINVLILWGAVIERGYAGQAWLTFRQALAVGGNIRKGERGTT
FT                   VVYADRFIPEAERERADRDGDEPSAIPFLKRFTVFNTDQCEGLPDTIASTAPPVPEGLI
FT                   LPQADALIRTSGADIRIGGDRAFYSVIGDFIQVPPPQAYFEPVNWHRTALHELGHNAEI
FT                   RIMPHLLGRARLAV"
FT   CDS             449594..450805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03970"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03970"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79744"
FT                   /db_xref="GOA:F0J2V5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2V5"
FT                   /protein_id="BAJ79744.1"
FT                   /translation="MPQYLQTCIEPYLDSFAESFAAENYTAGTVKTYQSILRKVGHAMD
FT                   VEGISPSALTLDMAEHLGRKVPRKKTGSVWPYRLARRFAQHLLDIGVTQPVPLTEAQQA
FT                   RATLLANFETYLVKHRGLSPRTIYHTLRFANRFLDHRFGDAIVDPGRLRPADVISFIEH
FT                   VLAGARRDKTVATHVRIFLQYLFGSGATATNLALSVPRAAKRWGARLPRHLSPEGVEAV
FT                   LACVRDSPRHGARDYAMLLIMARLGLRAAEVIAIQLDDIDWRAGELLVRGKGKLHDRVP
FT                   ISAEVGEALCRYLREERGPASCRTMFVTHRAPYRPFKDSQIVNAVLKDALKATGQKPVT
FT                   PYVGSHLLRHSLATQLVNSGASLDEVGDVLRHRSRTSTMIYARLDIDGLRSVAMPWPVA
FT                   GGAQ"
FT   CDS             450802..451743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03980"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03980"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79745"
FT                   /db_xref="GOA:F0J2V6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2V6"
FT                   /protein_id="BAJ79745.1"
FT                   /translation="MSLTFQLDRYLAVRRRLGYDLSTSERILRRFTRFADSERVTHIDT
FT                   ALFLRWHATLGEANGMTRAARLTAVRLFAQWLSSFDPAHEPPPRGLLPDTVMRSRPHIY
FT                   SNAEVASIIAAAKALPSICGLRGLTCSTLFALIAVTGLRISEALALDGNDLDADNGVLR
FT                   VRQGKNGKERLLPLDPSTVERLLNYRIERDRLIGHPAVPLFVTDKATRLTDCTARYNFA
FT                   QACQQIGLRSEQQYHRHGRGPRIHDLRHTFAVRTMIDWYRTGKDPAREMIRLTTYLGHS
FT                   SPSRTYWYLEAVPELLDLAIARATASGGEMAQ"
FT   CDS             451740..452732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_03990"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_03990"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79746"
FT                   /db_xref="GOA:F0J2V7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2V7"
FT                   /protein_id="BAJ79746.1"
FT                   /translation="MNAVTLPALIQRFFTDRLCTQLEASRHTVAGYRDTFRLLLRYASA
FT                   RRKKPPVNLTVEDIDADLVADFLAHTETARGNSARSRNTRLAAIRSFFRFVAMTDPTWL
FT                   LHCQRILAMPNKRYVKRAVTFLDAEEMAALLAAPDRTTWAGRRDHALLLLAVQTGLRAS
FT                   ELVGLTRGDVVLGTGAHIRCMGKGRKERATPLRRETAKLLATWIGNDKDEGKPLFPSIR
FT                   GERLSRDALEHLVRKHCLTASRACPSIGTKQVTPHTLRHSTAMDLLHHGVDPAVIALWL
FT                   GHENVETTQIYIHADMRMKEKALARVAAPATPSGRFRPDDQLLAFLEGL"
FT   CDS             452882..453175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04000"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79747"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2V8"
FT                   /protein_id="BAJ79747.1"
FT                   /translation="MSGGFGSASYAKEELVAEMTAAFLCASLGIVPTVRHADYIGSWLE
FT                   VLRDDDHAIIRAASAASKAADYLLAFQIEDDEREGPECRPAGPVVLSAVYVP"
FT   CDS             453438..453596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04010"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79748"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2V9"
FT                   /protein_id="BAJ79748.1"
FT                   /translation="MLAYFALTGQLTRERMEDVITLEQAMEDDRRFERLAARITQLLEE
FT                   EKKNADE"
FT   CDS             453583..453897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04020"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79749"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2W0"
FT                   /protein_id="BAJ79749.1"
FT                   /translation="MRTNKTAEINDLIRIWVHIDPTTDQFMRLAGLYVLYAVLDKTGGF
FT                   PKKAGVTKRTMAKGRVRSFIFQRKHQQRVLRALNAYDAVIASTDRSSVVQFARLHSVAA
FT                   "
FT   CDS             454066..454461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04030"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79750"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2W1"
FT                   /protein_id="BAJ79750.1"
FT                   /translation="MSAAENVELHSHHAELIAEALATEGGHLSIGRGGFILWYGDGCRL
FT                   LGYDSEPIKAACIAAGLPVIDSRGVAFDAVARLVMRGPMVAVGAPPDPPPHGPFSYAPL
FT                   AAVAAAYRAAGAEVVNLPQPAADAPGG"
FT   CDS             454562..456547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04040"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79751"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2W2"
FT                   /protein_id="BAJ79751.1"
FT                   /translation="MAATQKIVLNPSRDIPFNKLVLSQANVRRVKAGVSIEALAESIAR
FT                   RSLLQSLSVRPVLDAEGNETGMLEVPAGGRRYRALELLVRQKRLAKTAPIPCIVKTEGL
FT                   AEEDSLAENTDREALHPLDQFRAFKTLRTKSQGEEEIAAAFGVTAAVVRQRLKLAAASP
FT                   ALLDGYAEGAMTLDQLMALCVSDDHARQEQVWATIQRGWNKEPHIIRRMLTEGAVRASD
FT                   RRASFVGTEAYEAAGGIVMRDLFQEDEGGWLQDPVLLDRLVAERLAREADAIRAEGWKW
FT                   LEAAPDFPYGHRHGLRPLPSTNPLTEPEQAEFDALKGEYDSLEEQYGEADELPEAVEAR
FT                   LIEIETAIEAFQNRPPKFDPADIVRAGAFISIDRDGALRVERGYVRPDDEPPGGSARRS
FT                   RSVRGAGQHRTRYRSGPVRHGGALDHDHHCRGAVSRGARGRRGAEAAARAADDGTHRTP
FT                   DARVAGSLGERLGHGVPGRAPRVLPPPVLSLRRRHMPVDRGQERRVRDPGSGTERHRVR
FT                   QSHRRAARGMGEAIAGDVRRTLERARRLRHRHARGAIRALRGTDDQRASRTLEPPSGRP
FT                   GARRSIGPGGQSRHGGGGLGADGRDLSWPGAEGPHPGGGARGKGRARRAADRPPEEAGD
FT                   CAGGRTAARRHRLAAQAAPHAQGSLR"
FT   CDS             complement(457580..458005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04050"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79752"
FT                   /db_xref="GOA:F0J2W3"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2W3"
FT                   /protein_id="BAJ79752.1"
FT                   /translation="MILYLDTSVLLAALTHEAETQRMQRWLGDQDPELLAISDWVTAEF
FT                   SSALSIKLRSGQIETQHRADALAMFTTMSAETFTVLPISGAQFRTATRFADQHALGLWA
FT                   GDALHLAICADYGANLCTLDRRLGEVGPALAVKTALL"
FT   CDS             complement(458002..458244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04060"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79753"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2W4"
FT                   /protein_id="BAJ79753.1"
FT                   /translation="MGSVSIADAKAHLSELVERAAGGETVQITRRGKPVAQIVAAKAPR
FT                   KRIDIAALRAMVEKMPMQPEPAGEFIRRMRDEARY"
FT   CDS             458430..462629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04070"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79754"
FT                   /db_xref="GOA:F0J2W5"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR026741"
FT                   /db_xref="InterPro:IPR026937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2W5"
FT                   /protein_id="BAJ79754.1"
FT                   /translation="MNLIVPALAEQSAMLASPSAPPAPDRASAILGAGRLLLPALERGQ
FT                   ALDAAILRTAMEAAFGASDTGGIWVWKDAYEACEVAQVLFLRQHGPAMRARAGSPAAML
FT                   AMLAKLAALAPTHTRRSEESAALQQFSTPIALGFAASAAAAITPSDLVLEPSAGTGLLA
FT                   VFAALAGGVLALNELAETRADLLGRLLPSAPVSRHDAAQIHDHLNPSIAPSVVLMNPPF
FT                   SVAAHVEERMADAAFRHGTAVETRLTVIDRVPAEDPTAFPPCPGIAPDAATLLEWVTRL
FT                   VPPRPAVSAPPVAPPAACPVPPRAIVPRPHPIPIRHPEPPIDPGIALAYEVRDERPPEH
FT                   GRISDALYESYSVQTIVIPGAQPHPTKLVQSSAMASVTPPRPSYRPHLPPAVISAGLLS
FT                   DAQIESVIYAGEAHAGHLAGAWLVDATYDQVSAAPDDAEGAVRFRRGWFLGDGTGAGKG
FT                   RQVAGVILDNWLKGRRRALWVSKSDKLIEDAQRDWSALGQERLLITPLARFRQGTPIRL
FT                   DQGILFTTYATLRSAEREGKVSRLDQIIDWLGRDFDGVLVFDEAHAMANAAGDTSERGE
FT                   RRPSQQGRAGLRLQHALPDARVLYVSATGATSVQNLAYAQRLGLWGGADFPFATRQEFV
FT                   TAMEAGGIAAMEVLARDLKALGLYAARSLSYEGIEVEIVEHALSREQVRIYDAYAEAFQ
FT                   VIHANLAEALEAANVTGPSGTLNRQAKAAARSAFESNKQRFFNHLITAMKVPTLIGAIE
FT                   RDIAAGAACIVQLVSTGEALLDRRLADIPAGEWADVQVDITPREYVLDYLAHGFPTQLF
FT                   EVFTDSDGNLLSRPVFRDGQPVQSREAVERRDRTIDHLAALPAVQGALDQIVQRFGTDQ
FT                   VAEVTGRSRRVVRKIAPDGNERLAVETRLGSANLAETQAFMDDEKRILVFSDAGGTERS
FT                   YHADLAVRNQRRRVHYLLEPGWKADTAIQGLGRSNRTNQRQPPLFRPVATDVRGEKRFL
FT                   STIARRLDSLGAITRGQRQTGGQGLFRADDNLESQYARAALRQFYGMIFAGKVACCSLQ
FT                   PFEETTGLDLSDRDGSLREDLPPITTFLNRLLALPIALQNGLFAVFEELLASRIENAIA
FT                   AGSYDVGVETLTADSLRVTERRTIHIHAASGAETRLFKLLRRDRNRPLPAGDALTLARD
FT                   KRARLLVNAQSGRAAVQMPAPSLTLDDGEVQRRIRLVRPMVRETIALDALDHTHWEEAD
FT                   AERFAATWNAEVAQVPEFTESAFHIVTGLLLPIWNRLPDELLRVYRLQTDDGERVIGRL
FT                   ISPAAMGEVCRALGLDDAPTLAPNEAWSAVLTDGVVLHLAGGLTVRRATVMGAARVELA
FT                   GFTDGAVDQLKAMGLTSEIIAWRLRLFIPVTERGPAILAALFERSQLLRVVDRVAA"
FT   CDS             462645..463694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04080"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79755"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2W6"
FT                   /protein_id="BAJ79755.1"
FT                   /translation="MSGSAAELAHRLAREAEAVCRHYLSNGRRQGRYWLVGDVQNTPGR
FT                   SLFVRLTGPDSGRGAAGKWTDAATGQHGDLLDLIRLNRGLDRLGDTLGEARAFLGLPKR
FT                   QLLRAPARPGSSDAARRLFALSRPIVGTLAETYLRNRGITARLEAAPALRFHPACFYRA
FT                   HDAAPREAWPALIAAVTDADGTIAGVHRTWLDRDGAGKAPIAAPRRALGHLLGNAVRFG
FT                   VASDVMIAGEGIETMLSLRCVLPDMPMAAALSANHLAALIMPPALHRLYIARDNDAAGR
FT                   HAAMCLRDRARAAGIEPRILWPVTNDFNADLRRFGADADALLTRLRVQLAPEDAERFAL
FT                   ANTRPVASG"
FT   CDS             464020..464997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04090"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79756"
FT                   /db_xref="InterPro:IPR019627"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2W7"
FT                   /protein_id="BAJ79756.1"
FT                   /translation="MGAASRTRTPIMATDRLIHHDAAEPPHAASPTARLLDELQLYGHR
FT                   PYQDDPDPRPLPEAARLEGALADIFDALVSTLSETRLEPDLADLLWSQVNLFHRTVDRV
FT                   QRELDANEDRQRRSQQEQDGSEIRSVELERLIAEGLTLIERRNAFELLREQAAELFEHH
FT                   TGSAWRPRAGSMVNHRALTAAMIDSRDFIAAKRRAETEVLLPAGPRIAFAGGVDFNDHG
FT                   RIWAVLDRVHRKHADMVLLHGGSPRGAERIAACWADTRKVTQIAFMPEWARHNKAAPFK
FT                   RNDRMLEVMPIGVIVFPGSGICENLADKARVLGIPVWRFGESGA"
FT   CDS             complement(465241..466176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04100"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79757"
FT                   /db_xref="GOA:F0J2W8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2W8"
FT                   /protein_id="BAJ79757.1"
FT                   /translation="MVNDQIGGIHVLPPLVINWHITEACNYSCKFCYAKWQAERETREL
FT                   IHNPARSRQLLEALYALFGPQAPDNPLSGRMAYRGVRLTLAGGEPFLYRRLCLDLINVA
FT                   RGIGFEISVITNASRLGIAEMRELAPNLSILGISVDSGNDHTNGAIGRKDGKGVALSLG
FT                   DLRERIAAARSINPKINLKINTVVNAHNWQEDFSDAIGQLCPDRWKVLRVLPARTDALV
FT                   ITQAEFDAFVARHRAFRNIMSVEDNADMTQSYLMIDPHGRFFQNRVGRPGYDYSAPILE
FT                   VGAAEAFKQIIFSPSGFVSRYPSVELPEVA"
FT   CDS             complement(466345..468093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04110"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79758"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2W9"
FT                   /protein_id="BAJ79758.1"
FT                   /translation="MDRDSPDPKFMSIGELHAAVRVSALLPCAIKDAAREAREALPEST
FT                   RNRLKHTTTLNHIVKGLGVAPGFAEYESTYSAKLLPFMQSYRLEEQKSLLATQADRLVR
FT                   LSYRQIADRMFASSLPQPKRIFTGTGVDYWTLLKAAAGCADMKVCALGDEKTTTPYDQA
FT                   RTTEINPTIPPFRYFVRAKNGVLELLSTIQFCNLIGDQLCDYGTDPTDSRLVATLYQLN
FT                   TSSAAQIRAGLRIFRDLIAGLDSGWMTVVPFSQNLVFLSDSQGGYDFVFRNLRDMPHDP
FT                   ASVGKSLPDSRTIAPSVDERFETWLYFHYTGWKERDQDDAELAFYEAGGTLATYPGSSA
FT                   ILREYLNRQGRGASAASPCEFCGSRAGKGTRRLTPLITIKEFRHFLNANPDYRAHRRNP
FT                   ADGDPWYEANTDSDDKLPASVTWYDAKAYAEWVNQDPHREVRLPTESEYREFFSDYIPS
FT                   HISVEDVAVAHARRLCDFIGPDGKVYDDHPPYMPNERFAELRIRYRLPLPLRDGPDGTN
FT                   LMQSPYFGEWLEAEGAAINGLFFCAQGMTGTAHETVVSPLAARFAPGSTGKYKSMKIGF
FT                   RLALLD"
FT   CDS             468929..469231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04120"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79759"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2X0"
FT                   /protein_id="BAJ79759.1"
FT                   /translation="MAIIGSFTKDTNGYTGTFRTLSINAKARLVPAEGGTDKAPDFRVF
FT                   AAGNVELGAAWTRKAKETGREYLSIKLDDPSFPQPIYASLVEAEVEDSYSLIWSR"
FT   CDS             469606..469776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04130"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79760"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2X1"
FT                   /protein_id="BAJ79760.1"
FT                   /translation="MTIIRRSDCPALNAAMTEAGYEIIAIETYHWPDGGTETEILWGRE
FT                   APPITGAELPF"
FT   CDS             complement(469848..470132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04140"
FT                   /product="Xre family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04140"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79761"
FT                   /db_xref="GOA:F0J2X2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2X2"
FT                   /protein_id="BAJ79761.1"
FT                   /translation="MDIRRIFGANLRHYRLAAGLSQEAVAERMGVDRAHVSSMERGSQN
FT                   VTLITLWHLADALKIQPADLLDTTPKPPVETSRPARRRLSAPVRRRRNT"
FT   CDS             470288..470575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04150"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79762"
FT                   /db_xref="InterPro:IPR018754"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2X3"
FT                   /protein_id="BAJ79762.1"
FT                   /translation="MIRPSFDAPVADEPPTSDQLTDYDRLHIIHYVILLDAERENVPWD
FT                   EVAREALQIDPKSEPARARRAYETHLARAKWMANSGWRQILRAGSPEGQV"
FT   CDS             470961..471536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04160"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79763"
FT                   /db_xref="InterPro:IPR018754"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2X4"
FT                   /protein_id="BAJ79763.1"
FT                   /translation="MLFWNADATARIVRVVVAAGPAAGRALVRFEPDVWGARHIGRLTP
FT                   DGYHLIVAPDVGTRHHLLLPGPEPPAPGAMLTPCIPWDEWHPERLEAARAFWHFAARPR
FT                   VSPAPRTPPPRPHPRGLKIAYMAWALDLAGAGASERDIHRAVIGDPPVLWEDSGARSRI
FT                   RTLLATARRWRAGAALQLLLPRRHALAG"
FT   CDS             471666..471971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04170"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79764"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2X5"
FT                   /protein_id="BAJ79764.1"
FT                   /translation="MAGRPTPRITAMQPEPLPNLPPRYLRTPEAAKFLGLSGRTLEKHR
FT                   TFGTGPAYRKIGGRVVYRLEDLQHWAEAGARTSTSDPGLGAATTRRPGRPAVFARR"
FT   CDS             471968..472816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04180"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79765"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2X6"
FT                   /protein_id="BAJ79765.1"
FT                   /translation="MMAEPPLPAILEHARPRAPVDLMNWPWFSLAKTPRAAPIDYQGRR
FT                   HSVLVTPAPGASAIATIWDADILFWATSQLIQAQDEKLRIAPTLIAPARRILRFLGRDT
FT                   GHSQYERLAAALERLAASEVVTTIGTLSDRPVRFHWIEAWQQTADGILLTLPEWLLDAV
FT                   RRRRVLAIDPDYFTLSGGIQRWLWLLARKHAGQQSTGWRISFEALHARSGSATRHCHFV
FT                   AALRRIAQSGRLLTYRVEPVQHCGNEGLSIGRWAVPAHSAALVPGDKPGFDPQLRERIC
FT                   E"
FT   CDS             473192..473668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04190"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79766"
FT                   /db_xref="InterPro:IPR021263"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2X7"
FT                   /protein_id="BAJ79766.1"
FT                   /translation="MIAQEPLTSVRLVFYRDRVEHCLRFGRDADARILDRRRRLIFFAP
FT                   GAVFAFVRWQANDFGTVLSRIDILRACGAGEPCATVAGVHPGGEILLRLSDWARVQRLL
FT                   ALIDAVEQAGVEATDVAPAYWQHVHNRLLCGEQPRPYARDQHRAWLLRRRVMAS"
FT   CDS             473665..474204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traF"
FT                   /locus_tag="ACMV_04200"
FT                   /product="putative conjugal transfer protein TraF"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04200"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79767"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2X8"
FT                   /protein_id="BAJ79767.1"
FT                   /translation="MKRNRRTRHAVLLAMLAALVLLAASAVQARPLVVWNATASTPVGL
FT                   WRVLPGASRKHLRVGDYVLFWPDRRSARFFARRGYLPRGVPLLKRVAAIAGQAVCERDG
FT                   AVSINGRTVARALPVDGRGRSLAAWSGCGKLPNGEIFVLIPSVPASLDGRYFGPTPIRA
FT                   VIGRVTPLWFPGGRAR"
FT   CDS             474501..475256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04210"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79768"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2X9"
FT                   /protein_id="BAJ79768.1"
FT                   /translation="MCGSAAPLLRGHGHEAVAVWRPDIAAAAHRFDIPEAWIAAVMRAE
FT                   SGGQATMDGEPIRSPAGAMGLMQVMPHTYAALRARYGLGANPYAPRDNILAGAAYLREM
FT                   LERYGVPWFLAAYNAGPARLDAFLHTGRALPAETQRYLAALAPQIGGTSGALQTAVGRM
FT                   GSSTKSAPEAALLGPNDAVSAGLFATVVVHPEASPARTVPPIVSPRLAPMAAPTEVTGG
FT                   SAAAGLEPRSASGSALNVRGNGALFVVLQ"
FT   CDS             475721..477769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04220"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79769"
FT                   /db_xref="InterPro:IPR021795"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Y0"
FT                   /protein_id="BAJ79769.1"
FT                   /translation="MARPDDDPRLRPRLGRTRSRDHRRVLAATQIKRAISRAGALAQPS
FT                   VATPPVGARSLADLPAKHGRGAAFARGRAASPRGWSQARPGARRVVVKARYVKMRAGSR
FT                   AAAVHLRYLQRDGVTREGSPGQLYSATVDRADGRAFLDRSEGDPRQFRLIVAAEDGAEM
FT                   SDLRAFTRDLMRQVERDLGTGLDWVAVDHFNTAHPHTHIVIRGVDEAGENLVVAGAYLA
FT                   HGIRERASELVTIELGPESTMERQAKLVREIDQERLTRIDRALLREAGNAAGGVIDLRT
FT                   AVGEPRSDVDRRQLRIGRLHALERLGLAEEIATGRWRLVPGMEETLRALGERGDIIKTM
FT                   HHALTRHGAERGAEQFAIHDLREPLAAPITGRLLGRGLGGDELGDRVHLIVDGLDGRVH
FT                   YVELPAAGADAANPPIGAIVALGAERGAPGAADRNIADLAHRTAGIYRPADHLATARAD
FT                   PGIADPEAYVEAHVRRLEALRRAGAVQRLDADHWRIPADLEQRAARHDTGRSQMPSLRV
FT                   LSALDLETQIRSDGGTWLDRQLLARDPVQVAQGGFGLEVEVALERRRQHHLSHGDARRD
FT                   ADGGVRYRRDLLATLERRELARAGGELATSRAVPFRMAASGDTIRGTYCEAIQLASGRY
FT                   ALVENGQEFTLVPWRPVIERSLGREVVGLVTGGGISWQLGRDRGLGI"
FT   CDS             478263..483557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04230"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79770"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR024975"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Y1"
FT                   /protein_id="BAJ79770.1"
FT                   /translation="MADYEEGTEASWPGEEQLDENRQDLAALAASQLSHALDARRRGLK
FT                   VYESLKSLNDVIGTQYGDRVLFELIQNAHDAHPPGEPGEIAVRLTIEADDRGELLVANR
FT                   GRPFTTSNLNALRNIGTSDKQIGEGIGNKGLGFRSVEALTDDVRVYSAAVAGPAERFEG
FT                   YCFRFARLDEIAAGLAGLGASSDMAESVAGNIPRYLIPVAVPDQSEGIMELARGGYATV
FT                   IALPLRSAHTVALARAQVEAVIDAGAPVLLFLDRIGSLEVSVRTVSTIIVERRLTREVE
FT                   PIAADTLPSDTSLTRVTLGAGEVYLVARRILPKPELLRAVRDSIAAAPPLKRWLDWRGD
FT                   AVVSVAVPLAGVEAGLGRLFNFLPMDERSVSPIVGHIDAPFFSDIDRRSIKPELALNKY
FT                   LLDAAALTAAAAALAIVDGGLNLPPTVVVDLAAWSAQHLQRISGAFAALKRPLAKAAIW
FT                   PIVSGGPASRAAFDTLYAWPDVRTRQLTPERLAEVAGAAIVPSALGDARLARISALAAA
FT                   VSLSLQPGEDKLAGWTEAVALALAAERRRSTARWDSFFDDVVALFAAAGARLSALEGRK
FT                   ILISGDGKPLAATAKGTDNAPPVFVRVRTGRRRRGDGPPSPPSSLARKFRFLHERIKLG
FT                   DATLRAFEKGGLLRRYDPLEILGGIRGALGTTPTSLQRGEALLWSFKVWRSGGGKPVDD
FT                   ALRGAELFVPTLGGWHAAPDAIASAAWTPLGRMLEQYLHDAAAASPDCARQRERLLVSF
FT                   ADWPKSSSEDRKEEWLRFLVLLGLVDGLRPVAGEMQTAGTPSGLWRPLLLSGKPALGLD
FT                   ERWVARVHDISFSNPYTNYNLKGALWRLPGQLEHADLPQSAREALSDLIVAYLREYEDT
FT                   HFSFTVEHDKGWNRVVLPTPIAVFLDEAAWVASVRRDEIVFAPPRASWSTTAPRQIPPR
FT                   FTTRFAAEPGSRGGLPPILFDPRIGLRDWSRAATAPERLASLAAALDDLSAAERRDLRD
FT                   QLRRAWSDVAEGRLALPKSLPLVIERMGGLDVLPSDPISKPTVHVTSERQGFAARALAD
FT                   RGEAVLDIGETDADAVRELVEATGGFTARLADAGDVRLIVDGSEFAVNSHDPLLVSGDR
FT                   TWLADAAVFAHEYLGDPLELRTLPPEELERRLRLVRVHHCASFALVINGHEVVARGDDR
FT                   VQPVAHAKTPTLVVGGGPIDLELLIDAAPALTKLVGARRNTLEQMLGRLMREGFTGTTS
FT                   GPTEEQYARAIRRDISVVRDHFAATRGGIERLTRALLPVVAHLRGEKTAATLAERHERL
FT                   GPDLNLREWLAKTLGPDLASQCLEAAANTDDQGVIRREMGFDFAEYGRTLAALGYPPLN
FT                   DEAEFRRLFGAYFAELRPRLVDRARRRFFDTWHAGGDLSDYVVLRKLDFVAFDPAWPAT
FT                   IESLDREVVEQAAMVAADAVLGPDDLSRVLPELEPTAAANRKLIAARYAGLTNLVRAWC
FT                   RKAAVEPPMVMTGGEPQQLIRVFDDAGLLDFEVIKPESLPTFCARVGVWPAGMPRSEVP
FT                   TELGLEQQDLDHEAREARDAKRRAEVDRRTILFGGSKLDTGDATFSHLFESLADTALKA
FT                   DDGWFARSRPPRLLPQEQREPGGGGGGKGGGNSQAWQNQPPEAIRKAMGIASEWLAREY
FT                   LRRRHPAEMSDNCWVSSNRAAFCSGDHGDDSLGYDFRIETARNEWLYEVKSALDEGGEF
FT                   EMTARELEVAGSASLEHKRRYRILYVPYVFDPARWRVLPLSNPAALSTRGRFRLVRSGS
FT                   VRYRFQAR"
FT   CDS             483568..483939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04240"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79771"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Y2"
FT                   /protein_id="BAJ79771.1"
FT                   /translation="MLQASTTGANAAARSAPPALLRVPYLTHIVGKRRAARGLGAIKRQ
FT                   LGRKDFRADARPLRRGLLDNGYAELPVTSAHAVALDLLPSLHKDPFDRMLIAQALVEGI
FT                   MLLTADANLARYPGPIQAI"
FT   CDS             484079..486088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /locus_tag="ACMV_04250"
FT                   /product="conjugal transfer protein TraG"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04250"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79772"
FT                   /db_xref="GOA:F0J2Y3"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Y3"
FT                   /protein_id="BAJ79772.1"
FT                   /translation="MTGTKILWGQMLGALAMVLFGCWAATEWTAWRLGFQPALGLPWVR
FT                   IGAAPVYQPQLFFAWWYHFDAYAPGVFARGAAIASAGGLGAALLAIVASVLRARQARHV
FT                   TTYGSAHWAAHHDIAAAGLFGDAGVQLGRLGAQTLRHDGPEHVLCFAPTRSGKGVGLVV
FT                   PTLLSWTGSVIVHDIKGENWTLTSGWRAQFSHCLLFDPTNPRSAAYNPLLEVRRGEWEV
FT                   RDVQNIADVLVDPEGALERRNHWEKTSHSLLVGAILHVLYAEPDKTLAGVAAFLSDPAR
FT                   PIERTLRAMMTTPHLGARGVHPVVAQSARELLNKSENERSGVLSTAMSFLGLYRDPVVA
FT                   KVTSHSDWRIADLVGAERPVSLYLVVPPSDISRTKPLIRLVLNQIGRRLTETLDVPARR
FT                   ATGHAPSRLLMMLDEFPALGRLDFFESALAFMAGYGIRAFLIAQSLNQIQKAYGEHDAI
FT                   LDNCHVRVCFATNDERTAKRISDALGTATELRAMKNYAGHRLAPWLSHLMVSRQETARP
FT                   LLTPGEVMQLPPTDEIVMVAGLPPIRAKKLRYYEESAFRDRVLLTPTLSERGYPDIPQA
FT                   RGDDWTGAGPIGAQAADSAEAVLPDPANGGIRQEPELPEHEAIVPAREPAGEFAILEDE
FT                   PDDEPQRQRAMAALQRQTVRNAAIDRGDGMAMGM"
FT   CDS             486092..486607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /locus_tag="ACMV_04260"
FT                   /product="conjugal transfer protein TraG"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04260"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79773"
FT                   /db_xref="GOA:F0J2Y4"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Y4"
FT                   /protein_id="BAJ79773.1"
FT                   /translation="MKSRLNCYFDPKLADQLTAFALRQGVHRSQLVEAAVTSFLSPDAL
FT                   DRREAAFVRRLDRLSRQMERIERDLTIAIEVQALFVRFWLSASPPIPAAQQDAAKAQGA
FT                   SRYQGFIETLGRRLQRGDSLVREISREISPEHHSRAGTSTGSGDKTDEDVASADADMAG
FT                   KEGVHAGL"
FT   CDS             486594..487601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbB"
FT                   /locus_tag="ACMV_04270"
FT                   /product="conjugal transfer protein TrbB"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04270"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79774"
FT                   /db_xref="GOA:F0J2Y5"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014149"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Y5"
FT                   /protein_id="BAJ79774.1"
FT                   /translation="MPVSDGTSMMLARSVRMLRTALGPAIATLLGQPDIVEVMLNPDGR
FT                   LWVDRLGAGLADTGLRMLPADGERIIRLVAHHVGVEAHAHNPRISAELPETGERFEGLL
FT                   PPVVTGPTFAIRKPAIAVFSLHDYVETGIMRADQAGLLRTAIAERWNILVAGGTSTGKT
FT                   TLTNALLKEVAATGDRVVVIEDTRELQVEAPNLVSLRTKDGVCSLADLVRSSLRLRPDR
FT                   IPIGEVRGAEALDLLKAWGTGHPGGIGTIHAGSALGALRRLEQLIQEAVVNVPRPLIAE
FT                   TIDLIAVLHGRGRHRRLAGLWQVGKVLAAGDYVLTEIGAERPSNIVPLQPGSHP"
FT   CDS             487598..487930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbC"
FT                   /locus_tag="ACMV_04280"
FT                   /product="conjugal transfer protein TrbC"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04280"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79775"
FT                   /db_xref="GOA:F0J2Y6"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Y6"
FT                   /protein_id="BAJ79775.1"
FT                   /translation="MSPNTIIHARRPHTAALIALVLLWPVSALAAGSNMPWEQPLQQIL
FT                   DSVQGPVAKIIAVLIIIGTGLGLAFGETSGGMRRLIQIVFGLSIAFAAASFFLTFFNFS
FT                   GGALVG"
FT   CDS             487927..488199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04290"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79776"
FT                   /db_xref="GOA:F0J2Y7"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="InterPro:IPR016704"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Y7"
FT                   /protein_id="BAJ79776.1"
FT                   /translation="MNGPADLPGWSVPLHRSLTEPILLGGVPRGMAIALGTLSAAIGLG
FT                   LQLWIAGIAIYLIGHAAALFLTRQDPQFGPVFARHLRAARRHLDV"
FT   CDS             488217..490838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbE"
FT                   /locus_tag="ACMV_04300"
FT                   /product="conjugal transfer protein TrbE"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04300"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79777"
FT                   /db_xref="GOA:F0J2Y8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Y8"
FT                   /protein_id="BAJ79777.1"
FT                   /translation="MLDLREYRTRRRELADFLPWAGLVGPGIVLNKDGALQRTARFRGP
FT                   DLDASTPAELIAVAARVNNALKRLGEGWAIFVEAARSAAPGYPESRFPDPVSWLIDEER
FT                   RHAFQEEGVHFESGYFLTFCFLAPPERAEQASRLLYDRGDVQHRRAQGAGESGGVDWRA
FT                   TLDAFAAETDRVLDLLAALMPDCTWLDDAGTLAYLHFTISTNGPHPVGVPEVPFYLDGL
FT                   LPDCDLTPGVAPMLGRYYLRTLTLRGLPDRTWPGLLDELNRLPIEYRWVARWLPLEKAE
FT                   AQKELGKKRRHWWAKRKGIAALLREVIWQQETRLVDSDAENQSVDADAALQELGSDAVS
FT                   FGYFTATVTVWDTDEAAAIEKVRLVGRAVRAQGFVAVEETLNAVEAWLGSLPGQCYANI
FT                   RQPLVSSLNLVHMLPLSAVWAGPERNAHLDGPPLLVAHTAGSTPFRLVPHQGDVGHTLI
FT                   VGPTGAGKSVLLALIALQFRRYPGARVVIFDKGRSSKAAVVGMGGAFHDLGLGGEVSYQ
FT                   HQQAVAFQPLARIDDAAERAWAADWIATLLVQESIELTPEVRGAIWSALGSLATAPVPE
FT                   RTLSGFTALLQVNRLKAALEPYTIAGPFDRLLDAEQESVADADVLAFETEDLLGSKHAA
FT                   RAVLTYLFHRIEAGLDGRPTLIAVDEAWFALDDPVFAPKLREWLKTLRRKNASVLFSTQ
FT                   SLADITRSPVAPAVIESCLSRIFLPNARAIEPESHDAYARLGLNDRQIETIARAVPKRD
FT                   YWVQSAAGCRLFELGLGEIALAFCGASRAEDLAAIDRVLGRHGLAAFPAAWLRERGLDW
FT                   AAALIAPGIATATNLPDASAAIGEAASLADIGPDPAQPMLPFGDGAAWSAEPAYPVTET
FT                   IP"
FT   CDS             490835..491617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbJ"
FT                   /locus_tag="ACMV_04310"
FT                   /product="P-type conjugative transfer protein TrbJ"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04310"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79778"
FT                   /db_xref="InterPro:IPR014147"
FT                   /db_xref="InterPro:IPR023220"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Y9"
FT                   /protein_id="BAJ79778.1"
FT                   /translation="MIHAWLKRTGTRVVGNALIGALLAISPVLPASATVPVIDIANLSQ
FT                   NVLTAARTLAEVNNQITQIQQGISMLENQARNLTTLPFSALAELQSSMGQIDRLMGQAQ
FT                   GLAYTVQQVQAQFQQLYPNYQSANFQGNVTQAGLLADANARWQASVSTFQHTMEVQSQI
FT                   VASIPSDQADLSALVGQSQGAVGALQAIQASNQLLALQARQLSATQDLIAADARAQAAN
FT                   AMQNAEARSAAEADWKRFYGNGVSYTPTPVNVFGGPAP"
FT   CDS             491614..491937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04320"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79779"
FT                   /db_xref="InterPro:IPR027587"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Z0"
FT                   /protein_id="BAJ79779.1"
FT                   /translation="MNAKALVIIGIFSIATPAWAAAPTIDQLVANPTLLNAEMDRCKHL
FT                   GMAANDDARCQTAWRAEDKRFFGNGVTYTPEPVNIFRNTPNKLVPAEKQRPIPPAPAGA
FT                   PHG"
FT   CDS             491930..493228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbL"
FT                   /locus_tag="ACMV_04330"
FT                   /product="P-type conjugative transfer protein TrbL"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04330"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79780"
FT                   /db_xref="GOA:F0J2Z1"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="InterPro:IPR014150"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Z1"
FT                   /protein_id="BAJ79780.1"
FT                   /translation="MGSNTSVIDHFLNVFSNYINSGFGLISPDVGFLVAVLIGIDATLA
FT                   GLAWALGEDDAIQTLAKKVLYVGFFAFILNNWPLLTQLVFNSFAALGLKATGSSLSYAN
FT                   FLQPGRLAQAGVQGADVLLSQIQRLAGFPDFFWNLGQILVMGLSWIVTLLGFFVLAILL
FT                   FLAIIEFKLTTLKGFILVPFALWRGTAFIAEPVLGQIVTSGVRILVFAVITGIGTQLFG
FT                   QILPSNPATELSLQDALTILLASMTIAGLAFSANRLAAGITSGAPQLGLGSAAAAGGAV
FT                   AGAAALAGMGGVAAARALAGGVGAAASLAGGASGAYTLGSATGGGSVSAGLAGVARGAA
FT                   GAATSGLRGTAQTASTALRDRFATGQRAAWSATGGSGGDAAVTSPSAAAPSGAPAWAQR
FT                   LRRQAVSRAAQNILHEAEGHGGGMRPNLRGDGT"
FT   CDS             493225..493935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbF"
FT                   /locus_tag="ACMV_04340"
FT                   /product="conjugal transfer protein TrbF"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04340"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79781"
FT                   /db_xref="GOA:F0J2Z2"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR035658"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Z2"
FT                   /protein_id="BAJ79781.1"
FT                   /translation="MRWRRFSSRLGDTEAPATPYQRAGQLWDQRIGSARVQAANWRLMA
FT                   FGCLALAAVVTADDIRTHSRAMVTPFIVEVDHLGAVQAIAPARVEVQPTDTEIAYFLAQ
FT                   FIERVRGLSVDPVVVRQAWLDAYAQITSRAKPMLDAYARQADPFGQIGKRAVTVDVTSV
FT                   VRASPNSFRVAWVEHPFQDGTALQPEHWTAILTVVIQTPHTEAALRQNPLGIYIDAISW
FT                   AREVNTTQTEGSTP"
FT   CDS             493932..494912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbG"
FT                   /locus_tag="ACMV_04350"
