Dbfetch

ID   AP011127; SV 1; circular; genomic DNA; STD; PRO; 1815 BP.
XX
AC   AP011127;
XX
PR   Project:PRJDA31129;
XX
DT   30-AUG-2009 (Rel. 102, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 3)
XX
DE   Acetobacter pasteurianus IFO 3283-01 plasmid pAPA01-060 DNA, complete
DE   genome.
XX
KW   .
XX
OS   Acetobacter pasteurianus IFO 3283-01
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acetobacter.
OG   Plasmid pAPA01-060
XX
RN   [1]
RP   1-1815
RG   Acetobacter pasteurianus genome sequencing consortium
RA   Azuma Y., Hosoyama A.;
RT   ;
RL   Submitted (06-APR-2009) to the INSDC.
RL   Contact:Yoshinao Azuma Yamaguchi University School of Medicine, Department
RL   of Microbiology and Immunology; Minami-Kogushi 1-1-1, Ube, Yamaguchi
RL   755-8505, Japan URL    :http://www.bio.nite.go.jp/dogan/Top
XX
RN   [2]
RC   DOI:10.1093/nar/gkp612
RX   DOI; 10.1093/nar/gkp612.
RX   PUBMED; 19638423.
RA   Azuma Y., Hosoyama A., Matsutani M., Furuya N., Horikawa H., Harada T.,
RA   Hirakawa H., Kuhara S., Matsushita K., Fujita N., Shirai M.;
RT   "Whole-genome analyses reveal genetic instability of Acetobacter
RT   pasteurianus";
RL   Nucleic Acids Res. 37(17):5768-5783(2009).
XX
DR   MD5; a4aa74a350144097aec3908ffd7aa6ce.
DR   BioSample; SAMD00060943.
DR   EuropePMC; PMC2761278; 19638423.
DR   StrainInfo; 481055; 0.
DR   PubMed; 19638423.
XX
CC   This work was done by Acetobacter pasteurianus genome sequencing
CC   consortium including Department of Microbiology and Immunology,
CC   Yamaguchi University School of Medicine, National Institute of
CC   Technology and Evaluation, Genetic Resources Technology, Faculty
CC   of Agriculture, Kyushu University, Department of Biological
CC   Chemistry, Faculty of Agriculture, Yamaguchi University and Mizkan
CC   Group Corporation Central Research Institute.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1815
FT                   /organism="Acetobacter pasteurianus IFO 3283-01"
FT                   /plasmid="pAPA01-060"
FT                   /strain="IFO 3283"
FT                   /sub_strain="IFO 3283-01"
FT                   /mol_type="genomic DNA"
FT                   /note="strain coidentity: IFO 3283 = NBRC 3283"
FT                   /db_xref="taxon:634452"
FT   CDS             466..1263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_44210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01208"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJD1"
FT                   /protein_id="BAI01208.1"
FT                   /translation="MRGTQLSGRFPMSVSLKELRRRGHSDEEIKMARMIQDGARRSGGA
FT                   PRSLAQILAGRPARSPSEASVEDLTPRQLRRQGSYGQAALIAKQAALSDSDHDRADRAR
FT                   FHANALAALGRVRTGKYDLLGAGNVSIGNQYIDAVQASLMESAATAPERDAALATLLLI
FT                   TRHLAWQDYTCTKVAADLAEMRGVDKAHMARTIALLESVGAISRVKKGRTKIIAVTPEG
FT                   AFRGKMDNHAEAVARYSAEVVQLHPSNEAADPRQTDLEDFTRS"
FT   CDS             complement(1378..1551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_44220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01209"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJD2"
FT                   /protein_id="BAI01209.1"
FT                   /translation="MTTRKETLVTFDAVTAARSPDVQKQLLEMAKADNNPEALEHALNV
FT                   ISLARKTSPEHQ"
XX
SQ   Sequence 1815 BP; 376 A; 538 C; 525 G; 376 T; 0 other;
     cagtaacaca ctaccgattg accctgtggg ccgcgctgct tcaatccgtg tggcagggac        60
     accctgcacc cctaccccct gttaccatat gatgcgcttt tgtgtgcttt tgtgcgcata       120
     gaaagcattt tgtgcgtctg attacccctt tcagggataa cacactaacc cctattgcct       180
     ctggcaaacc ggctccgcct tagggccgtg tgcgagatcg ccgccagcca ctccacccct       240
     tgagcaatac ccctgccgcc cggttctcta ccccttcaga acgggggcga gcgcagcgcg       300
     ggagcggcgt agcctgcccg ctagggcacc ccgttttcct ccaaccttcc ctaatactct       360
     tttgggatat ggataccggc ggaaggtttt tgcaaaaaat cgcagaaaac cgggaagtgc       420
     agagagaaat agcttgacgg atagttgcgt accacgcaac tatagttgcg tggtacgcaa       480
     ctatcaggaa gatttcccat gtccgtttca ctcaaagagc tgcgccgtcg ggggcattcg       540
     gacgaagaaa tcaaaatggc gcggatgata caggacggtg ccagacgatc gggaggcgct       600
     ccccggtctc tggcgcagat actagccggg agaccagcca gaagcccctc tgaggcgtct       660
     gtggaggatc tgacgcccag acagctgcgc cgacagggta gctacggtca ggcggctctg       720
     atcgcgaaac aggcagccct ttccgattca gaccacgacc gggccgaccg ggccagattc       780
     cacgccaacg ccttggctgc tctggggcgc gtccgaactg gaaaatacga cttactggga       840
     gcaggaaacg tgagcatcgg gaaccaatac atcgatgcgg tgcaagccag cctgatggaa       900
     agcgccgcga ccgcaccgga gcgagacgct gccctagcta cactgctgct gatcacgcgc       960
     caccttgcat ggcaggacta cacctgcacc aaggtggccg ctgatctggc cgagatgcgc      1020
     ggtgtcgata aggcccatat ggctcgcacc atcgcgcttc tggaaagcgt tggtgccatc      1080
     agccgggtga agaaggggcg gacaaaaatc atcgccgtga cgccagaggg tgcattcagg      1140
     ggcaagatgg ataatcacgc cgaagcggtg gcccgctact cggcagaggt tgtccagctg      1200
     cacccatcga acgaagcagc cgacccacgc caaaccgatc tggaagattt cacccgctct      1260
     tgaggggttg aggggcgcgc ccattacgca ggacacacac cgtgagtcgt aactacgccc      1320
     ttactacgtt cggggcacct gaaccgcacg caaaccatag tttgcataag tgcgccctta      1380
     ctgatgttcg ggtgatgttt ttcttgcgag tgaaatgaca ttcagggcgt gttctagcgc      1440
     ctctgggttg ttgtcggctt ttgccatttc cagaagttgt ttttgcacgt ctggacttcg      1500
     agccgctgtt actgcgtcga acgtgacgag tgtttctttt cgcgttgtca tgtcggttct      1560
     ctgttccgtc gattacgaca aaaatggtca aacccagaaa gggcgcactt atacaaactc      1620
     tcgtttgccc ccttttgggg tgtgcggcca aaggttcccc ttagcgatct tgaggctccc      1680
     cggacggccc cacggggccg ggctacgccg ctcccgctct gcgctcgctc cgggctgtca      1740
     catcgaagaa ccgggcggca ggggtattgc tcaaggggtg gagtggctgg cggattttcc      1800
     tccccgcttt gcagg                                                       1815
//