Dbfetch

ID   AP011125; SV 1; circular; genomic DNA; STD; PRO; 3204 BP.
XX
AC   AP011125;
XX
PR   Project:PRJDA31129;
XX
DT   30-AUG-2009 (Rel. 102, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 3)
XX
DE   Acetobacter pasteurianus IFO 3283-01 plasmid pAPA01-040 DNA, complete
DE   genome.
XX
KW   .
XX
OS   Acetobacter pasteurianus IFO 3283-01
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acetobacter.
OG   Plasmid pAPA01-040
XX
RN   [1]
RP   1-3204
RG   Acetobacter pasteurianus genome sequencing consortium
RA   Azuma Y., Hosoyama A.;
RT   ;
RL   Submitted (06-APR-2009) to the INSDC.
RL   Contact:Yoshinao Azuma Yamaguchi University School of Medicine, Department
RL   of Microbiology and Immunology; Minami-Kogushi 1-1-1, Ube, Yamaguchi
RL   755-8505, Japan URL    :http://www.bio.nite.go.jp/dogan/Top
XX
RN   [2]
RC   DOI:10.1093/nar/gkp612
RX   DOI; 10.1093/nar/gkp612.
RX   PUBMED; 19638423.
RA   Azuma Y., Hosoyama A., Matsutani M., Furuya N., Horikawa H., Harada T.,
RA   Hirakawa H., Kuhara S., Matsushita K., Fujita N., Shirai M.;
RT   "Whole-genome analyses reveal genetic instability of Acetobacter
RT   pasteurianus";
RL   Nucleic Acids Res. 37(17):5768-5783(2009).
XX
DR   MD5; ca4d72ec32db9091c99c6c274f4ad8d4.
DR   BioSample; SAMD00060943.
DR   EuropePMC; PMC2761278; 19638423.
DR   StrainInfo; 481055; 0.
DR   PubMed; 19638423.
XX
CC   This work was done by Acetobacter pasteurianus genome sequencing
CC   consortium including Department of Microbiology and Immunology,
CC   Yamaguchi University School of Medicine, National Institute of
CC   Technology and Evaluation, Genetic Resources Technology, Faculty
CC   of Agriculture, Kyushu University, Department of Biological
CC   Chemistry, Faculty of Agriculture, Yamaguchi University and Mizkan
CC   Group Corporation Central Research Institute.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3204
FT                   /organism="Acetobacter pasteurianus IFO 3283-01"
FT                   /plasmid="pAPA01-040"
FT                   /strain="IFO 3283"
FT                   /sub_strain="IFO 3283-01"
FT                   /mol_type="genomic DNA"
FT                   /note="strain coidentity: IFO 3283 = NBRC 3283"
FT                   /db_xref="taxon:634452"
FT   CDS             complement(116..562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_44160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01203"
FT                   /db_xref="GOA:C7JJC6"
FT                   /db_xref="InterPro:IPR009444"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJC6"
FT                   /protein_id="BAI01203.1"
FT                   /translation="MASFRIETHIANLRQLEKPSTEQRILILLYDKTDRTPKEERDLKA
FT                   LIRSEKAQEAVKEAKAKASEAKARSSKIAKRERDAKDKERTHNLIQSAGLLILAGLVDS
FT                   KTGNPTWDKGELLGALASMAKAEINDTKRQEWKEKGDALLAGEK"
FT   CDS             744..2195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobA/L"
FT                   /locus_tag="APA01_44170"