FT                   /product="P-type conjugative transfer protein TrbG"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04350"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79782"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014142"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Z3"
FT                   /protein_id="BAJ79782.1"
FT                   /translation="MRFSFALACGGALALSACAQPVPKIAYDNPQPAHLVPSPPAPVQV
FT                   VTWPEPLPLPGQLKKVPRASASRVPAQPANPIVRVAQANAAARINPTRDGYINAMQVFP
FT                   WSDGALYEIYASPLHVTDIALQPGEHLISIAAGDTVQWKIGNTTSGAGADQQVHVLIKP
FT                   ISADLPMNNIVIMTDRRAYHLEVHPTKDTYMAAVSWNYPQDDLLALRTQNAAATDYANT
FT                   VAANDVNIAALHFRYRLSGDDPPWRPVQVFDDGSKVYVQFPPGIAQGDMPPLFILGAPG
FT                   GKAEIVNYRVRGHTMIVDRLFAAAELRLGAGPQQVVRITRTDGHN"
FT   CDS             494912..496171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbI"
FT                   /locus_tag="ACMV_04360"
FT                   /product="conjugal transfer protein TrbI"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04360"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79783"
FT                   /db_xref="GOA:F0J2Z4"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Z4"
FT                   /protein_id="BAJ79783.1"
FT                   /translation="MADPDDAEPGQRPAPKAAPADFALRARPRAVTRLSRRVLIVAAGG
FT                   VAVCVVGAVWWAFALHSFRITTGKELYNTDVRPSPDVIGGLQNGYASLTKPKPLPAPPR
FT                   AVPRLGPPLPGDLGRPMLGQGAPTAFAAPPNGADQAAARLRAQAADAGVFFTVAANTGG
FT                   TNGAAGTASGALPAGEPAPGPASGNGALAGPHGDQNQQDAKQAFLNSPVDRAIYSPDRL
FT                   QAPLSPYELMAGTVIPAALITGLNSDLPGQVIAQVTQDVYDSVSGRTLLVPQGAKLIGK
FT                   YDSVVAYGQSRVLLIWTRLIMPDGSSVVLDNLPGADTQGYAGLEDGVDYHFWRLLRGVA
FT                   LSSLLGVSSALATNNVVGGTGTGNVIIALGQSADQAANQAGQSIVSRDLGVQPTLTVRP
FT                   GFPLDVMVNRDIVLRPYGRG"
FT   CDS             496183..496500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04370"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79784"
FT                   /db_xref="InterPro:IPR018733"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Z5"
FT                   /protein_id="BAJ79784.1"
FT                   /translation="MAKLRIGPLPDDRPVKRTITFTAALDALIRDYAAAIAAQDGLSEA
FT                   PTIEKLVPIIVERFITTDRAFRAPVRRVPAAVPHKPPPNSEPSQSNRERHGDQSTIAGS
FT                   E"
FT   CDS             496572..496886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04380"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79785"
FT                   /db_xref="GOA:F0J2Z6"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Z6"
FT                   /protein_id="BAJ79785.1"
FT                   /translation="MAKGTTMTGATKRKDHPLSMRLPEGDLAIIDRAADLRGRSRTDFV
FT                   REAAVRAAEEVLMESTLLRMTPEGFEAFVQAISAPATPVPEMVASLRRKAPWEKGAAKH
FT                   "
FT   CDS             496886..497407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04390"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79786"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Z7"
FT                   /protein_id="BAJ79786.1"
FT                   /translation="MAEPPLSAPELLKPGHDVTHFSCGKPSLDHWLKTRALANQQKGFT
FT                   VVMVVHVAGRVVGYYGLAPTAIVPAALPRSIRTGQPPNPVPCILLGQLATDQAWIGRGI
FT                   GTGLFNHALARSVSGAALIGGRALVVNAVDDEAAVFWRRRGFLPSRDDALVLFRSIADI
FT                   SASLIAVETR"
FT   CDS             complement(497516..499558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04400"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79787"
FT                   /db_xref="GOA:F0J2Z8"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR013473"
FT                   /db_xref="InterPro:IPR014061"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Z8"
FT                   /protein_id="BAJ79787.1"
FT                   /translation="MSNGTLPARDALDNKANQLFAGKVVRKDLVRKVKVGANVPVFVLE
FT                   FLLGKYCASSDEVAIQMGLQVVNDTLANNYIRPDESAKAQSKVKESGKYSFIDKVKVRL
FT                   VDSDYWAEGVNFNNKFLHIPSQYVRDYERLLMGGVWAQVDMRFETDEESKGKNPFWIDK
FT                   LVPIQIATFDLDEYRNVRKQFTTDEWLDLIVRSMGYEPGEMSRRLKLLFLVRLIPLTER
FT                   NYNLVELGPRGTGKSYVVQEVSPYTALLTGGTTVANLFGHMSGRQKGMVQIWDVVGFDE
FT                   VADLQKMPKEVITTMKTYCESGTFQRGQEAVAGDASIAMFGNTNQPIDVMVQTGHLFAP
FT                   MPDTIRDDMAFIDRLHFYLPGWEIPQMRNELFTDHYGFVVDYLAEALRDMRKHNFTEII
FT                   DRFFSMGAHLNARDRKAVRKTASGLVKILFPHGDVTQEELAEILELALEGRRRVKEQLK
FT                   KMGSFEYYQTSFSYTLQDTGEERFVGVPEQGGRDLISADPLSPGSVYTAGVTSDGTVGL
FT                   YRLEVSVSSGTAKLRLAGGISGAMKESVQRAFSYVQAKKVELGITRDLETSDLHVEVID
FT                   LLGNRVEAEIGVAFFVAAYSALRKVPVSPALLVLGDMSVQGNIKPLRSLTEPLQVAKDN
FT                   GAKRSLIPIENKRNFLDVSADIMEHVDPIFYGDPKTAAMKVLGNV"
FT   CDS             complement(499561..502113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04410"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79788"
FT                   /db_xref="GOA:F0J2Z9"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013973"
FT                   /db_xref="UniProtKB/TrEMBL:F0J2Z9"
FT                   /protein_id="BAJ79788.1"
FT                   /translation="MHPLNEYISKQLAEKLKARKVVVWYDPRREFAPFIGELRGGARTS
FT                   DEAVPVAVGGLAARLAEFDGSMFELRAVVEPFVCDDAPSEWVIIYLPGCERDRHGSVLM
FT                   ELEKAGECYEPQLKRLARNVLRQRYTDGVIDEMLAPERVSYEDLARASSDTSSTEPPSV
FT                   LKSIFHGASGNDGIIAPWLASDGRDAEIESKEATRELVKLIRSKLGLELPDDAPLSRLR
FT                   SITLRYVLAGEFRGDLSGALPLALDSIPAPRTRDEEGAVRELAHLLRTKFSEAYPGMAD
FT                   RVEAELGLNAAAISAGTLGSIDTFRFEERALLAHCGDLVAQKKFDQALELITGREQSFW
FT                   LDRDVGRKAQWEACRRMAELGALGVAVRAAVGKASVDANGWIDAYVAKDGWFRLDQAQR
FT                   RLEAWVANLDDEPEERPLGIVRGVYEDACRAMADGFTRALVAANWAVSSCLHQTRIFSE
FT                   VVSEQPKPVAYFFVDAMRFEMGVELSERLPKSVEVSVRAAVCALPSITPIGMAALQPGA
FT                   SSSFSVVEQGGALGARIDDAFLPDLTARKKFAASRIPKVADIALDELLSLQPSRLAKKV
FT                   EGSQVIIVRSQEIDHAGERGFTFQARQVMDTVIDNLARAIRKLAAAGVEHCVLTADHGH
FT                   LFFPSDRDESMRIESPGGDEVDLHRRCWIGRGGTTPSGCVRVTASALGYDSDLDFVFPL
FT                   GSGVFKAGGDLAFHHGGPSLQEMVIPVVTVRMKTSAPGRSSSGPVAAIGLPEAVTNRIF
FT                   SVVIQLDGKNLSLFSTELVVRPLLMSAGKQVGGVGMAIDGEFDRSTGCVKLEAGKQVTV
FT                   AFLLSDESVPSLRVVIQDPTTDAELYRSPTDIPVRLGV"
FT   CDS             complement(502113..503186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04420"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79789"
FT                   /db_xref="GOA:F0J300"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:F0J300"
FT                   /protein_id="BAJ79789.1"
FT                   /translation="MTISEDTIKNAVLRYHREYDRYLKLSARVAEICRFEIVEGNAIRA
FT                   QVTFRAKSPKSLEGKLRRFAASGKRDLPTVQSVFDAVRDLAAVRIATYEQRHEDQVVQL
FT                   VCNRFVDLKGAKPQSERKDKNAADNNNFYRATHIEAFLPEADVIGTYANVSDVPCEIQV
FT                   CSMMAHVWNEIEHDLGYKPLTGSLSEQERSLLVSLGFAVRQGDITIGNLFAETERRQRE
FT                   HGGVFTDVYDFVARVRGWFPDIDFGRNAGPLYEALQPVRLVSPESIRKLIAASEPMTAT
FT                   AQSALDEFSAKLAAKGDARFALDRNSSDLLLVLLLPKVAAYIVSSSGEAVSDGVARLRW
FT                   FAARFQELSKVESGGLS"
FT   CDS             complement(503183..505198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04430"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79790"
FT                   /db_xref="UniProtKB/TrEMBL:F0J301"
FT                   /protein_id="BAJ79790.1"
FT                   /translation="MTLFIRAVAAEDKAAAIKRAISGDSADRFAPDLDQFKQLPGTPFA
FT                   YWVGAGVRAAFQRFQTVEGNGRAVRQGLATADDFRFVRTHWEIDPRDRGKKWFPFAKGG
FT                   RLSPFYAGIHLVVNWADGGAEIKNNLNEKGNVRSNVWMLRDTAANYFFKGGLTWPLRAS
FT                   KFAPQPLPAGCIFSVRGYSVFLEEMLLLPSLAIFNSKPFDYIFKALLGRFGYPEFIVGV
FT                   LQKLPWAEPSVEQANDLAALARSAWSLARTADTAVETSLAFTLPAPLNAADSVAAVTSK
FT                   LAGLQSKIDAISFELFNLDESDRTEIEGAAVFASAEINEDNDESEDDNSEVAAAENAQF
FT                   YVLSWSVGVAFGRFDIRLATGERSIPPEPEPFDALPDRSPGILPSGAAPFMPCSGIFVD
FT                   DPGHADDLISRIIAVYERVGQPWPEPAALRRSFAREFFPGHIKMYTKSRRKAPIYWQLA
FT                   TPTGSYSVWLYLHTLNKDTLFRAQTDYIAPKLAHEQRQLDQLRADSGPNPSASQRKAIE
FT                   AQEAFIGELQALLGEVKRVAPLWNPTLDDGVVIIMAPLWRLVPQNKPWQKELKAKWDEL
FT                   AAGKYDWAHVAMHLWPERVVPKCATDRSLAIAHGLEEVFWKEGDNGDWVSQSSPMRSIE
FT                   ELVHERTSAAVKAALKELSEASAPNGAKTRARRSSS"
FT   CDS             complement(505195..507117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04440"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79791"
FT                   /db_xref="GOA:F0J302"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F0J302"
FT                   /protein_id="BAJ79791.1"
FT                   /translation="MDKATRNAIERATQQARKLLDEDFSSQLEGTFDVLRSGVIAPAGG
FT                   AHLTARQKFQRDKIVATIEHKRAAGATAVEAVTDYVRDSAFTTLNRFVALKMLEARQLV
FT                   QECISKGDQSSGFKEFCGMAPGVALLPDAAGYRLYVESLFDEFSTEIKVLFDRRDAASV
FT                   LWPKRQTFEALLALLNAPDLSGVWDEDETIGWVYQFFNSGEERKKMRDESQAPRNSREL
FT                   AVRNQFFTPRYVVQFLVDNTLGRLWLEMHGVQSRLTDLCEYLVRSADDTVQVRPKKDPR
FT                   DLRILDPACGSGHFLLYSFDLLLAIYEEAWSTEGPAPASDATGRSLRNDYADLADLRRS
FT                   APKLIVEHNLHGVDIDPRCAQIAALALWLRAQRAWRDFGVPASDRPRIQRTHIVVAESM
FT                   PGDAALVDEFAARLDPPLLRDLFKKMVGESRLAGELGTLLRVEAAIAAELRRAREQFVK
FT                   QRQTTGFLPGMEPVVKQGSLDLSGIDDDRFFHEAEIRIVEALRAFAESATGRASVRRRL
FT                   FADDAAQGVALIDLTRTRFDVVLMNPPFGACSVAAKTEFDKSYPRTKNDVYAAFVERGI
FT                   ELLHPRGRLGAITSRTGFFLSSFQKWREEVLLPKAPPRIVADLGIGILDGAMVETAAYC
FT                   LEAVA"
FT   CDS             complement(507130..510672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04450"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79792"
FT                   /db_xref="UniProtKB/TrEMBL:F0J303"
FT                   /protein_id="BAJ79792.1"
FT                   /translation="MANEPIKSLFANDIHRRIEEVIKVDQTSDDILRDEINEYVVTDAI
FT                   RSHYTSIFDAYSETPNKPHEGIAIWVSGFFGSGKSSFAKMLGLSIENRPVAGIPAGDRF
FT                   GQRTGDNKLQVLLKAINEKIPTHAVIFDVSTDRGIRSGNQSLTEIMYGLFLQSLGYAKD
FT                   LDLSELEIALEEKGQLEGFEAEYERLFKKEWSVEKGKVAFALSEASRVLHSFDPETYPM
FT                   ADSWVKAVKNKADISPGKLAERANELMKRRRPGQALMFVVDEVGQFVARDVQKMLDLQA
FT                   VVQSLGVKGRGKHWIVVTSQEKLGELVSGLDDKKIELARLMDRFPLQVHLEPSDISEVT
FT                   SRRVLSKNAPAQKALGELFDQHRGRFTEHTRLTADIKLPELTRDSFIDLYPLLPYQIDL
FT                   IIQVVSGLRTQGGASKHVGGANRTIIKLAQQLLINPAVNLADQPIGSVARLDQVYDLVE
FT                   GNIGSEVRAKISAISKELDHPLAQPVAKVICLLQYVKSVHRTAENISAALHPGVGGDSQ
FT                   LAAVKDALRQLEAANKVRLGDDGYRIPTPAEDDWERIRNGINPKPGDAHRIYSEVLAGF
FT                   WQPQPTHTLFDTKTFKAGLAIHGREIVDGDMMFHVHLAEDGAAFQALAAELRARSQQER
FT                   KSVFWAVALNDAIDRETVELFRSKEMLARKEREAKTADETALIGEEKIRQRRHQDELRR
FT                   LVRAACLAGSVSFRGNDRSPGDRAVDMGKSAAEILSDVLPEVFDRFREAAAKPADVKKG
FT                   LDALFTAENLQGLPSVFGSLGLLRDEKGKTVFRVESGALAEVLSRIEERANYGDTASGR
FT                   YLADELAKEPFGWDFEVVRLLVLSLLRAGKIQATSKGQTIDSATGIEARDTFSNNNFFR
FT                   QASFRPKKGIEFEELVKASEAFRDTFGSEVKELNAGAIVSELRKEIARHEDPVSSAHAQ
FT                   LIAYRLPGAAVLDGAIGQMKAVLRGSEDNAIATFNASHRAIKDAIKRATELEQALSEPK
FT                   LRDLDRAREALRSAWPFLSGEADVADDLRADATELEDLLARETFYRELPLIEQHASAID
FT                   AEYARRFDEALDARIDAYTHALERLAQTPGWDGIDQDQQEKLAAPLLRGKTRDQVRVPI
FT                   PQLRSELDACEARLQDAIAELHRIVDGDRVATVRLGGYFSGGVETEEQLDAALAGIREE
FT                   CSRLIGTGKKVIVQ"
FT   CDS             complement(510686..510925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04460"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79793"
FT                   /db_xref="InterPro:IPR014858"
FT                   /db_xref="UniProtKB/TrEMBL:F0J304"
FT                   /protein_id="BAJ79793.1"
FT                   /translation="MDLVAAQMPHDPDPLSDIVFIQRTGALFPVYRTFSLLEQLKGRVT
FT                   VPTILFYPGDLDGAAGLRFMGVLAAEHNYRPKIF"
FT   CDS             complement(511258..512043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04470"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79794"
FT                   /db_xref="InterPro:IPR014948"
FT                   /db_xref="UniProtKB/TrEMBL:F0J305"
FT                   /protein_id="BAJ79794.1"
FT                   /translation="MTPAARSHVVSSFTLIKGAMIAETYAVFAAWDFGASKKANLDRLR
FT                   SDNFIGAGSTTWLRDVAKVLNRRFDPVNRDRALVLLAKNGCPIDEWKPILLWHVTRDEF
FT                   LLRDFLINWLFPTFVSGTYRVRTEDVYEHLRSVGRRGGIIEHAWSDTTLNRVSAALLKM
FT                   AVDFGLLRGSSTKEFASYHLPERSFLYILYALREETRNPRKVLETAEWRMFLMLPSDVE
FT                   RELLRLHQYQKVDYQIAGSLVQLSLPCANACEYAKRMVA"
FT   CDS             complement(512040..512186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04480"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79795"
FT                   /db_xref="UniProtKB/TrEMBL:F0J306"
FT                   /protein_id="BAJ79795.1"
FT                   /translation="MRRSSEGRAVPLPGGFTGTNLDMELLALGFARGEPGSLAVPYARL
FT                   DNP"
FT   CDS             complement(512700..512894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04490"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79796"
FT                   /db_xref="GOA:F0J307"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J307"
FT                   /protein_id="BAJ79796.1"
FT                   /translation="MPDEILTLPEVAQLLKVAEKTVYTMAQKSQLPAFKVGGQWRFQRV
FT                   DIDRWIEQQKASSRDEGRT"
FT   CDS             complement(513381..514652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04500"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04500"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79797"
FT                   /db_xref="GOA:F0J308"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="UniProtKB/TrEMBL:F0J308"
FT                   /protein_id="BAJ79797.1"
FT                   /translation="MEKLTKRAVDALKPSKVGIEGSERFLWDGELKGFGVRASPGGRKS
FT                   FIVQYRTPEGKHRRTVIGHYGLMTVEQARVIAREKLVAVSKGVDPAAPVEPDGSTTTVG
FT                   QICDWYLLEANAGRILGRRRRPIRASTLTMDKSRIETHIRPLLGDRRVSSLKLGDIEAM
FT                   QADIAAGKTAKGRAGPRGGTPIGGEGVAARTVSSLHSIFEHAVRWGKIESNPARGVRKL
FT                   ASAPRERRLSSVEIARLGEAMRTLAAEGEHPTGLAAIRLLLLTGFRRMECLALQRAWVD
FT                   AEQRAIRLPETKTGPQMRVVGQAAIDLILAQPVTDGSPYVFPADWGNGHFIGVVRVLER
FT                   VCGAARLTDVTPHTLRHTFASVAGDLGFSELTIAALLGHAARGVTQRYVHIDEALRVAA
FT                   DRVSAKVVALLDGRDRDAGSSTRR"
FT   tRNA            514820..514902
FT                   /locus_tag="ACMV_t0080"
FT                   /product="tRNA-Gly"
FT   CDS             complement(515096..517579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="ACMV_04510"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="protein synonym:phenylalanine--tRNA ligase beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04510"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79798"
FT                   /db_xref="GOA:F0J309"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="UniProtKB/TrEMBL:F0J309"
FT                   /protein_id="BAJ79798.1"
FT                   /translation="MKFTLSWLKTHLDTDASLDAIAETLSAIGLEVESIADRGASLAPF
FT                   RIARVIEATQHPNADRLRVCRVDPGDGTEVSVVCGAPNARTGMRAVFAPPGSFVPGTGI
FT                   TLKVGEIRGVPSAGMLVSERELGLGDSHDGIIDLPDDAPVGTPYARWAGLDDPVIEIGV
FT                   TPNRGDAFAVRGVARDLAAAGLGTLKPWAPPPIAAAGASSIAWQNAYPEACPWVLGRTV
FT                   RGVRNGESPDWLKRRLESVGLRPINALVDITNFFTLDLGRPLHVFDVGKIAGDALTLRR
FT                   GAGESFRGLHGRDVTATADDCVIADAAGAQSLAGIVGGEATGCDETTRDVFIECALFDR
FT                   VRIALTGQRTGIHSDARQRFERGIDFALLPAALDAATAMVIELCGGAASEITEAGAKPD
FT                   WHRTATMRFERLASFGHSTITPDRAADILDRLGFAGVARDAASITVAVPSWRNDIAAAD
FT                   LPGGSALDQHGGLAAATAEAARLGARTIEPEVDLIEEVLRIDGLDRIEPVSLPGAAPVP
FT                   SASLTPRQARTVRARRVLAARGMAECVTFSFLDRATAGRFGATPATLALKNPIAADLDQ
FT                   MRPTPLATIALAAARNAARGHGDIALFEIGPAYRDVSPDGQDLVAAGLRAGRTPLSWVE
FT                   PARPADLWDAKADAIAVLGELGVPLDAVTVTADAPAHYHPGRSGTLRQGPKTRLGWFGA
FT                   LHPSLCAALDLPEGSVAFELDLGAIADPKRRRKAAPSLPQFQPLRRDFAFIADATVTAE
FT                   AVLRAAKGAERTLIANVALFDRYAGEKLPEGKVSLAVAVTLQPRETSLTDAEIEAVSAK
FT                   IVAAVAKATGATLRG"
FT   CDS             complement(517576..518649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="ACMV_04520"
FT                   /product="phenylalanyl-tRNA synthetase alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="protein synonym:phenylalanine--tRNA ligase alpha
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04520"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79799"
FT                   /db_xref="GOA:F0J310"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:F0J310"
FT                   /protein_id="BAJ79799.1"
FT                   /translation="MSDDLPTIESQARTAIAAAGDPAALDAVRIALLGKTGQVTALLKT
FT                   LGSLTPDERKRVGAEVNALKTAISAALDARRAVLEAEALAARLAAERIDVTLPGRPDRA
FT                   GTIHPISRTMEELTALFGAMGFGVKEGPDIEDDWHNFGALNIPSHHPARAMMDTFYLDA
FT                   AAGSRPVVLRTHTSPLQIRTMLAETPPIRVIVPGRTYRSDHDATHSPMFHQCEGLVIDR
FT                   GITLAHLKGCLIDFLRAFFERPDLKARFRSSYFPFTEPSMEVDIAWDRKSGEIGGGSDW
FT                   LEILGAGMIHPNVLANCGLDPREFQGFAFGMGVERITMLKHGIPDLRTFYESDVRWLAH
FT                   YGTSPLAPVTLHEGDAR"
FT   CDS             519539..520042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omp16"
FT                   /locus_tag="ACMV_04530"
FT                   /product="outer membrane lipoprotein Omp16"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04530"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79800"
FT                   /db_xref="GOA:F0J311"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="UniProtKB/TrEMBL:F0J311"
FT                   /protein_id="BAJ79800.1"
FT                   /translation="MNIKALGALAAVALLAACSNAPKTTAMATGSGATAAQSGPAPGSE
FT                   QQLVADVGDRAFFGFNKSNLTGADKATLDRQASWLAKYPNVDVLIAGNADPRGTEAYNL
FT                   ALGARRAHAARDYLVAKGVAASRIQTVSYGKSCLVSPGNTEQDYAQDRVAITSVQGFNP
FT                   QHCH"
FT   CDS             520223..521128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04540"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79801"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:F0J312"
FT                   /protein_id="BAJ79801.1"
FT                   /translation="MLKTLYAAGVAVAILLPAAARAQMITSREGIALENQILELKHQIR
FT                   TMQTGGGNGSSVLGAPAPSAPERSGQAPSSDLVASLLDRVHTLNGEVQDLRGRVDTLEH
FT                   EVATQHDEIKQEIGNLKFQLEQGGKPGFQTPANAAEGAPPAAPSSAQEPHTLGTLPREP
FT                   ARPTPETAAPARAEASLGAARAALSHHDYRAAEADAHAVIAKQGKQAGHGEASLILAQS
FT                   LFHQGRHQEAAIAFDDAYNADRAGPHAPDALLGLANSLTAIHQNQEACDTLDSLTSQFS
FT                   SPSPSLKARVEAARRRAACH"
FT   CDS             521173..522342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="ACMV_04550"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04550"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79802"
FT                   /db_xref="GOA:F0J313"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:F0J313"
FT                   /protein_id="BAJ79802.1"
FT                   /translation="MAALGPFGAAPRVAVGVSGGADSMALTLLAASWARERGGDCLGLI
FT                   ADHGLRPVSADEASLTGRRLAALGIGYRILRLQLGPGPALQARARDARHASLAAAARGA
FT                   GIVHLLLGHHAGDQDELRAMRAARGPRGLAGMAGFAARDDIVILRPLLGTDPAVLREFL
FT                   SGRGIGWVEDPSNADARFERVRVRATRRQAALVPPSLDADRRAAAERDVAEILVRDVSL
FT                   RPEGWAIVRAASLPVEALAVLFRVLGGAAYPPARAALERLAPELRPATLGGVRIMAAGR
FT                   HGPGWLLVREAAACAPPVAAVRGAVWDGRFRVRDVPPGARTIGALGDSAAEIGRRSGLP
FT                   AALRRTLPAFFGGDGVLSVPHLAGGPASAVVFAPQGPAAAAPFEPVPCG"
FT   CDS             522532..524457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="ACMV_04560"
FT                   /product="ATP-dependent protease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="protein synonym:cell division protease FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04560"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79803"
FT                   /db_xref="GOA:F0J314"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J314"
FT                   /protein_id="BAJ79803.1"
FT                   /translation="MNNLGRNLLVWVIIALFFVLLFNMFQPTTAESNHGTQVAYSTFVS
FT                   EVNAGKVDHVTIRGHDITGALKSGSTFETYAPDDPGLVNTLISKKVSVVAKPLNPPENP
FT                   LLHYLVSWAPMILLVGVWIYFMRQMQGGGGRAMGFGKSRARLLTEKQGRVTFEDVAGIE
FT                   EAKGELQEIVDFLRDPQKFQRLGGKIPKGVLLVGPPGTGKTLLARAIAGEANVPFFTIS
FT                   GSDFVEMFVGVGASRVRDMFEQGKKNAPCIIFIDEIDAVGRHRGAGLGGGNDEREQTLN
FT                   QMLVEMDGFESNEGVILIAATNRPDVLDPALLRPGRFDRQVVVPNPDVNGRERILKVHM
FT                   RKVPLAADVDPKVIARGTPGFSGADLANLVNEAALLAARMGKRVVAMAEFEYAKDKVMM
FT                   GAERRSMVMSEDEKKMTAYHEAGHALCSISQKHCDPVHKATIIPRGRALGMVMSLPEGD
FT                   RYSMSKAKLLSELVKAMGGRAAEEIIFGPDNVSNGASGDIKQATDITRRMITEWGMSDK
FT                   LGMIAYGDNGQELFLGHSVTQHKNVSEATAQEIDREIKLVIDHAYSEARRILTERLDDL
FT                   HRLAKGLLEYETLNGDEIQIVLRGEPVVRQVVDEPAPDSRRASVPTAQKPEVPKSGGLG
FT                   PLPAPG"
FT   CDS             524580..525458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04570"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04570"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79804"
FT                   /db_xref="GOA:F0J315"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="UniProtKB/TrEMBL:F0J315"
FT                   /protein_id="BAJ79804.1"
FT                   /translation="MSLKIGVIGLGRMGAAMAARLIERGHQVCGWNRTAARAEAIQGLA
FT                   AKASPAEVAMSADYVIVMLLDETASRAAYHGEGGLLSANLQQALVIDMSTLKPADMQAN
FT                   AEAVTAHGGRFVACPVGGTVGPARSGKLLGLAGGDAATIDAAKPVLDELCDRMERFDTP
FT                   QAAAAMKLAVNLPLLAAFQALGEAALITRDYGISPERLLGIIGKSSGGAPAFATRSAAI
FT                   ITEMGGTRSESVGFSLEAVEKDLRLMDEAGDAAGFNLKLVESVRRAAHDAVREGWGDRD
FT                   LAALAAFNLRA"
FT   CDS             complement(525462..526223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04580"
FT                   /product="putative enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04580"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79805"
FT                   /db_xref="GOA:F0J316"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:F0J316"
FT                   /protein_id="BAJ79805.1"
FT                   /translation="MTETPPILERHGAIARLRLNRPALRNRLGADDLAVLLGHCATLAA
FT                   DDSVRVVVFEAAGPVFSAGFDLDALSRGDTGDAEDGPGGIGRVGTALAALPQPVIARLH
FT                   GNLYGGAVDLALACDFRIGVTGMELLMPAARIGLHYYRSGLARAVERIGPDATRLLFVS
FT                   AQAIDAATLLRIGYLTQLAAADGLDAAVDALAARLEANAPLAVRGMKAAIARLAAGTLD
FT                   GESFAAGLDAAHRDPVFIEAMGALRAKKRGG"
FT   CDS             526514..528667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="ACMV_04590"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04590"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79806"
FT                   /db_xref="GOA:F0J317"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="UniProtKB/TrEMBL:F0J317"
FT                   /protein_id="BAJ79806.1"
FT                   /translation="MMFDKYFRKELDWGGRKLILETGKVARQADGAVVASYGDTVVLAT
FT                   VVGARSVKPGQDFFPLTVNYQEKFYAAGRIPGGFFKREGRPTERETLTSRLIDRPIRPL
FT                   FPHGFRNEVQVIVNVLSHDLENEPDIVSLVAASAALTLSGIPFFGPVGAARIGYIDGEY
FT                   ILNPTSAQIAESRLDLVLAGTEEGVLMVESEAHELSEETMLGAVTFGHAAFQPVIQAII
FT                   ELAEHAAKDPWPLVEESDEEKALAARVDELAREGLRAAYAEREKTARHEKIGAVKAAVL
FT                   ETLAAEERSVEKAKGMFKELEADIVRNAILDNGIRIDGRDTRTVRPILAEVGVLPRTHG
FT                   SALFTRGETQALVVATLGTAQDEQIVDAIEGEYRERFLLHYNFPPFSVGETGRVGSPGR
FT                   REVGHGKLAWRAIHPLLPGKDKFPYTLRVVSEITESNGSSSMATVCGTSLALMDAGVPL
FT                   PRPVAGIAMGLIKEDKGFAVLSDILGDEDHLGDMDFKVAGTEAGVTSLQMDIKITSITP
FT                   EIMKIALDQAKDGRLHILGEMSKALTGAREGVSANAPRITVINVPKDKIRDVIGTGGKV
FT                   IREIVEYSGCKIDIEDDGTIKIAATSDEQAQKAIDRIRSLTSEPEVGQIYTGKVVKIAD
FT                   FGAFVNFFGARDGLVHISELAQGRVARTGDVVKVGDTVKVKMIGLDDRGKVKLSMRVVD
FT                   QATGADISDQVGAKGGRREDAAE"
FT   CDS             complement(528798..529103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04600"
FT                   /product="putative major facilitator superfamily
FT                   transporter"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04600"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79807"
FT                   /db_xref="GOA:F0J318"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:F0J318"
FT                   /protein_id="BAJ79807.1"
FT                   /translation="MLAPAAAPWVWVVFIGIGQGACFPLALTLMVLRTGGPAEAMALSA
FT                   FSQMVGYAVSIAGPLGLGVIHTLSGHWWPSVAFLVILQAPTLGFGLAAARPRTIRF"
FT   CDS             complement(529103..530011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04610"
FT                   /product="putative major facilitator superfamily
FT                   transporter"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04610"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79808"
FT                   /db_xref="GOA:F0J319"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:F0J319"
FT                   /protein_id="BAJ79808.1"
FT                   /translation="MTPDTKTTTATAAADSPFRNLLLFAGILLIAVNLRAALASVSPLL
FT                   TPIGAALGLGPLGLTVLATIPVVCFAALAPVSIMLQRRIGLEAAMMTVLVLLAAGLLIR
FT                   VLGGAAALFAGTVMGGAAIAMGNVLLPGLVKRDFPTRVGLVTGCYTTVMTTIASVAAAV
FT                   SVPVADATPLAWRGALGLWAVPAIVAAAVWAPQLAHGAHRLSHTPTSGAFRKLARSPLA
FT                   WAVTMFMGLQSLGFYSILSWLPAILHAHGSTRRWPGSCSRRRPSSPFRRRWSRRASPPA
FT                   AATSGCCLRVCSPSSVSAMSG"
FT   CDS             complement(530043..530684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04620"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79809"
FT                   /db_xref="GOA:F0J320"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:F0J320"
FT                   /protein_id="BAJ79809.1"
FT                   /translation="MTASPVVDFEGLAATETSADPFPHLVMRGFVRPERLTSVVADLPP
FT                   LGARGSFPIESVRLGPNAAQLMDEMKGERMRQIIAGKFGLDLDGAPVMLTLRGRTDARD
FT                   GKIHCDSIAKRVTILLYLNPASEAWARQDGCLRLLRGPDDLEDYAVEVPPVDGTLLVFP
FT                   NGPTTWHGHRTYVGKRYTVQMNYMTTDAKARYEMRRHRVSALVKRLLPAA"
FT   CDS             530806..531180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04630"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79810"
FT                   /db_xref="GOA:F0J321"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:F0J321"
FT                   /protein_id="BAJ79810.1"
FT                   /translation="MLAGRLALALLYVQAGWSKVVHWPGIVHLLTHLDAPAPTLGAVIA
FT                   VVCELGAGGLVMLGLRTRPAAIVLILFTIAANWLAHRFWLMQGQAAAAAEIQFFLDLAI
FT                   CGGLLLLASAGPGRFSLDRR"
FT   CDS             complement(531243..531446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="ACMV_04640"
FT                   /product="30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04640"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79811"
FT                   /db_xref="GOA:F0J322"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="UniProtKB/TrEMBL:F0J322"
FT                   /protein_id="BAJ79811.1"
FT                   /translation="MQVLVRDNNVDQALKALKKKLQREGVFREMKLRRHYEKPSERRAR
FT                   EAAEAVRRARKMERKRIEREGF"
FT   CDS             531665..532219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="ACMV_04650"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04650"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79812"
FT                   /db_xref="GOA:F0J3F6"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3F6"
FT                   /protein_id="BAJ79812.1"
FT                   /translation="MALLKLARLGHPVLFAKAEPVADPAAPEIARLLHDMAETLADAGG
FT                   VGLAAPQVHVPLRLFIYRVPESRAGGGEHDGPRGLSAVINPELVLHPGEPVEDWEGCLS
FT                   IPGMSALVPRAARLTLRAMDATGAPFSREAAGFHARVIQHEADHLDGILYPQRLRDPRL
FT                   MGFNEEVARFRDEIARAAGEL"
FT   CDS             532219..532875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04660"
FT                   /product="putative ubiquinone biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04660"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79813"
FT                   /db_xref="GOA:F0J3F7"
FT                   /db_xref="InterPro:IPR012762"
FT                   /db_xref="InterPro:IPR013718"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3F7"
FT                   /protein_id="BAJ79813.1"
FT                   /translation="MNEMAMTGEDEVRADDDALLRALVEEVPFDGWTRTALRRALARLG
FT                   RDPDEAELLFEGGAPAMIEAWTALVDRDMEDAAGTIAETRLAARVRALILLRLDRVAPH
FT                   REAIRRALAILALPRNAALAARITGRTVDAIWHAAGDRSADFSWYTKRAILAAVYSTTL
FT                   LYWLRDASENGEDTRAFLDRRLAGVALITRTRKRIESRLAGLRRGPMRAGPSPSA"
FT   CDS             complement(532844..534034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04670"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04670"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79814"
FT                   /db_xref="GOA:F0J3F8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3F8"
FT                   /protein_id="BAJ79814.1"
FT                   /translation="MTNDTADVAIIGAGPVGAALALRLAAGGQRVVLVDRAALPPMEHP
FT                   DFDGRAYAIAYGSRDLLDRAGLWDRLPFPPCPIERIRVSDGKPGRPPSPLFLDFDHRDV
FT                   GDEPFGWIVEARSLRMAINRALADSAVILHAPATARVTRDADGATVAIADGPSYRVNLV
FT                   VAADGRGSTLRAEAGIAVTRYPYRQSAVVCAVEHERPHHNVALEHFLPGGPFAQLPMSD
FT                   ADGAHLSAIVFTESHANAARLAAMDDPRFTIEVARRLGAHLGRIRLVGRRWTYPLSALH
FT                   AHRYHATRLVLVGDSAHGVHPIAGQGLNLGLQDGIALAELIDAAADPGSPDLLARYQRI
FT                   RRPANIAMLAATDALDRLFSTDLPPVRLVRDIGLAAVNRMPRLKRRFMRTAMGLRA"
FT   CDS             534206..535603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="ACMV_04680"
FT                   /product="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04680"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79815"
FT                   /db_xref="GOA:F0J3F9"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3F9"
FT                   /protein_id="BAJ79815.1"
FT                   /translation="MPIIRAFGCWHSPCIPACIAITHIAEQEGHRRMKRRLLIGSMGTF
FT                   LGIMGWNAAAFADTAPKLDSGDTAWMLTSSVLVLMMTVPGLALYYGGLLRRKNILAMLM
FT                   QCFFATALISVLWVVIGYSLAFTKGNPFIGGLSQVMLMGDGTGTLSGTIPETVFCMFQC
FT                   TFAIITPVLILGGPADRLKFSSAMVFLGVWLIAVYAPIAHMVWGPGGFLGGQGVLDFAG
FT                   GTVVHINSATAGLIAAIMVGKRTGYGSVNMAPADLGYTLVGASLLWVGWFGFNAGSALT
FT                   SGGQAGYAMINTHLATAAAVLSWTLVEWMIKGKPSLLGAVSGAVAGLVAITPACGFVPV
FT                   GGALVIGLVAGVVCFWGVTGFKRMFGYDDALDVWGVHGLGGIAGALLTGVFAVKSIGGT
FT                   NGLLAGNPHQMVLQAEGIVVTLLYSGIVSYVILKIIDVTMGLRVSPDAEREGLDISEHG
FT                   EVLQHGY"
FT   CDS             535727..538156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK"
FT                   /locus_tag="ACMV_04690"
FT                   /product="DNA translocase FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04690"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79816"
FT                   /db_xref="GOA:F0J3G0"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3G0"
FT                   /protein_id="BAJ79816.1"
FT                   /translation="MSATTESRQFLSPALKARFVRHLAELGALCAVLAGLTVLVSLVSY
FT                   HAGDPSLDTASSLPPQNLAGRFGAILADLLLQGFGVAGALPALVLLAWGFVLVNRGEIT
FT                   RWRLRALAALLAMPCLASMFGVFHALNAAFAPAWPVAAGPGGAIGALLGGYGAVVAHSA
FT                   LGVIGRVLLLGLSALIGIAVSAFAFGLTSGEWRLAGRRAAAAAAASAKHGQRAVRGASN
FT                   MSVWLREIVASPPMSDPPAADDRSALAIPRAPDEAMDPYADEAGPAPMRRDDLVAQPAA
FT                   SASAPRLTRTAPTRKAPPRQERLPLPDSLWRLPPLELLKQAPPHAATGPNTESLQANAR
FT                   LLETVLGDYGVQGRIVEIRPGPVVTLYELEPAPGIRSARVIGLADDIARSLSVLAVRIA
FT                   TVQGRNVIGIEVPNARRETVFLSELLESADWNATTGRLGLALGKDIGGKPVIADLARMP
FT                   HLLIAGTTGSGKSVGVNAMILSLLYRLSPEECRLILIDPKMLELSVYEGIPHLLAPVVT
FT                   EPAKAVAALKWVVREMERRYRAMSGLSVRNIAGYNERVNEALARGEVVTRRVQTGFDSE
