Dbfetch

ID   AP011126; SV 1; circular; genomic DNA; STD; PRO; 3035 BP.
XX
AC   AP011126;
XX
PR   Project:PRJDA31129;
XX
DT   30-AUG-2009 (Rel. 102, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 3)
XX
DE   Acetobacter pasteurianus IFO 3283-01 plasmid pAPA01-050 DNA, complete
DE   genome.
XX
KW   .
XX
OS   Acetobacter pasteurianus IFO 3283-01
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acetobacter.
OG   Plasmid pAPA01-050
XX
RN   [1]
RP   1-3035
RG   Acetobacter pasteurianus genome sequencing consortium
RA   Azuma Y., Hosoyama A.;
RT   ;
RL   Submitted (06-APR-2009) to the INSDC.
RL   Contact:Yoshinao Azuma Yamaguchi University School of Medicine, Department
RL   of Microbiology and Immunology; Minami-Kogushi 1-1-1, Ube, Yamaguchi
RL   755-8505, Japan URL    :http://www.bio.nite.go.jp/dogan/Top
XX
RN   [2]
RC   DOI:10.1093/nar/gkp612
RX   DOI; 10.1093/nar/gkp612.
RX   PUBMED; 19638423.
RA   Azuma Y., Hosoyama A., Matsutani M., Furuya N., Horikawa H., Harada T.,
RA   Hirakawa H., Kuhara S., Matsushita K., Fujita N., Shirai M.;
RT   "Whole-genome analyses reveal genetic instability of Acetobacter
RT   pasteurianus";
RL   Nucleic Acids Res. 37(17):5768-5783(2009).
XX
DR   MD5; 26365bacd7d3a3ef0099a9c26f4355db.
DR   BioSample; SAMD00060943.
DR   EuropePMC; PMC2761278; 19638423.
DR   StrainInfo; 481055; 0.
DR   PubMed; 19638423.
XX
CC   This work was done by Acetobacter pasteurianus genome sequencing
CC   consortium including Department of Microbiology and Immunology,
CC   Yamaguchi University School of Medicine, National Institute of
CC   Technology and Evaluation, Genetic Resources Technology, Faculty
CC   of Agriculture, Kyushu University, Department of Biological
CC   Chemistry, Faculty of Agriculture, Yamaguchi University and Mizkan
CC   Group Corporation Central Research Institute.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3035
FT                   /organism="Acetobacter pasteurianus IFO 3283-01"
FT                   /plasmid="pAPA01-050"
FT                   /strain="IFO 3283"
FT                   /sub_strain="IFO 3283-01"
FT                   /mol_type="genomic DNA"
FT                   /note="strain coidentity: IFO 3283 = NBRC 3283"
FT                   /db_xref="taxon:634452"
FT   CDS             741..1499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_44190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01206"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJC9"
FT                   /protein_id="BAI01206.1"
FT                   /translation="MWSFPPFEKGTTGEENLIYFYLAWITSPQNEHFCRKTAKKWLAIK
FT                   SLTVRLLVRSLCDLIDANARVLHMPATITRLTSKPERLRQDQADLLRQALLPFEEQMPA
FT                   DAFRAVIGLIDRQTASRKRWTFVMLSPEQNAIVVDYLAEHSKRPLTALRVWALCFKHLR
FT                   TDTGEILLTREEIAEKIGQRPQEISQIMSELVAFRAITRTRQKVGGMKGPGMVHYFMNP
FT                   NVATHLSGSERDAAQGEAPPLLVLMEGGKQ"
FT   CDS             1601..1945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_44200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01207"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJD0"
FT                   /protein_id="BAI01207.1"
FT                   /translation="MNVLAAKIIMTDQTEPAPLIGVVPLDEAFSRLEAAFHGIPSPKSH
FT                   NFISQELADKVLTPSRRNIIEVLTNRGGLSLAEIATATGQAIEGVRADVQALCLAGLLC
FT                   QPDADHAAFF"
XX
SQ   Sequence 3035 BP; 742 A; 840 C; 853 G; 600 T; 0 other;
     ctacctgaac ggcaacattg agcgggttgg ggttaatgat ggggggcatg tggttgtgac        60
     tttcagtgcg gcggcactga aaaaaaggcc gggaatctgt aagattttaa gagcgcgcat       120
     caacaagtgg cttgatctgg ccttcgaaat tatcactcca cttcaacgat tgatggacaa       180
     gttttctgtc acgcttgagc agcgagcgtc agtcgccaaa gaagccggat atgcgccaga       240
     tgatgattgg gatttgggca acggattggg attttgaagg cacccctacc ccctgttacc       300