FT                   /product="mobilization protein MobA/MobL"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01204"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJC7"
FT                   /protein_id="BAI01204.1"
FT                   /translation="MAIGRLSMKVGGKGKACAHSNYIERQGKYAHRLETGERLVATGSG
FT                   NMPEWAQSSSQFWKAADEHERANGTTYREMEIALPRELDDKQKEKLVREWVKQEIGQQH
FT                   AYTWAIHSPKASDGGEQPHVHLMFSERVMDGHERGPEQFFKRYNSKTPEKGGAKKANTG
FT                   KHPLERKEELKDLRHRWEVLCNRHLRAAECRERVSLKPNNEIRQGEPEPKMLPSEWQRG
FT                   TGKADIIAFREARKEQVEARHDVRLSVRPTEQMEAELIHLAYRKKVDQEKAQVTAEAAR
FT                   QAEATRRADEERQALIAKLPAMEKAVIAEIEDETNRRLRTDGEFQALQNEREQHEEARQ
FT                   EAEANADKAERDETAAAQEAQDLAKKHTIQTRLHRSGFKTFMPLAEAEQFRDDCKTYKE
FT                   AERTRQTSLAEKVEQIDQKLKEIRQRILDKARKELDGLYKKLASIREAMKAAKEARVVQ
FT                   EKAQKKAQTPASQEDQAVRKRGRGR"
FT   CDS             2317..3006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_44180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01205"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJC8"
FT                   /protein_id="BAI01205.1"
FT                   /translation="MEGLTRLWVPLQAEDGRRSRETPVTFVKNRVPALSHAQNAIPRDK
FT                   LKSLFKSGVEAALMTGELPSRNHGWKSVFDKFIDLMGPDGSWFPSHAKVAEKAGVSERT
FT                   AWAAINALESIGLIRVEARYLYDPEKGKTVRTSNLYEVVVTKAQRAIAILAAAARKAKE
FT                   AAKRQWAIASRSSMAEWGRRVIHHLPATAAEDPQLNIFKRGNQAEPSRNWSHNEWIEYC
FT                   QTGNQTT"
XX
SQ   Sequence 3204 BP; 858 A; 815 C; 907 G; 624 T; 0 other;
     caaattgcgc tacagatagt ttgatagtct tccgaagttc cagagagagg cagcagaaac        60
     tcttttactt tcgcttctcc accagcctgc ctgaaaatta cataaactga atccatcatt       120
     tttctccggc taataacgca tcaccttttt ctttccactc ctgccttttg gtgtcgttta       180
     tttcggcttt tgccatagaa gccaaagccc ccagaagttc gcctttgtcc catgttggat       240
     tgccggtctt actatcgacc agaccggcca gaataagcag gccagcagac tggatgaggt       300
     tatgcgttct ttccttgtcc ttggcgtctc tttctctctt ggcgattttc gatgatctgg       360
     cctttgcttc ggatgctttg gctttagcct cttttacggc ttcctgcgct ttttccgacc       420
     ggatgagtgc cttgaggtct ctttcctctt ttggcgttct gtcagtcttg tcatagagca       480
     agatcaggat gcgctgttct gtcgatggct tctcaagctg tcgaaggtta gcgatatgcg       540
     tttcaatccg aaaagaggcc ataggttttc atccaaacat aaaacgatta tccggcttta       600
     tagcataaaa atggtagcaa atagacgaga gccaaattat ccttccttgt aggaaggcgc       660
     gcttagacgt ttctcataaa tgagaaacag cacgttaggg gtaaacccct taaaaccccg       720
     ttttaacttc aaaggattgt ggtgtggcga ttggtcgttt gtcgatgaag gttggaggca       780
     agggcaaagc ctgcgcccac tccaactaca tcgaacgcca aggcaaatat gcccatcgcc       840
     tagaaactgg tgaacgactg gttgcgaccg gcagcggcaa catgccggaa tgggcgcaat       900
     cctcatcaca gttctggaag gcagcggatg agcatgaacg ggcgaatggc accacatacc       960
     gcgaaatgga aatagccctg ccgcgtgaac tggatgacaa gcagaaggag aagctggtca      1020