FT                   TGRPIFEDQPLALEPLPLIVVVIDEMADLMMVAGKEIEAAVQRLAQMARAAGIHVIMAT
FT                   QRPSVDVITGTIKANFPTRISFQVISKFDSRTILGEQGAEQLLGMGDMLYMAGGGRITR
FT                   VHGPFVSDREVEDVVAYLREQGEPDYVEAVTEAVEDDAPAMPGLAAAEGGEGGLYQQAV
FT                   ALVAREGKASTSFIQRHLQIGYNRAAKLIEQMEKEGVVGPANHVGKREVLIAGDRD"
FT   CDS             538137..538547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04700"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79817"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3G1"
FT                   /protein_id="BAJ79817.1"
FT                   /translation="MPATATERLPPALIVHDAEHVARALAPGRPVTLLSPPGFALYAGC
FT                   LWWRSLLASERFTGPALLDCADAAGRALEALRIGLRGLVLDPATPAFPRIAALADEYRV
FT                   TLLDAPPPALDLGNRIGPAALAAWLDAADNPA"
FT   CDS             538600..539514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbaB"
FT                   /locus_tag="ACMV_04710"
FT                   /product="fructose-bisphosphate aldolase class I"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04710"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79818"
FT                   /db_xref="GOA:F0J3G2"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3G2"
FT                   /protein_id="BAJ79818.1"
FT                   /translation="MRVTQRVRKILSWYESDNPGTKANLARILMQGKLGGTGKMVILPV
FT                   DQGFEHGPARSFASNPAAYDPQYHFQLALDAGLSAYAAPLGMIEAGADSFAGSIPTILK
FT                   LNSSNSLATEKDQAVTGSVSDALRLGCSAIGFTIYPGSEHQFAMMEEFRELAEEAKAAG
FT                   LAVVLWSYPRGPMLDKKAETAIDICAYAAHMAALLGAHIIKVKPPTEHIGLDAARKAYE
FT                   KVDVSTLAKRIEHVVQSCFNGRRLVVFSGGEATDSASLIETVRALNEGGASGSIIGRNA
FT                   FTRPRDEALALLSQIVGIYQGKA"
FT   CDS             539511..540131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="ACMV_04720"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="protein synonym:thiamine-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04720"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79819"
FT                   /db_xref="GOA:F0J3G3"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3G3"
FT                   /protein_id="BAJ79819.1"
FT                   /translation="MTELYLITPPRLGPDFADALAAALDAGPVACIQLRLKEAGADEMR
FT                   RAIDALRPVAQSRGVAFLLNDDPRLAVETGCDGAHLGQDDLAAHGGLARVRRVLDGLSL
FT                   GITCHDSRHLAMEAAEQGADYVAFGAFYPTGTKEPKARADVEILRWWSELMEVPCVAIG
FT                   GITPGNAAPLVEAGADFLAVVGAVWQHPDGPAAGVRAFRAELA"
FT   CDS             540215..542749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04730"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79820"
FT                   /db_xref="GOA:F0J3G4"
FT                   /db_xref="InterPro:IPR007657"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3G4"
FT                   /protein_id="BAJ79820.1"
FT                   /translation="MSEPIVPIWRELLAEFDGAADPQPFLDRLIQEAFRRPGEFELHLM
FT                   LVERMFARGRDARGLAINGYVLACGDPHFRFRAHLQRADHFRRHGAFREAEADIEAARA
FT                   IDPGSHWPVLAMAENLAQEGRVGERGDYIRAEYEGLRPESRAEIARHYAGWAAFDHFDR
FT                   TRASPGWQPRRPGRVPALERAGMILLVKDEEDIIGQNLSHHYALGFRAFCVLNNMSTDN
FT                   TREIVSRFRDSHDDCFVLLVDDPVRGHYQADKMRVYAETLQRHAEIAGLRLDWLFFIDA
FT                   DEFIASDTSRPSSEQLSALERRLNDPDTRVLVMHWIHAASPQVLEEFGSEDDPFEKINV
FT                   MRYRLLPLVPKVAYRVGFDYSLKNGNHFIEKLNDSLDSVVQVGCDDWYIYHFSLRSLSH
FT                   VRKKIINGGRAFVGTRGLNDHGQHWRERYALFQKYGDRIISEVLEEHVRFVPSLHPPRI
FT                   DSPEKRLPTRRVSSDIEPIDIKRAVNEISGIEAIEIAKAYTCERPEPAFVKGPVTSDIM
FT                   NDFRRERSVWPISVYKISDIEIHGPWFNAGIILVSQRHRFRIDEIYQPAGEQPQDICLE
FT                   KSLHELQFENKRFLEINEDCVLLATNGHNIYGHWLVDFLPKIYLLDYIGIDVSKIKFLM
FT                   PSDVGHWAIDLMNLVGIKKENLIIYDQNEIVPLCRSLFVPTLLRMSGRTSPLFLNATEF
FT                   INKRIDKNIQTKSDVSNTFLYFDREQEFTWRKIDGHDKIIKLFNDLNFHIVRPEKLSIS
FT                   EQIRLVRGAKVIAGQHGSALHSTIFCQDPVFAVVLHENRRNWFAGLQAGIGEYLGHQTG
FT                   YIFGETSSHENIFSTRFEASDIRMGVDFARMA"
FT   CDS             542917..544920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04740"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79821"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3G5"
FT                   /protein_id="BAJ79821.1"
FT                   /translation="MIRPRICLSMIVRNEAPVIRRCLASVLPLIDHWAICDTGSTDGTQ
FT                   DIIRSFFEEHAVPGELRESPWRDFAHNRNEALELARPHGDYILIIDADDALELPPGFAR
FT                   PELAADGYTFDIQDVNIVYRRTQIVRSALPWRWHGVLHEVLHCDAPASEEHLPIVMRRN
FT                   HDGARRRDPSTYARDASILEAAIFVEEDPWLRARYVFYHAQSLRDMGQHERAMIAYLMR
FT                   AEMGFWQEEVYWSLYQAALMMERLGRDEETVLAAYRRAAAAAPHRIEALFAASRYCFAK
FT                   GRNEEGFRIAEHGIGKPAPEGGLFVETWVHDYGLLDQYAANGYWAGHYSESFNAALEVL
FT                   ASGKVPAHELPRVARNFRALLDKVRPASAPDYGRLGQESYPDQHALKPERLLRSGTTTA
FT                   PRVLIAILAKQKEEFLPLYLDCIEALDYPKSSIVLYIRTNNNTDRTEEILREWIARVGH
FT                   SYAAVEFDPSDVDERVEQFGAHEWNAIRFRVLGRIRNESLRKTREHGCDWYFVADIDNF
FT                   IRRCTLRELVATGLPIVAPLLRDAEPSSYYSNLHAEIDDNGYFRDCAQYELIMSRRIQG
FT                   LIEVPLVHCTYAVRADVIEHLNYDDGSGRYEYVILSDSARKASIPQYFDNRQVYGYITF
FT                   SKNPDQYDENSAARAERNMWAVRKFMSEDRHG"
FT   CDS             545162..545545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04750"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79822"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3G6"
FT                   /protein_id="BAJ79822.1"
FT                   /translation="MRSNKSMIRTTAAALAIGLGLAAFGGTALADPGYQAQGGWHRQGQ
FT                   QQGWQQPRRQNNWQRHGWQNRGNYQHSRYHGGWGNNGWQHQRWGHPHYDREGYHVMGTQ
FT                   GYYAPPALSFSINLPLAGGQYGH"
FT   CDS             545566..546366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04760"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79823"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3G7"
FT                   /protein_id="BAJ79823.1"
FT                   /translation="MAPTRTQACGPALRLSGVARFPLAPGAGMFPAYSRAARADCRGGR
FT                   FGSSSGMTSRFLPIFRRGYEPGARRRAGAGLLLLAMSTAPGFAATPRLLPDRDASAIYQ
FT                   VSQPGKPEQTWRIRFDAAAGLVRATSLSGTPMPMTALLDLHSGRAQLVLPQMHALVNVP
FT                   GLSGAMGQVMAMRGAHFTPLGTATIAGYRCTRYLVLRRNASGTACLTPDGFALAASGSD
FT                   PHGRVSVQALSLHIGPQPAGDFEPPMGYSEVTLPPQMLASLLGQ"
FT   CDS             546435..547784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04770"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04770"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79824"
FT                   /db_xref="GOA:F0J3G8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR008166"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3G8"
FT                   /protein_id="BAJ79824.1"
FT                   /translation="MVRSACVAIAKNEANNIAEWIAFQISIGFDSVIIYDNCSSDNTVS
FT                   IIEKFSKNYDVKIINWPENDNKYQINAYNDALQRFGSNFEWIAFFDVDEFLVINRPLDL
FT                   KSLLRIYADGSAAAIGIPWAIFGSSGHISQPYGLIIDNFIQRSNENFGPNRHVKSIVKP
FT                   VFTKCCHQPHTFEVNGDYIGLNGKKLELDNDSLLKNIPDYSFGKLNHYFTKSKIQWMQK
FT                   LKRGYHDIERLDSDFSIYDVNDVNDRSACRYRFNVLKILKNIELNIDRTNNFSGKKIGI
FT                   GITTFNRFDVLKESIRRIKNFTSIPCEIFVADDGSIDNTLEFLPNEDGIYYFSGRNRGV
FT                   AWNKNRCLFFFRNFIHVDVIILLDDDVHVDGIGWEQNFVNGAIKYGHINYAFPDMIEEN
FT                   VDRRCDSIEPGITRKLGGPCIAFSHPALDECGYFDSRFLKFGHEHTEFTK"
FT   CDS             547884..548183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04780"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79825"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3G9"
FT                   /protein_id="BAJ79825.1"
FT                   /translation="MTSTGNDIDIANNARIWNEVVSKDGSLFRSPWSTLPQKIEFLAEQ
FT                   RQIAERYQFPFPFIQAPFDEVAYGTIFQDIEDTSLSPWRHFVAHGLSEGRNRLV"
FT   CDS             548551..551271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04790"
FT                   /product="ribonuclease E"
FT                   /EC_number="3.1.26.12"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04790"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79826"
FT                   /db_xref="GOA:F0J3H0"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR028878"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3H0"
FT                   /protein_id="BAJ79826.1"
FT                   /translation="MTKTMLIDASHAEETRVVVLDNNRLDDFDIEAADRKQIKGNIYLA
FT                   KVIRVEPSLQAAFVEYGGNRHGFLAFAEIHPDYYQIPVADRQKLLELEAEEARRRVEAE
FT                   DAEDEQEAALAAPRPPRVTEIAIGDAPPDAEGQVDAEAAAAPAEVGEAEADSGPEASGA
FT                   GAGEDRAGEGAEATATPPEQVGGDDGVDGAEEAQERRRLRALRSYKIQEVIHRRQIMLV
FT                   QVVKEERGSKGAALTTYISLAGRFSVLMPNSPNGGGVSRKITSLADRRRLKEAIAELEI
FT                   PQGMGMIVRTAGANRPKPEIKRDCEYLLRLWDDIRERTLASIAPALVYEEASLIKRTIR
FT                   DVYTRDVDQVLIEGEDGFRSARDFMRMLMPTHVKKVQQWTERQPLFAKHNVEQMLDQMF
FT                   QPTVQLKSGGYLVINQTEALVAIDVNSGRATRERNIEDTALRTNLEAAEEVARQLRLRD
FT                   LAGLIVVDFIDMETRKHNAMVERRLKDALKNDRARIQVGSISHFGLLEMSRQRLRPSLA
FT                   ETMLIACPHCQGVGHVRSTASTALAVLRAIEDEAARQAAELLVHLTPDVALYIFNHKRA
FT                   QIAATEARFGMKVVFVADGTVPATFKIEKVKAHAARPQETPAPTFRAPAETEEVEAEQQ
FT                   GDEVATEDAAGNAGKAADEVERRRRRRRRRRGGRREDLVSAPTGEQPEIAGIPAEFESR
FT                   MNDVLPTAARADAAEAPAPEVTMEPAVADTAPAVPEPAKEPEVVETAPAATEAAPSLAG
FT                   EVPAPEAEAETKPKRRAPARPRSPTTRRRRAAASQAAEPEVQQPVFTDIADIFEAAEQA
FT                   EARAPKPRRTRRPKARPMEAETAVADAPATTEAVAEVSAAPQDGSASAGNVAGAEAPVA
FT                   NEGQAAPGAAVQPVLIGASETPTAARKRGWWKRPA"
FT   CDS             551458..551628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04800"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79827"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3H1"
FT                   /protein_id="BAJ79827.1"
FT                   /translation="MPVVDVTGVLKMGKTSRGVARQYAGSAGKIANGRVGMLAAYVSAH
FT                   AMPLSIGLSIC"
FT   CDS             552034..552318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04810"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79828"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3H2"
FT                   /protein_id="BAJ79828.1"
FT                   /translation="MARRRAPAIPDDLLDQLLAGGDAAAALNSGDLVNALKKALAERAL
FT                   SAEMDYHLSDEAEAENSRNGHCQEFRVWAAVEHQAARALTKRSPKMTAN"
FT   repeat_region   552381..552383
FT                   /rpt_type=FLANKING
FT   repeat_region   552384..555022
FT                   /note="Belongs to IS21 family"
FT   repeat_region   552384..552420
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 37 bp inverted repeat"
FT   CDS             552588..554105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04820"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04820"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79829"
FT                   /db_xref="GOA:F0J3H3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3H3"
FT                   /protein_id="BAJ79829.1"
FT                   /translation="MRQIRQMLRLAGDGISAREIGRMLGVARSTIQDNLKRAQEAGLAW
FT                   PVPAELTDAAIEERLFARSGYKQGVRRRAEPAWDELVCELKRPGVNLQVLWEEYRDQHP
FT                   DGYGYSRFCELFREFEARLSPVMRQDHRAGDKVFVDYSGKRIGIVDRASGEVRQAEIFV
FT                   GVLGASSFTYAEASWTQTLPDWIGAHVRMFRAFGGVPRLIVPDNLKSGVNKPSFYDPEI
FT                   NLSYGRMASHYGVGVLPARPFRPRDKAKVESGVRFAQTYILGRLRRQTFFSLAEANQAI
FT                   AGMVDRINDYVMRRIGVSRRHLFETIERPALAALPASDYEFAEWGLARVALDYHVEVCG
FT                   FFYSVPHELIRQQVDTRATERGIEIFHHGKRIAVHQRRYGGRKHGTDIEHMPSAHRRYA
FT                   EWTPERFRRWGASIGPHTEGLITAILASRPHPEQGFRTCLGILRLFKDLEPARAEAVAD
FT                   RAVAIGAFTYKSLASIVANKLDRSTAAAGEPQAVITHGNLRGSGYFH"
FT   CDS             554117..554869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04830"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04830"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79830"
FT                   /db_xref="GOA:F0J3H4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3H4"
FT                   /protein_id="BAJ79830.1"
FT                   /translation="MLTHPTLDQLHDLGLHGMAKGFKDLGAHPETASLDHAAWLALLLD
FT                   HETTLRRQKRFERLARVAKLRQAATVEDIDYRTARGLDRAMFLKLAGCDWIRAKHNLLI
FT                   TGPCGVGKSWIACALGQKACREDLSTAYHRVPRLFAALALARGDGRYAAMLRQIARVDL
FT                   LILDDWGPETLNADQRRDLLEIVEDRHDRRSIIITSQVPVDRWYEIIGDPTIADAVLDR
FT                   LVHNAYRIELTGESLRKKKNPATVTMQA"
FT   CDS             complement(554906..556132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04840"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04840"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79831"
FT                   /db_xref="GOA:F0J3H5"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3H5"
FT                   /protein_id="BAJ79831.1"
FT                   /translation="MARRRAPAIPDDLLDQLLAGGDAAAALNSGDLVNALKKALAERAL
FT                   SAEMDYHLSDEAEAENSRNGYGRKSVSTGTGKIEIAIPRDRAGSFDPQLIAKYQRRFPG
FT                   FDDKIISMYARGMSTREIAEHLREIYGMDASAELISTITDAVLDEVTSWQQRPLDPVYP
FT                   LVFFDAIRVKIRDEGVVRNKAIHIALGVMADGTKVVLGMWIEQNEGAKFWLRVMNELKN
FT                   RGVEDILLAVVDGLKGFPEAITAVFPETIVQTCIVHLLRNSMDFVSYKDRKAVATALKD
FT                   IYRAVDARAAEAALADFEAGPWGQKYPAIGQSWRRVWQEVIPFFSFPGEVRRIIYTTNA
FT                   IEALNSKLRRAIRARGHFPSDEAAAKLLYLIAYSDEAGHAFRFHSGHPFRNEAGHRSDL
FT                   KPATCASFG"
FT   repeat_region   554986..555022
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 37 bp inverted repeat"
FT   repeat_region   555023..555025
FT                   /rpt_type=FLANKING
FT   CDS             556133..557227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04850"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04850"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79832"
FT                   /db_xref="GOA:F0J3H6"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3H6"
FT                   /protein_id="BAJ79832.1"
FT                   /translation="MGLPFYPLCHSHTKFRTLPRNGYGRKSVSTGTGKIEIAIPRDRAG
FT                   SFDPQLIAKYQRRFPGFDDKIISMYARGMSTREIAEHLREIYGMDASAELISTITDAVL
FT                   DEVTSWQQRPLDPVYPLVFFDAIRVKIRDEGVVRNKAIHIALGVMADGTKVVLGMWIEQ
FT                   NEGAKFWLRVMNELKNRGVEDILLAVVDGLKGFPEAITAVFPETIVQTCIVHLLRNSMD
FT                   FVSYKDRKAVATALKDIYRAVDARAAEAALADFEAGPWGQKYPAIGQSWRRVWQEVIPF
FT                   FSFPGEVRRIIYTTNAIEALNSKLRRAIRARGHFPSDEAAAKLLYLILNRSEKEWVMPP
FT                   REWAMAKAQFAVIFGDRFVRALAA"
FT   CDS             complement(557696..558874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04860"
FT                   /product="putative potassium channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04860"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79833"
FT                   /db_xref="GOA:F0J3H7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3H7"
FT                   /protein_id="BAJ79833.1"
FT                   /translation="MDLWFPHVPLALAVGVAGALAILPTIQKFAAQYLHLDLANLVSAI
FT                   HPISGNIPGLILNGVPNVVVGALQILIALGLLGRSRIAWLSAIGIALAQLLLTVHLGAA
FT                   TRLDGETIYILVLLASLLLARNHFSRSSLAAGTLFAVASVLVLMVYGVLGSLLLGAGFS
FT                   PPITNLPAAVYFVIVTMSTVGYGDILPKSEDARLFVVSLIVLGLTVFATALTAVIGPVL
FT                   QNRINRTIGPRRQKMKRVNHFIISGHGVLARNTARELHHRGEAVVFITETEDAGFSDAE
FT                   TVIGDPTDLDTLRKAGGEHARAILALSDDDSENAFVILAVRELGTDAKKVAAVSTRKNL
FT                   ERVRRVHPDMILAAPVFGGEVLAMALTEQKIDGDWLLSRFLDVRPHDADGTS"
FT   CDS             complement(559034..559273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purS"
FT                   /locus_tag="ACMV_04870"
FT                   /product="phosphoribosylformylglycinamidine synthase PurS"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04870"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79834"
FT                   /db_xref="GOA:F0J3H8"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3H8"
FT                   /protein_id="BAJ79834.1"
FT                   /translation="MKVLVAVKLKTGVLDPQGKAIGHALEGLGYNDVNDVRVGKLIELD
FT                   LAETDREKARDAADSMARRLLANTVIESFEITIP"
FT   CDS             complement(559270..560034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="ACMV_04880"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04880"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79835"
FT                   /db_xref="GOA:F0J3H9"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3H9"
FT                   /protein_id="BAJ79835.1"
FT                   /translation="MARRRQLYEGKAKILFEGPEPGTLVQYFKDDATAFNAQKKGVITG
FT                   KGVLNNRISEFLMQRLGEIGIPTHFVRRLNMREQLVREVEIIPIEVVIRNVAAGSMSTR
FT                   LGIPEGTRLPRSIIEYYYKNDALNDPMVSEDHITAFGWASTQDMDDIVHLSLRINDFLT
FT                   GLFLGVGIVLVDFKIEFGRLWENDDMRIVLADEISPDNCRLWDAKTNEKMDKDRFRRDL
FT                   GRVEEAYQEVAKRLGILPEAGTRDMKGPETMQ"
FT   CDS             complement(560164..560685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="ACMV_04890"
FT                   /product="ATP synthase subunit b"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04890"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79836"
FT                   /db_xref="GOA:F0J3I0"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3I0"
FT                   /protein_id="BAJ79836.1"
FT                   /translation="MEYEALTGTLWDKGTFWVTVAVLIFLAFFGRKIVGAITTMLDQRS
FT                   AAIQHELDEASRLRAEAEAMLKDAESRREAALAQAKDMLAMAGREAERLAADLLAEAEA
FT                   SARRREQMARERISAAEAAAIAEVRDAAAALAARAAEQILKETIDEAHDRGLIDQAIGG
FT                   LPAALRQKAA"
FT   CDS             complement(560692..561261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpX"
FT                   /gene_synonym="atpG"
FT                   /locus_tag="ACMV_04900"
FT                   /product="ATP synthase subunit b'"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04900"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79837"
FT                   /db_xref="GOA:F0J3I1"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3I1"
FT                   /protein_id="BAJ79837.1"
FT                   /translation="MRRTTILLAATALGLTPATAMAEGKMPQMDFSNPLTGAQVVWMAV
FT                   IMVVLYFVLARWALPRIGGVIENRHNRIATDLETARRAKAEAEHAVRELNLAIQNARES
FT                   SQGAIAEAVNAAKERARAQTAALNDRLSAQIASAEAEIDSARRTAVGALAPIARDVASS
FT                   LLHRLIGEAVEPGRIEQAVSALSTQG"
FT   CDS             complement(561287..561520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="ACMV_04910"
FT                   /product="ATP synthase subunit c"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04910"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79838"
FT                   /db_xref="GOA:F0J3I2"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3I2"
FT                   /protein_id="BAJ79838.1"
FT                   /translation="MAIDTLLLARDVGAGLATIGVAGAGVGIGNLFGAFVGAVGRNPAA
FT                   RDKMFRDVLLGFALTEAVALYALVIALIILFA"
FT   CDS             complement(561593..562348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="ACMV_04920"
FT                   /product="ATP synthase subunit a"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04920"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79839"
FT                   /db_xref="GOA:F0J3I3"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3I3"
FT                   /protein_id="BAJ79839.1"
FT                   /translation="MAQESGINALGQFQLTTGFGAFGKAIEFTNSNEMMLLAAVIVTSL
FT                   FVVALRQRALVPGRMQGLAEISYEFVHNMVLDTIGEEGKRFFPFVFTLFAFILIGNILG
FT                   LFPYFFAFTSHIAITGALALFVFALSTLVGFWYHGIGFLKFFSPPGVPGWLLPLLIPIE
FT                   IVSFLSRPISLSVRLFANITAGHVMWEVFAGFMLMLVSGLGAVGVVAAIIPLGLNIALT
FT                   ALEFLVAFLQAYVFAILTCLYLHDAIHMH"
FT   CDS             complement(562362..562679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04930"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79840"
FT                   /db_xref="GOA:F0J3I4"
FT                   /db_xref="InterPro:IPR016989"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3I4"
FT                   /protein_id="BAJ79840.1"
FT                   /translation="MGDEPAQGPDDRSDFDQRLAAARSRAGLDKPAGKSAEQDKGPNPF
FT                   SVATRLGAEMVASLVVAVAIGYGLDRLFHSAPWFMIGFVPIGAAAGLRNVFRAMGPGDK
FT                   D"
FT   CDS             complement(562764..566261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="ACMV_04940"
FT                   /product="chromosome segregation protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04940"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79841"
FT                   /db_xref="GOA:F0J3I5"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3I5"
FT                   /protein_id="BAJ79841.1"
FT                   /translation="MPARFARLRISGFKSFADPTTIDILPGLTGIIGPNGCGKSNVVDA
FT                   LRWAMGEASAKSLRGGEMEDVIFAGTMARAARNLAEVSITLTDTAGLAPVPFQNEPELQ
FT                   VSRKIERGSGSSYRINGREVRARDVATMFADLASGARNSAMISQGRVSALVNARPDERR
FT                   ALLEEAAGITGLHARRHEAELKLRAAEQNLLRADDLRAQQEARLAELRKQARQANRYRN
FT                   ISGLIRDAEAEYLAIERELAERRRRAARAQFAEAEAAVGHAEKLRDDVLGRETSQNDAL
FT                   PALRAREADTRTRLERARILAEQIDAEIARLEAARREAEARVATLRKDHAGAERIARDA
FT                   EAAAIRLEAERSQLAADHELAPARIEQARREAEAASAALAQCEAATQQATEAAARAQAQ
FT                   RQAMETRLTQARGTAGQADRRAREAEAAHATAQAALVSPERLAAAEATREAAERAVAAA
FT                   ETTYAEAQNRVQGAETRRTEAHAAAIRARSAATEADAAAARLKAETDALKALLAQKFGR
FT                   DPDPVLDRIKVPAGLETALGAALGAELSAGEQASAARHWRSLPAIASDAALPRIGETIT
FT                   APDALRRALDHILLLPDGEDGEALQATLRPGQILVSIEGGVWRWDGFVVRPGAPTEAAV
FT                   RLAQRNRLDQLDVEFARARQSAEATRATLQEAEAAERDARHAEEEARTARRAAESAIDR
FT                   TRKDLRTTAETASRLAAEAERLAAREAAAAETRARIEAEAGEARAALAAIEAEFATLDD
FT                   AQAFRDALDRARSALSESRRRDSEATQALQRLQTEADARARRLDTIIREQSDWAERARD
FT                   ANDRRTDLGARLREAEASLETLGADGGARERRAEAGAELEAAESDHHAAARDLASAEEA
FT                   ARRNSAAARAAEQDLARAREARIGAESAVREADHAWGTVAEKMLERLGVDPALPAVADP
FT                   SPDAAEKARKRFERLTRERDEMGPVNLRADIEVGEIETRLAAIDRDREEITSAIAKLRG
FT                   SIGHLNREGRERLSAVFTEIDRHFQALFTRMFGGGRAHLALTGSDDPLEAGLEIFAEPP
FT                   GKKLATLSLLSGGEQALTALSLIFAVFRCNPAPLSVLDEVDAPLDDANVERFCRLLEDI
FT                   SQDTGTRFIVVTHHHHTMARMDRLYGVTMQERGISRVLSVDLGTAAAMVEPAGAIAAE"
FT   CDS             complement(566269..566898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04950"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79842"
FT                   /db_xref="GOA:F0J3I6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3I6"
FT                   /protein_id="BAJ79842.1"
FT                   /translation="MDRRSLLGMVGGLATAGSLGIAFPAAAAETKADSPYSIRSLGNPN
FT                   APVTVYEYFSLNCPHCAEFATHALPKVIESYVKPGKVYYVFKDFPLNEDALWAAQIARA
FT                   LPAKAYYPFISELFRTQDEWAYAPGLKTPKDYQNALFRYAALAGMDRTTFDAAIANKKL
FT                   RAFVLNELNDAEKTYKVNSTPTFIINGRKREGAVSFDTFSSWLKAA"
FT   CDS             567100..567615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="ACMV_04960"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04960"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79843"
FT                   /db_xref="GOA:F0J3I7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3I7"
FT                   /protein_id="BAJ79843.1"
FT                   /translation="MNLKDHIRGIPDFPKPGILFYDISTLIRHADAWQVAMGRLAKVVR
FT                   AHHPDLLAGVESRGFILAAPLALKLGCGFIMLRKRGKLPGATVGYDYDLEYGQDRIEIQ
FT                   ADAVQPGQRVVVVDDLLATGGTMAAGIKLLRKVGAEVPAAAALIELAFLKGRDRLDVPF
FT                   EALVSYDQ"
FT   CDS             567640..568713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04970"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79844"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3I8"
FT                   /protein_id="BAJ79844.1"
FT                   /translation="MKRRAALGALGTIIAGSALPFARASDLPTPANAIFADTFGGSYRI
FT                   VVGGLPGGQADRWGRAIALGLEKILSPRTPLRIETVGGQDGVTGANRLQTLMVSDGHTA
FT                   ALLPGESSIAFLTGDPRVHFRPGEWIPILAGLSSGVIVLRGGAGRLAQAAPVRLAAAAP
FT                   ESPDLAAILAFERLGVPISPIFGLRGTTAVARAFGLGEVDAVMLTGEDIPADLASLQAE
FT                   GGVAICSLGTVDQAGRTVRDPRFANVPTVAELAGIRHAKALSPPLERAFQGVAAASRLD
FT                   FIMVLPHLTPAASVALWRQAALGAIQGSALQSAATASAISLTVNGAAVALAPIAASPEA
FT                   LLALRQFLFTRFGWRPS"
FT   CDS             568743..570143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="ACMV_04980"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04980"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79845"
FT                   /db_xref="GOA:F0J3I9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3I9"
FT                   /protein_id="BAJ79845.1"
FT                   /translation="MAKSATRFVCNECGAVAPKWAGRCEACGAWNTLEPQAVVPTGTGR
FT                   KAAVQAGRGIDFVGLAGETPPPPRIPLGIEEFDRVLGGGMVPASAILVGGDPGIGKSTL
FT                   LLQAAARLAASGRRVLYVSGEESVAQIRLRAERLDLKTAPVNLASATVLADILGSLRAE
FT                   RDAALVVIDSIQTIWDETVESAPGTVSQVRANAFALIQAAKTQGFALMLVGHVTKEGAL
FT                   AGPRVLEHMVDVVLHFEGDRGHQFRILRGAKNRFGATDEIGVFEMTGRGLAEVANPSAL
FT                   FLAERHGNVTGSAVFAGLEGSRPVLMEVQALLSANGAGSARRSVIGWDQGRLSMLLAVL
FT                   DARCGLKLGGHDVYLNVAGGLRVSEPAADLAVAAALISAASGVPADPETVFFGEIGLSG
FT                   ELRQVAQVELRLKEAAKLGFGRAALPRRVAGGTRRLSAPEGMVLAEYGHLSDLVAAMGA
FT                   VTGNGEEA"
FT   CDS             570143..570706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_04990"
FT                   /product="putative colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_04990"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79846"
FT                   /db_xref="GOA:F0J3J0"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3J0"
FT                   /protein_id="BAJ79846.1"
FT                   /translation="MTWADGIAIGVVLLSGLLALARGFVREVLGIGAWIGAGLAAFVSY
FT                   PLVEPQITGIVGNPKLVLPVSIGIVFIVVLIVLSILSAWLGSMVRDSVLSGVDRTLGLA
FT                   FGLVRGAVIVCLAYIALSIFLQPSEWPSAIRRAKFLTYAENGSAFLVAFLPAAYRPHVD
FT                   RIGPAAAPAAAPVSSAAGGIGPSQ"
FT   CDS             570787..572268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="ACMV_05000"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05000"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79847"
FT                   /db_xref="GOA:F0J3J1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3J1"
FT                   /protein_id="BAJ79847.1"
FT                   /translation="MTQSENPVIRDDDDKLHEECGVVGVWNVTDAAAITALGLHALQHR
FT                   GQEATGIVTHDGVRFHAHKGIGLVGDNYGDAKVMAGLPGTRAIGHNRYATTGATLLRNV
FT                   QPLFAEFEFGGLAVGHNGNLTNAHTLKRALVRRGCLFQSTTDSEVFVHLIAISLYATVL
FT                   DRLIDALKQVQGAYSLVALTNDMLIGVRDPLGVRPLILGRTHGADGSGPGWVLASESCA
FT                   LEMVGAEFVRDIEPGEIVAIDRGGVRSLKPFVPQKPRFCVFEYIYFARPDSIVDGMSVY
FT                   AARKRIGSELAQESPVEADLIVPVPDSGVPAAMGYAERSGIPFELGIIRNHYVGRTFIE
FT                   PTDQIRHLGVRLKHSANRPALEGKRVVLVDDSIVRGTTSKKIVEMVRAAGAREVHMRIS
FT                   SPPTTHSCFYGIDTPERGKLLAARNSEAEMAALIGVDSLAFISIDGLYRALGHQGRDAA
FT                   DPAYCDACFSGDYPIPLTDHAEPRDAQLSLLAELA"
FT   CDS             572293..572970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="ACMV_05010"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05010"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79848"
FT                   /db_xref="GOA:F0J3J2"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3J2"
FT                   /protein_id="BAJ79848.1"
FT                   /translation="MTLVDQIRAIMSAMKTRMPTAGEALPGRATPMPIPEFHYVSGARL
FT                   AEPYPPGSEVAIFGLGCFWGAERKFWQAPGVLVTAVGYAGGFTPNPTYEEVCSGRTGHA
FT                   EVVLVVFDPRATSYQNLLKLFWQNHDPTQGMRQGGDIGTQYRSAIYALSDEQLRLAELS
FT                   RDAYQNVLSEAGFGRITTEILPAPTFFFAEAYHQQYLAKNPDGYCGLGGTGVTCPAGVM
FT                   PAD"
FT   CDS             complement(573030..573287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05020"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79849"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3J3"
FT                   /protein_id="BAJ79849.1"
FT                   /translation="MNIKTHDGIAEDAPFQAFLDPHQITEAQLAELGLEEIAYVRPIMT
FT                   PNGPAFGVFAANGVPMAVAADNSVARAAIVQHELAPVSVH"
FT   CDS             complement(573289..573792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05030"
FT                   /product="small heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05030"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79850"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3J4"
FT                   /protein_id="BAJ79850.1"
FT                   /translation="MTTRVFTSPLFLGFDHLEQVIERAAKTSSEGYPPYNIEQLSSTSL
FT                   RITIAVAGFTMDDLQITQEDNQLVIRGRQNDDMQGRIFLHRGIAARQFQRAFVLAEGIE
FT                   VKGAWLDNGLLHIDLARPLPEAKIRTIAIKKGAGGQNGASSARTLDSDAVASRIVGREL
FT                   QEGS"
FT   CDS             573918..574475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="ACMV_05040"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05040"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79851"
FT                   /db_xref="GOA:F0J3J5"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3J5"
FT                   /protein_id="BAJ79851.1"
FT                   /translation="MSATTDIADAGIPEILIVPDKRLRMKARRVVGADRDDVAELVPRM
FT                   FAAMYRAPGIGLAAPQIGVSLRLVVMDLAPDDQKQPMVMINPEITARSEELVSREEGCL
FT                   SLPGQYAEVIRPGQISVAFEDEDGKKRTIDADGLLAACIQHEIDHLDGVLFVDHLSALK
FT                   RNMILRKLAKDLREKAARKPAR"
FT   CDS             574475..575380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="ACMV_05050"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05050"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79852"
FT                   /db_xref="GOA:F0J3J6"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3J6"
FT                   /protein_id="BAJ79852.1"
FT                   /translation="MRLAFMGSPGFAVPALRALHAAGHDIVAVYCQPPRPVGRGHRIHK
FT                   CPVHEAAEALGLTVRTPERLRRDDAERAYFRALDLDAAVVAAYGQILPADMLVAPRRGC
FT                   INIHASLLPRWRGAAPIHAAILAGDAQTGVTIMQMDEGLDTGATLLAEAVPIGPEDTTV
FT                   DLLDRLADLGAALVIKVLDGNFPPVPQPEAGVTYAPKLSKADAEIDWSASAAVILRRIR
FT                   AFWPWPGTETRLDGEALKIIRAEPAAGQGEPGTVLDDRLAIACGDAAIRPTLVQRAGRA
FT                   AMPAEAFLRGHPVAIGTRLG"
FT   CDS             575377..576144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="ACMV_05060"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="protein synonym:tRNA-uridine isomerase I"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05060"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79853"
FT                   /db_xref="GOA:F0J3J7"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3J7"
FT                   /protein_id="BAJ79853.1"
FT                   /translation="MRRWALRLEYDGRGFVGWQRQENGLSVQEVLETAASRLCGGDVPD
FT                   SVVAGRTDAGVHAAGQVAALELPDRLDARAVREALNFHMKPHAVAVIEAAPAPSAAWSP
FT                   RFSAIGRAYRYLILNRSARPALRDGFVWHVKAPLDAPAMHEAAQSLLGRHDFTSFRASS
FT                   CQANSPLRTLDRLDVRRDGETVVIEAEARSFLHHQVRNMVGTLKLVGEGRWRVGRVAEA
FT                   LAARDRSAAGPTAPPDGLVLVAVRYEVDPFPRN"
FT   CDS             576317..576787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="ACMV_05070"
FT                   /product="translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05070"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79854"
FT                   /db_xref="GOA:F0J3J8"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3J8"
FT                   /protein_id="BAJ79854.1"
FT                   /translation="MPQVRLIDQDGEMLGVMSTREAQRRAGEVGLDLVEISPNADPPVC
FT                   KLLDYGKFKYEQQKKKNEARKKQKVIEIKEIKVRPNIDENDYQVKLRAMKSFIGDGDKV
FT                   KVTLRFRGREMAHQELGVKVLERIRLDMETDTKVEQMPKMENRQMIMVLSPR"
FT   CDS             577086..577460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05080"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79855"