     atatgatgcg cttttgtgtg cttttgtgcg cataaaaagc attttgtgcg tctgattacc       360
     cctttcaggg ataacacact aacccctatt gccattctgg caaaccggct ccgccttagg       420
     agtgtggcag ggacaccctg caccccttcc ctgcaacctt tctcttgccc aattcttccg       480
     gctggactgg caaccaacac actaaaccgc ctcaaaaatc cccacagatg cccgtagagt       540
     gtccagaagt ctgaagtgag agggaaaccg cccttttccg tctcgcggcc ttctaggtga       600
     agatatgccg gtttcgcttc cgcctcactt catccgcctt gagcagattt cttcttcccg       660
     gttctgcctt ccgatcaggt ctggagcgag cgcagagcgg gagcggcgta gcccgccggt       720
     aggcgtccag acgggccgaa ttgtggagtt ttccaccgtt tgagaagggg actacagggg       780
     aagagaatct tatctatttc tatctggcgt ggataacttc accccaaaat gagcattttt       840
     gccggaaaac cgccaaaaaa tggcttgcta ttaagtcgct cactgtgcga ctactggttc       900
     gctcactgtg cgacctaata gacgccaatg caagggttct ccacatgcct gcaacgatta       960
     cccgcttgac ctcgaaaccg gaacggctcc ggcaggatca ggccgacctt ttgaggcaag      1020
     ccctgctccc atttgaagag cagatgcccg ccgatgcctt ccgtgccgta atcggcctga      1080
     tcgaccgcca aacagccagc cgcaagagat ggacattcgt catgctaagc cccgaacaga      1140
     acgcaatcgt ggtggactat ctggccgaac actctaagcg ccccctaacc gcgctgcggg      1200
     tctgggcact gtgcttcaaa cacctgcgga cagacactgg agaaatcctg ctaacccgcg      1260
     aagaaatcgc agaaaagatc ggccaaagac cgcaagaaat cagtcaaatt atgtctgaac      1320
     tggtggcttt tcgggccatc actcgaaccc gccagaaggt aggcggcatg aaggggccgg      1380
     gtatggttca ctacttcatg aaccccaacg tggccacgca cctaagcggc tccgaacggg      1440
     atgcagcaca gggagaagcg cccccgctgc tggtgctgat ggaaggcggg aaacaataac      1500
     ccccacccgg acgccctaac gggcggccta cggcgctccc gcgctgcgct cgctccgggt      1560
     ctgcatccat tttttgccgg gttatcctgc ctgctcatga atgaatgttt tagcggctaa      1620
     aattatcatg accgaccaga cagaacccgc ccccctgata ggggttgtcc cactggatga      1680
     agccttttcc agactggaag ccgccttcca cgggataccc tcaccaaaga gccacaactt      1740
     catcagtcag gaactcgcgg acaaggtgct gacaccttca cggcggaaca tcattgaagt      1800
     gctgactaac aggggcggtt taagcctcgc agaaattgcc acggcaacag gccaggccat      1860
     tgaaggcgtg cgagctgatg tgcaggcgct ctgtctggcg ggcctgctct gtcagccaga      1920
     cgcagatcac gcggcctttt tctgaccgat tgccccgcac ccgaaggcgc ggggctggaa      1980
     acatcattac aacgtcgtag ctcaccacaa gctaaacagc atacgcgaac agaaccgcca      2040
     tatgttgcag gcgggaatgt acgccagatc ggcttgtctt gcacgctcaa aaaaaacggg      2100
     ggcagggtgt ccctaccaca ctcctaaggc ggagccggtt tgccagaatg gcaatagggg      2160
     ttagtgtgtt atccctgaaa ggggtaatcc atgaaagcac tcgctgcaat tcgcgttcag      2220
     aagatcaaaa gcatgtccac aattcgggca gcagaagaac atgggcggcg gctggatgag      2280
     gccagcaaca agcgcgtgga tgccaccaga acggctatga atctcgccgc atctcaatac      2340
     agcccggatg atccgttggc gcttgaggcg gcttacagga gctttaggaa ggccacagga      2400
     gcggttgagg gtaagggcgc ggcaatcatg gcccacatga tcgcggtgat ttctcccgaa      2460
     gttctggccg aagccggaga ccctagagac cccaacaatc ccaaggttcg ggcgcttttc      2520
     gagcaggcac aggcatgggc acggtcagag tttggcgatg aatctcttgt ggcatcccgt      2580
     ctggatgtgg acgagaaagg cgcgggagtt gtggatctct tcgtgtgccc gactgccatg      2640
     caagccggtg gccggggccg aaaaccaaag ctgacgattt cggtcaaatc cggactggaa      2700
     gccgtagccg ccaagaacgg caacaaacgc tcatacagcg ccattcagga ttcatgggga      2760
     gaatgggcca gccagcacat agaccgccgc ctgaagcgtg ggaaaccgaa gcgggaaacc      2820
     atgctgaagc atgtccatgc cgacattctg cgggaagagt acgaggcaat agaccgccgg      2880
     aaggccgagc tggatgcacg agaaatcgcg cttgaacgag aagagcagaa gctattcgag      2940
     gacaggaaaa aagtggccgt atggcaggat caactggaac agcgcctaga aaatatcgag      3000
     cagagacaat ttgcggcccg gtcgtttgtg aagaa                                 3035
//