     gggagtgggt gaagcaggaa atcggccagc agcacgccta cacatgggcc attcattctc      1080
     ccaaggcgag tgacggcgga gagcagcctc atgtgcatct gatgttttca gaacgggtca      1140
     tggacggtca tgaacgcggg ccggaacagt tcttcaaacg ctacaacagc aagacgccag      1200
     agaaaggcgg agccaagaag gccaacaccg gcaagcatcc tttggagcgg aaagaagaac      1260
     tgaaagacct gcggcatcgc tgggaggttc tctgtaaccg gcacctcaga gcagcagagt      1320
     gtcgggagcg cgtcagcctg aaaccgaata acgagatcag gcagggtgaa ccggaaccga      1380
     agatgttgcc gagcgaatgg cagcgcggca ccggcaaggc cgacatcatt gctttccggg      1440
     aggcccgaaa agagcaggtc gaggcccgcc atgacgtgcg tttgtcggtc aggccaacgg      1500
     agcaaatgga agctgaactg attcacctgg cctaccggaa gaaagttgac caggagaaag      1560
     cccaggttac ggcagaggcc gccagacagg ccgaagcgac ccgccgcgca gacgaggaaa      1620
     ggcaagccct tatcgccaag ctgccagcga tggagaaggc cgtcattgcc gagattgagg      1680
     acgagacaaa caggcggctc aggacggacg gtgagtttca ggcactccaa aatgagcgtg      1740
     agcagcatga ggaggctcgt caggaggcag aggccaatgc tgacaaggca gagcgtgatg      1800
     agacagcagc agctcaggaa gcgcaggatt tagctaagaa gcacacgata cagacccggc      1860
     ttcatagatc tggcttcaag accttcatgc ccttggccga ggccgagcag ttccgtgacg      1920
     actgcaagac ctacaaggag gccgaacgga cgcggcagac ctctcttgcc gagaaagtcg      1980
     agcagatcga ccagaagctg aaagagattc gccagcggat tctggacaag gcccggaagg      2040
     aactggacgg tctttacaag aaacttgcat ccattcggga agccatgaag gcggccaagg      2100
     aagcccgtgt agtccaagaa aaagcccaga aaaaagccca gacgccagcc agtcaggaag      2160
     atcaggctgt cagaaaacga gggcgagggc ggtgaagggg ttgcctttgg agtaaatcca      2220
     gaagaatctc tgccccagaa acggcgaagg cccggtgatt gcaacaccga gccttcagca      2280
     agtccgatta gaacacacct aagcggaccg cctttcgtgg aaggattaac ccgactttgg      2340
     gttccccttc aagcggaaga tggtcggcga agcagagaaa cgccagtgac ctttgtaaaa      2400
     aaccgagttc ccgccctctc ccatgctcaa aatgcaattc cacgggataa gctgaaatcc      2460
     ttgtttaagt caggggttga agccgcgctg atgactggcg aactgccaag tcggaatcat      2520
     ggctggaagt cagtattcga taagttcatc gacctgatgg ggccggatgg ctcgtggttt      2580
     ccatcacatg cgaaagtggc agagaaagcc ggagtgtctg aacggacagc atgggccgcg      2640
     atcaatgcgc ttgagagtat cggccttatc cgtgtggaag cccgctacct atacgaccca      2700
     gagaagggta agacggtcag aaccagcaat ctctatgagg ttgtggtgac caaggcgcag      2760
     agagccatag cgatccttgc tgccgctgct cgtaaggcca aggaagcggc taagaggcaa      2820
     tgggcaatag ccagccggtc aagcatggcc gagtggggca ggagagttat ccaccaccta      2880
     cccgcaacgg ctgcggagga cccccaatta aatatattta aaaggggaaa tcaggccgaa      2940
     ccatcccgaa actggagcca taacgagtgg attgagtatt gccagacagg caatcaaacc      3000
     acctaaccgc aacggcatcg acctaaccgc aacgacaaaa aggcattgaa ggggagcaga      3060
     cgggagaggt ctgtccacct aaccgcaacg gcattgcggt taggtcaaaa aggtatccat      3120
     ttttgccact gatcgcgtgt cactacgacc tgtcgagatt cattgataat ggcaacgaca      3180
     gtcgccggcg cgggaagccc atac                                             3204
//