FT                   /db_xref="GOA:F0J3J9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3J9"
FT                   /protein_id="BAJ79855.1"
FT                   /translation="MDALIGGGSVAVTPEHKRVLFASTGAAAIDLESAAVARVAAEYGL
FT                   DFAVLRAIADPARRRLPPAALVALGPDGRISIEQVLKSVFRRPAQIPDLIALGREAAAA
FT                   RRTLQRALEFYRSRANTTGT"
FT   CDS             complement(577427..578230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05090"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05090"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79856"
FT                   /db_xref="GOA:F0J3K0"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3K0"
FT                   /protein_id="BAJ79856.1"
FT                   /translation="MTALTVATWNINSVRLRRDLLHSLMDQAAPDIVCLQETKVPDDLF
FT                   PEDLGTALGLPHVLKRGMKGYNGVAILSRLPLTAVEDTPDWCMKSDCRHIAARIDTGTD
FT                   PLVLHNFYVPAGGDIPDRAENPKYGHKLDFIAEARDHFAMNRPHRTMLVGDLNIAPLEN
FT                   DVWSHKQLLNVVSHTPPETEGLNAWRTEGFIDAIRHFVPDDQKLFTWWSYRNRDWRASN
FT                   RGRRLDHIWVSTDLIGNLARHAILQDARDWERGSDHVPVVLALDL"
FT   CDS             complement(578227..578910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05100"
FT                   /product="putative fumarylpyruvate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05100"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79857"
FT                   /db_xref="GOA:F0J3K1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3K1"
FT                   /protein_id="BAJ79857.1"
FT                   /translation="MSEFVIAPPAIPAVPVAGGGLFPVRRIFCVGRNYAAHTREMGGDP
FT                   NREPPFFFTKPADAIALGDSVPFPSATQNLHHEMELVVALGAGGRDIPSDAALAHIYGY
FT                   AAGVDLTRRDLQDEAKSLRRPWDMSKGFDLSAPISLIVPAARIGHPAAGRISLAVNGER
FT                   RQNGDLSDMIWPVADIISFLSSLVELKPGDLIYTGTPDGVGQIQPGDRVYGVIDGVGEL
FT                   EFTLA"
FT   CDS             complement(578939..579694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="puuD"
FT                   /locus_tag="ACMV_05110"
FT                   /product="gamma-glutamyl-gamma-aminobutyrate hydrolase"
FT                   /EC_number="3.5.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05110"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79858"
FT                   /db_xref="GOA:F0J3K2"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3K2"
FT                   /protein_id="BAJ79858.1"
FT                   /translation="MISRSSKLIGISCCRKLFGVFGMLNHAASDTYVRAVDLVIGGVPV
FT                   LIPANGDRSHVDTLLDRLDGLILTGSRSNVAAVFYGGPPQPPDDAPEDPERDRVTLPLV
FT                   RGAVARGLPVLAICRGLQELNVALGGTLHQRLQDLPGRIDHSTPMQPHAPVRTGKAHHV
FT                   TLRSGGRLARIVESNLLSVNSLHNQGIDRLAPGLLVEARATDGTIEAVTGTGPGYLVGV
FT                   QWHPEYDFEHDAASRRIFESFGAAVNKAV"
FT   CDS             complement(579789..580409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolA"
FT                   /locus_tag="ACMV_05120"
FT                   /product="putative outer membrane lipoprotein carrier
FT                   protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05120"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79859"
FT                   /db_xref="GOA:F0J3K3"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3K3"
FT                   /protein_id="BAJ79859.1"
FT                   /translation="MIARRALLGIAATCVAASFSPAWSAPLSSGHTQQVLGKVLDYLNS
FT                   LKTVTARFMQVGPDGSVRTGTAIVQRPGKMRFEYDKPDPQLLVAGFGLLVYHDPQLDQT
FT                   TNIPLSSTPLGILLAKHITFGGDVKLLRVSTPPGEIQVTLTRAGREAQGHITLVFSTNP
FT                   IELRQWRLTDAQDRVTQVSLYDLKPAAPFPDKTFEFVPGYNTN"
FT   CDS             complement(580428..580817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05130"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05130"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79860"
FT                   /db_xref="GOA:F0J3K4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3K4"
FT                   /protein_id="BAJ79860.1"
FT                   /translation="MGQQMNSEELVGVLRDTIVALVRREGVDLSARQLGVFLTCYLNDD
FT                   AHTVRGLASELNVSKPAITRALDRLSDLDLARRKVDPSDRRSVLVQRTTKGSAFLREIR
FT                   SVMTEVTSDGRSRPEQTSRRSVAAN"
FT   CDS             complement(581037..582428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05140"
FT                   /product="leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="protein synonym:leucine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05140"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79861"
FT                   /db_xref="GOA:F0J3K5"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3K5"
FT                   /protein_id="BAJ79861.1"
FT                   /translation="MILTPDPQTSHSGPRLPIRALRPDAVEPFLATADTPTAASVRMQG
FT                   FTGQASAVVLLHGPNGCSGALLGLGDRPTQATFGDLHAKLPPGAEWSLLPGDYDPGQAW
FT                   LGIALGTYRFERFRRPRPPLPRISVDHAPDRARHLASAICFARDLINTPANHLGPSDLA
FT                   DAGTTLAERYGAAVRRIRGAELEDGYPAVHAVGAGSERPPEVLQFNWGSDSSHPLISLC
FT                   GKGVCFDSGGYDLKPSAAMLRMKKDMGGAAITLGVAQAVMALNLPVRLDVRIGCVENSV
FT                   SGHAMRPLDIIRTRAGLNVEVGNTDAEGRLVLADLLADAADAKPHWLIDFATLTGAARV
FT                   ALGPDLPALFSNDDALANGLLAAGTAADDPLWRLPLWQGYESWLDSPTADLNSVASKPF
FT                   AGAIIAALFLRRFVPSGTPWAHIDTYAWNDSTRAGKPEGGEAQALHATFGAIEALASVS
FT                   TTKRP"
FT   CDS             582822..584726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="ACMV_05150"
FT                   /product="UvrABC system protein C"
FT                   /note="protein synonym:excinuclease ABC subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05150"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79862"
FT                   /db_xref="GOA:F0J3K6"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3K6"
FT                   /protein_id="BAJ79862.1"
FT                   /translation="MMSDTQRPAPKGIEVISGALVSMPAAPGVYRMLDLSGNALYVGKA
FT                   RSLKKRVTTYTQIARLPERLRRMVSETSTVEIITTHTEAEALLLEANLIKRLKPKYNIL
FT                   LRDDKSYPWLVITEDGDFPQLAKHRGAQVRKGRYWGPFASAWSVNQTIQALQRVFLLRT
FT                   CPDTVFANRTRPCLLFQIKRCSAPCVGRIDAEAYGALVRQASDFLSGRAGTVQHDLAAA
FT                   MAAAADVMEYERAAAIRDRIRGLAHIRGGDVINPESVGDADVIAIHQAAGQSCLQVFFI
FT                   RGGRNYGNRSFFPTQAQGATPGDVLGAFIAQFYDDKTPPPLILLSNTVPQADLLKDALG
FT                   LKAGYKVELAVPQRGEKRHVVEHAATNAREALERKLAESAGQEKLLAATAALFGLEGNP
FT                   ERIEVYDNSHIMGTNAYGVMIVAGPEGFIKPAYRRFSIKGPITPGDDFAMMREVLTRRF
FT                   VRATAEDPSREDGTWPDLVVIDGGAGQLSAARAVLDELGVSDVPLVAIAKGPDRDAGRE
FT                   WFHLPDRSPFQLPPRDPVLYFLQRLRDEAHRYAITTHRASRSRKITTSELDGIPGIGSA
FT                   RKKALLNHFGSARGVRQAGLKDLEAVSGINRTTARLIYGYFNPDARFDDLPAGGIRKD"
FT   CDS             584823..587039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05160"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79863"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3K7"
FT                   /protein_id="BAJ79863.1"
FT                   /translation="MSDTISGTVLSGVTLSSAQYADPVAIEGIIDVAGGNALVAPLTWT
FT                   IDVTGTIAASDDGGVLLLAGGQIDNHGLVTAASDAVLSTSGRAFDIQNEASGTLASASG
FT                   DAVKLSGGVTGSTLLNAGLISAGNAGIGLQIGAAVAINEAGGVIEGGSAGVVLGNVASF
FT                   DNFGTVGGSTGILVPIGQNYVDIVQGGLVSASSGPAISFTGGAVMTVTDTLTVLPGATF
FT                   DGAAIGGQVADLVFGGTTEGTFVNPTQEFVQFNTISIAAGATWDLAGISTISSSFRNDG
FT                   TLLVQAGDAIDFGAAVSGSGVIDLAGGFVDFANTVAAGTTIDFNAPGSFMQFNQSHPFS
FT                   GTVEGFTPGDTIDITGFGASQQLSGTVAGNVLTLNNGLAPLYVTFATAPGPLAVVAIGG
FT                   TNPKTFEVVVPCFRHGTRLLTPSGLRPVETLSEGDEVITLRGEVRQIAWRGRRRIDCRR
FT                   HPVPESVLPVLIEKDAFGVGQPCRDLYLSPDHAIWIDGSLVEIKRLINGLSIRQVTVPT
FT                   VTYYHVELESHDVVLAEMLPAETYLDCGNRFQFEDGDATISLFPDFGALARDPGRLYAP
FT                   VVDGGPDLARIRAGLQYRVASRGIRQKAGNFQVVADGKTVAPVWSADRHRIYRLPPAPC
FT                   DLKLLSTASRPAELDPASEDWRWLGIAICDAVLDGDPVDIAAPFFGRGFHGPEHAGDGW
FT                   FRWTDGTATMDAAGARELAFTVRAVAPVWDVPAPSCGVSVRHRA"
FT   CDS             complement(586969..587904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05170"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79864"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3K8"
FT                   /protein_id="BAJ79864.1"
FT                   /translation="MRRRLLVALPLLLAGCGTLPQPLLGKPGAMGARLAVPPPPVLIVP
FT                   PPPDALLGNRAADAYAHDLAKALVDRNVPSIVRPARPYDWQLEATARTANATVIPGFRI
FT                   IGPGHKEYGHLTGAEVSGAAWAAGDPATLRQAADAAAPGLVKQLSAINAAVQQSNPASL
FT                   ENRPPRVRLIRVTGAPGDGNHALKLDVSRDLPKLGVVMVDHTADADFLIDGVVKVSPAN
FT                   KDGKPGGSDLVELDWTVRNRRGGFIGKVSQLHDLKPSEMTPYWGDVAAAAASQAALGLR
FT                   QVIRNATLKHDALPKHRKTEPAHPTPAQQP"
FT   CDS             complement(587901..588644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05180"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79865"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3K9"
FT                   /protein_id="BAJ79865.1"
FT                   /translation="MISFVTASLDVPHGFFTRAGGVSPGPYASLNCGRSGQDDPANVAE
FT                   NRARAVMAIGGHRDRLAGLRQVHGAVAVTSPDPEGPFHEADAMVTDQPGLALGIITADC
FT                   APVLFSSADGRIVGAAHAGWRGAAAGVLEQTAALMRRMGASKIVAAIGPCIHRESYEVG
FT                   LDMRTAVLASGAESECFFSAGRPGHWHFDLPGYCAARLAMVGIDAAILPHDTLSDETAF
FT                   FSHRRRTLRGEGAGGHQISIIMVRS"
FT   CDS             complement(588641..589615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05190"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79866"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3L0"
FT                   /protein_id="BAJ79866.1"
FT                   /translation="MIERLDAFMARANAAYYASRDPFVDFVTAPEISQVFGELLGLWVA
FT                   MAWSMLGSPAPFALVEAGPGRGHLMTDALRAAKRAMPAFVEAADIHLIETSPRLIGLLK
FT                   DRLPQAMFHADLSTIPDQSIILLANEFLDALPIRQFVRRGPAWRERYVADGAFVEASAE
FT                   TALPDAPEGTVIERNETAEAFVAALASRISRRGGSALLIDYGHEGGATGESLQAIMDGQ
FT                   PADPLAEPGRRDLTAHVDFSRLAMAARNAGAEIRGPAAQGAFLAALGIHERTAQLGHHA
FT                   GQDDALRLLAATRRLTSPEAMGSLFRVMAICPRGMEPLPGFGA"
FT   CDS             complement(589612..590442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="ACMV_05200"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05200"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79867"
FT                   /db_xref="GOA:F0J3L1"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3L1"
FT                   /protein_id="BAJ79867.1"
FT                   /translation="MKNVYVWPHFDPILVRFGPFAIHYYALAYITALVLGWRLMRRLVR
FT                   EAPVVATHEQVDDFLSWATLGVVLGGRLGYILFYQPVYFLDHLNRTYAVWDGGMSFHGG
FT                   MLGVAVAILIYCRRHGIDPWRFGDRVAVPVPIGLFLGRIANFVNGELWGRPAPAWFPFR
FT                   MIYPESGSDVPRYPSELIEATLEGLVLFIVLLIASRNERIRSQPGYLGGMFVMGYGIAR
FT                   TTAECFRQPDWFLGYLMFGLTMGQLLSIPMIVIGATMIWRAKYVARRQGALATA"
FT   CDS             complement(590439..591419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaD"
FT                   /locus_tag="ACMV_05210"
FT                   /product="ADP-glyceromanno-heptose 6-epimerase"
FT                   /EC_number="5.1.3.20"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05210"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79868"
FT                   /db_xref="GOA:F0J3L2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3L2"
FT                   /protein_id="BAJ79868.1"
FT                   /translation="MILVTGGAGFIGSNLHAALHERDLNVVIVDKLRTTGKWRNLRAHP
FT                   PAMIVEPRELGDFLASQPPLDAVIHLGAISETTAIDGDLVWQSNVALSQMLWRWCAAQR
FT                   LPFIYASSASTYGDGSAGFDDDNDLAALRRLRPLNLYGWSKHAFDLWVAGECAAGRPRP
FT                   PQWAGLKFFNVYGPNEYHKGRMISVVKVKFDEVASGSPARLFRSDRADIADGQQARDFI
FT                   WVDDVVAAILFLLDHPEVSGLFNLGTGTARSYVDLARAVCSACGVGERIEFVPMPESLV
FT                   GQYQSFTEARMDRLRAAGFDRPFTPLEQGVEAYIRNFLSRPDQYR"
FT   CDS             591479..591832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05220"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79869"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3L3"
FT                   /protein_id="BAJ79869.1"
FT                   /translation="MTERPRFFDDLAGLAGGALSAASGLRDEISALVRARVDEAIRRLD
FT                   LVRREEFDAVMELAVRARAESEALASRVAHFEDMVIPAAPRPVGPDAGASATPSAPASG
FT                   PLAVPDQDGNAPI"
FT   CDS             complement(591808..592401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05230"
FT                   /product="septum formation protein Maf"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05230"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79870"
FT                   /db_xref="GOA:F0J3L4"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3L4"
FT                   /protein_id="BAJ79870.1"
FT                   /translation="MRVILASTSVTRQSMLKAAGVLADTESSGVDEAPIKRAGTLAGQS
FT                   AAVVAARLAREKALAVSARHPDAVVIGADQMLDCEGTWFDKPADREEAAETLHRLSGRT
FT                   HRLETSIACVRDGEVTWFHGEAPRLTMRPLSDAFITAYLAAEGEAALHSVGAYRLEGPG
FT                   IQLFERIEGDFFTILGLPLLPLLGYLRQIGALPS"
FT   CDS             complement(592402..593409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05240"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05240"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79871"
FT                   /db_xref="GOA:F0J3L5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014182"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3L5"
FT                   /protein_id="BAJ79871.1"
FT                   /translation="MKAVAFTHSLPVTADEALIDIEAPDPVLRTHDVLVEVRAVSVNPV
FT                   DTKIRRRNEPLGEPRILGFDAAGIVRSVGPGVTRFGIGDEVFYAGSVDRQGSNAQFHAV
FT                   DERIIARKPRSLSFAEAAALPLTTLTAWEMLFDRFSIPRDRVHHDTLLIVGGAGGVGSM
FT                   AIQLACQLTGLVVVATASRPETINWCSSLGAHHVINHHHPLAHQLETCEVSAPSYIFCT
FT                   NHVERHWRELCHVLAPEGRIGLIESTGPLDMNEIFNKSASVHTEYMFARSLHQTTQMIE
FT                   QHHILQSVSRLVDQGVLRTTMTENYGPITAANLRRAHAAVESGTTRGKIVLEGF"
FT   CDS             complement(593451..594176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05250"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79872"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3L6"
FT                   /protein_id="BAJ79872.1"
FT                   /translation="MPVVPFDVEPHDGAEPVVIGGLQTSILWRRSARARRIALRIDPQG
FT                   GRIVITLPPRGSRKAGLALLRGHEIWVAERLAALPAPVIIADGNEIPIFGRPHRIIHDP
FT                   SLRGGAIIERAAIRIGGHPEFLARRVRDALHDLALRELSAQARDKAAHVGVRPAAIRVK
FT                   DTRTRWGSCAANGTLMFSWRLIMAPSFVQDYVVAHEAAHLRHMNHGPDFWRLAEMLTPH
FT                   RVAATSWLAAEGPGLLRIS"
FT   CDS             complement(594185..594661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05260"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79873"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="InterPro:IPR008228"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3L7"
FT                   /protein_id="BAJ79873.1"
FT                   /translation="MSKAGNAPFWRTKRLEEMTPSEWESLCDGCGRCCLHKLRDEETNE
FT                   LAFTNVSCRLLDTATGRCRNYENRLREVPDCSALTPELVTAIDWLPPSCAYRLIAEGKD
FT                   LPDWHPLLTGDPESTFRAGASVAGRVRSETSVHHLEDHIVNWPARWPRARCHAG"
FT   CDS             complement(594700..595428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05270"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79874"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3L8"
FT                   /protein_id="BAJ79874.1"
FT                   /translation="MMKHNDVVRGVARGTTRVGIAALLLAIPLASCASDAGTPNAAQEL
FT                   VDRSTLTIETMLGSGTASAGQATQLLRNAKAVVVCPRIFKAGFFVGGEGGSCVLVSRAA
FT                   GGSWSDPAFYTMGSGSFGLQIGAQDAEVIMLLMNNTALNAFLNSQFKIGADAGVSVATL
FT                   GAGIGGSSGTALGADIVTFAKSRGLYGGISLSGSVFSNDAALDQQYYGQTVGPRQIVVN
FT                   MTVNNAGANPLRAMLAKYGG"
FT   CDS             complement(595486..596115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05280"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05280"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79875"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3L9"
FT                   /protein_id="BAJ79875.1"
FT                   /translation="MTELDMKPTTFWLIRHATVTPDALALLYGQMDVPICGERRLRDTP
FT                   RYAALASSLPRPAHWVVTPLSRTRLTAEAIMAAGYGPVVPQVEETLIEQDFGIWQGMNM
FT                   SEFNRRGSPHPFWPVGGDEQPPEGESFAQLRARVGAGLDRLGDAHRGKDVVAVSHGGAI
FT                   RAAVAHALDLTAHQALSLAIENLSVTRIEHHGHAWRVVTVNEQISI"
FT   CDS             complement(596138..596938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05290"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05290"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79876"
FT                   /db_xref="GOA:F0J3M0"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3M0"
FT                   /protein_id="BAJ79876.1"
FT                   /translation="MIAALRRIWGLMYRHFCLYRRSWPRLLELAYWPTLELLIWGFTAK
FT                   FVVQGHADLPVRAAGALIGGVLLWEVALRAQMGVTISFLEEIWSRNLGHVFVSPLRPRE
FT                   MVFALLGVSIMRSLAGLAPAAVIAFLLYDFNVFTFGPALILFMLNLFLMGWWLALGVIS
FT                   LLFRYGASAEALAWTLAFGLTPVACVFYPASILPGWLRPVADALPAAHIFAGMRSALYR
FT                   HVTDFSQLGIAFGLNGIWMAAAAMIFAAQFRAARRNGALVTIGE"
FT   CDS             complement(596935..597672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05300"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05300"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79877"
FT                   /db_xref="GOA:F0J3M1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3M1"
FT                   /protein_id="BAJ79877.1"
FT                   /translation="MDAINVENLTKSFGAVRAVEGVSFRVAPGTTCGLLGGNGAGKTTT
FT                   ISMLLGILAPDAGAIRVLGHDMARDRFAALARMNYSSPYVALPMRLTVEENLRVYGHLY
FT                   NVPQLERRIRELARDFDLEALLRRKAGALSAGQKTRVALAKALINRPALILLDEPTASL
FT                   DPDTADYVRTGLERYRDETGAAILLASHNMAEVERLCAEVLMMKGGRIVDRGTPAGLIA
FT                   RYGRGDLEQVFLAIARGTESRAS"
FT   CDS             complement(597695..598348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metW"
FT                   /locus_tag="ACMV_05310"
FT                   /product="methionine biosynthesis protein MetW"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05310"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79878"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3M2"
FT                   /protein_id="BAJ79878.1"
FT                   /translation="MSQQAPVRFVGKNMRVDLELIAEMIPPGSRVLDIGCGDGALIDLL
FT                   ARTRRCDARGIEIDMAEVTRAVAHGLPVMQGDADADLIHYPDAAFDYVVLSRTLQAVEQ
FT                   PREVLRQMLRVGTRAIVSFPNFGHWSLRWQLFSTGRMPMTTTWNRMWYETPNIHPCTIR
FT                   DFFDLCATEHYQVEQWLAADEAGRRAPWRRFPLLANLFGEQGLFVLRREPAAED"
FT   CDS             complement(598345..599490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="ACMV_05320"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05320"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79879"
FT                   /db_xref="GOA:F0J3M3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3M3"
FT                   /protein_id="BAJ79879.1"
FT                   /translation="MDQSPFPDIAHQTASFSDGLVLDCGTTLQRLEVAYRTYGSLNAEK
FT                   SNAILICHALTGDQYVAEPHPLTGKPGWWNALVGAGKPVDTDRFFVICANVLGGCMGST
FT                   GPRSRRDHGADEPWSIDFPAITVQDMVRAQKKLVDWLGIERLFAVVGGSMGGMQVLAWA
FT                   SLFPDRVFAAVPIATAPYHSAQNIAFHEVGRQAIYTDPDFHGGHYRTHGVIPARGLAVA
FT                   RMTAHITYLSEAALARKFGRRLQRQNALAAPVFGERFAVESYLEHQGSSFVRRFDANSY
FT                   LVITRAMDYFDLAADHGGSLSAAFRGTKARFLLVSFSSDWLFPTAESRAMARALNQVAA
FT                   NVSFVEIVSDKGHDAFLLDEPDFHRTVAGFISGAAEAAGLQ"
FT   CDS             599596..600483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05330"
FT                   /product="putative chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05330"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79880"
FT                   /db_xref="GOA:F0J3M4"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR020822"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3M4"
FT                   /protein_id="BAJ79880.1"
FT                   /translation="MSETPPSPTPNDTAPETLARLRAEIDALDDRIHDMLMQRAEIIER
FT                   VASQGGKRGVPIRPGREAAILRRLLDRHQGSLPQHTIVRIWRELFSGALMIEGGLVIAV
FT                   ADGVQAELLAVAREHFGPLTAMRRHRTPSQALADVTGAAAHAAVLPLPSDEDDDQAAWW
FT                   VGLMHGGPPRLSIVAKLPFWGRRGEGVPQADAYVVSSFVPDASGNDRSLIGIEIVPDTS
FT                   TARIVGMLRDAGFDVGSLLLRRVTRREVGYALADVEGYVPREDARLGTLAGFLAPPVVL
FT                   GSYAAPVGASGPSR"
FT   CDS             600480..601574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="ACMV_05340"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /EC_number="2.6.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05340"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79881"
FT                   /db_xref="GOA:F0J3M5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3M5"
FT                   /protein_id="BAJ79881.1"
FT                   /translation="MSGLPTARPAVFSVPPYVGGESRLDGVNRVIKLSSNEGAFGPPPG
FT                   AIAALTEVAAIAHRYPDGGATSLRAAIGRRFCLDPARIVCGNGSDDLIALLIQSYGGPG
FT                   TELVMSRHGFLIYEIAARLAGMNVRKAPERNLTADIDAMLAEVTPATRLVFLANPNNPT
FT                   GSLVPASDVSRLRAELPPDVLLVLDAAYAEYVERADYDPGVELVDSGQNTVMTRTFSKM
FT                   FGLGGVRLGWAYAPLAIVDVLNRTRMPFNVSGPAAAAGIAALDEPGWVERCRNHNTRAR
FT                   TELAARIERAGFRVWPSEANFLLADLETADRAAAADTHLRSRGIIVRQVAAYGLPQCLR
FT                   ITIGTDEECSTVADALDDFGQNHG"
FT   CDS             601567..602454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05350"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05350"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79882"
FT                   /db_xref="GOA:F0J3M6"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3M6"
FT                   /protein_id="BAJ79882.1"
FT                   /translation="MAEPLFNRLALLGIGLIGSSIARVARERGDLARTIVANARTQATL
FT                   DRVMELGIADECEIDPARAVQGADCVIFCAPVGAYAALAEAIGPHLAPGAIVSDVGSTK
FT                   QSVIRDIGPHLPEGVHFVPAHPMAGTEFSGPDAGFAGLFKGRWCLLTPVPGTDQDAISR
FT                   MRTFWERCGAMVSVMDAAHHDRVVAIVSHLPHLIAFTICGTADDLADETRQEVLQFAAS
FT                   GFRDFTRIAASDPTMWRDVFLNNREALLEMLARFTEDAQAMARAVRWGDAAYIEDKVLR
FT                   GRKIRQALIDINQA"
FT   CDS             602530..603465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="ACMV_05360"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="5.4.99.-"
FT                   /note="protein synonym:tRNA pseudouridine 55 synthase"
FT                   /note="protein synonym:tRNA-uridine isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05360"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79883"
FT                   /db_xref="GOA:F0J3M7"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3M7"
FT                   /protein_id="BAJ79883.1"
FT                   /translation="MAPNQTRQKRGRIIDGWIVLDKPPGITSAHAVARIKRLLQAAKVG
FT                   HGGTLDPLATGVLPIALGRATKMVPYVMDGTKRYRFTLRFGEARDTDDADGAVVMTSDF
FT                   RPETSDIDAALVAFRGTIMQVPPAFSAIKVDGERAYDLARAGLPPELPPRPAQIDRFDL
FT                   IDRPDPDHAIFEVESGKGVYMRSLARDLARAVNTVGHIAALRRLSVGPFAETGSTTLDK
FT                   IADSGDSLARDPDFLLPVETALDDIPALALTEAEAAALRNGQALSLVQFMGRIPLACDP
FT                   DGGLARLMAGRRFVALGRLTDGQLKPERVL"
FT   CDS             603489..603758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="ACMV_05370"
FT                   /product="30S ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05370"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79884"
FT                   /db_xref="GOA:F0J3M8"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3M8"
FT                   /protein_id="BAJ79884.1"
FT                   /translation="MSITPDRRQELIGEYANKANDTGSPEVQVALLTERIVNLTEHLKT
FT                   HAKDFHSRRGLLMLVGRRRRLLDYVKRQDVKRYEALIGRLGLRR"
FT   CDS             603899..604669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05380"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79885"
FT                   /db_xref="GOA:F0J3M9"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3M9"
FT                   /protein_id="BAJ79885.1"
FT                   /translation="MAMGPDMRSYRSATVAAGAGVLDEGLRAYMLRVYNWMASGLLLTA
FT                   IVSYAISHTGLINAFYPLVATPGGAMIREPSILAYISIFAPLAFMLVMSFGVNKLSTTQ
FT                   AQALFWAFCGLMGASLTNIFLVYTGQSILTTFFVTAGTFAAMSIYGYTTRTDLTKFGSF
FT                   LVMGVIGLLIAMVVNIFLHSPAMQFAISAIGVLVFTGLAAYDTQRIKADYVQYGYRFGA
FT                   GMAAKRSVYDALQLYLNFINLFLFLLQFMGNRRN"
FT   CDS             complement(604762..605055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="ACMV_05390"
FT                   /product="phosphocarrier protein HPr"
FT                   /note="protein synonym:histidine-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05390"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79886"
FT                   /db_xref="GOA:F0J3N0"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3N0"
FT                   /protein_id="BAJ79886.1"
FT                   /translation="MSADHSPVRLAQTVTICNARGLHARAAAKLVTLAEKFSASVEVSR
FT                   DGQSVSAQSIMGLMMLGAGLGSTIEITAEGWDAKEALAAVVELVEAGFYENG"
FT   CDS             complement(605052..605474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05400"
FT                   /product="phosphotransferase system enzyme IIA component"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05400"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79887"
FT                   /db_xref="GOA:F0J3N1"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3N1"
FT                   /protein_id="BAJ79887.1"
FT                   /translation="MIGMVLVSHGKLGVALREALEHVVGPQRNIATVSVEADADIETQR
FT                   KEIADRVADVDTGDGVVVLTDMFGGTPCNLSMSMLERDDVEVIAGVNLPMLVKLAKVRG
FT                   SHSLADAVHCAEEAGRKYIACGSEILHPVTPKRACG"
FT   CDS             complement(605471..606382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05410"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79888"
FT                   /db_xref="GOA:F0J3N2"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3N2"
FT                   /protein_id="BAJ79888.1"
FT                   /translation="MSARMVIVTGLSGAGRNSVLRALEDIGYEAVDNPPLRIVETLVRG
FT                   DKPLAVGVDARTRDFSAEDVLSTIDRLQTRGCVRPELIFITASPEALQRRFSETRRRHP
FT                   LALAGTVSEGIETEQALTRTLRNAADWVIDTSELSLAGLRQIIDQRFGLGGPGMSITLV
FT                   SFGYPSGLPQEADLVLDTRFLRNPHYIPDLRDRTGLDPQVRDYIRQDPDFPEFFERVSG
FT                   LTDYLLPRFVREGKKYVMIAFGCTGGKHRSVSLVEMLGSRLRNADWNVLIEHRSLGSRS
FT                   AGGAWKAMPGAHQGAPMPGVQK"
FT   CDS             complement(606379..606717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05420"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79889"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3N3"
FT                   /protein_id="BAJ79889.1"
FT                   /translation="MLKLIDRGFNLVADDQVQVAGDQVSAPDTLVGMIELRGIGLFGVP
FT                   AVRQATLKLVVQLCGIEERLPKPRTNDTLNAPEITINPHSCSAPIRIHWALDALGGRRM
FT                   QYCGSFVE"
FT   CDS             607864..608547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05430"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05430"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79890"
FT                   /db_xref="GOA:F0J3N4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3N4"
FT                   /protein_id="BAJ79890.1"
FT                   /translation="MRILVVEDDKDVGGFVVKGLREAGHTVEHADNGRDGLFMAASENF
FT                   DAIILDRMLPGGIDGLRLLETLRAQDNVTPVLFLSALGEVDDRVKGLKAGGDDYLTKPF
FT                   AFAELLARVEAMARRGKGEGPATRLNVGDLEMDLLSRGVKRAGQKIDLQPREFRLLEYL
FT                   MRHAGQVVTRTMLLEGVWDYHFDPQTNVIDVHISRLRQKIDKPFDTPLLHTVRNAGYML
FT                   RVEEP"
FT   CDS             608629..610023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05440"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05440"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79891"
FT                   /db_xref="GOA:F0J3N5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3N5"
FT                   /protein_id="BAJ79891.1"
FT                   /translation="MRSAGVRFAIFYALVFGISAIVLAGSLYYSTIGLLGRQTHEAIRV
FT                   DARSLAAHFEAGGLTGLVLTLDSRISEDINDHAIYLLVDPLGNRIAGNMSRWPQGINTA
FT                   HVWYQVPLERGGRKSTALMRYYELPGGFQLLVGRDVSTRAQLRRILRDGLLWALAAMAF
FT                   LGVLGAIVIRGLFKRSLADISGITRAIARGDLTRRVRRSGNGDEFDELAETINDMLDRI
FT                   AKLMDGVREVSNSIAHDLRTPITRARARLEDAAAHARTTEELQSAVERATLDLDGIVNV
FT                   FQALLRIAEIEAGARRSAFRDVDLAPVLDDLAEFFDALAEERGILIVRDWPKSIPIFGD
FT                   RDMLQQAVSNLLDNAIKFSRETDRVVIAAHAGGGHVEIQIADHGPGIPEADLSRATERF
FT                   YRAEAARSTPGSGLGLALVSAIAQLHGGSLLLENNEPGLRARLILSQRDNAPPQSPRQE
FT                   AASSMA"
FT   CDS             610189..611511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05450"
FT                   /product="putative major facilitator superfamily
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05450"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79892"
FT                   /db_xref="GOA:F0J3N6"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3N6"
FT                   /protein_id="BAJ79892.1"
FT                   /translation="MTDTTSAAAPSSWSARLTPAHWRVLTAAFFGWVFDGYETYALITV
FT                   IGPAMAALLPASERGHIHAAAGLAIAITLLGWAAGGTVGGIAADYIGRKRMLLISVVGY
FT                   SLFTGLTAFSTSVGMLVAFRFLTGLFLGSEWSTGNSLLAETWPNEARPKGAGFLQSGFG
FT                   FGAFLAAAVWYLLRPLGPDAWRAMFLVGVLPGFLVLFLRRRIDDSEAWARAVREKRWAV
FT                   TENSGRLSLSARPFTLFQLFADPEGRRRTVLACLMSISTTMGWWGIATWIPGFVGGFAA
FT                   HHGLHGPYWASVAGLVYTAGAVVGYLVSGFLADWMGRRRYLVFLFVGGLVMTPAVYLWS
FT                   HSLATLLFASWLNGFWTLGAFSWYAIYLPELFATNVRGTASAFVFNASRFIAFLGPLMA
FT                   GELIGALGGLAHVALAFSVIYVIGLVVAPFMPETKGQPLPQ"
FT   CDS             complement(611527..614241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05460"
FT                   /product="putative outer membrane autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05460"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79893"
FT                   /db_xref="GOA:F0J3N7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034061"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3N7"
FT                   /protein_id="BAJ79893.1"
FT                   /translation="MQTLINLGTAQTWTYPAYNQYVPTTVVTAIQEGATGAGVSIGILD
FT                   TGANTGVQALQGRVAWFNSYLAQGNNTLNQNNIASANDPYGHGSIVTALLGGATQGTYD
FT                   NTQGPVNFFAGGVAPDATLYVAQTCDATGACTLYGKTYQDLMANGVHLFNQSLAENASS
FT                   FSTTSAAIQASQQIGALFAPFGTGNLYVWAAGNNPQSPNDISVEAEAPAYTNSLQPQWI
FT                   SAVNVDINSLGQVSGLDPTSNACGITAQWCIAAPGYDQVPIVAGTSFNTGFAVGTSFSA
FT                   PIITGVAALIWQKFPWFTPANVSDTLLTTATPLGSAPAPNTTYGWGLVNAAAAINGPAQ
FT                   FAFGTFTANIGSDQGTFSNNIGGSGGLVVDGTTGTLTLTGNDGYAGGTTINGGNLALTG
FT                   SLGSAVTINGGSFGGSGTVNGSVTNAGGTLVSQAAAGSSGLTINGNYATGSGSSTAIAI
FT                   GNPLTVSGKAQLNGTFKVLAPPQTYLPQSIETFISAGSIQGAFSNQTYGAGVYYTVSNL
FT                   QYGAQDLTATVTRSNVAQVAAAMPGATPVAVAAASGVQGALQQINTWSAGEAAANPTFL
FT                   NAVAAVLSARTAQQAQASLTSLSGEIYPTLRTITIDEDMSISRAIAGHAAEHQAGPTTS
FT                   VWVRYLGTFGSFRETGTDAAHYNDNGVVVGLDTPIAPGFTAGVAFAHDQANASLNGFGG
FT                   RFRSDLDTATAYARLGGAAGPYLTGQVSYGWMNGRVDRSVLLGYQTAPVSSEPTGTIGG
FT                   LAAEAGYRIGAWTPYVRLGAVHLYEHAVSETGGLGFGLAMPAVDQTDGYVTTGLRGRTV
FT                   LALFGHAILASGRLAWQHRLGGSSNSQGAFEATPAATFNLSGQNMPVNVLRAGFQLSGR
FT                   LDRAWSWNAGVSVNYAPSGMNAEAVNVGLKARF"
FT   CDS             615311..615493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05470"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79894"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3N8"
FT                   /protein_id="BAJ79894.1"
FT                   /translation="MPVTMRQTHASDKKLFVDYAGDTVLVVVGRLTCETRAAQISSRFS
FT                   AHRAASMPRRPQLDA"
FT   CDS             complement(615665..616321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05480"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79895"
FT                   /db_xref="GOA:F0J3N9"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3N9"
FT                   /protein_id="BAJ79895.1"
FT                   /translation="MTPRPLAVRIARGHPRLFTGLLCGALVFLLLSGDLAPTLRVVIGW
FT                   DIAVAVYVALAMLHFSRADHTRIGADAARQEEGEWTIFGLSLAGALMSFTAIVIFAARG
FT                   KGTTAHTPYVALAAATLVASWLMTQITFTYRYAHEYYAATDSGPEGGLAFPGGEAPDYL
FT                   DFVYFSFVLGMTFQVSDVNILSRKMRRLATLQGVIGYLFNTVVLALAINIAAGLF"
FT   CDS             complement(616387..618030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05490"
FT                   /product="putative L-ribulokinase"
FT                   /EC_number="2.7.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05490"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79896"
FT                   /db_xref="GOA:F0J3P0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006003"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3P0"
FT                   /protein_id="BAJ79896.1"
FT                   /translation="MSHPANHIVIGVDVGTGSARAGVFGLDGTMRGSAVRAIRAWRPRP
FT                   DFIQQSSTDIWAAVSDAVRCAMAEAGSGLVVRGIGFDATCSLVVLDEAGAPLPVEPDGD
FT                   PAQDVILWADHRAQAEADEINAGGYEVLRYVGGRISLEMETPKLLWLKRHAPQSWAAAR
FT                   HVFDLPDFLTYRATGAASRSLCSTVCKWTYLGHEERWDEAYFRAIGLGELADEGFTRIG
FT                   TTILPIATPVGGGLSAEAAAAFGLAPGIPVGTSAIDAHAGGIGVIGAALDGMAPDAAAL
FT                   GRRVALIGGTSSCHMAVAPEPRFVPGVWGPYHAAMIPGMWLNEGGQSATGSLIDHMVTT
FT                   HAAYPALAAAAKAEGVSIYERLNALVGRMAAEAGSAAALTEGLHVFPDFHGNRSPRADA
FT                   TLRGMISGLPLSADEADCARLYLATLQALAYGTRHIIETMNANGYAIDTIMATGGGTKN
FT                   PLFLREHADATGCRIVLPAEPEAVLLGSAILGAVAGGVYPDLPAGMAAMSRAGAMIAPE
FT                   AANAGFHARKYAVFRRMHDDQMAYRALMRS"
FT   CDS             complement(618058..618999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05500"
FT                   /product="putative carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05500"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79897"
FT                   /db_xref="GOA:F0J3P1"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3P1"
FT                   /protein_id="BAJ79897.1"
FT                   /translation="MTGMIVTMGEILVDILAEEKGQGFHEPGRLLGPFPGGAPATFIAQ
FT                   AARLGAGAGIISCIGDDDFGWLCVDRLRREGADVSAVRIEPDQVTASAFVRYREDGDRD
FT                   FLFNLKRSAAGRITIDAAARAMLAQCAHFHIMGSSLFSFHIIDEMKKAIELAKANGAVI
FT                   SFDPNIRKEMLMIPEMRAGLEFMLGYTDIFMPSGPEILLPTEAKSERAAVEELLDLGVR
FT                   MVVIKRSRKGVSFRSRDEQFDLPAFPVEEIDPTGAGDCFGAAFVTCLLQGMGTRRALDY
FT                   ARAAGALAVSRKGGMEGVADFATLDAFIAAAG"
FT   CDS             complement(618996..619850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05510"
FT                   /product="DeoR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05510"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79898"
FT                   /db_xref="GOA:F0J3P2"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3P2"
FT                   /protein_id="BAJ79898.1"
FT                   /translation="MTLGAKSAVLQRRLKIADWIRQYGQMRVDELSTALKVSEVTIRGD
FT                   LTYLEEQGLIVRSFGKAIAAKSGAPRDRPAGAPLTKALLVPMLRRAQALIGPDQTVLIG
FT                   PGPLATQAIPWLAEIPGVSVVLTSTEAIPLARTCLDARIYLLGGEITAESGMIEGAGAL
FT                   RMLDHFALGWSILEADALSADSALLVAAKPAERLAEAAIRRSTRSIVLIGNPALSLERR
FT                   TAQLGLTGISDLILPGMPSNRLRDILLGAGFRPVETDGGTEAHFSSHPAHSRSGARAFG
FT                   EAS"
FT   CDS             620277..621587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05520"
FT                   /product="sugar ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05520"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79899"
FT                   /db_xref="GOA:F0J3P3"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3P3"
FT                   /protein_id="BAJ79899.1"
FT                   /translation="MKRQIRIAVGGLALGCLGITAAHATTLTIATVNNPDMLQMQKLSP
FT                   QFTKETGIKLNWVVLPENTLRQRVTTDIATNSGNFDIVTVGSYEVPIWGKAGWLAPIKN
FT                   LPASYDVKDLFPSVRNGLSYKGTLYALPFYAESSATYYRKDLFKAAGLTMPAHPTYTEI
FT                   EKFAAKINDPSKGIYGICLRGLPGWGENMAYFTTLVNTFGGRWFNMKWQPRIDSPAWKK
FT                   AANFYVNLEKKYGPPNVTSNGFTENLALFSQGKCGMWIDSTVAAGTLWDPKTSKVANEV
FT                   GMVSAPVAVTPHGAHWLWAWALAMPKTTRHKADDMKFLEWATSKAYLKLVGKTFGWVQV
FT                   PPGTRISTYDNPDYTKAAPFASKVKEAILSADPNNPTLKKVPYTGVQFVAIPQFEGIGT
FT                   EVGQQIAAALAGQKSVDAALAQAQKATARTMKEAGYH"
FT   CDS             621660..622571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05530"
FT                   /product="sugar ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05530"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79900"
FT                   /db_xref="GOA:F0J3P4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3P4"
FT                   /protein_id="BAJ79900.1"
FT                   /translation="MIQPTSGTITPGRSGATQRRQVRTLPLLLPAVILLLLWSILPLLQ
FT                   TILYSFQHYNLMEPPSAYNGGLNYTYLFTDSSTWTAIWNSVVLVAGTLVASIVFGTIIA
FT                   LLLNNDFPGRNIARLMAIAPFFVMSPVAALIWKNLLLDPVSGLAGWLMTLVGFKPIAWF
FT                   SVYPMVSIVIIYSWRWIPFATLILLTALQSLDTDQLEAARMDGAKGLARLRYIVLPHLG
FT                   RPISIVVMLESIFMLSAFAVIYTTTNGGPGHATTTLTYMIFIRALNDFSIGSASAAGVF
FT                   AIVLANILAFFLIRAVSRTLQA"
FT   CDS             622582..623403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05540"
FT                   /product="sugar ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05540"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79901"
FT                   /db_xref="GOA:F0J3P5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3P5"
FT                   /protein_id="BAJ79901.1"
FT                   /translation="MKPSLSSRVVLAILAWAAAFIMFFPILWMLVTAFKTEGQAIAIPP
FT                   LLIFTPTLKSFFDATQNAGYLLFALNSVIVSVGSTVLAIAIAFPAAYALAFFPGKRTEF
FT                   TLMWMLSTKMLPAVGVLMPIYLFLKNVHLLDTRLGLVGIDTLMNLPIVVWMLYSFFKDI
FT                   PHEILEAARVDGVGPRQQMIHLLLPLAGPGVASTALLSVILAWNEAFWSINVTASHAGT
FT                   LAAYIARFSAPEGLFWAKLSAASVLAVAPILVFGSLTQRRLVRGLTFGAVK"
FT   CDS             623413..624510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05550"
FT                   /product="sugar ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05550"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79902"
FT                   /db_xref="GOA:F0J3P6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3P6"
FT                   /protein_id="BAJ79902.1"
FT                   /translation="MAKLLLEKVEKRYEGFHAIKGVDLSIDDREFVVFVGPSGCGKTTL
FT                   LRMIAGLEEITGGDFSIDGVRANDIPPDKRGLAMVFQTYALYPHMTVAENMGFALKMAK
FT                   VPKAEIEKKVAHAAEMLQLDKVLARRPKALSGGQRQRVAIGRAIVRNPKGFLFDEPLSN
FT                   LDAALRVQMRTELVKLNKQLETTMIYVTHDQVEAMTMADRIVVLNGGIVEQVGSPLELY
FT                   HNPANLFVAGFIGSPKMNLLEGEIAARDDAGADVKLDDGGTIRVEAANIAAAPGLRVTL
FT                   GTRPEHTALAADGEIGGTADFVEHLGNETLVYVKRPGEKQMIVKADDLAGVRMGDPVRM
FT                   KPQSARAVLFGPDGKALLRREFHLH"
FT   CDS             624547..625320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05560"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05560"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79903"
FT                   /db_xref="GOA:F0J3P7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3P7"
FT                   /protein_id="BAJ79903.1"
FT                   /translation="MYLEKYDLKGRNAVVTGGGRAIGLACSTALAEAGAHVVIADRDAN
FT                   VCEEGKAELARLGYSADAIVLDVTDPDAVNAAADSLNAKFGAIDILVNNAGIARSGVAA
FT                   EDVTDEHWLDVINVNLNGVFWCARAFGRAMLARQRGVIVNTGSMSGFISNKPQKQSFYN
FT                   ASKAAVHHLTRSLAGEWADRGVRVNAVAPTYIDTPLTRFGMEDPELNRIWLDMTPMHRV
FT                   GQPHEIASVVLFLASDASSLMTGSIVLADGGYTVW"
FT   CDS             625328..626101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05570"
FT                   /product="putative sorbitol dehydrogenase"
FT                   /EC_number="1.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05570"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79904"
FT                   /db_xref="GOA:F0J3P8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3P8"
FT                   /protein_id="BAJ79904.1"
FT                   /translation="MSGRLQGKYAAITGGAGGIGRAMAAGYIAEGATVCIADRSLEAAA
FT                   AAACELGPQAHACALDVAEMASIAAFTDFTAARGGLDILVNNAAVFDLAPIADITEASY
FT                   DRLFAVNVKGLLFTLQAVARQMIANGRRGRIINMASQAGRRGEALVGVYCATKAAVISL
FT                   TQSAGLDLIRHGIRVNAISPGVVDTPMWQEVDALFAKYESLPVGEKKRQVGLAVPYGRM
FT                   GRPDDLVGAAIFLASDEAEYVVAQTLNVDGGNCMN"
FT   CDS             626182..627681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="ACMV_05580"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05580"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79905"
FT                   /db_xref="GOA:F0J3P9"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3P9"
FT                   /protein_id="BAJ79905.1"
FT                   /translation="MNFSQPIIDPFDYVVFGGTGDLARRKLLPALYLRDLDGQLPETSR
FT                   IVGSARTDMTGEGFRELVEASLREFIADKLDPEVLARFLARLHYVSVDAKAARGWPELA
FT                   TLLSDEPRQIRVFYLATAPELYGPIADNIHAHGLQTPETRIVLEKPIGHDLASARAIND
FT                   RVGAVFEERNIFRIDHYLGKETVQNLLVLRFANSLFEPVWNHNGIDHVQITVAETVGVE
FT                   DRGGYYDHTGALRDMIQNHLMQLLCLVAMEPPATFDREEVRDEKIKVLKSLAPISRDDI
FT                   ATKSVRGQYRAGAIKGGPVKSYAEEKDIAPGSTTETFAALKVEVRNWRWAGVPFYLRTG
FT                   KRMPEKVSEIVIQFKPVPYWIFPTGSDHAMPNRLVIRVQPDEHIRLHLWTKEPGPGGLR
FT                   LRNAPLNLSFAETFKNNHMPDAYERLLMDVVRGNATLFMRRDEVEAAWEWTESILDAWK
FT                   SAGDRPKLYTAGTWGPSEAVAMIVRDGRTWFDEQAGYGAGD"
FT   CDS             627724..629538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="edd"
FT                   /locus_tag="ACMV_05590"
FT                   /product="6-phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05590"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79906"
FT                   /db_xref="GOA:F0J3Q0"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3Q0"
FT                   /protein_id="BAJ79906.1"
FT                   /translation="MVQDAIARVTDRIRARSEAGRAAYLARTGALISRGVHRSAVGCAN
FT                   LAHALAGCAKAEQDDLKRDDKPNIGIVTSYNDMLSAHQPFGRFPDLIKHAVREAGGIAQ
FT                   VAGGVPAMCDGVTQGREGMELSLFSRDVIAMATAIALSHDVFDGALLLGVCDKIVPGLV
FT                   IAALSFGHLPAIFVPAGPMPSGISNTEKSRVRQLYAEGKVGREELLESEIGAYHSPGTC
FT                   TFYGTANSNQMLMEIMGLHLPGASFVNPNTELRDALTGAAAKRILEITARGNEFTPVGQ
FT                   MVDERTVVNGMIGLLATGGSTNHTIHLVAMARAAGIAITWQDFSDLSEHIPLLTRIYPN
FT                   GSADVNHFQAAGGMPVLIGALLDAGLLHGDARTVWSPDGLQAYRDQPVLEEKVLRWKPA
FT                   PAASLNRDILRDATEPFSKDGGLRIMHGNLGQAVTKISAVKPEHRVVVAPARVFRSQEA
FT                   MQEAFKAGELHRDFVAIVTHQGPKANGMPELHKLTPPLGVLQDLGFKVGLVTDGRMSGA
FT                   SGKVPSAIHVTPESACGGALAKVRDGDMIRLDCEAGILEVQVDQAEFAARPLPEVDLSA
FT                   HHHGIGRDLFGAFRAAVAGADLGASVFA"
FT   CDS             629535..630170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="ACMV_05600"
FT                   /product="2-keto-3-deoxy-phosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /EC_number="4.1.3.16"
FT                   /note="bifunctional protein"
FT                   /note="protein synonym:KHG/KDPG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05600"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79907"
FT                   /db_xref="GOA:F0J3Q1"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3Q1"
FT                   /protein_id="BAJ79907.1"
FT                   /translation="MNRQDGLDALLAVSPVIPVLTIDNAADAVPLARALIEGGVGVVEV
FT                   TLRTKAAMEAIAAMAEAVPEMVVGAGTVLTPSQYREVEEAGAKFVVSPGSSPAVHAAAA
FT                   KSRVPFLPGAATPTEVLHLLEAGFRYQKFFPAEQAGGIPMLKAIGAPIHEVTFCPTGGI
FT                   TPTTAPDYLALANVICVGGSWLTPAAALRAGDWAGIAKLAAQAAALKR"
FT   CDS             630227..631570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05610"
FT                   /product="sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05610"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79908"
FT                   /db_xref="GOA:F0J3Q2"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3Q2"
FT                   /protein_id="BAJ79908.1"
FT                   /translation="MNFTVIAIIAGLGGLLFGYDTGVISGALLFIRHVFHLGPAMQGVV
FT                   VAIALGAAAVGAAVAGTLSDKFGRRPVLLVTAAVFVLGALLSAAAWSVAILLAGRVLVG
FT                   GAIGVASMLTPLYLSEMSPRDKRGAVVTINQAYITIGIVVSYGVGYLFSHGGDGWRWML
FT                   ALGALPGVILFAGMLVLPESPRWLAGKGHREAARKSLAFLRGGHDVESELRDLRQDLAR
FT                   EGRATAPWSVLLEPRARMPLIVGIGLAVFQQITGINTVIYFAPTIFQKAGLSSASVSIL
FT                   ATAGVGLVNVVMTFVAMRLLDSAGRRRLLLVGLSGMLVTLLAVAGGFMAGMQGGLAWVT
FT                   VISVAAYVAFFAIGLGPVFWLLIAEIFPLAVRGRGMSLATIANWAFNMLVSITFLDLVH
FT                   GLGRGPTFLIYAAMTLITLVFTWFLVPETKGRSLEQIEAALEGEGRLA"
FT   CDS             complement(631578..632852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05620"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79909"
FT                   /db_xref="GOA:F0J3Q3"
FT                   /db_xref="InterPro:IPR031566"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3Q3"
FT                   /protein_id="BAJ79909.1"
FT                   /translation="MHPHVTGLAALVPFFGTLASFALLPGVAPRLWHRYMLRISLFWVA
FT                   LGLVFGAEAAGPAAALTQLWHSGLVDFLPFIAVLMALYTLGGGVLIAGGPWGRPGGNLL
FT                   LLAAGTLLASAMGTIAASLLLIHPLLSANAARREVRHLVLAFIFVVANAGGALTPLGDP
FT                   PLLIGFLRGVPFFWPLFNLAGPMLVVVLPVLALTFAIDWRLARREPVRPAERIRVRGGA
FT                   NLAMLGIFIAVLTVAGIVPGPEIAIGPASLPAGQIAITLTAIVFVAASERVTPRAIRAR
FT                   NQFAWAPMREIAILFFAIFATIPPVLRTVTAAGLPQSAAGWFWASGLSSAFLDSGPTYL
FT                   MFFEAAGGNAAQLIAPPATLLTSFAAGSVLFGGLTYLGNAPNLMIRAIAARRGVRMPGF
FT                   FGYMLAASAVLLPLFALTTLIFFAG"
FT   CDS             632965..633600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05630"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79910"
FT                   /db_xref="GOA:F0J3Q4"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3Q4"
FT                   /protein_id="BAJ79910.1"
FT                   /translation="MEMSGERLIAAPREAVWAALNDPEVLKACIQGCESIEKLSDTEMT
FT                   ATVAAKIGPISARFNGKVTLADLDPPNAYTISGEGQGGVAGFAKGGAKVQLADAEGGTK
FT                   LTYQVSAQIGGKMAQLGARLIDSVAKSYAESFFTKFSERLAPAPEAAPAPTPTKETTSM
FT                   AEHAHDHAHPAHGEDRSNPVIAGLPLGIWVPIIISAVVVALVISKFLG"
FT   CDS             633597..634499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05640"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79911"
FT                   /db_xref="GOA:F0J3Q5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3Q5"
FT                   /protein_id="BAJ79911.1"
FT                   /translation="MTETSLPRTVAETAELLARGNYVADRALATSVHLALAMGRPLFLE
FT                   GEPGTGKTEIAKVLAEQLGRRLVRLQCYDGLDLAAAAYEWDHARQLMEIRLAESGGASR
FT                   ASLRETLYSAEFLLRRPLLSAIDPGLPPAVLLIDELDRADEPFEAFLLELLGDFQITIP
FT                   ELGTIAASTRPVVVITSNRTREVHDAIRRRCLYQWVDYPDAVRERAILAARAPGVPAKL
FT                   SAQVVEFVQRIRTTDIFKLPGVAETIDWASALAALDEVELAPAAVEDTLGALLKYQDDI
FT                   AKIRGETAARLTGEAIQAA"
FT   CDS             634496..636481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05650"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79912"
FT                   /db_xref="GOA:F0J3Q6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3Q6"
FT                   /protein_id="BAJ79912.1"
FT                   /translation="MSASDTGRLAPNVMHFARLLRRAGLPVGPGEVIAAAEALTHVDIT
FT                   DRRVMRAALQAVMLRRHEHALLFDQAFSVFWRNPDAAKFAQMLAAMDGRAPREEKAAAG
FT                   ARRLAEAMQAAKSREQEPRPDERREIDALLSASGQERLESLDFEAMSAEEIAAAYPVDD
FT                   NAGKRIGYFIWRPYRPGTAVLSRAMPILGGLLALALLTVAGFLAVVRSRSLRLQASEVR
FT                   IHHLAFHDPLTGLPNRTFFNESADAALAALSGTSIALLFLDLDRFKQVNDTLGHPAGDT
FT                   LIREFGARLRALVREEDMVARVGGDEFTVMLAGVAGREDVEKLCARIVESVRVPFDLDG
FT                   NRVFVGLSIGVALAPDHGTDRIDLLRKADIALYSAKSTGRGRFAFFDPVMDDALRLRRE
FT                   IEADLRAALQESGEIVPYYQPIHAAAGHTITGFEALLRWRHPALGWISPDLFIPIAEEA
FT                   GLIEMMGERVLREACTAAVNWPNRTIAVNASGPELANPGYAERVAAILRVTGLPPQRLE
FT                   IEITETAANGQIGTAAENLASLRAMGVRIAIDDFGTGFSSLARLQQLRVDRVKIDRSFI
FT                   HGFGDQDSDEVIVRAIIELAHARGLRVTAEGVETLEQREGLARIGCDDLQGFIFSKARP
FT                   APEIDRLVEADDAPANDMPAPQGRTA"
FT   CDS             complement(636995..637234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05660"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79913"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3Q7"
FT                   /protein_id="BAJ79913.1"
FT                   /translation="MAARCGASANADLVVRHVAVAVTVEIAVLIGILQFVLIAQPVLIL
FT                   VLRPGRAAEGNQAGSQASQPGGAGDDAPAGHDFR"
FT   CDS             complement(637704..638354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05670"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79914"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3Q8"
FT                   /protein_id="BAJ79914.1"
FT                   /translation="MTQLDFTGPHQFFIRAPGCEVIVASRDGGDVPSDGLVFARTARLA
FT                   DVPGCDLLCVPGGTNALDAALDDGFISELRRLAADARYITSVCTGSLILGAAGLLRGRR
FT                   AACHWAWRDLLKPFGAIPDDGRVVRDGNVITGGGVTAGIDFALVVLAEIAGPQVAQTLQ
FT                   LGFEYAPAPPFEAGRPEHAPPDILAACRQGLARLAATREAQTREAASRLATQH"
FT   CDS             638478..639425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05680"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05680"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79915"
FT                   /db_xref="GOA:F0J3Q9"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3Q9"
FT                   /protein_id="BAJ79915.1"
FT                   /translation="MARHIGILIYQDFQILDASGPITAFEIAARHQADVYRLAILSASG
FT                   GPVRSSSGAVLGSEPASAAGALDTLIVTGGRGCRRAMECPEIRAFVVAQARGARRLCSV
FT                   CSGAFLLAAAGVLDGRRVTTHWRRTEELARLFPRLLVEPDAIHIRDGAIWTSAGITAGI
FT                   DLSLALIAGDLGEAVARRVAQEMVVYYRRPGGQSQFSALIEMGGGDGRFAGLLGWMRDH
FT                   LDARLTVEVLAERAAMSPRHFSRAFSRSVGMSPARAVERLRLETARERVEHSSMPIEVI
FT                   AGMVGFHDPERMRRAFLRAFGQPPQALRRSAQAQ"
FT   CDS             complement(639518..640300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bdhA"
FT                   /locus_tag="ACMV_05690"
FT                   /product="3-hydroxybutyrate dehydrogenase"
FT                   /EC_number="1.1.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05690"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79916"
FT                   /db_xref="GOA:F0J3R0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3R0"
FT                   /protein_id="BAJ79916.1"
FT                   /translation="MARFDGKVGIITGAASGIGRAIAEQFAREGGHAVIADLDLDAARK
FT                   TASAIATFGPAPLAVSMDVTDEQHVEDGVAAAAERFGRIDVLVSNAGIQIVRPLAEFPF
FT                   SDWKKLLSIHLDGAFLTTRACLKYMYAQKSGSVVYIGSVHSKEASKLKAPYVTAKHGLI
FT                   GLCKVLAKEGAEHNVRANVVCPGFVRTPLVEKQIPEQAKELGISEDDVVRNVMLKDTVD
FT                   GEFTTVEDVAAAVLHFAGFPSNALTGQSMVVSHGWFMQ"
FT   CDS             complement(640341..641078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adc"
FT                   /locus_tag="ACMV_05700"
FT                   /product="putative acetoacetate decarboxylase"
FT                   /EC_number="4.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05700"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79917"
FT                   /db_xref="GOA:F0J3R1"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="InterPro:IPR023653"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3R1"
FT                   /protein_id="BAJ79917.1"
FT                   /translation="MDAATIRETAFAMPLTSPGFPKGPYRFVNREYMIITYRTDRAALE
FT                   KIVPEPLELADDVVKYEFIRMPDSTGFGDYTESGQVIPVRYKGKPGVYVHSMFLNDHPP
FT                   IAGGREIWGFPKKLARPVLEVEIDTLVGTLDYGRIRVATGTMGYKHHTLDHDPVLSSMH
FT                   EPNFLLKIIPHVDGSPRICELVRYHMSDIVLKGAWTGPAALALYPHALAPVADLPVREV
FT                   VAASHILADMTLDLGEVVHDYLA"
FT   CDS             complement(641096..642244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05710"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79918"
FT                   /db_xref="GOA:F0J3R2"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021095"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3R2"
FT                   /protein_id="BAJ79918.1"
FT                   /translation="MSVTNKRRSRQPSAATPACATGLRNVLLLQGGGALGAYQAGAYEA
FT                   LAEHAYDPDWIIGVSIGAINASLIVGNPPERRLERLREFWKRVTTPRPGFIPPALSLHV
FT                   AAEKKLGALNAVLFGQPGFFRPRHPVDFITENPLSFYDTAHLRQTLEELVDFDLINSGT
FT                   TRLAVGAVQIRTGNMIYFDNAECRITPQHIMASGALPPGFPPVEIDGEAYWDGGLVSNT
FT                   PLEYMMRCEPRENSLVFQVDLFPARGPMPKTLDGVAEREKDIRYSSRTRYGTDAEKRRQ
FT                   DLRRRVCAFLEKLPPELRDDPIAKHLQEFSCPAQIDVVHLIYRPEHPQGADKDVQFDRT
FT                   TATERWRHGHEDASRALVAAPWREPHPHELGMRTFDIAKTES"
FT   CDS             complement(642633..644537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05720"
FT                   /product="putative penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05720"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79919"
FT                   /db_xref="GOA:F0J3R3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3R3"
FT                   /protein_id="BAJ79919.1"
FT                   /translation="MRPATIIEPCLGTGRGARQTARMNAQRDKKQRAVFTRRAMIIGGS
FT                   QVALFSALTARLYEMEIVDHSRYSRLARKNAVSERLIAPERGLITDRNGVILAGNRQQW
FT                   QALFLMTAASDPAATIARLERIVSLSPADRARLAKLATGPIHFLPILVKKDLGWDEMAR
FT                   LEVHRPSLPGLIIDRGFRRFYPLGPLTAHPVGYVVRPDSADAGREPVLALPGVRVGGSG
FT                   IEKSANAALFGSPGIVEDEVDAGGAVVRVITRRPAREGHAVGLTLDAGLQRTAAGALNG
FT                   RPGAAVLIDTSTGDLLAMASAPSFDPTWFDDGVPDHVWRRWTSKAAHHPLTDRATGGLY
FT                   APGSSFKPTVALAALEAGAITGDTRFFCSGHMKIGNRIFYCWLRSGHGSMDVASALQQS
FT                   CDIFFYHVAMRTGIDRMAAMARHLGLTGREALALPNVAEGFIPTRRWAKQRQIDWTKGD
FT                   TAVQGIGQGYTVLTPLALAVMAARIGTGRAVRPRIIRTVGAVERTHPAATTLSLSDRHL
FT                   ALVRQGMAEVVNTPLGTAWGARLALRGARMAGKTGTAQVIGESAEMEAENYNDAELPWQ
FT                   DRPNALFVGYAPLDRPRFAAAVVIEHGTLLGPVKIARDLFAAALSRRRLAYGDESRPA"
FT   CDS             645009..645659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05730"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79920"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3R4"
FT                   /protein_id="BAJ79920.1"
FT                   /translation="MRSAEPLRAAEIGVSPRRRARAGYAAAAQIAAWARAGTSAPARLP
FT                   GTAEGFAEWTQYPQPEALDPVSGWRFFYHAHAVRERLRAEHGHFHIFTPGPAGGMGFTH
FT                   LIGISVDVQGLPIRLFTTNRWVTDEAWQPAAAIGPRASRPRLAGASPGDVARWLENLVV
FT                   LFAPDIVALLYARDARMGSGIGPDDRRFEDRRLRIPSQMRVSLAAALRRLAAA"
FT   CDS             645961..647133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05740"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79921"
FT                   /db_xref="GOA:F0J3R5"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3R5"
FT                   /protein_id="BAJ79921.1"
FT                   /translation="MSQIAATGPRPPRVLLAAASVVIVGLLAMTMPATGGRLPALVLIG
FT                   AAMGMTLAHGGYGFAYGWRALVLRRDGSGAMANLLMLAAATVLFAPILARGAVFGHGVA
FT                   GAIAPAGVPVAVGSFLFGVGMQMSGACASGCLYASGGGNLRTLLALLFFCAGAFIATFQ
FT                   LPWWLSLPSLGAVSFGGMIGWGPGAALQIVALGGLALILRRFAPPASPMMRAWLPQGSA
FT                   WFRGPWPLPFAALMLAGLNWLTLLIAGHPWSIVWGFTLWGAKGASLLGWVPPAHGFWSW
FT                   PFPHAALSHGILADETSVMNISIVLGALLASAIGGRFSLTAKFEPLPLLSAALGGLAMG
FT                   YGARLAFGCNIGSLFSGIASTSLHGWEWLVFALLGTPVGIALRRRFGLPD"
FT   CDS             647192..648133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05750"
FT                   /product="rhodanese"
FT                   /note="protein synonym:thiosulfate sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05750"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79922"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3R6"
FT                   /protein_id="BAJ79922.1"
FT                   /translation="MKLSVIPAFGLAAAVLGGTAFAAKPVPPLVSADWVAAHACKPGVV
FT                   MLDVRNPIGGGNVQTYMHGHVPCAVYSNYAQNGLWRKDVDGAPGMVPPVAELETLIGGL
FT                   GIGNRTRVVIYTAGTSATDMASAARVFWTFKYLGDNNVSILNGGYAGYVGRGSTPAHPV
FT                   QAGFVKPVATRFVAHVRPRLLATEAEVERAMKAHVPLVDDRPSAQYLGVNLAPVDTRPG
FT                   TIPGARNLPESWLTVNDGGVFRTPADLAGLYKAAGVPMAGRQINFCNTAHWAALGWFAS
FT                   YELLGNKQAKLYTGSMSQWSRNAALPVERQVR"
FT   CDS             complement(648192..649190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05760"
FT                   /product="LacI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05760"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79923"
FT                   /db_xref="GOA:F0J3R7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3R7"
FT                   /protein_id="BAJ79923.1"
FT                   /translation="MEDVAHRAGVSVSTVSHVINGTRKVRPATVEAVRDAIRKTGYVPN
FT                   SLAQALAGASTKTIGVAISALTNHYFAETVRVIESECARRGLMIFLADTHDDPDQELRV
FT                   IKALHQRRVDGIILAPTAGTDRRALDYLKGKGIPSVLVDRIVRGEFDQVGVENTVACRE
FT                   LISHLIGHGHRRIGFVAGAPGISTSIERLEGYRDALHRAGIPFDPALVCCGESANEPAR
FT                   RAVRELLRLDPRPTAIVASNNLMMIGAMHALRDAGIEVPAGMALVGFDDFDWAELFNPR
FT                   LTVLAQPLEDIAMKAVELLTRRIARPDDQFEIVRLTPELRIRNSCGCQDQR"
FT   CDS             complement(649326..650816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="ACMV_05770"
FT                   /product="xylulose kinase"
FT                   /EC_number="2.7.1.17"
FT                   /note="protein synonym:xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05770"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79924"
FT                   /db_xref="GOA:F0J3R8"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3R8"
FT                   /protein_id="BAJ79924.1"
FT                   /translation="MRSFASPLSLGIDLGTSGVKAVLLTSSGAVIGTMSAAVPTSHPHP
FT                   GWAEQDPEDWWIACMTALRELRRQYPEAYEAVRSIGLSGQMHGAVLLDRHNRSIRPVIL
FT                   WNDARSTAEAAFLAENHPSFIEATGSLPMAGLTAPKLLWLHGHEIESFRKIDCLLSPKD
FT                   YLRLRLTGERVTDMSDAAGTLFLDVHRRSWFEPMIAATHLEPRQFPRLCEGTSATGTLT
FT                   RSAAGELGLDSKVVVAGGGADNPASAVGIGASHPGNSFVTLGTSAAVVSITDRPLARIA
FT                   GGVHGFCHALPERWYAMGAILCGANSLRWVSKLLSMPSEQALLDRVAAELPLERPVPPT
FT                   TPLFLPYLSGERTPHNDPNVRGGFMNVGIETAAPSFGYAVLEGVAFALRDAMGSVEESG
FT                   SDIRHCSLVGGGAKSDYWGQLLANVLGRELHTLEGSELGAGIGAAKLGFAALGIDEPVN
FT                   MSLPVRKTFEPQADRREDLDDRYRKFRTLYPAARSLCT"
FT   CDS             651173..652168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05780"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05780"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79925"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3R9"
FT                   /protein_id="BAJ79925.1"
FT                   /translation="MKLAKRLSIVGMAIAGTIGLAGPHAEAAQTCAKPKYVIGMSLMTL
FT                   TNPYFETMAKTAAKDAAADCAKLIYYGGNMSEAQQLNQVEAFIQRHVNAIMFAPADAAA
FT                   ASSAVLAANHAHIPVFTIDTNVDMKTLKRAGGHIVEFVQSNNVQLGENAAKEVIAYDKS
FT                   ALHGAPVKLGWIDYPFATSVQDRDKGFKKIIDGDKNIHVVSRLNGKGTTPGGLSATAAM
FT                   LSAHPDVNVIFDINAPSGLGAMDAIRAANKVGKVAVIGLSGSQQAVQAICQNSVYKAGA
FT                   LQSPAVESKIEVANIIKYLDGDKNIPKLVLTKTYTVSKANCHEMMKIAYP"
FT   CDS             652165..653670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05790"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05790"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79926"
FT                   /db_xref="GOA:F0J3S0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3S0"
FT                   /protein_id="BAJ79926.1"
FT                   /translation="MTTVSTGQAGSLALSGIVKRYDSAPVVRGVSFSLRAGEVTALLGH
FT                   NGAGKSTALKILGGAEQPSGGHILLDGEAVTLTTPRIAEAHGIAVVWQELRIIEKLTVT
FT                   QNFFLNREKRRGPFTDRTAMNEHVRRALATYGLAADPDMAAGALSPADRQMLEIIIALD
FT                   KGGRFLLLDEPTSALNASEITRLLDTVRRLAAGGTSIAIVTHKLGEALAVADHVVVMKD
FT                   GDVVLDAERADLSEADLAYYITGHRRDATALAEVSPRTAFGGTTLLDIRTLSSGNCRSA
FT                   SLEINAGRVVGLYGVAGAGQVELLEVLFGVRPMQGGEIRLAGEPYVPTTPRAALAKGFG
FT                   FLTDDRKANGFIPDMTIGKNIVLASIDRFSRGIWFDDAAVAEQARTMAARLAIRSPLGT
FT                   SVRRLSGGNQQKVIFAKWVTARSRILLLAEPTKGVDIGAKAEIHALIRELAAAGDTLLV
FT                   CSSEIEEILEVSDVIYVFRHGICEGTGIPRAEAEARSILAQSL"
FT   CDS             653696..654706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05800"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05800"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79927"
FT                   /db_xref="GOA:F0J3S1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR035568"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3S1"
FT                   /protein_id="BAJ79927.1"
FT                   /translation="MAKQDTSTTASPQRKGLRLPPETGIFVILALIMAGMEVLTGNFLT
FT                   IGNISTLLVNTITIGLLAVSETFVLLIGGIDLSVGAIQALSGVTAAVVINHTPLGWPGA
FT                   ILGGILAGALIGFINGSITHYINVPAFITTFATLGVAASIPLIVTQANPIPIFSNTFNA
FT                   LGQGYVLKIIPIGVLVMLVVAAAAHVVLSRTAFGVKVYAVGGNRHSAWLAGVNIARIEI
FT                   LCFTLSGTIAGLAGVILAARLASGYPTAGSGASLFDGIASAVVGGVSLFGGSGSVAGAL
FT                   LGAIVIGTLTEGMDVLDLNTYWQPLVIGIVILLAVMLDTWKTGLLRTLMRRLRRA"
FT   CDS             654838..655107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05810"
FT                   /product="histone-like DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05810"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79928"
FT                   /db_xref="GOA:F0J3S2"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3S2"
FT                   /protein_id="BAJ79928.1"
FT                   /translation="MSKAFITDVIQNSTGITGVAANRAATDVIEAIVKELKKKGKFTLP
FT                   SFGTFTVRKTKARKGVNPRSGEPIKVKAGKTVRFKSSPTLKTRV"
FT   CDS             complement(655214..656110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmd"
FT                   /locus_tag="ACMV_05820"
FT                   /product="GDP-6-deoxy-D-lyxo-4-hexulose reductase"
FT                   /EC_number="1.1.1.281"
FT                   /note="protein synonym:GDP-4-dehydro-6-deoxy-D-mannose
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05820"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79929"
FT                   /db_xref="GOA:F0J3S3"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3S3"
FT                   /protein_id="BAJ79929.1"
FT                   /translation="MGQLRRILVTGAGGFVGRHLMPELGRRFPWAELVSFRADITDPAA
FT                   TETSVRDVRPDACVHLAGIAAIPEAREHPRRAFAVNLDGTLNLARALLAHAPGCQLIHA
FT                   GSADCYGASFRSGQPLDESAPLAPLNTYAASKAAADLTLGAMAAESGLRVLRFRPFNHV
FT                   GPGQSEAFALGSFAAQLRRIARGDAAPVLHVGNLDAERDFLHVNDVVRAYALALGRSDD
FT                   LPNGTIFNIASGIPRRMRDMVEAMIVSLGIHVSVEIDPTRLRPSDIPRAVGDASRAENL
FT                   LGWHPDHGIEEIVRSVL"
FT   CDS             complement(656225..657208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmd"
FT                   /locus_tag="ACMV_05830"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /EC_number="4.2.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05830"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79930"
FT                   /db_xref="GOA:F0J3S4"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3S4"
FT                   /protein_id="BAJ79930.1"
FT                   /translation="MKTALVTGITGQDGAYLSQLLLGKGYEVFGVIRRSSHRGVEDHRL
FT                   RWLGIADKVTLLDGDLADLSSLVRIVKDVRPDEVYNLAAQSFVASSWRQPILTANITAV
FT                   GVTNILEAIRAEQPEARFYQASSSEMYGLIQEPMQSEATPFYPRSPYAVAKLYGHWITV
FT                   NYRESFGMHASSGILFNHESPLRGVEFVTRKVTDGVARIKLGLAGELRLGNVDAKRDWG
FT                   HARDYVKAMWLMLQQDKPDDYVVATGRTTTVRDMCRIAFDHAGLDMERHLVIDPAFYRP
FT                   AEVDVLLGNPAKAEQKLGWRPETTLEQMIIEMVDADLERLRRTTPG"
FT   CDS             complement(657287..659533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05840"
FT                   /product="oxidoreductase molybdopterin-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05840"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79931"
FT                   /db_xref="GOA:F0J3S5"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3S5"
FT                   /protein_id="BAJ79931.1"
FT                   /translation="MSETSIRFGSNAGQSVTRRDGIAKVTGAATFAADNHPEGLLHAVY
FT                   VPATIARGRVIRLDTGAAKAHPGVVEVFTPENRPALAGDPDAKPFLFAFRTEVLQSAEI
FT                   RYANQPIALVVAETVEAATEAARLVVPHYEALPPRLGLDGDAPYKPESGNFGRPAETVF
FT                   GDVAAGHAAARHAVDLTYETPAQYHNAMETHAIVATWDGDQLALDVPSQAIVMSRGAYG
FT                   YYFGIPAENVTIRSPYLGGGFGSKAVINGPALLAILAARALRRPVKLMLRREQMFGPVG
FT                   HRGATRQRLRIGTDDDGRMTALDHESLAVTSTFDDFIEGAADASLGLYATEALRSTQYA
FT                   VRADIGTPGPMRAPGIASGSAALECALDEMAEAAGLDPLEFRLRNYADAEPGTGRPYSS
FT                   KALRECYRRGAERFGWANRPRAPRQMTDDRGLLVGWGMGTALFHAPMFAAEARATLRPD
FT                   GTGLVETAAADMGQGAWTALAQIAADGLGLPLEKIEFRAGSSDLPDGGIAGGSGHTATA
FT                   GGALHAAGCDAVRRLGEIAVADPASPLFGANAGVVARDGRLFARDDDSRSESYVEIIAR
FT                   AGGAAVQGTGSAARPPEAAERHAMYSHGAVFAEVKIDPALFQIRVTRLVGAFAAGRIIN
FT                   PRLATSQLMGGMIWGLSFALHEEARHDRRTGRIVNADFAGYHIPVNADVAGLDVITVHE
FT                   DDPHVNPLGIKGVGEIGITGTVGAIGNAIWHATGTRVRRFPIRIADLLAGSQSM"
FT   CDS             complement(659526..660569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05850"
FT                   /product="oxidoreductase FAD-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05850"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79932"
FT                   /db_xref="GOA:F0J3S6"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3S6"
FT                   /protein_id="BAJ79932.1"
FT                   /translation="MTPFAYLRPATLDEAIGAWEPGAAYLAGGTNLVDLMKTGALRPAK
FT                   LIDLARLPGLDAIETLEDGSVRVGALVRNADLAHDITFAAQFPMVAEALLSGASGQLRN
FT                   AATVGGNLLQHPRCAYFQDPLTACNRRAPGSGCDARDGDNAALAVMGWSEACIATSASD
FT                   FCVPLAALDAVVETAGPAGAREIPFAELHRLPGDSPERATALAPGELIVALRLPAAASA
FT                   FRAHARYLKLRERTSFAFALVSAAAALRLDRGRIAEARLALGAVAAKPWRSREAEAMLA
FT                   GAAPAPELFARAAAVALSGATPSGANAHKIELARRTAARALALAAAGTPARMPALPASP
FT                   FGDLAHV"
FT   CDS             complement(660566..661063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05860"
FT                   /product="oxidoreductase iron-sulfur binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05860"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79933"
FT                   /db_xref="GOA:F0J3S7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3S7"
FT                   /protein_id="BAJ79933.1"
FT                   /translation="MLHPIHLTLNGICRDLTLDDPRITLLDLLRERMALPGTKKGCDRG
FT                   QCGACTVLVDGRRINSCLVLAVTLDGAEITTIEGLTEGGRLHPVQAAFIEHDGFQCGYC
FT                   TPGQIMSALGLITEGHAGDDPERIREGMSGNLCRCGAYHGITEAVQDAARRMADTSAGD
FT                   AA"
FT   CDS             661204..661809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05870"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05870"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79934"
FT                   /db_xref="GOA:F0J3S8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3S8"
FT                   /protein_id="BAJ79934.1"
FT                   /translation="MGEFGTMQIAGRKPRSDAQRNRERLVAAAKEILGQGGPEASLEAV
FT                   ARRAGLGIGTLYRHFATRESLFLAVYASEVAQATETATELESAGDGLEALRAWIHGMVG
FT                   LVETKRGLIGALSVAMTEEARARYSEVSAPLIVAMERLVARAQADGSVRADVTTQEIMS
FT                   TVFALCYARQPDPGWKVQVLRIIDIFVDGLRPPMARGG"
FT   CDS             661987..662619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05880"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79935"
FT                   /db_xref="GOA:F0J3S9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3S9"
FT                   /protein_id="BAJ79935.1"
FT                   /translation="MVDSVYQHVLAWKDALDAEDIDLAVWRIHRKIGMSGGLFTNQLLR
FT                   ETGLEISPERIERLRRGHAESYRRYGKRIRPLPGARALLDHLTGSGVPWAIATSGRMET
FT                   AAVNLEALQVDPEQAAVITRDQVNHAKPNPDLFLAAAERLGAAIETAVVVGDSIWDMLA
FT                   AARCKALGVGLLSGGYGAHELREAGAIRVYEDPADLLRHIDEIGGRR"
FT   CDS             662665..663573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05890"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79936"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3T0"
FT                   /protein_id="BAJ79936.1"
FT                   /translation="MILTEGGVPENEPGSTVRLHDGRALGYLDVGAAEGPPVFHFHGHG
FT                   SSRLEALVLADAARSAGLRILAFDRPGIGRSAPRPGDRLLDWPADILEAADLLGIGRFA
FT                   VQGMSAGGPYALACARACPARITVCSLVSALPPPAIARRSGPLKRRLAWWIASLFPRYL
FT                   RSRLRQFRPDGIPTREMINARLMRIAHWLGGEDLALMRNPAMLDLMARTMTETALQGGA
FT                   ANRTEIERLARPWGFRIGDVPVPVLLWHGGQDRILPVEAARLMARRLRQCAATYYDGEG
FT                   HFSVLVNRSHDLMCALRAHAR"
FT   CDS             complement(663642..664256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05900"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05900"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79937"
FT                   /db_xref="GOA:F0J3T1"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3T1"
FT                   /protein_id="BAJ79937.1"
FT                   /translation="MGAIILCTAGLAACAAKAPQASLAMPPPAEPPPQALPALTVAKRL
FT                   STMPPVAVPAVLRPPLDLSGRNETGKASYYARRFAGRRTADGQRFNPHAPMAASKTLPL
FT                   GTVAKVVNLSNGTSTTVTVADRGPNVESRMLDVSPEVAIRLGMIREGVARVLVEPITIP
FT                   EPDGKVKLGAGAAHASKAQIAAAIGTSRRVMRQDGIRVADR"
FT   CDS             complement(664422..664901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05910"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79938"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="InterPro:IPR014519"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3T2"
FT                   /protein_id="BAJ79938.1"
FT                   /translation="MDTDELATIGYEKCGFDDFVRCLREAGVRQVIDVRDLPLSRRAGF
FT                   SKRQLAAGLDAAGIGYHHLRALGTPAAGREANRRRRWDEFWRIVDDRLATPEAAFALAE
FT                   AAELASAKPSCLLCYEAAVCQCHRLRVGERLSASHGFRLRHLLVQGAVGHTPPSR"
FT   CDS             665137..665961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05920"
FT                   /product="putative sulfotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05920"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79939"
FT                   /db_xref="GOA:F0J3T3"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3T3"
FT                   /protein_id="BAJ79939.1"
FT                   /translation="MGRIIWLASYPKSGNTWLRAFLQNYILDEGRPQDINRLTLLSTGE
FT                   SGASLYRPFMAEPDATLSAEAAARLRPAVHRAIAGADPQRVFVKTHNANVDHAGTPLVT
FT                   AGVTDRAIYLVRDPRDVAVSYAHHLGVGHDALIDLMTDDRAVSGDNVHKVTEFVGSWNR
FT                   HVESWTAHPAWPTMVLRYEDLLADPADGFGDVIRFLGAEPDPPRLARAIRHSAFDVLAA
FT                   QERERGFVERPGAAALFFRNGRAGQWRDVLSDRQSRAVEHAQAPQMRRFAYL"
FT   CDS             666094..666489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05930"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79940"
FT                   /db_xref="GOA:F0J3T4"
FT                   /db_xref="InterPro:IPR021218"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3T4"
FT                   /protein_id="BAJ79940.1"
FT                   /translation="MREILVLADAILAVHVIVILFNVTGLVVIPVGARLGWRVIRVAWL
FT                   RLLHLALLAVVAGQAVAGRACILTIWQQDLAGGAGTVHPLIMQWVDRLIYWNLPMWFFQ
FT                   ILYCAVFLYVVALTVYVPFWGTATRNR"
FT   CDS             complement(666559..667095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05940"
FT                   /product="putative flavin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05940"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79941"
FT                   /db_xref="GOA:F0J3T5"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3T5"
FT                   /protein_id="BAJ79941.1"
FT                   /translation="MAMRDLPLARVYQFIEPGPVVLLTTAERGHLNVMTMSWHMMVEFE
FT                   PPLIACIVGEGDYSFAALRRTGECVIAIPAAELASTVVGIGNCSGRDVDKFARFGLTAR
FT                   PARLVTAPLIAECFVNLECRGIDMRLVRRYDMFVLEVIKGWIDPARRNARTLHHRGFGR
FT                   FAVDGETISFRSRMR"
FT   CDS             complement(667299..669341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05950"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05950"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79942"
FT                   /db_xref="GOA:F0J3T6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3T6"
FT                   /protein_id="BAJ79942.1"
FT                   /translation="MGDSAPLTAAGSGTRTDTRLVSIRIFFLNLLQANEALVVVGRLFV
FT                   LKKLSIRYQFAMLGAFGVAITVAAVALNLFDSYQMELHSKEAQARALVASAVTSTETYV
FT                   HLAAQGVITKQKAQSLALKALGAARFDHGNYFFVYDRHGVALANPKKSVIGKNLENVKD
FT                   PYGHYVIRPLMQAAASGHPIFHEYYWPKAGSSTPQPKISYMAEVPGWHWMIGSGLYISD
FT                   LRTNFWNGVLRFAAIFIPVLFAFLLLMIYMQKNIANILKRMTSVMKALSTGDSSVDVPF
FT                   TDRTDEIGGMASAVEIFKSAGIEKARLENDATAAARQRETERARTEAERAAAAQQLATV
FT                   VDSLAHGLEELSAGRLTFRLTAAFAAEYEQLRTDFNGAMQRLQDAMRVVATNASAIRSG
FT                   SGEISSAADDLARRTEQQAATLEETAAALDEITTTVRNTADAAVHARNIVDTAKQDAEH
FT                   GGSVVSQAVRAMGEIETSSKQIGNIIGVIDEIAFQTNLLALNAGVEAARAGEAGRGFAV
FT                   VASEVRALAQRSADAAKEIKTLISASNQQVVAGVDLVDETGKALERIVRQIAELNDSVA
FT                   KIAASAQEQSTGLVQVNTAVSQMDQATQQNAAMVEESTAASHSLVQEAEQLTQLIGRFD
FT                   LGTSPAPASPGRLPVTPPRPAAKPAPIAAPKRHLEGADAGDWEDF"
FT   CDS             669828..673115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05960"
FT                   /product="putative signaling protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05960"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79943"
FT                   /db_xref="GOA:F0J3T7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3T7"
FT                   /protein_id="BAJ79943.1"
FT                   /translation="MPSDDTETRRLAALGRYDIVGTPAEESFDRFARLAAHGLDMPIAT
FT                   VSFADASRHWLKAKVGTDLECMPRGTVFCEHTIGTDSPLVVPDAREDERFRDNPLVSGF
FT                   PHIRFYAGAPIITPDGYRIGSMCVLSPEPRAEFDASSRKFLTELAQSVMTELELRRLNR
FT                   EQAKVSADLAFWNRLSEAIADAADFDAALDHALACCAERAGAAICFLVAFHPAYRMLEY
FT                   VKSHIAQDSDLADFDMTPWFAGHPVDTISFGAALVEGRMYDSGPMMDADPGPAYPRLRE
FT                   LVRAGIRRQVVHPFDLADRRFGLVLDFRSPAIAEETHGLILEFVARLTPLLLGRLREDA
FT                   LERANRALRTIHEATEAFAHATTAQAVFDAACRLAVETGGYNTCWVGLAQHDPEKSVSL
FT                   AASAGRGTGYVAQLRLSWADVPNGRGPAGTAIRERRISRWRDIAVDPRFEPWRHKALAS
FT                   GFRSCISLPFGGAGIPAAGALTLYSSDPMAFGEEERDLLVELTANMTKALQAFTTRQER
FT                   DDALMAHSMSERRIDRLLAATGVVLYALALHGDEAVLVDMSENIVDMLGYVPGNIRGLD
FT                   WWRNHVHPEDLPQAALGVPRTVESGQFVHRYRIRHQNGGYRWIHDEKTLQRDAAGNPVG
FT                   IVGVWIDITERREAEEQIYRLAHIDPLTELPNRRLLNERLREVLIEARRTGVQGALLFI
FT                   DLDRFKTINDMLGHSAGDSALRQAAQRLRQAVRAADTIARVGGDEFVVLIADAGSTVAD
FT                   AADHAATIARKMIDALTARPISIGEREYHLGASIGFTMFPKPDDTIDTLIREADTAMYQ
FT                   AKAGEADVVMFRQSMHLSIVARHAIEDEIRSALKAGRFEIWLQDQVELGGKPVGAEVLL
FT                   RLRDRDGRIAVPSEFIGIAESSGLIVPLGRWLLREACALLARAHRDRPDWRLSVNVSPR
FT                   QFRDPAFVTDVIAALDISGVPADRLTLEITENLLIRDTFEIARIMGILADRGVRFSVDD
FT                   FGTGYSSLHYLRQLPIHEIKIDRGFIGQVPDDASSVAIVEAILAMARRLDLDVVAEGVE
FT                   TPEHVAFLKARGCPRMQGYFFACPISVSEWLERSAHTPDAGVANARR"
FT   CDS             673399..673986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05970"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79944"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3T8"
FT                   /protein_id="BAJ79944.1"
FT                   /translation="MQEELRANHLEWSLHHPGFEVKLWSLDELLSLCRVGGFTWVAQVL
FT                   TADAPVPLQLDLIRFFLLEQLGGIWADLTVRPVGPMPAALLAAEFVAIGVDGGAPVFDQ
FT                   RFLAARPGLECFMRATDKVMRGGFDEARRMSGQDALAAAFAASRRPVAACLLSEQDTWG
FT                   SLLERRSLDRDADWLPDPMATLEANAARPTPA"
FT   CDS             complement(674006..674596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05980"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79945"
FT                   /db_xref="GOA:F0J3T9"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3T9"
FT                   /protein_id="BAJ79945.1"
FT                   /translation="MIPTASAPPSIAQTRRPRTRSAPLGLALLLAAGLGACTNPYDPGQ
FT                   RALGGAALGAGTGAAIGALAGGGRGAATGALIGGAIGAVGGAATTPPPPSPYEAGYPPA
FT                   APASWSPEMVWLPSPGVYVALGYNYPLFFYSGLYYYLYSGRWYVGSSYSGPWRIHAAPP
FT                   PLRRFHSGYWNSYQMRARNYYHNNPGWRHFRPR"
FT   CDS             complement(674779..675990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_05990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_05990"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79946"
FT                   /db_xref="InterPro:IPR011486"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3U0"
FT                   /protein_id="BAJ79946.1"
FT                   /translation="MSLDHSRTPGRRNRTRLIAASFGAAISLCALQSAQAFNGPSAIKI
FT                   DGGPLGPLQLSGGADGYMYALSGTGNSTSGGLLGTDKSTGAEFMNGQIEVQKTSGLVQF
FT                   TIQVGSNNSLTLGTKPTATSVQTFSTGPLYAGYITLAPTKNFSISVGQIGSLEGYESGI
FT                   DWNNANVLTTDLFYVENSQSRGVSATYTMGPVSASVTFGDGFDTGVFNFLQGLVTYSFN
FT                   DNNALSVFGATNLGHTGLLANTYGSATTPYNQSTVGSYGANYINSTMIGGYYSYTHGNL
FT                   NLVPEVQYVYAKPDQKVGISKFTSNFGAALFADYAFGKSPYSLGGWVEYFSSNGPGFWF
FT                   LNPGAQGYGLSVTPTWQNKNLFVRGDLGLLHLTKVGYAGSTGYGANGTGRNQATFVVEA
FT                   GVLF"
FT   CDS             complement(676175..678955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06000"
FT                   /product="putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06000"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79947"
FT                   /db_xref="GOA:F0J3U1"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3U1"
FT                   /protein_id="BAJ79947.1"
FT                   /translation="MDTPSRLILPAAPSLVTAHGRAALLDPDGELRHLTVAEARAALRD
FT                   LPPPLVVHEAATLQRLDLSIPVLDLLDLFAFVMPAVTAAPTPSGLARALDFDPPATIEA
FT                   AAALLPDIAIALLGRLDQSASLPMNRRAAGLAALMGEAGWPWAKPVAAALGQPAARPDR
FT                   AALRLGMILPEWQEEAPRPPPSSYPVPQDAARGRLADLLGGGAEQRPAQSDYASAATAA
FT                   FAPPAAEGVPHCVLAEAGTGTGKTLGYLAPASLWAERNQGSVWISTYTRHLQRQIEQES
FT                   ARLEPDPARRRRRVVLRKGRENYLCLLNFEDAAAGARGYNLVALGLIARWALASSDHDI
FT                   AGGDLPGWFAELFGAGLLPQIADRRGECIHSACPHWKRCTIEHVIRRARGADLVIANHA
FT                   LVMAQAVWGGLDDSSVPTRYVFDEGHHLFDAADSAFAAELSGASMAELRRWLLGAEGGR
FT                   SRARGLARRLEDLVAADERLAAPLDALRAAARVLPGATMLARLGEPTAALDQIGPGAAE
FT                   AFLTALAAQARARATAAERESNLDIEADLYPAEPELAAAASDLARDLARLEAPLTSLRE
FT                   RLAARLDEEAGTIDSTERQRIEAAIRSLKRRALDPVASWRRMLAAVNEAPPEPGERPFH
FT                   VLFIRQGRDIALLSHLLDPTEAFADAVASRAHGLLITSATLRDRTTAMDDVEQDAEWQR
FT                   AESRTGATHLAAPAIRAAFASPFDYPAQTRIFIVRDNLRETPEALASAFRALFLASGGG
FT                   ALGLFTAIARLRAVHARIAPALDAANIPLFAQHVDAMNNATLVDSFRAEQNACLLGTDA
FT                   MRDGVDIPGNALRLVVFERTPWPRPDILHRVRRTHLSHGDPKTYDDAIVRLRLRQGFGR
FT                   LIRRAGDRGVFVLLDRAFPSRLESAFPTGVTVSRQGLAETVAAVREFFAADRASA"
FT   CDS             complement(679003..679638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06010"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06010"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79948"
FT                   /db_xref="GOA:F0J3U2"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3U2"
FT                   /protein_id="BAJ79948.1"
FT                   /translation="MSAQPARDCALCPRLSGFRAANHAKFPGWFNAPVPCFGPENARLL
FT                   VVGLAPGLRGANRTGRPFTGDFAGHLLYATLIKYGLAIGVYAERPDDGLELRDCRIINA
FT                   VRCVPPENRPLPAEIAACNGFLARDIAAMTQLRGILALGGIAHQATLRAFGLKQSHAKF
FT                   SHGAMTELPGGIVLADSFHVSRLNTNTGRLTAAMFEAVVGALLARIAA"
FT   CDS             complement(679645..680217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06020"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79949"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3U3"
FT                   /protein_id="BAJ79949.1"
FT                   /translation="MRLLPQEKTALFIDGANLYAASRALGFDVDYRRLLDFFDRVNLVR
FT                   AYYYSALLDTEEYSPLKPLTDWLAYNGYTLVTKPAKEFTDGAGRRRVKGNMDIELAIDM
FT                   LEMAPHIDHAILFSGDSDFRRLVEAVQRRGVRVSVISTIKTSPPMIADELRRQSDQFVD
FT                   LADIANEFTRRQTEPRPRMQRAEATQD"
FT   CDS             680319..680825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="ACMV_06030"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="protein synonym:7,8-dihydro-6-hydroxymethylpterin-
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06030"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79950"
FT                   /db_xref="GOA:F0J3U4"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3U4"
FT                   /protein_id="BAJ79950.1"
FT                   /translation="MFMILIALGANLPLTDDGSPYDTCFHAVEEMQKIETIHLVAVSSW
FT                   YRTRPVPPDPTQPDFCNGVVRFSGAPDPVALLEALHEIEARFGRVRSVPNAARTLDLDL
FT                   IDVNGMVRETGSPILPHPRAHLRTFVLRPLLDVAPDWVHPLLLRPARELFSALPERAEG
FT                   EIRLW"
FT   CDS             680928..681338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="ACMV_06040"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06040"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79951"
FT                   /db_xref="GOA:F0J3U5"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3U5"
FT                   /protein_id="BAJ79951.1"
FT                   /translation="MARVTVEDCIEQIPNRFELVLLAAQRARNLSRGASITIDRDNDKN
FT                   PVVALREIADSTVDFGGLEQDLVKSLSRVPDPEPADEEVQDLIPTDQNIFGLQDVSAEE
FT                   EAAAMAAESEEMTSEDIAAAIEAELGGGRPRR"
FT   CDS             681376..683625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relA"
FT                   /locus_tag="ACMV_06050"
FT                   /product="GTP pyrophosphokinase"
FT                   /EC_number="2.7.6.5"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06050"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79952"
FT                   /db_xref="GOA:F0J3U6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3U6"
FT                   /protein_id="BAJ79952.1"
FT                   /translation="MGVNHPLLAPEGLAGTAVTHEALKPLISRINGYDTKVDIALIDDA
FT                   YGVASEAHAGQTRENGDPYITHPLAVADILADYRLDARSIVTALLHDVIEDTKVTLPAL
FT                   QGRFGAEVAGLVDGVTKLTRLELQSDRTKQAENFRKLVLAMSKDIRVLLVKLADRLHNM
FT                   RTIHFVRSPERRARIARETMEIYAPLAERIGMDRVKVELQNRAFAVLDPEAYDSIQARL
FT                   NFLRGQGADVIDEVRAELGRILKEAGVEVIDISGREKSIYSIWEKMQRRNVAFEQLSDI
FT                   MAFRIIVPTREQCYVALGAIHAAFPVIAGRFKDYISTPKANMYQSLHTGVTLRHPRNQK
FT                   IELQIRTPEMHAIAENGVAAHWLYKQGEASAADVKQFRWVQDLLEILENSSAPDEFLEN
FT                   TKLELYQDQVFCFTPKGQLIQLPRGATAVDFAYAVHSQIGDTCVGARINGRLMPLRYEL
FT                   QNGDQVEILTARGGTPSPSWERFVVTGKARSRVRRFIAGQLREQNRDQGKAALAKAFRQ
FT                   DGVDGSEKVLEVALKALKQASLDDLYVAVGTGNLAARDVVQAAYPDLRESRAPRMVPGM
FT                   LARAPRPPARGTGLPITGLISGMEVHYAGCCHPLPGDKIVGIIATGKGVTIHTRDCLTL
FT                   ETFANTPERFIDVDWDYALIGPGKEGTRDGNGRERPFTGRISVIASNAPATLANIANAV
FT                   AKQDGAIANLKIIHRQQDFFECLMDVEVRDLRHLSQVIAGLRAAGGVAQVDRART"
FT   CDS             683671..684075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="ACMV_06060"
FT                   /product="holo-[acyl-carrier-protein] synthase"
FT                   /EC_number="2.7.8.7"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06060"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79953"
FT                   /db_xref="GOA:F0J3U7"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3U7"
FT                   /protein_id="BAJ79953.1"
FT                   /translation="MIIGIGSDLCDIRRVERTLERFGERFIQRVFTETERRRAARRPAQ
FT                   FAATLAKRFAAKEACAKALGTGFRRGVFMSDLGVVNLPSGQPTLALTGGAAERLAALTP
FT                   PGRSAFVHLSLTDEYPYAYAHVIIEARDGA"
FT   CDS             684080..685168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06070"
FT                   /product="putative RNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06070"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79954"
FT                   /db_xref="GOA:F0J3U8"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3U8"
FT                   /protein_id="BAJ79954.1"
FT                   /translation="MTAPATVVPVCRHFGVCGGCSAQDVAPAALAEAKHARLAAALARA
FT                   GFADPHPAPVVSIPMGTRRRADFAVARVAGAVRLGFHETRSRTVVDIAECPLLRPELEA
FT                   LIDPLRALLARLQGLRKSADVRVNLLDAGADVSVALDGEATAADRARLVAFAQEHDLPR
FT                   ISLGAEPVLIRRPPTLDCAGLVVLPPPAAFLQPSFEGEAAIRAAVLAGLPPKLTRKSRI
FT                   VEFYAGIGTLTGALAAHARVHAVEGSAPALAALDEAARTGGQAGRIDTERRDLARRPVT
FT                   AKELAGAACVVLDPPFDGAGPQIAPLVEAKVQRIVYVSCNPEALAREAAPFARAGYRLL
FT                   ASTPIDQFPGSDHLESVVVLGL"
FT   CDS             685409..686983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="ACMV_06080"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="protein synonym:alpha-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06080"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79955"
FT                   /db_xref="GOA:F0J3U9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3U9"
FT                   /protein_id="BAJ79955.1"
FT                   /translation="MTIHHPNFGAVPDDRVFIFDTTLRDGEQSPGFSMNLDEKLRMAEA
FT                   LAELGVDVIEAGFPIASQGDFESVRRIAETIKGPVIAGLARSGRDDIVRAGEAVKPAER
FT                   KRIHTFISTSPLHMKYKLRMEPDAVLEAVVRSVTLARDYTDDVEWSAEDGSRTEPDFLC
FT                   RCVEAAIRSGATTINIPDTVGYAVPEDIARIFTMLRERVPGADAVIFSTHNHNDLGLAV
FT                   ANTIAAIKAGARQIECTINGIGERAGNAALEEIVMAIRTRHDAVPYRNNIDTPRILRTS
FT                   KLLATITGFDVQPNKAIVGRNAFAHESGIHQDGVLKNAATYEIMTPESVGWQKTSLVLG
FT                   KHSGRAAFRDKLRALGYGEVGDNALNDAFRRFKDLADRKKLVYDEDIAALFDETVLRDQ
FT                   SRIRFVALEVWAGSKAKPRARLELEVDGEMKVHESHGDGPVDATFNAIRAICPHEAELK
FT                   LFTVGAVTEGTDAQAKCGVRLEENGKSVDGQGSDTDTIVAAARAYVHALNKLIVKRERK
FT                   EPAALTA"
FT   CDS             complement(687094..688005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06090"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79956"
FT                   /db_xref="GOA:F0J3V0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3V0"
FT                   /protein_id="BAJ79956.1"
FT                   /translation="MPGAEMSGFFEGFSETTADLGDGRQFRLRSGGSGPPLVMLHGMPQ
FT                   THCMWHRIAPALASRFTVICPDITGYGLSYKPAASEDHEAYSKRRMARDIVDLVAHLGI
FT                   GRFALVGHDRGARVSHRLALDHPERISRLALLDIIPTIEHFERTDMRFAMGYYHWFFLA
FT                   QPAPLPEDLINRDAGYWLLSQTARHKTAKAVFDEAAMADYRRAMADPATVTAICEDYRA
FT                   AAAIDLDHDRESRARRERITAPLQVLWGSRGLVGALYDPLEIWRGYASGQVEGQAIESG
FT                   HFLAEEAPEATLAALQEFLADG"
FT   CDS             complement(687987..689468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06100"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79957"
FT                   /db_xref="GOA:F0J3V1"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3V1"
FT                   /protein_id="BAJ79957.1"
FT                   /translation="MRPARLAPALCGAAILLVAIAWRRGGEYDEFYSVFLVAGHPRPDW
FT                   PALPFGAGAARAFYRGHAGFGAIATGLRRGDVHPPLYFWLLSLWRDALGVGLFRLRLLS
FT                   VVETLGALALLGRIALRMGISPSLTIAITTLFYGFAYTGIVARDFALATLCAMAGTLLA
FT                   IDAARGGSARAGFCAGALLGAACFSNYLASFTAVAVGLWLAWMTWRQWRVWLAAALGGA
FT                   AFLPAGLWFFLAQAGSRRGQFPPFRLAPALGALARDQAGALLGALPREVPAAFAMPVAA
FT                   VLGVGLAGLLILVLHDGRRALGRDDRALLAAGFAASPLGLLALGAAFGNQPFEMRYVWL
FT                   GLPFAGLALAASLRRRPWALAASLAVGATSVAGLALSPATMQPAARMVRAAARLPAGTL
FT                   VIVPFGNDGVGVPGPFVAAAPAQMHILVARAAGAAVLAAARPYPRIAVARIEADGASRA
FT                   LVPRLAALFKAAPCWHSVPAGPLLAVFANTCRERR"
FT   CDS             complement(689529..690788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="puuB"
FT                   /locus_tag="ACMV_06110"
FT                   /product="gamma-glutamylputrescine oxidoreductase"
FT                   /EC_number="1.4.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06110"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79958"
FT                   /db_xref="GOA:F0J3V2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3V2"
FT                   /protein_id="BAJ79958.1"
FT                   /translation="MALSNYYETTARYDATTAPLEGDLRCDVAIIGAGMTGCSAALHLA
FT                   ERGYRVVVLEGERIGFGASGRNGGQVLPGFAADLGKLRRLAGDSVAKALWEMSLEAVDL
FT                   VHAQIARFAMPCDPRRGYLHVAVKDRQVGELEAWQRELEALGLEGFRLLRGAALQERLR
FT                   SPRYLAGLLDPVAGHIHPLNYTLGLAHAAMAAGAVIHTGTRVASITSGDEVVLKTARGS
FT                   VRTGHLLICGNAYLGTLVRPIAGYVMPVGTYIVATEARADVRDLIPHDEAVADLNFVLD
FT                   YFRRSADDRMLFGGRVSYSTLPPPNLGAAMLVRAKRAFPQLADARAEHVWGGNVAITRN
FT                   RLPHFGRLGRNVLFAQGFSGHGVALTGLAGRLMAEAVAGRAERFDTFTRIPHARFPGGP
FT                   LLRMPTLVLATSWFRLRDML"
FT   CDS             complement(690794..692134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="puuA"
FT                   /locus_tag="ACMV_06120"
FT                   /product="glutamate--putrescine ligase"
FT                   /EC_number="6.3.1.11"
FT                   /note="protein synonym:gamma-glutamylputrescine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06120"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79959"
FT                   /db_xref="GOA:F0J3V3"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3V3"
FT                   /protein_id="BAJ79959.1"
FT                   /translation="MTDLAEWFNEHRITEVECLVPDITGIPRGKIMPAQKFLRGGAPRL
FT                   PESIFIQSVTGEYPEDPEDTLTDPAIIDINLIPDPATVRLVPWAHEPTAQIIHDCQYSN
FT                   GRPVTIAPRQVLRHVLELYKERGWQPVLAPELEFYLVGRNTDPDYPLVPPVGRSGRQET
FT                   GRQSYSIDAVNEFDPLFEEMYDFCEMQELDLDTLIHEEGAAQVEINFLHGDPLNRADQV
FT                   FLFKRTVREVALRHDMYATFMAKPMGQEPGSAMHVHQSVVDLETGRNLFADQDGRPSQL
FT                   FLSFIAGLQKYIPAIMPIFAPNVNSYRRLTRFSNAPINLQWGHDNRTCGLRVPYGEAGA
FT                   MRVENRVPGADANPYLAFAASLACGYLGMMEGLTPTPAFRGSAYSQPYSLPRELSHALE
FT                   MMEQARPLIDILGQKLVEVFVAVKRLEYETYLRVISSWEREHLLLNV"
FT   CDS             complement(692270..693346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06130"
FT                   /product="spermidine/putrescine ABC transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06130"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79960"
FT                   /db_xref="GOA:F0J3V4"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3V4"
FT                   /protein_id="BAJ79960.1"
FT                   /translation="MKGLMGKIAGGALAALIAIGGGAPAAHAAGKTLYLFNWQDYIGKG
FT                   LIKKFEAYCGCNVVQTYYDSNSELDAKLRAGGDSQYDVVVPSSYYIPQLVQQGLIRKLD
FT                   KSKLPNFKNLLPRFQNVSYDPHDTHVVPYQWGTIVIGYNKDKIKNPPESWAALFDPKYN
FT                   ASYPFSMMKGSGRDLIGAACAYLGEGFACKTKAAWIKAAKLIEKQVKRPNFSGFVDGDP
FT                   TMQQLKKGVVAIGMTWSGSVAQCYADKTCLNIGWILPKEGSEAWVDNMAIPTHAPNPEL
FT                   AYKFINFILGAKEGAELSNFNMYPSPNAASEPYLDKAIKQPLVTPTAAQMKRLSFIPAL
FT                   TPAQTKEFGAIWTAVRQH"
FT   CDS             complement(693419..694261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06140"
FT                   /product="spermidine/putrescine ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06140"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79961"
FT                   /db_xref="GOA:F0J3V5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3V5"
FT                   /protein_id="BAJ79961.1"
FT                   /translation="MMAISMGKSTRRSLLAMSLPVYLLLYAPLLLIAIFSFAPPPLAKG
FT                   QTFYWYADLLHSPEVIAAFRRSLTLAIGSSILGTALGTLMGFGLYRYRDRNATGIASAL
FT                   PSLIIYTPIIMPSLVFGISELIFFSFIHSATGFLAAGLLTMGIAHVTFEAPFVALVVFA
FT                   RLSGLDPNMFEASHDLYADARQSFLHLTVPVIRPAIIGGFLLAFTLSIDDFTISFFTAG
FT                   PGSTTLPIYIYSAVARKGVSPDINALATLMIATVIGTGLLQYMFTRNRARKLVARPGD"
FT   CDS             complement(694269..695201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06150"
FT                   /product="spermidine/putrescine ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06150"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79962"
FT                   /db_xref="GOA:F0J3V6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3V6"
FT                   /protein_id="BAJ79962.1"
FT                   /translation="MSATTADARRGSAARAERLGRALRLWVTAGPGLTWIVLFLVLPSA
FT                   ILLGIGFFTSGSYGGPELPLTLQPLREVAGYSILGWSSGNITVLVRSLIQAMSAGVLTV
FT                   LFAYPVVFYIVTRPPAARPLLLLFIVLPSWTNQVVRTYAWMELLGPESALSHLVQSLGL
FT                   LQPHLGLFPGVLAMQIGLTYNYLPYMVVPLYAAAEKLDWALVEAGRDLYASGPRLFWNT
FT                   VFPQTLPGLLSGIILVVIPAFGDYVVPTLLGGGKSMMIGSLIASQFLETPNWPYGAALT
FT                   IFMLVFTCAGLLAFRVLSKRLGGAEESMM"
FT   CDS             complement(695198..696331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06160"
FT                   /product="spermidine/putrescine ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06160"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79963"
FT                   /db_xref="GOA:F0J3V7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3V7"
FT                   /protein_id="BAJ79963.1"
FT                   /translation="MAGPVVSAAMKPHDAASEPAVADRRGQIVLEDISRVFAADVVAVD
FT                   RINLVIHPGEFFTLLGPSGCGKTTLLRMIAGFETPDSGRILVSGREMQAVPAHRRPVNT
FT                   VFQSYALFPHLTVAENIAFGLRMRGVAKAERRERTRRIMELLQIDAFANRNPAQLSGGQ
FT                   RQRVALARALVNEPEVVLLDEPLSALDAKLRAELQVELMRMQKRLGMTFIFVTHDQHEA
FT                   LVMSDRIGVMQRGRLLQVGPVLDVYERPSSVFVAEFLGLSNIWPVTALPGGLIDTPLGP
FT                   LAIGNPDPASGTAMIRPEKIWMYSESGAPTGRPNMVAGVVREAIYMGASTQYRVELENG
FT                   APLLVYDTNNQAAERSWRPGEAVTCELKPENIVLIGS"
FT   CDS             696695..697810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ald"
FT                   /locus_tag="ACMV_06170"
FT                   /product="L-alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06170"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79964"
FT                   /db_xref="GOA:F0J3V8"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3V8"
FT                   /protein_id="BAJ79964.1"
FT                   /translation="MLIGVPREIKNNEFRVGLTPASVRELHANGHRVLVETGAGEGIGM
FT                   DDAAYVRAGAAIAADAATVFAEAEMIVKVKEPQPEECRRLRPGQILFTYLHLAPDPEQA
FT                   KLLMQSGAIAIAYETVTDAQGRLPLLAPMSEVAGRMAVQVGAVSLQKAAGGFGVLLAGV
FT                   PGVPPAHVVVLGGGVVGTNAARIALGMGADVTILDKSIARLAQLDDLYGPRLKTMFSTT
FT                   EALEQTVFNADLVIGAVLVPGASAPKLVTRDMLGHMRRGAVLVDVAIDQGGCFETSKPT
FT                   THDNPTYVVDGVVHYCVANMPGAVPRTSTFALAQATLPYALRLARQGWREALRADPHLR
FT                   AGLNVANGRIVHPAVAAALGHDLLPVEQVLA"
FT   CDS             697813..698424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06180"
FT                   /product="Xre family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06180"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79965"
FT                   /db_xref="GOA:F0J3V9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3V9"
FT                   /protein_id="BAJ79965.1"
FT                   /translation="MDADAPEPPDPPDPSDPATAADAGVGARLRRMRQIFGLTQRELAR
FT                   RAGVTNGAISLIEQGRVSPSISSLKKILDGIPMSLAEFFTLDLTAPEDVFFTAADLTEI
FT                   AFDERISFRMVGRRLKDRALQMLHETYSPGADTGEAMLRHEGEEAGVIIRGRIVVTVGD
FT                   QERTLGAGEAYYFRSRIPHRFRNPFDEVCEVISANTPPSF"
FT   CDS             698677..700053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06190"
FT                   /product="putative aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06190"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79966"
FT                   /db_xref="GOA:F0J3W0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:F0J3W0"
FT                   /protein_id="BAJ79966.1"
FT                   /translation="MSDQTIAFDWQAADAAHHLHPFSDHKSLHEGRVRIITGGDGVWLT
FT                   DDQGRRVLDAMAGLWCVAAGYGREELVEASAAQMRALPFYNTFFKTSTRPVIALAERLA
FT                   AMAPGDLNHAFFACSGSEAVDTALRMARTYWITRGKPAKRIVIGREYGYHGSTTLGAAA
FT                   GGMKDMHRQGAALPDFAHIMPPYWYGRGSQMDPAEFGVHAARALEAKIAELGADNIAAF
FT                   IGEPIQGAGGVIIPPATYWPEIQRICRENDILLIADEVICGFGRTGRMFGCETFGIQPD
FT                   MMTLAKAITSGYAPLSAVMVGDRVAEVLINETGEFYHGFTYSGHPVSCAVALANLDIIE
FT                   REDLAARAAASGEILRERLHAALDDLPIVGEIRGVGLIGAIELTADRRTRRPFEKTGRV
FT                   GTICRDHCFANDLVMRAVRDTMVFAPPLIIGEAEIDDMVARARRAITATMDEVRGEMAV
FT                   "
FT   CDS             700055..701416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="puuA"
FT                   /locus_tag="ACMV_06200"
FT                   /product="gamma-glutamylputrescine synthetase"
FT                   /EC_number="6.3.1.11"
FT                   /note="protein synonym:glutamate--putrescine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06200"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79967"
FT                   /db_xref="GOA:F0J4B5"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4B5"
FT                   /protein_id="BAJ79967.1"
FT                   /translation="MDAMAASADRRALLADCELIEAFIIDVNGVPRGKWLQRDRADALF
FT                   TGGVALPRSAYLLDIWGRDIVEGGIAFDTGDPDGKCFAVPHSVAIMPWAEGRAAQALLT
FT                   MQEPDGSLFYADPRGVLSRVIDRLAARGLTAAVGIELEFYLLDPNRTGGQRVAPRGADE
FT                   SHWRGWQTDTLGLWEIHDYEPVLRDLLRAADAQSIALDTLISENGPGQFEVTLHYAADA
FT                   LRMADDAVLFKRSVKHIARKHGLAATFMAKPFGNWAGSGMHVHVSLLDRAGRNVFTGDA
FT                   ARAAPALYHALGGLVAAMPDTMLTFAPHANSYRRFAPGTHAPVFGDWGHDNRMSSIRVI
FT                   NADPAAARIEHRVAGADCNPYLVLAALLGAMDKGIGEGADPGEETFGDKVAATAPRLPI
FT                   AWSQATERFASSPLTRAIFGESFQSIFAACKRQEIAEFRRRISDVEYDAYLKNA"
FT   CDS             complement(701429..702517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06210"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79968"
FT                   /db_xref="GOA:F0J4B6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4B6"
FT                   /protein_id="BAJ79968.1"
FT                   /translation="METVIPRKLRPDGRGTRLDPPNRFETVRQDAFDDGWGTLDEAPPP
FT                   PATVLIRDATKSVISRNDSPDLGFDRGLNPYRGCEHGCIYCYARPTHAWIGMSPGLDFE
FT                   TKLVFKPEAATLLERELSRKGYQAAPIVLGSNTDPYQPVERQLRLTRAVLEVLERFGHP
FT                   VSIVTKSAGVLRDVDILGRMAARNLARVHLSVTTLDARLARAMEPRAAAPGRRLDAITG
FT                   LKAAGIPVGVLAAPMIPGVNDAELERILEASARAGASCASAILLRLPHELGALFEDWLK
FT                   RTMPDRAAHVLSLIRQTRGGALNDAAFGSRFRGTGAYAALLRARFHRAARQFGLSDAPP
FT                   PLDCGQFAKPPAKAASAQLSLF"
FT   CDS             complement(702606..704048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06220"
FT                   /product="mannose-6-phosphate isomerase/mannose-1-phosphate
FT                   guanylyl transferase"
FT                   /EC_number="2.7.7.13"
FT                   /EC_number="5.3.1.8"
FT                   /note="bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06220"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79969"
FT                   /db_xref="GOA:F0J4B7"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4B7"
FT                   /protein_id="BAJ79969.1"
FT                   /translation="MPDQTQARDAGIVPVILAGGTGTRLWPVSRKSYPKQFWPLISSRT
FT                   MLQETASRAQGELFAAPIVVANDEHRFIVAEQLRGSGHTGARILLEPVGRNSAPAIAAA
FT                   AFLVAEGDPDQVMWIMAADASIADAAALGQALGIAAAAAREGHIVTFGMRPSVAETGYG
FT                   YIEQGETLAGHHGAFRIARFVEKPDAATAATLIADGRHYWNSGMFVATARTMLSEMERL
FT                   APEVARSVRAAFDTRRPDLDFIRLDAEAFRGSPEISIDYAIAEKTDRAVVVPASLGWSD
FT                   VGSWSAIWEIAEKDAAGNAALGDAVIEDSTGCYVRSDGAVTAVLGLENTVVVTTPDAVL
FT                   VAHRDKAQNVKRVVDALKRLKRPEAEDHNRVYRPWGFYESLIQGDRFQVKRIVVMPGAK
FT                   LSLQKHFHRAEHWVVVAGSALVTRDEETLLVRENESIYLPLGCVHRMENPGKIPLTLIE
FT                   VQSGSYLGEDDIVRFEDTYGRS"
FT   CDS             704134..704922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06230"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79970"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4B8"
FT                   /protein_id="BAJ79970.1"
FT                   /translation="MEKTGLDDLTSAELRALLPRRPLVLLPLGSQEDQGAHAPMGDFRL
FT                   AAALAGRIARAATEAGTLTLAAPALPFGAADHFGAVPGGLALAPATFRAVLADLIADLR
FT                   RTGLDRIVILNGHGGNAPLVHEVTLSIRRAGGPIIPSFYLWKVARRLMERRIGPAAGRF
FT                   GHGAEPLASITLALRPDAARPDLAVKPAPGARLLGCPVIGFGTIGFEDVEIDAPAEYPE
FT                   IAPSSATADATGADPALGAAVIADLIALAVRFCAHVASLT"
FT   CDS             704919..705842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06240"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79971"
FT                   /db_xref="GOA:F0J4B9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4B9"
FT                   /protein_id="BAJ79971.1"
FT                   /translation="MSVVPAWIPITIAAALFQVWRTALQARLRGALSAPAAGFVRFVYA
FT                   LPADILLLGAALFLLRRSLPAIPPAFVLDCLAGGVAQIFGTMLLIMAFGHRNFVVGTAY
FT                   AKTEAAQLVIFSVLVLGVRIPPEAIVGIMLAVAGVLALSFAGQKFSAADLLRASAQPAA
FT                   LCGLGSGFSFAVTAILLRNATLTLGADTPVLLKALLTLTVTNALQTLAQGGFMALRNRA
FT                   ELAKCFTLWRRAAPVGVLSAFGSGCWFAGFALTNVALVRGLGQIEILFTLAVGHFFLRE
FT                   RTKRGEITGLVLVGLGVVLIAAAGIG"
FT   CDS             complement(705878..706573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="ACMV_06250"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /note="protein synonym:4-diphosphocytidyl-2C-methyl-D-
FT                   erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06250"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79972"
FT                   /db_xref="GOA:F0J4C0"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4C0"
FT                   /protein_id="BAJ79972.1"
FT                   /translation="MTVALIVAAGRGHRLGGPIPKQYRLLDGVPILRRTAEALRRHASM
FT                   RAVFVVINPADRALYDEAMSGLGLPEPVAGGASRQESVRNGLEAIASVAPERVLIHDGV
FT                   RPFVAPDVIGAVIGALDRVPGAVVGVPVTDTLKRCSGAIVTGTVDRADLWRAQTPQGFR
FT                   YDAILGAHRLAQTAHRGRDFTDDCAVAELAGLAIEMVPGSEENFKITTEADLLRAEALL
FT                   RERARALAG"
FT   CDS             706829..707779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="ACMV_06260"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06260"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79973"
FT                   /db_xref="GOA:F0J4C1"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4C1"
FT                   /protein_id="BAJ79973.1"
FT                   /translation="MMYAAAQFHGHVAPGQDVPVPRRGLRAAISCRGVGLHGGQEVNLR
FT                   FAAAEPGSGIRFRRTDLGVTIPARHDLVADTRLCTVLADPARPEARIGTVEHVMAALAG
FT                   LGIDDALVEVDGPEIPILDGSAAEFVFLLNCAGIVETGLPRDIIEIRRPVRVSDGSAFA
FT                   ELRPAAQGEYGFSAALQIDFPARAIGRQALSLEITPESFAAELARARTFTMKQDIDRLR
FT                   EAGLALGGTLANAVVVDGDEVINPEGLRSPDEFVRHKLLDVVGDLALAGAAIRGRFVGA
FT                   RTGHRLNNLLLRALFADRANYRFAGVAEPDLAAVA"
FT   CDS             complement(707820..709463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06270"
FT                   /product="ABC transporter permease/ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06270"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79974"
FT                   /db_xref="GOA:F0J4C2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4C2"
FT                   /protein_id="BAJ79974.1"
FT                   /translation="MTDSVLAPLLRVILIWRRQAPAIVFGALVALASLAAGIALMAAAG
FT                   HYIAAAALGITLAVPVALEVTGVARVVLRYLERLTTHDATFRALAALRLWFYRGLARSA
FT                   AGGLGFRRSGDVLARLVNDIEALDGVLLRLLIPLLGAAMLVPVLLVAVGRDDDTAAALV
FT                   LVLFAVVAFVMPWRAMLAARAAAADETEAGGALRVSVLDTLTGLREIKVYEAEGRMLAG
FT                   VQWQESRLFRAERDLAARGGALQGLAFLATQAALLAVLLIHGANPVAVVVAVFVVVAAF
FT                   EVVGGMPRAGVTAGRASAAASRVLQAAEAEPRVRDPARPAPMPGSNALAFEHVAFRWTP
FT                   EGQAVFEDLSLDIPAGSRIAVLGPSGAGKSTLAALALKLVSPDEGQIRLGGTDIATLRS
FT                   ADVRRRIAWLSQTTHLFADTIRNNLLIGRDDADDDALWAALEAARIADMVRALPDGLEA
FT                   WVGEQGSQFSGGQGRRLALARTLLSPAPILILDEPCSGLDLETERAFLATLNNTLEGRT
FT                   VLMITHRLTGVERLDRVYRLQNGRLTPAAR"
FT   CDS             complement(709463..711178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06280"
FT                   /product="ABC transporter permease/ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06280"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79975"
FT                   /db_xref="GOA:F0J4C3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4C3"
FT                   /protein_id="BAJ79975.1"
FT                   /translation="MKWANCLYVASMARQSSPAKQWIRQEIRLGGRRARLAIGLGVASV
FT                   LVAIGQIACAAGLLAAAIAPGRLPTALLGLGFVTAALVRAALVVGQEHEASRLGIAARR
FT                   RLRSDTLGRLMSAGPGLLRGRHSAELSIIVVDRIEAMNGLHGRWLPAARLAAIGPALVA
FT                   LAAAIADWRSGVILACAGLLVPMFMAITGIGTGVAARRQFTAMTRLQTRFLDRVRGIAT
FT                   IVLAGRAETEAAALGRAADELRLRTMRILRVAFLNATALDLLAAAALVGIAIRFAGPLL
FT                   AGQTALAPTALFCVLLVPEFFAPFRAFSAVYQDRMTAQTAAEDLVGLPEPAVAAVPPDA
FT                   IRNVPAQGITIAFEGVGFAWDQERGPVLRDLSFQLPAGETMMLVGPSGSGKSTIIELLL
FT                   GYIRPQSGRITLNGAPIETIVPTALARMTALISQRPVLFAGTIEENIRLGRPEASEAEL
FT                   LEAVRLARVNEFAERLPEGLATRIGEGGYGLSGGQAQRIAIARAFLKDASLLLLDEPTA
FT                   QLDPATEREVVESLKRLAIGRTVVLASHAAFAHEFSGRKLDLGAAQTARLEGVA"
FT   CDS             711347..712183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="ACMV_06290"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="protein synonym:pantoate--beta-alanine ligase"
FT                   /note="protein synonym:pantoate-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06290"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79976"
FT                   /db_xref="GOA:F0J4C4"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4C4"
FT                   /protein_id="BAJ79976.1"
FT                   /translation="MQIVRNVPDLRAARAALTDGGRARLALVPTMGALHEGHLSLIRAA
FT                   REAGHVVAASIFVNPTQFGPNEDFTRYPRDPERDCALLAEAGCALAWLPEVSTMYPPGD
FT                   ATSVEVAGLSVVLEGAVRPGHYRGVATVVVKLLGQVRPDAAYFGEKDWQQVQVIRRVAA
FT                   DLFLPVEIVVGPTLREKDGLAMSSRNRYLDPADRARAPLLHQVLRRVRAALRDGEPAAA
FT                   ALAAGRRALAEGGFIVDYLELVDAGTLAPLTAPDDGARLLAAARLGTTRLLDTVAV"
FT   CDS             712280..713200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06300"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79977"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4C5"
FT                   /protein_id="BAJ79977.1"
FT                   /translation="MMEQRRLSLPQSPDLQPSSGLMPVQSRRPVAGRTESERRERASLR
FT                   RLEAGEQRKRAARLAEALRNDSFVLRYLPRLDLASPGDGFVSAELWLGLPNRRRGLMPV
FT                   APLLRGIDRAPLRHEMLCHTLRIAAEELACGPPRWQISVPMSGHALADGLIGEVALQTL
FT                   DPLGIEPHRIDILIDEAELVIGGDLLQQQIASLREAGIGVTLEGFGNAFGGLALLSRLP
FT                   FTGLKLDRRLAHALVNDPAGPDVVLIRAAIDIARRYDVLVSIDGIETETELQKARELGI
FT                   GQAQGPWVGPALPADVMRARLRLNG"
FT   CDS             713252..713584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06310"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79978"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR021660"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4C6"
FT                   /protein_id="BAJ79978.1"
FT                   /translation="MTAVPHSARPSAPATPDEAGRAIRATLADRRPGASICPTDAARQI
FT                   AAARGETAPDAWRRHLAAVRRAARDLARRGEIIILRKGRAVDPDAMRGVIRLRLPGVEA
FT                   ETTEET"
FT   CDS             713584..714066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06320"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79979"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4C7"
FT                   /protein_id="BAJ79979.1"
FT                   /translation="MAVGILPLLLSLIFPACGKAGAAGVKPPGFVDFTHLTLPSSPNKA
FT                   LAAPAGFIPKPAFDTPRYALPPAALYALVARVAGAEPRTYTLDAFPDRLQQAWVARTPA
FT                   ANFPDVVIAQIRPDPAGGSDLILYSHSIYGYSDFGTNAARLQRWLSAIGRAAEAHP"
FT   CDS             714063..715829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06330"
FT                   /product="putative ABC transporter permease/ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06330"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79980"
FT                   /db_xref="GOA:F0J4C8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4C8"
FT                   /protein_id="BAJ79980.1"
FT                   /translation="MKFLRAVGAALADAWRLAKPYFSSEERWAALALLGTIIALNLISV
FT                   YLNVLFSYWYKIFYNALQAKDAAGFWQSIFTYKMIKGYPWFVPGFTEIATFNILVGVYA
FT                   FYLQQMLEIRWRRWITENFVTDWLGNRAHYQLSLKAEAGSPLDNPDQRIADDLRSFVSN
FT                   NLSLGISFISNIVNLLSFIFVLWFLVPPLHLLGLVIPGYLVWIAIIYSLVGTYLTHVIG
FT                   WKLIPLSFQQQQVDADFRFNLIRVRENTEQIALYGGEAEEGVGLKQRFHAIYLNWWKIM
FT                   KRTKALNFFTIGFSQVAIIFPILIAAPGYFSGLFTLGLLLQINNIFGNVQGSFSWFVSS
FT                   YPQLVGWRATVQRLDGFERAVKLAHAHRPDHVAVAADAALHAEDLTVSLPDGRELFAGA
FT                   NLAIERGEPVVITGPSGTGKSTLFRALAGIWPFGRGRVSRPSGTAMFLPQKPYFPLGSL
FT                   KRAVAYPQQEYDVDDEAVRAALDDVGLGGLGLRLEHVDNWSLRMSGGEQQRLALARVLV
FT                   AKPDWLFLDEALSALDEEAAASLFAMLRARLPATQIVSIAHHDSVIRLHPRRLRVRRGE
FT                   GGHARVDEAETA"
FT   CDS             715875..716771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06340"
FT                   /product="putative glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06340"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79981"
FT                   /db_xref="GOA:F0J4C9"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4C9"
FT                   /protein_id="BAJ79981.1"
FT                   /translation="MALFGHRGARGLLPENTLEGFASIAALDLTGAEFDVGLTADGVAV
FT                   VHHDPRLNPDIARDADGAWLAPDAAPLLRERTLADLGTFDVGRLRPGSDYAARYPEQTP
FT                   ADGARIPTLDAVIAALSGRDLLIEVKTFPDRPGLTAPPEGIAQAVIACLNRHDALDRAV
FT                   LFAFDWRVLRAAAAAAPALRRCCLTEPETVSAGPLWLDGCDLGAFGGNLPRAVAATGAV
FT                   CWAPFHATLEEDDVREAHALGLAVLPWTVNAPEAFDRMIRLGVDGMISDRPDLARAAIG
FT                   RAGLQVAGPGFVAAMAR"
FT   CDS             717643..718689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06350"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06350"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79982"
FT                   /db_xref="GOA:F0J4D0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4D0"
FT                   /protein_id="BAJ79982.1"
FT                   /translation="MNELKERSENRPAVSRATPVDGSRRSRRPFIILVLVLLGLAGASL
FT                   VYWWRTRDFASTTDAEIDGSIHQIAPRISGQVVAVLVKDNQHVVRGQLLVRLDDGTQKV
FT                   ALDRAEAERAQAQAQLGAREADLAEARANVEVADATLFRAKRDEARYAKVDPRAVTPTT
FT                   RDAIAADLRAAVARTDAARQQVKAAQAAVAAADASVKAAGVAVENARLELGYTEIRAPV
FT                   SGWVAKKTVRTGNVVGAGTAMMAVVGDHVWVTANYKETELGAIRPGQSVNVYVDAVPGV
FT                   AFHARVASIQHGTGSIFSLLPAENATGNYVKVVQRVPVRIEFDDSRISRYLLAPGMSVE
FT                   PYIRIRGK"
FT   CDS             718686..720236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrB"
FT                   /locus_tag="ACMV_06360"
FT                   /product="multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06360"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79983"
FT                   /db_xref="GOA:F0J4D1"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4D1"
FT                   /protein_id="BAJ79983.1"
FT                   /translation="MSLLYASRPNTPRSAAGLYNPWLIVAMVALAPFMEVLDTTIANVA
FT                   LTHIAGSLAVSPDESTWVLTSYLVSNSIILPITGWLQDVVGRKRLFLICVALFTASSVF
FT                   CAVSTSLTMLIVARVLQGLGGGGLQPITQSMYADSFPAEKRAQVFAVFGLVIIVAPATG
FT                   PILGGWLTDHLSWHWVFLINLPIGLIAFTLIAIFVDEPELLVRERAARLAGGLRFDWLG
FT                   LLLVAVGFGALQIFLDKFSIDDGFGSFFIRSLFAVWAVSLSTLVVWEWGHPEPVVNVRL
FT                   FAHRNFAISCLVMFVIGFILLSTTQLLPQLTQTLMGYSSETAGFALALGGLATIGLMPL
FT                   AGVVTGRIIPARVLLVGGLVETGIALIFQSHLAPNASFYTISIDRVLQVIALPFLFIPI
FT                   SALSYVGLPPARNGDASAIINQVRNIGGSIGISFVTTLLAWRTQFHHARLAESVTPYAS
FT                   LHGQTLSQIGAAVQHQAAFMSYLDLFHILGLMALLVWPVVLLLSTPSSPAAEGVVYEI"
FT   CDS             720226..721785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06370"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06370"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79984"
FT                   /db_xref="GOA:F0J4D2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4D2"
FT                   /protein_id="BAJ79984.1"
FT                   /translation="MRSEVFAPRLRRRALMGTAMLAALALGGCELGPNFHAPRTRTAAS
FT                   FLANRPALTSPDTVSQGKVDLAWWQSFDDPALTTLEHEAIARNLDVKAATERLAEAEAQ
FT                   AQIEGAALYPNLNFSGSYTREKPSNKGVFTALSGGGSTSTSTNAGSTASGSSTSIGGGG
FT                   LPGSELQPFNLFQYGFSSVFDFDLWGKNRRAVEASLAAVQASRDARRAVLLNTEAEVAH
FT                   DYINLRAQQAVLAITRRNLASAEHIANLTRQREQAGLANALDVADAQAQAESVRAQIPT
FT                   LRTAIAADINQLSLLLGEGPEALRAQLVTAKPIPPVPPVVPIGLPSQLLQRRPDIREAT
FT                   ARLHQATAEIGVATASFFPDISLAGSVSLQALQFSNLNQLSAVTYAIGPQITMPLFEGG
FT                   RLRGELHLRKAQQREAAVNYAKTVLTAFHQVDNALTAYDEEQKTQAALQADVTQTRRAL
FT                   SLAQERYREGLIDYLQVLTAQQSELAAEQAQAQSQAKISTDLVSLYQALGGGWEQNEPA
FT                   AG"
FT   CDS             complement(721790..722803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06380"
FT                   /product="luciferase-like monooxygenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06380"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79985"
FT                   /db_xref="GOA:F0J4D3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4D3"
FT                   /protein_id="BAJ79985.1"
FT                   /translation="MGMMESIPFSVLDLAPVPDGATPGDALRNSIDLARHAEALGFNRY
FT                   WLAEHHNMPGIASAATSVVIAHVAQATTRIRIGSGGVMLPNHAPLVIAEQFGTLAALHP
FT                   GRIDLGLGRAPGTDPRTAHALRRNMEGTEARFIEDVIELQSYFQPAAAEQRVRAVPGEG
FT                   LDVPLWLLGSSTFSAELAAALGLPFAFAAHFAPDLLGAALTLYRTRFQPSARLAKPHAM
FT                   ICVTVCAAPDDGEAEFLFTSQQRAFVNLRRGQPGLLPRPAPLDGFWSERERAGVEHALA
FT                   YAMVGGPARVAAKLAGFVAEFRPDELMIACQIHDHAARRRSYDIVREIRGGLSKAA"
FT   CDS             complement(722889..724118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icd"
FT                   /locus_tag="ACMV_06390"
FT                   /product="isocitrate dehydrogenase"
FT                   /EC_number="1.1.1.42"
FT                   /note="protein synonym:oxalosuccinate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06390"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79986"
FT                   /db_xref="GOA:F0J4D4"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4D4"
FT                   /protein_id="BAJ79986.1"
FT                   /translation="MAKIKVKNPIVEMDGDEMTRIIWGFIKDKLILPYLDVDLKYYDLG
FT                   IENRDATDDKVTVDSALATKEYGVAVKCATITPDEARVKEFNLKQMWRSPNGTIRNILD
FT                   GTIFREPIICANVPRLVPHWSQPIVIGRHAYGDIYRAAETKIPGPGKVQLSYIPADGSK
FT                   PLILDVHDFKGPGVALGIHNTKASIEGFARASFNYGLARNYPVYLSTKNTILKAYDGMF
FT                   KDVFQEIFDAEFKAEFDKRGLTYEHRLIDDMVASALKWNGGYIWACKNYDGDVESDIVA
FT                   QGFGSLGLMTSVLMSPDGKTVESEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLA
FT                   YRGKFDETPEVTEFAETLERVCVETVESGFMTKDLALLISKDQPWMTTQDFLAKLDENL
FT                   QAAMAKRQAA"
FT   repeat_region   724150..724153
FT                   /rpt_type=FLANKING
FT   mobile_element  724154..725771
FT                   /mobile_element_type="insertion sequence:ISAcr4"
FT   repeat_region   724154..724172
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 19 bp inverted repeat"
FT   CDS             724251..725597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06400"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06400"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79987"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4D5"
FT                   /protein_id="BAJ79987.1"
FT                   /translation="MPATVETTPCLPGLSPVAGKPVLARFDGEMLSSDGGLLALREVEK
FT                   RLGIAAQLAACIDDPRTPERVQHGLDEIIRFRMLMIAAGYEDGNDADRLRNDPMFKLAM
FT                   ERLPEAGDLCSQATISRTENLPGPRALLRMGLAMVEHYCASFRTIPNRVVLDIDDTFDA
FT                   AHGAQQLCLFNAHHDEYGFQPIVVFDGDGRMLAAVLRPACRPKGAQIVKWLRRLIDAIR
FT                   SHWPRTAIMLRGDSHYCTPEVLRFCRARRLDYIFGVAPTTTLRKHVIALEASTTARAQQ
FT                   APGEKIRRFKEFNDGAASWDRVERIIARVEAGPLGVDTRFIVTSLKAGSPRTLYQEIYC
FT                   ARGQAENHIKAWKTHLAADRTSCSRASANQMRLFLHIGAYWLMWSLRSLMPRRSRWRGI
FT                   QFDTLRLRLIKLAVRLETLKRSIRLHLPRSMPDQAILGYALARLPRLVI"
FT   repeat_region   725753..725771
FT                   /rpt_type=INVERTED
FT                   /note="imperfect 19 bp inverted repeat"
FT   repeat_region   725772..725775
FT                   /rpt_type=FLANKING
FT   CDS             725857..726585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="ACMV_06410"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06410"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79988"
FT                   /db_xref="GOA:F0J4D6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4D6"
FT                   /protein_id="BAJ79988.1"
FT                   /translation="MTSGLGHATDWDRDAALTAARILLEIRAVNFRPEEPYTFTSGWKA
FT                   PVYIDCRKIIYFPRARAKICELGVEKLYRHVGFETIEAVAGGETAGIPYAAWMADRMGL
FT                   PMAYVRKKPKGFGRNAQIEGDVPEGRNTLLVEDLTTDGGSKIHFANALREAGAICNHVF
FT                   VVFYYGVFPGSLNTLAEMGMSLHHLCTWWDVLEACRGGDYFPEATLAGVRKFLEDPVAW
FT                   SAKHGGVASAEEAAAFKASK"
FT   CDS             727055..728188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06420"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79989"
FT                   /db_xref="GOA:F0J4D7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4D7"
FT                   /protein_id="BAJ79989.1"
FT                   /translation="MTESTAFYRERRAPLPPFSAILGTDQAERLAIGLTLISMALYLFC
FT                   LVAEWIGVSLNLVDATQSLWLTIVALGGEVAFYVLLRSGISRRWPDPTLSLPQMVFAIT
FT                   LLGAAYLINPQVRGELLMLAALVLEFGAFQLPPRRCRDLGWFAVAVFGVAMAIGATVSP
FT                   DRFDPRIEVFQFALMLAFLPVIAGIAGKLSQMRLDQKQQRRQLRDALKQVQILATRDEL
FT                   TGLPNRRHALELIERETARARRSGAPLCVAILDLDHFKRINDTFGHGVGDEVLRTFGRE
FT                   GRLVLRADNIFARWGGEEFILVMPDSTLIDAQTIVRRLREHMASPECWASCLRARTTFS
FT                   AGIAEFLVGETLDETFIRADAALYEAKKLGRDLTMTA"
FT   CDS             complement(728262..731045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06430"
FT                   /product="beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06430"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79990"
FT                   /db_xref="GOA:F0J4D8"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018905"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4D8"
FT                   /protein_id="BAJ79990.1"
FT                   /translation="MRRMPLAALLSLSAIVAVRAAHAAPQAAGCAWRNDHLSTARRTAL
FT                   LLHALTPGDETDLIAGAGTHEPYVFYTRGLKRFCIPPMGLEDGPAGVGDKLGGVTALPA
FT                   GVALAATWDPSLARRYGAVIGAEQKAKGTAVDLGPTVNIDRDPRWGRSFESLSEDPYLA
FT                   ARIGVAEIRGIQSTGVMAQVKHFAVYNQETYRNTPEDDVIVSPRALHEIYLPAFRAAVR
FT                   RAHVASIMCGYATIGGHESCGDKALLTGVLRADWGFRGFVTSDYQAIHATADAAAGADM
FT                   EQPFATYFGARLTQAVAAGKLARSVPETMTRHILAEMFRFRLFDHPPQGSTTAIVATRA
FT                   DRLAATRIAEAGTVLLKNDGNVLPLDPGHGGTIAVIGPAASIQPVYAGGGSANVVPMQP
FT                   VPPLAGIDHAPGMTRHVDYVAGLPADKALTPIPPSALSGPFRPTPLHGSFQAVLTAPET
FT                   GTYVLGITNPCHCYAPTDLSLDGRELLSDPGTPPVSTYSAAVQLRKGERYRLGVTGAAS
FT                   RLTWATPSTLRPDIARAVAAARRAAVAIVVVADDTESEAADRPDLDLPSAQNRLIEAVS
FT                   SANPHTVVVIDAGAPVAMPWLGKVAAVVDAWYPGETNGTALAAILFGKADPGGHLPVTF
FT                   PAHLADMPTAPVARFPGTGGRVDYSEGIDVGYRWYSAHHVRPLFPFGFGLSYTHFAFSD
FT                   LKVVSGPGDGTRPVVVSALVTNAGKVAGSDVAQLYLRFPRSAGEAPLKLVGFRRVRLAP
FT                   GQSKRLRFTVTPRQTWWWHGSGWTASPGTYRLYLGDAADDAHLAQRVSFPMPQTVGARN
FT                   VLVEAPEQAIPGQPVKVKVSLSAGGEATLRHVRLRLDAPAGWRVSAIGSAAGEGIQPGE
FT                   AVRATFTVTSPGWAAAGTYALRAVAQLGARHCTRGADAGCVTATRDSGAMITLAAR"
FT   CDS             complement(731055..733331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcsA"
FT                   /locus_tag="ACMV_06440"
FT                   /product="cellulose synthase catalytic subunit
FT                   [UDP-forming]"
FT                   /EC_number="2.4.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06440"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79991"
FT                   /db_xref="GOA:F0J4D9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR003919"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4D9"
FT                   /protein_id="BAJ79991.1"
FT                   /translation="MMRHLPALTNGLTFIVASAVGFVLIAATLLPTTGPLPDIEQGVVF
FT                   GLLLILYNLDGGCRSRRKRPIVRISISALTILLTCRYLDWRLTDTLPFGFGTINIALGI
FT                   LLVLAELHGIGSAIMGQIINVLPLDRTPQHFTLDPASCPTVDILIPTYNEDPEIVETTV
FT                   IAATQIDYPASRFRVYILDDGGTDAKRAKPGAAGREAARRAETLREIARKFGAIYLTRP
FT                   ENVHAKAGNINHALGQIDGELILVLDCDHVPTRDFLSRTVGFFQADPKLFLLQTPHNFV
FT                   TPDPIERNLSTFEVMPAENELFYHVMQPGLDFWGAAFFCGSAAVLRRHVLDEIGGISGK
FT                   SITEDAETTVKAMCRGYRTAFYNRPMVSGLQPETFSGFILQRVRWAQGMMQIFMLDNVW
FT                   LKSGLTFMQRLLFTNFAFYWLFPISRSILLLMPPLFLFFGFNVAATTPRQLLVYALPYY
FT                   LAALVNSQYFYGRVRWPFISQVYETAQTVFLSAALVSVLRRPRAPKFKVTPKGEMLDKD
FT                   FISGLSWPFYWLFALACASLGIGLWRIVTQPQLRWALIFVVFWVVLDMIALLGVIGALA
FT                   ERRQTRTMPRIGCKGPAWMHRDGGGWVEAALHDLGRGGAGLVLAAGTEGPQPGDRVRLH
FT                   VPGLRGGLPAVVRHRKDGARNSIIGLQYVSDGVAEARAAVDRAFGDSELLVRNAALRHR
FT                   GTSIAYAFGFLFAIGLRGTARHFRILARDAAITLRVSRQRRALLASSRQAEENGGQKAR
FT                   LAPLS"
FT   CDS             complement(733328..734458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcsZ"
FT                   /locus_tag="ACMV_06450"
FT                   /product="endoglucanase"
FT                   /EC_number="3.2.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06450"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79992"
FT                   /db_xref="GOA:F0J4E0"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4E0"
FT                   /protein_id="BAJ79992.1"
FT                   /translation="MTDMARRNFLGLLGAAALTGGPVMMARELWQSSWRGYRHGFIDGQ
FT                   GRVIDYSANKGFSTSEGQSYGMFLSLVAGDRATFRRILNWTNTNMAGGRLGEVLAAWKW
FT                   GLHGGKWGVIGANSAADADAWMAYSLLEAARIWKDHNLGAEGHKLATRIADDESVAING
FT                   FGRVLIPGASDFPDTPPVIVDPSYTPLFLARGIARATNLPKWQAIAATLPRLMTTICRN
FT                   GFAPDWAWAPQAPASPPAGLPETGTGSFDAIRCYLWAGLTAPETEGSATVLASLKGMAR
FT                   YLATHRAPPQSVDLASQATHGTGGIGFSAALLPYLAALGRHRLLHQQLGRVLAQRETSG
FT                   LFGQPADYYSENLILFGLGGLSGSIRFDKQGGLITS"
FT   CDS             complement(734463..735197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06460"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79993"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4E1"
FT                   /protein_id="BAJ79993.1"
FT                   /translation="MKSASLRRTARRATRAGIVTCISTIAITATARAAPHTNLFIAGGQ
FT                   YANSSQSAYLGAILPLPGGTLGKGFFVSPFAGWNRYTFQKNGQSFTGSEPSASVAIGHA
FT                   WDEPDFNLSLSVAGGYSNTTVTPYAPKGSFHGGQWFAEPEIYAQLKLPAGATATVNGGY
FT                   LTGMRSYWSSAYLLVPVSPSIAIGPEADFGGGINYRSRTFALRVADKLTSSLDVDLSAG
FT                   ATTNLPGPYHPYVALNLSVPFR"
FT   CDS             complement(735194..737464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06470"
FT                   /product="cellulose synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06470"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79994"
FT                   /db_xref="GOA:F0J4E2"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4E2"
FT                   /protein_id="BAJ79994.1"
FT                   /translation="MPCPDRPGHGLPARFQPARWAAGLALALPLCCQPAQARLEHRQSE
FT                   VRSGAGIPATAISHPLAWYDRDRAPIVLKGRSASGDITFQVADHREVSAAELHLLGTNS
FT                   ASLIGGASQLLVLLNGSPLKQIPLDGSSPTIDRTIGIPPGDLRDGTNQLTLSVTQKAAQ
FT                   GCEAFDDPALWTRISPKSQLSMSYRRDSVPLTLASLKSSFMSWQPDTSHIFVLYDPALA
FT                   RAPEPIMAIARSVARADAMRAVSFVARPLDRVGKAVAQTSAATVIILKLENGAAAGSGL
FT                   DAATLSIARNPVGGVVMTIAAETPRALTGAARLIGRPGTVWPNEQSAVIRIPAATGHMQ
FT                   SPHAPAASPTDISFRATGLPTQTEHGRSSQFAPVTFWNPNWDSHAILYLHMAYSAGGGA
FT                   GSMIQALVNGKMVNTIPLTNPDGGTYPDYKLLVPQDALKVGRNRLVLKPVFHMQHAAAS
FT                   ACVANDFGHNLAVTVFSDSHLTIIGGAPVDKDDLAAMTTGVYPLRTIAIASPSPAAISA
FT                   AATLGAKLAQVTPDQPLNLVLEPHPAAKPGVLVVGAVSRLPEQLLSASGISLVGGSPAV
FT                   KEPSGRTPHVPDAADLDDVTAWLGRIFGNRAESAPTGKTGHGQAADATVQGFGNAAIMA
FT                   VADAPAVPDAPGRLAPAIVLTAKSDAGLAQAMGKLVHTATWRQISGQAIVVAPAKSELQ
FT                   VLPAENVPIGPSARLGFLATRNPLTTVLAVLGTLVILILLVRTFVTLRRRRLHPSVKGV
FT                   DER"
FT   CDS             738233..738514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06480"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79995"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4E3"
FT                   /protein_id="BAJ79995.1"
FT                   /translation="MEKTTICILGAVVGAAIAAPVMSSAASLPPAPRFEAASYAELLGP
FT                   VPNASVMLREHDAALARQRAEQGGARIQQADEHHHHHHHHHHHHHQTW"
FT   CDS             complement(738636..739388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctrA"
FT                   /locus_tag="ACMV_06490"
FT                   /product="cell cycle response regulator CtrA"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06490"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79996"
FT                   /db_xref="GOA:F0J4E4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4E4"
FT                   /protein_id="BAJ79996.1"
FT                   /translation="MRLLIFGKTFDRHDSLNSFIKSKLAVIDETADVDEAVDLTHHYEY
FT                   EAVVMRVFDTYRIEFDLIRRLRKSGFRAPIVAVANTLAESARLHILEAGVDDLIVGAPS
FT                   YEETFLRIQNHIRRNRGFQDSSLSVGNIEVNMNAKKVFVGAREVAVTKKEYQIIELLAL
FT                   RKGCVLSKEAILDHLYGGLDEPNAKIIDVFICKIRKKLLAADGQDVLVTNWGRGYMMAD
FT                   QRPQNMVQTVTAPGIQARIKTTASLAVA"
FT   CDS             complement(739913..740620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixK"
FT                   /locus_tag="ACMV_06500"
FT                   /product="nitrogen fixation regulation protein FixK"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06500"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79997"
FT                   /db_xref="GOA:F0J4E5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4E5"
FT                   /protein_id="BAJ79997.1"
FT                   /translation="MLHVAAEPSRSTIANWSAAGEPGFRAGALEAGASLFIEGETVDKI
FT                   YDLVSGIVRLSKMLPDGRRQILGFLFPGEIFTPSGFAISHGGCATCSADAVTAVEVVTH
FT                   RLSSFDGLLASRPELTRSLLATAAKSLFMAQQQMLLLGRMSATERLVWFLLRMAEQQDV
FT                   EAGEPIRLPMSRVDIADYLGLTMETVSRVFRWLRERNIIALKGATEIRIVDPGRARQIA
FT                   DCACSATMPRCRQ"
FT   CDS             740813..741535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="ACMV_06510"
FT                   /product="transcriptional regulatory protein OmpR"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06510"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79998"
FT                   /db_xref="GOA:F0J4E6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4E6"
FT                   /protein_id="BAJ79998.1"
FT                   /translation="MDAGTILIVDDDPQIRTMLRRYLAGEGYGTREADSEAGTHAALLG
FT                   GDVTLVLLDLMLGGEDGLALARAIRARSDVPIIMLTGKDDVIDRVAGLEAGADDYIAKP
FT                   FHLREVLARIRALKRRMTGRGTPEPAEPDPPEAVIRFDGHALDPLGRTLRGRDGADIPL
FT                   TTAEFELLAVFLRHAGRVLDRDQLLNLLKGRDFEAFDRLVDTQVMRLRRKIEQDPGQPQ
FT                   LIKTVRGAGYVFAGKLER"
FT   CDS             complement(741551..743449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06520"
FT                   /product="putative two-component hybrid sensor and
FT                   regulator"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06520"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ79999"
FT                   /db_xref="GOA:F0J4E7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4E7"
FT                   /protein_id="BAJ79999.1"
FT                   /translation="MTPEPEAPDAPLAFARSFEAALIGKSLDGIITSWSEGAENLFGYR
FT                   ADEIIGRSIHVLAPPGREAEMDELLARTARGETFDQFETIRRRKDGTLVRVLLTLNPVH
FT                   DTEGCIVGISKIARDITEHRSTEARLRSILDTAPDAIVVIDPRGTVRSFSQAAERMFGY
FT                   AAEEVVGRNVSMLMAEPHAAAHDGYLARYLETGERRIIGIGREVEARRADGSTFPIELA
FT                   VGEVDLPETRLFTGFIRDASKRKRLENDLAQAQKMEAVGQLTGGLAHDFNNLLAVISGN
FT                   LEMLESHVAGGEAAELLAEARLATERGAELAARLLAFGRRQTLRPLAIDVNELVGKMAP
FT                   LFRRTLGSPVMIETRLAAGLPRTMADPGQIETALLNLALNARDAMPKGGRLVIETGLLH
FT                   VDADYAAQQAETLPGDYVVLAVTDSGIGMSAETRGRAFEPFFTTKAVGEGSGLGLSMVY
FT                   GFVKQSGGHVQIYSEPGLGTTVRLFLPAIRAEMPAADDEAAPSPPPDRAIVLVVEDDPA
FT                   VRRVAERRLARLGYSTIDAATGAAGIAALEAHPEIAVLFTDIVLAGGMSGLDLAIAARA
FT                   ARPELPVLFTSGYGDPIVLKGRALPAGAIWLQKPYAEAALANALAALLRPVRDEGV"
FT   CDS             743730..744191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06530"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80000"
FT                   /db_xref="GOA:F0J4E8"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4E8"
FT                   /protein_id="BAJ80000.1"
FT                   /translation="MSYIEQVLLPDETVMSWTHLHWFVYLRGIVTMVLAFALIIAGGLA
FT                   GGRPSTYLHVAAAAAFLLGCWLLLVAWLRRMSTELAVTDRRVIHKSGILGRTTHEMSLE
FT                   KVESVEVRQSIAGRLFNYGTVIVRGTGSTWEPFPRIADPLAFRSSITAA"
FT   CDS             complement(744201..744380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06540"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80001"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4E9"
FT                   /protein_id="BAJ80001.1"
FT                   /translation="MPWSAEEAERHTHRANTPELRELWAKIANECLARTGDEGRAIREA
FT                   NAVIARLARQAPRG"
FT   CDS             complement(744382..745203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06550"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80002"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4F0"
FT                   /protein_id="BAJ80002.1"
FT                   /translation="MKARGGVTLLCLVVLLAGCARPPVRAAIRPPAPERAADAAYRAEV
FT                   AAAAAELAREVPRASVPAPAAAAQWIAAARRGLAAAGVGVTRSQLIVVVDRNPRVQRLC
FT                   IVAARPAGAWDVVGCDAVSTGQAGRRGYFITPVGVFAHTTGILDYRALGTFNENHIRGL
FT                   GLKGMRVWDFGWRVAEKGWRSDGETGEIRLLVHATDPDYLEPRLGQTGSQGCVRISAAM
FT                   NRFLDRHGVLDAEQEAASRDDARIAATLPADRAPSPLAGELLVVIDSTEGA"
FT   CDS             745359..746813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06560"
FT                   /product="Xre family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06560"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80003"
FT                   /db_xref="GOA:F0J4F1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4F1"
FT                   /protein_id="BAJ80003.1"
FT                   /translation="MTEPEDRPLREPKLFAGARIRQIREQRGLQQRDIARRLGLSPSYM
FT                   NQIENDRRPVPPRLAAPLCDLLGIPLAELSGDDEVRRAGDLLEAALDPALGPGRLTFTE
FT                   ARAAVRDTPELARRFIALYAAYRAQQARLARDPALGRDEPGPLPPYDEVRDWVQSERNY
FT                   FHEIDLAAERLAAHIHATLGPDSAALERHLAAGHRIEVVPSANLLPDGILWQIDRRNRR
FT                   LLIAEEMRLETRRFSLAHVIGLLSHGRLISRLIERAKVSSDAARGIARVALANYFAGAL
FT                   IMPYAAFLAEAEAERYDIQRLQIRFQASFEQVCHRLSTLQRPGAQGIPFFFLKTDTAGN
FT                   VLKRSSATRFRFDRFGGPCPLWNVYQAFSQPGKISVQLAQPPGETTYISIARTVGGGGT
FT                   SYLSRPRAVAVGLGCEIQYAPRIVYAAGLDLDRPGAIDPIGPGCRSCPRVACRHRAMPP
FT                   IDGTIDVGTAERGVVPYRVSRPPPGA"
FT   CDS             746857..747996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="ACMV_06570"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06570"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80004"
FT                   /db_xref="GOA:F0J4F2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4F2"
FT                   /protein_id="BAJ80004.1"
FT                   /translation="MTIPGSPVNPAAPLRIESLRLTDFRSYARLDWQPGGMVVALAGPN
FT                   GAGKTNLLEAVSLLAPGRGLRGARLAELARRAPGASGGWAVAARIDGPEGRFAIGTGIE
FT                   AGQGERRRLLLDGEPAAAARVAARFSCLWLTPQMDRLFTEGASARRRFLDRLVLALEPG
FT                   HASEVAAFEAASANRNRLIEAGGYDPLWLATIEDSMARHAAALTAARLHVIERLNALLA
FT                   AGAADPFPAARLSLDCPIGAELAHRPALAVEEWLRGRYAATRAEPVAALSPQRADLGLE
FT                   HASSGLAAALASTGQQRAMLVAIVLAHAALVAISRGAAPVLLLDEPFVHLDAAHRSALG
FT                   EALHRGGAQVFCTATERDQLAALGDAAIWTVGEGVLHRA"
FT   CDS             complement(748046..748975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="ACMV_06580"
FT                   /product="flavokinase/FAD synthetase"
FT                   /EC_number="2.7.1.26"
FT                   /EC_number="2.7.7.2"
FT                   /note="bifunctional protein"
FT                   /note="protein synonym:riboflavin kinase/FMN
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06580"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80005"
FT                   /db_xref="GOA:F0J4F3"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4F3"
FT                   /protein_id="BAJ80005.1"
FT                   /translation="MIRVFHDWSGIPPEARGASVALGNFDGMHRGHVEVLRAAHAARPD
FT                   APRAALTFAPHPREFFRPDDPPFRLMLEAERAAALEAEGIEILYELTFDRAFSLLSAEA
FT                   FIEEVLDRGIGAAHLACGADFAFGHRRGGDVAMLRAAAEARGIGLSIVPHLDDAEGPIS
FT                   SSRIRRLLQDGYPERAAALLGRPHAIRGVVAHGDARGRTIGFPTANVALGRHLEPARGV
FT                   YAVTVRLADGRMVKGVANIGRRPTVAEGAISRLEAHLFDFSGDLYGQEITVSLHRFIRD
FT                   ERRFASFDELRAQIAADADEARRLLSTV"
FT   CDS             complement(748972..749472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06590"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80006"
FT                   /db_xref="GOA:F0J4F4"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4F4"
FT                   /protein_id="BAJ80006.1"
FT                   /translation="MCAAIRSTATGVPMPSCVPFDQLEPGQTASLGKTITEADILLFSA
FT                   VSMDTNPVHLNQELADETLFKGRVAHGMLCGSLISAVLGTVLPGLGTIYLTQSMRFRAP
FT                   VRIGDTVTAEVEVASLDHEKKRATMRTRCFVRGKVVIEGEAVVIPPTEAVVAVAQNEKR
FT                   AAE"
FT   CDS             complement(749495..750427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06600"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06600"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80007"
FT                   /db_xref="GOA:F0J4F5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4F5"
FT                   /protein_id="BAJ80007.1"
FT                   /translation="MTMTEPRIAVLLPCHNEAAAIGAVVRAFRTALPGADIYVFDNNST
FT                   DDTAAIARGAGAIVRREALQGKGHVVRRMFRDIQADLYVMADGDDTYDAALAPAMIELA
FT                   RRGPYDLVNCVRRETDAAAYRGGHRLGNRLLTGAVRAIFGDRVEDMLSGYKVLSRRFVK
FT                   SFPVLATGFDIETELAVHALELALPIAHVEGDYRPRPAGSESKLRTWRDGWRILRLILR
FT                   LLRHERPLAFFGALGGAAFLVAAVLIAPVIATYLRTGLVPRLPTAVLATGIVLAGALSL
FT                   TTGIILDTVTRGRRETRLLAYLRHAAPGP"
FT   CDS             750552..751727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06610"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80008"
FT                   /db_xref="GOA:F0J4F6"
FT                   /db_xref="InterPro:IPR018666"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4F6"
FT                   /protein_id="BAJ80008.1"
FT                   /translation="MRRLVRFLSLVVVLAALGWLGLWWYAESRLALAVDQAAARLHAAG
FT                   WTVSHGAVTRGTSPFVADVRVADLRLTPPVADGPAPTLEIPAVDLVVHPAAPLTLDLGF
FT                   ATVWRMALEGGPSFTLRFGSIAADDRFDLADLLHHAPDPLRAGAFHATDLRVDSENTNF
FT                   TLVSIAAIDASGTRNPDAGPDSMAATLHESLRGLALSPLFVTLGNLPFGGKLTALSVDL
FT                   ALSGPAAALPARLTLPPGARWLAPGAAANLPALWRQLGPALHRWAQGGGHGTYDFGLTV
FT                   GPLDAHGTGSFGFDAGAQPKGRLHLVADGLGAALGALSTHYPSLTGDISALTTAAAPYF
FT                   TRGPKGGQRLAVDFVLAHGAVSANGTKLTTVPPLVWPASPQAVPGKAAPKG"
FT   CDS             751733..753208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06620"
FT                   /product="putative major facilitator superfamily
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06620"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80009"
FT                   /db_xref="GOA:F0J4F7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4F7"
FT                   /protein_id="BAJ80009.1"
FT                   /translation="MDTEPEDEAATLSPSQMRLTALIVATALFMQNLDGTIVATALPAM
FT                   AKSFHADPLHMSLALTSYLLSLAIFIPASGWFADRFGSRTVFRAAILVFTIGSILCGLS
FT                   QSLGQLIAARIFQGLGGAMMVPVGRLLLLKSVRRRDMIAATSWLTMPALLGPIIGPPLG
FT                   GFIVTYLSWRWTFDINVPIGLIGIVAVTLHVREVKDAEHAGRLDIAGLVWSGLAMALLM
FT                   SGFETIGRGLIPLGWSLGCFAAGAVASLAYWRHARRHPHPILDLTLMRIDTFANSTIAG
FT                   SFFRVLAGAMPFLLPLMLQLGFGDSAAKSGTITFAAAVGALAMKPLAEPILRRLGFRVA
FT                   MMLFGGLAVVFTAACAAFRPGWPELALDAVLLVGGVFRSLQFTALNTIAYADVPRSRMS
FT                   AATSFYATFQQITLTLGISVAAGALEFTTIFAGHAEPSIADYGWAFLIVSAIGGLSVPV
FT                   CARLSPAAGDDVSGHHAPPPAGPAIDANPAARQ"
FT   CDS             753239..754978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06630"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06630"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80010"
FT                   /db_xref="GOA:F0J4F8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4F8"
FT                   /protein_id="BAJ80010.1"
FT                   /translation="MMETGSSIALARRLWRQHVSAYRGRVALIIVATLIMSGTTALYPA
FT                   LIDRAFTMFARRDPRILYQVPLIVLAVTLVKALAQYAQTLLTQQVVLGTIRRLQVSMFD
FT                   HLTGAELARIDREAPAALAARFTTDATVIREAMSRAVNGIADFFTLIGLVGTMLWIDWE
FT                   LSLIAALLYPLAGLPIQKIGRRIRRASGGMQERMGETAALLNESFAQARTVRAYGLEED
FT                   ERRRAERAFEHLYRALMRMIRGRAALDPVLEVLGGLAIALVIGFAGWRHAAGASGIGNF
FT                   TGFVAALLIASRPLRALGTMNAAVQEGMAGLERVFHVIDEPSVVADRPDAVELPPGPGR
FT                   VEFRHVGFAYPDGRPGLRDLSFVAEPGRTLALVGASGAGKSTALALLPRLYEADRGAIL
FT                   IDGADISAVSLDSLRGAIAYVGQDALLFDDTIAANIAMGRRGASIDEIRAAAEAAAAGF
FT                   IADLPEGFETRVGVNGQRLSGGQRQRVALARALLRDPRILLLDEATSALDAESEAAVQQ
FT                   ALARLRRGRTTIVVAHRLATVRDADRIVVMADGAVVESGTHEDLIAGDGAFARLVRAQA
FT                   LAG"
FT   CDS             755254..755832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06640"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80011"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4F9"
FT                   /protein_id="BAJ80011.1"
FT                   /translation="MLRPRFDAFIEALCAHIAGEGAKRRIAGPLIILIWQRLRRLAARF
FT                   ARLVTTPPRARATPPRARITRPAGRPGAPHTLPRAFGWLARLIPGTASVAAPFRALLDT
FT                   PDMAALIAATPEAGRILRPLCHTLGIRPPAPLRRPRQPRLAPPPEAPSPELPPRPEPPA
FT                   HHPAPPPNPAWPRAPGATRFNPPRRKKPA"
FT   CDS             756027..757169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06650"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06650"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80012"
FT                   /db_xref="GOA:F0J4G0"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4G0"
FT                   /protein_id="BAJ80012.1"
FT                   /translation="MVENRSKTVALSSAALDAPWENGALWLFFPDYRGSVPYQSLLAAA
FT                   LAERAEVESGTIAMALEAAPRRRTVFHLHWEDALYADAGGDGEAAATISDALERLAAFR
FT                   ARGGRLVWTVHNAAPHEDRFPALSLGLRQGLARLADVVHVHCRTGVDLALGLGAPAERI
FT                   VLMRCPDLAPAYPDDITDAAARRYFGFAASDIVFANLGANRGYKDLGGLHDGFTALNAL
FT                   IPAARLVLAGRQGGYFEQRYIEPRPGIRLIPRFVDDAVVQYVVRAADFMVLPYRRILTS
FT                   GALALAFGFGRPAIVPDLPALLDVVRPGEDALVYRADDTGDLLRAMIEAAELPAAERLR
FT                   MRAQALQAGREVGFDRLAGALLDAIPPAPGKSAPAATPCG"
FT   CDS             757174..757944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06660"
FT                   /product="glucose-1-phosphate cytidylyltransferase"
FT                   /EC_number="2.7.7.33"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06660"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80013"
FT                   /db_xref="GOA:F0J4G1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR013446"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4G1"
FT                   /protein_id="BAJ80013.1"
FT                   /translation="MKAVILAGGLGTRISEESYLKPKPMIEIGGKPILWHIMKIYAHHG
FT                   INDFIICLGYKGYVIKEYFANYFLHMSDVTFDMRNNRMQVHHRHAEPWRVTLVDTGADT
FT                   LTAGRLRRVREYLGNDTFCLTYGDGVTDLDLAALLDFHAGHGKLATLTAIQPPGRYGAL
FT                   NLDDRTVRNFQEKPAGDGAWINGGYFVLEPGVFDYIESDMTPWEGEPLERLATDGELMA
FT                   YQHSGFWQAMDTLRDKNHLESLWMRHDPPWKVWA"
FT   CDS             757941..759017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbG"
FT                   /locus_tag="ACMV_06670"
FT                   /product="CDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06670"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80014"
FT                   /db_xref="GOA:F0J4G2"
FT                   /db_xref="InterPro:IPR013445"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4G2"
FT                   /protein_id="BAJ80014.1"
FT                   /translation="MILFDDAYRGRRVLVTGHTGFKGSWLSMWLARLGADVSGIALDPD
FT                   TSPSHWDLLGLGIDSRRLDLRNAAALREAVREVRPEVVFHLAAQSLVRRSYRDPLGTWN
FT                   TNVMGTANLLEACRDVGGLRAVVIATSDKCYQNNEWCWGYRETDPLGGNDPYSASKAAT
FT                   ELLAASYRRSFFAGGEAALIATARAGNVIGGGDWSEDRLVPDIVRAIAAGAEVQIRSPR
FT                   ATRPWQHVLEPLSGYLLLGARLLRGDDMFATAWNFGPGPEANLEVATFLEAFAALWPDL
FT                   RWRAEDMQGPHEAGQLNLDSARARTELGWRPVWEIGEAIERTVAWYRHHATHGLACSEN
FT                   QVDEFEQDAARGDAVWCR"
FT   CDS             759017..759568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbC"
FT                   /gene_synonym="rmlC"
FT                   /locus_tag="ACMV_06680"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06680"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80015"
FT                   /db_xref="GOA:F0J4G3"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4G3"
FT                   /protein_id="BAJ80015.1"
FT                   /translation="MDIRQTALPGVVVVESPVVADARGAFQRCFCSRDLAPLLGTREIA
FT                   QINRSLTARSGTVRGLHFQFPPHAEMKLIRCLRGRVWDVAVDLRAGSPQLLRWHAEELS
FT                   AANGRMLVIPEGVAHGFQALENDSELLYIHTAHYAHAAEGGVRCDDPQLGIDWPMMVGG
FT                   LSDRDRALPMLPALFTGFPQ"
FT   CDS             759565..760788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06690"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06690"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80016"
FT                   /db_xref="GOA:F0J4G4"
FT                   /db_xref="InterPro:IPR013630"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4G4"
FT                   /protein_id="BAJ80016.1"
FT                   /translation="MMCRHCAADLDQGFLDLGFAPPSNAYLTPEQLRRPEITLPLRLFV
FT                   CTRCWLVQTEDFAAPEDLFAADYAYFSSTSSSWLDHARHYAQMITTRLALDGDSLVVEV
FT                   ASNDGYLLRNFVAAGIPCLGIEPTRDTAEAAERLGIPVLRAFFGRGLGERLAAEGRRAD
FT                   LIIGNNVYAHVSDINDFTAGLQAALKPDGVITLEFPHLLRMIAGRQFDTAYHEHFSYLS
FT                   LTTVARIFHSHGLRIWDVEELPTHGGSLRIYGCHAEDARPEAESVGRMMATERAFGLFE
FT                   RTTYAEFQAIADGIRNNLLGFLVDERRRSTRIAAYGAAAKGNTLLNFAGIRPNLLPYVV
FT                   DAAESKQGKFLPGSHLPVVPPAALRERRPDIVLILPWNIADEIVERHSYVRDWGGRFAV
FT                   AVPEITFL"
FT   CDS             760937..761953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06700"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80017"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4G5"
FT                   /protein_id="BAJ80017.1"
FT                   /translation="MRGERREVGDMSCEDGLTLILPTRGERDISAWIEYHVDLLAGEYG
FT                   EDFSIIVASEIEPGYRRALENRFVRHFRLEECFFRRIERALDMTTTRNFVLVADDDFLL
FT                   SLDRREIEDMPDDVISISPKTLRSTGTTVNELIENIHTVAISSHFEFCHDTKEERLVRY
FT                   LSAPLPSDNSIFYGIFNKDKYRTVLSKHMPFMACLFPACDWTFVAALMAEYKFRSSETS
FT                   VLLRDTTNVLDLIARELRDIKTMPFQAFMPWAKAIPLHLSLSYIRDVIAPDLLPLLSKE
FT                   IVRLNMERYDGLVYANLLDPEVGLNRDDIADVVNNSKWLNSEGCVMFQNLFNQTMTL"
FT   CDS             762104..762946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06710"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06710"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80018"
FT                   /db_xref="GOA:F0J4G6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4G6"
FT                   /protein_id="BAJ80018.1"
FT                   /translation="MARILLTGATGFVGRAAAQVLKARGNDLRCVVRTGTVGRLVGLGI
FT                   SDEVVETPDLFAETSEWWSEVAAETDIVLHAAWYAEPGKYLTSGKNVDCLAGTLRIAQG
FT                   VARAGVGRFVGVGTCFEYDLSPGYLTHMTPLDPTTPYAAAKAAAYLTLREWLPRQGVSF
FT                   LWARLFYLYGPGEDERRLVSYLHRQLALGKPVELTRGEQVRDFMDVREAARLLVDELES
FT                   TRIGAVNISSGQGITVRALAESIADIYDRRDLLHFGARPENLTDPPLVVGLRDSGAEA"
FT   CDS             763073..763843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06720"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80019"
FT                   /db_xref="GOA:F0J4G7"
FT                   /db_xref="InterPro:IPR007072"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4G7"
FT                   /protein_id="BAJ80019.1"
FT                   /translation="MSDFKSEIPDRVAAMQANGRLPAAAAEFLRASVPCQYSYNFHWLG
FT                   RPIIQYPTDVIAMQELIWEVKPDLIVECGIAHGGSLIFSASMLALLDMCEAIEAGEPLE
FT                   PAVSRRKVLGIDIDIRAHNRTAIDAHPMRSRIEMIEGSSISADVIAEVGRIASAHRNVL
FT                   VCLDSNHTHDHVYAELEAYASLVSVGSYCVVFDTLIEDMEPDACPDRPWGVGNNPKTAV
FT                   HAYLKNHPEFQIDKLIPDKLMITVAHDGWLRRTC"
FT   CDS             765024..766637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06730"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06730"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80020"
FT                   /db_xref="GOA:F0J4G8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4G8"
FT                   /protein_id="BAJ80020.1"
FT                   /translation="MTDKISTLRLSVSRLLVIWMWANAGAAALTGYLSDNGWIAPLIMG
FT                   IVLAGICHICWKVAPLGKSSRLTTAVAFVAVISVMVAAARGSEMQIDLHMYYFAALAVI
FT                   AASCDRDAIIMATGAVAVHHLLLNFIAPALVFPDGTDFRRVILHASILVAEAASLILMS
FT                   NSINALFEDSENSVRRAELATQEAERAGREALDERSARATEQAAQARAREQEAARLQDV
FT                   VDALAGGLSGLAHGKLNERLTDAFPSEYDVLRRDFNSAAQQLNDVIRDLVVQAGTVESG
FT                   SAEIATAVEDMARRTERQAASLEETAATVAEVSQGLSRTLDDVVSTRDLAGKAHEMTRA
FT                   SSEVVNEAMTAMGRIDESSRQIAQIIGVINDIAFQTNLLALNAGVEAARAGDAGRGFAV
FT                   VASEVRALAQRTSDAAKEIRELIATAETQVRSGVESVDRTGAVLASLASQVNDIDKMVR
FT                   RISDTANEQASSLKMVSQAVGDMDQVTQQNAAMVEEANAAANSLLAEARHMMTLQQRFV
FT                   VDDAAAPPSRYWPAAAKEMA"
FT   CDS             766637..767191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06740"
FT                   /product="SCO1/SenC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06740"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80021"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4G9"
FT                   /protein_id="BAJ80021.1"
FT                   /translation="MPGRRALLAGLAGWPAACIAAPPPAFRFALQDGAGKVVTQARFRG
FT                   RYLLVVFGYTKCTDRCPTTLTHLARALEMADPRNRIFDAVFITVDPRHDRPKAAAHYAS
FT                   LFSPRIEGLGGSKRQVNEAIAAFHVYVAWPNGPNGQPTHGGLIYLLSPSGQLATVLPDG
FT                   LSADALASALRRYPVPKPGRE"
FT   CDS             767480..768289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06750"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80022"
FT                   /db_xref="GOA:F0J4H0"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4H0"
FT                   /protein_id="BAJ80022.1"
FT                   /translation="MRLRAIGYGLAVALALGSAGSALAVPARRSGGPEAAAGEARVAER
FT                   RLPARVRRDLAVLRARWRRRAFAADWRRLARRYPAPGDRDFIVVDIARERLDLFRDGRY
FT                   RAGWRVSTSRFGVGQRRGSDRTPVGVFRVVGELGRGGPADQVLNAAGPTGRFAKPVLAP
FT                   GHLAASRLIVGRILLLEGLQPGWNQGGDVDTLARDIFIHGTANVGMLGRPASRGCVQMA
FT                   PGAVIRLARMILPGALVMITRGVGGLRRIPGPSTGPGNLDFSEIAKK"
FT   CDS             768338..769159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06760"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80023"
FT                   /db_xref="GOA:F0J4H1"
FT                   /db_xref="InterPro:IPR007715"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4H1"
FT                   /protein_id="BAJ80023.1"
FT                   /translation="MTASIIGPEDIDAVLATVPRQRIRPLDAVRALIRLARDPEDTQQV
FT                   ALMGIALAGRSQRRVFRRFVSFPAGQAVIREKRSLARTLDDHDYLRTLKPNSLGRHYLA
FT                   FMEREGLSARGLIEATPAVTRKLSELPEPIRLFSSYTSRDMHDLYHVLTGYGRDELGEV
FT                   CVLAVSYEQLRIRAFRLISTTGPFVVRRYLRKAGIDGDGVFAAVREARRIGRAAAWIPS
FT                   LDIEALLAEDLDELRARLNLAEPVAYRAVIARIRTATGWNSGPFTALARTV"
FT   CDS             769518..770471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06770"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80024"
FT                   /db_xref="GOA:F0J4H2"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4H2"
FT                   /protein_id="BAJ80024.1"
FT                   /translation="MTVRDAILQACQVAFTIAAAPFIQGCIVQFEERIQRGHGPGVLQP
FT                   YRDLWKLFHKDIVVPETASWLFWVTPVVAFTCMMTVPILIPVLTNYPLPLSNMGDILGG
FT                   GLILTLGSFMITLAGLDTGSAYGGIGSSRAAVIGILAEPTLILVFVGITLFARSMLPFV
FT                   VNHLLVASPAVYLGPAHLFLVAAFFILLTVETDRLPIHSSTHIEVYMIEEARVLEYAGP
FT                   LHALLKWASMMKQFILYTIFCNVLTMPWFLSTRGLAPGVLGSAAGVIVKFVIVACAIVT
FT                   VDTIQARLRFYRYQEPLAVSFLLAVLAIIGTQIGLG"
FT   CDS             770471..771151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06780"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80025"
FT                   /db_xref="GOA:F0J4H3"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4H3"
FT                   /protein_id="BAJ80025.1"
FT                   /translation="MHGFHATPVEASLFGVLAIASLLLAFVMLGSRWLRHYLIAFAAES
FT                   WAIALLSAAVGYIDHYPELYVIALLTLAFRGTLLPYLLLRIIRRLTIERELEPLLRPGS
FT                   SLVLGAGAVVFSLVVAARMTQALHLTAEVVVLALTVMLSMKLIGYLMLAVRHEAVSHVL
FT                   GLLVLENGIFLGTQILVPGMPMLLELVILFDLLIVVVCFGVLVRYLVGQVGSTSALQLR
FT                   RLVG"
FT   CDS             771153..772673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06790"
FT                   /product="NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06790"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80026"
FT                   /db_xref="GOA:F0J4H4"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4H4"
FT                   /protein_id="BAJ80026.1"
FT                   /translation="MTGIATSVLIGAPALAVLAMLAAPRPRLAERLNLAAAGLCFIAAV
FT                   AMTVSAPAAGARYLGRYLIVDPLGAWIILCAAVVYLLASIHACGYMRMPGEEARLPRFY
FT                   QLFALFALTIFIAPLMNNPGLYWIAIEMTTVVSTFLVAFEQAAEAIEAGWKYIIIVSAG
FT                   ITLALLGTVIFYWAGTFSLGPTYDMTWRVLRHAAPHMDRALLVLGFLLVLVGYGTKVGL
FT                   APMHTWLPDAHSEGPAPVSAMLSGALLNAAMAGIVRYLAVLHRAGLFMLPDQILAVFGT
FT                   ASLLVAALFIVRQRGVKRLMAYSSVEHMGIVALGFGFGGPFGVAGAMYHMLNHSLNKSL
FT                   MFFGAGNAMRSFGTRSMTRIRDYARHFPVAAALWLAGAVAITGAPPFGLFASELTILRA
FT                   GFRGAGLWAAIVMLVLLILIFIGFLDHFRVMYFEPAGDDAPRPARLGAWTVAPMWLALI
FT                   PLLVLGLWWPRAMWRDFQTVEQVIERPAAAPGPAARASARMPDARRAS"
FT   CDS             772670..774106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06800"
FT                   /product="putative NADH-ubiquinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06800"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80027"
FT                   /db_xref="GOA:F0J4H5"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4H5"
FT                   /protein_id="BAJ80027.1"
FT                   /translation="MNMPSRRGMDPSSIEAAAGALRAAGGRMIMVYAAPEADGRQTLRY
FT                   VSSRPGIAGFEVWSVPAGGTVPSIATIWPLLGWYERETADHRGIAFSGQPEPFSLIAPL
FT                   RADEEADLRRLPGLSGDAVQVLPFGPVRAGVVESAEFSFFYVGEAILHYVPHLFLKHRG
FT                   MEDRFVDQTPETGLVLAERVSGVGSVAHALAYAQAMEAAAQVAVPGRARYQRVIVAELE
FT                   RLYNHLHYLGHLADTTTLKVAHAEGALLAERVKQIGARVTGSRFLRGVIAPGGLRRELR
FT                   VEGLAGALDALRAPIRRYIARLDASESHFDRLATTGVLPREVAFDQGATGPVARASGLD
FT                   RDLRRDHAYAAYDDPDLALAVATGTDGDAHARARVRIAEIENALLMIERAIALTPGGAI
FT                   RVACAPAAGAEAMGWAESPRGTLIYAVHVGPDGRLARVKIKSPSFSNWRVFPYTVHGTN
FT                   MMDYAINEASFGLTIAGCAR"
FT   CDS             774120..774914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06810"
FT                   /product="putative NADH ubiquinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06810"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80028"
FT                   /db_xref="GOA:F0J4H6"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4H6"
FT                   /protein_id="BAJ80028.1"
FT                   /translation="MALWTLIGLLEGSATTSWPLKPGPDGQDGVVGMPRLDPGRCEAGC
FT                   EVCAASCPTGAIGLAGARIALDYGRCVVCQRCVETCPTGALAESRDWAFGARTRDDLRT
FT                   GIEAAGMAALAAADGPGRGFRRSLHVRHVDAGSCNGCESELQALNNPFYNLHRLGIFFT
FT                   PSPRFADLLLVTGPVTRAMLEPLRRTWEAMPAPRWVMASGTCAVSGGIAPGGPCLSGLE
FT                   EALPVDLYLPGCPPNPAAIIEALLMFLGRRAQRVRGGRIDGE"
FT   CDS             774904..776880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06820"
FT                   /product="putative NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06820"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80029"
FT                   /db_xref="GOA:F0J4H7"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4H7"
FT                   /protein_id="BAJ80029.1"
FT                   /translation="MANDLIGLATLFWLVAGLIALAGRGVVLGRGLAGLGCLAGMIAAI
FT                   LTLPGASPPVALPVFRIADEGSGFTLSPAALWLFGFGLAPAMLAAWLGSPGRGGRFWLF
FT                   GLSMSLIGALGVFGVTQGAAFLVAWEVMSLGGAAMILGERLAEGAGSRALFMLGLLEVG
FT                   AVALLAAVLVLGTASGSLGFAGFAGAWRGAALYGPAIAGGLLLVGFGAKLGLLPFYEWF
FT                   PGAYGAGSGATGAVLSGVVLNAAFFGLARGLLVWLPGGVDEGFGIALCAIGVISAILTT
FT                   LYAFQQEDWRALLAFSSAENASVAVTALGASLLFEAGHLPLFAGLAFTVALLHLAAHAL
FT                   AKGALFLAADGVFAATGGYAIRQDGVLRANTPLFGMGALFAAMSLAAMPPQAGFVSEWF
FT                   MFQTVFQGFHLPGLAERLTLVLTGAGLALTAAIAFATFVKLFGVGLQGRAADGGARLPA
FT                   RHQSAVGALGLAVLALAVGMPVWLGALARVWPAHDAIDAAAHMTDGWILVPLSAGFAFI
FT                   SPSKLVIVMPLLALVPVAAILLCRRRPARRVPVWYGGSPRLDRRNATTALTFSNSLRTF
FT                   YSFVYRPRAETGVETSLSPYFVKHLRFEHDVAPIFGPALFGPVVRLVHGLARRGRVLQS
FT                   GSLNLYLGIIGLLLVAILVVALF"
FT   CDS             777002..777349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06830"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80030"
FT                   /db_xref="InterPro:IPR003793"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4H8"
FT                   /protein_id="BAJ80030.1"
FT                   /translation="MRIMEDALLLRVFLGEDDMAGGQPLYRAILEAAMRAGLAGGTALP
FT                   APMGFGGSRGIRTGINVDAGAHQPIVVEIIDRPDRIEAFLPLIEPMIPSGVVTLEALKM
FT                   RKIVPGSPAPA"
FT   CDS             777380..777796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ACMV_06840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06840"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80031"
FT                   /db_xref="InterPro:IPR003793"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4H9"
FT                   /protein_id="BAJ80031.1"
FT                   /translation="MDVPHEASLLRIYTSSADRHGGTPLFIAIVHAARDHGLAGATVLR
FT                   GPLGFGHTGRLHEGHLLPFSDDHPVIIEIVDATDRIEAFLPVLDSMMQSGLVTIERARV
FT                   LQYGRHRPGWLERVRQQFFPASPPPAAQARVGLN"
FT   CDS             complement(778012..778917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /gene_synonym="rmlD"
FT                   /locus_tag="ACMV_06850"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06850"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80032"
FT                   /db_xref="GOA:F0J4I0"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4I0"
FT                   /protein_id="BAJ80032.1"
FT                   /translation="MPPRPILITGASGQLGHALAARAPAAGLPARAIGRPGFDFDAPET
FT                   IARALAAADPALVVNAAAWTAVDAAETSADAAFRANRDGPATLATLCRSRGIPLIHVST
FT                   DYVFDGTKGAPYTETDPIAPLGVYGHSKAAGEEAILAAGADAIILRTAWIFSATGKNFA
FT                   RTMIAAARRLPALRVVADQRGAPTAAEDLADAILAIAARILAEGWQPGFAGIFHATSAG
FT                   DTSWHGFATEILALAARHGTPHPDIIPIATADWPTPARRPADSRLDTTKLNQTFALALP
FT                   HWKDATARIVPAILAQDETP"
FT   CDS             complement(778919..779473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbC"
FT                   /gene_synonym="rmlC"
FT                   /locus_tag="ACMV_06860"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06860"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80033"
FT                   /db_xref="GOA:F0IXU4"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:F0IXU4"
FT                   /protein_id="BAJ80033.1"
FT                   /translation="MIEPLDLPGVMLITPPRFADSRGWFSETWNQARLAALGFTETFVQ
FT                   DNHSSSTRPGTIRGLHCQLAPFAQGKLVRCIRGAIWDVAVDIRHGSPSFGRHAAAELSA
FT                   ANGRQLWIPPGFLHGFCTTEPDTEVVYKVTAPYDKASERGVIWNDPDLALPWPVPAGTA
FT                   LLSDKDNLLPRLAEAEPWFRL"
FT   CDS             complement(779470..780351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /gene_synonym="rmlA"
FT                   /locus_tag="ACMV_06870"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06870"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80034"
FT                   /db_xref="GOA:F0J4I2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4I2"
FT                   /protein_id="BAJ80034.1"
FT                   /translation="MIRKGIILAGGSGTRLHPSTLAASKQLLPVYDKPMVYYPLSTLLL
FT                   AGIRDLLLISTPQDLPQFRRLLGDGGQYGIRIGYAAQPSPDGLAQAFLIGADWLAGEAC
FT                   ALALGDNLIHADHLSLALRQAAGREAGATVFAYQVRDPERYGVVTFDDAGRAIDIVEKP
FT                   AAPASSWAVTGLYFYDRRVTEFARRIRPSARGELEITDLNRLYLDDGSLAVERLGRGTA
FT                   WLDAGTPDSLLQAATFVQTIQARQGQLVGCPEEVAFRMGFIDADTLRRHAARLGKTELG
FT                   RVLRELADGEAA"
FT   CDS             complement(780348..781343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /gene_synonym="rmlB"
FT                   /locus_tag="ACMV_06880"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:ACMV_06880"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ80035"
FT                   /db_xref="GOA:F0J4I3"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:F0J4I3"
FT                   /protein_id="BAJ80035.1"
FT                   /translation="MASTPHEVVTVDKMTYAASEDALGAALGHPRHRLIRADIADAAAM
FT                   RAVFEAHRPDIVMHLAAESHVDRSIDGPRDFIDTNITGTFVLLEAARAWFATLDEPARR
FT                   RFRFHHISTDEVFGALEQGDPPFTETTPYDPRSPYAASKAASDHLVRAWRHTYGLPAIV
FT                   SNTTNNYGPWQFPEKLIPLVLINALEGRPLPVYGDGSNLRDWLFVEDHAEALLAIALTG
FT                   TPGETYAIGARQPRSNLDVVRAICRLLDARRPDPAGPRERLITFVADRPGHDFRYEIDP
FT                   ARSEAALAWRAAHDFEAGLARTVDWYLANEPWWRAIRARRYAGQRLGTAA"
FT   CDS             781629..7