Dbfetch

ID   AP011124; SV 1; circular; genomic DNA; STD; PRO; 49961 BP.
XX
AC   AP011124;
XX
PR   Project:PRJDA31129;
XX
DT   30-AUG-2009 (Rel. 102, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 3)
XX
DE   Acetobacter pasteurianus IFO 3283-01 plasmid pAPA01-030 DNA, complete
DE   genome.
XX
KW   .
XX
OS   Acetobacter pasteurianus IFO 3283-01
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acetobacter.
OG   Plasmid pAPA01-030
XX
RN   [1]
RP   1-49961
RG   Acetobacter pasteurianus genome sequencing consortium
RA   Azuma Y., Hosoyama A.;
RT   ;
RL   Submitted (06-APR-2009) to the INSDC.
RL   Contact:Yoshinao Azuma Yamaguchi University School of Medicine, Department
RL   of Microbiology and Immunology; Minami-Kogushi 1-1-1, Ube, Yamaguchi
RL   755-8505, Japan URL    :http://www.bio.nite.go.jp/dogan/Top
XX
RN   [2]
RC   DOI:10.1093/nar/gkp612
RX   DOI; 10.1093/nar/gkp612.
RX   PUBMED; 19638423.
RA   Azuma Y., Hosoyama A., Matsutani M., Furuya N., Horikawa H., Harada T.,
RA   Hirakawa H., Kuhara S., Matsushita K., Fujita N., Shirai M.;
RT   "Whole-genome analyses reveal genetic instability of Acetobacter
RT   pasteurianus";
RL   Nucleic Acids Res. 37(17):5768-5783(2009).
XX
DR   MD5; c2d0ddf354ae98d7e553359ee2785e79.
DR   BioSample; SAMD00060943.
DR   EuropePMC; PMC2761278; 19638423.
DR   RFAM; RF01497; ALIL.
DR   StrainInfo; 481055; 0.
DR   PubMed; 19638423.
XX
CC   This work was done by Acetobacter pasteurianus genome sequencing
CC   consortium including Department of Microbiology and Immunology,
CC   Yamaguchi University School of Medicine, National Institute of
CC   Technology and Evaluation, Genetic Resources Technology, Faculty
CC   of Agriculture, Kyushu University, Department of Biological
CC   Chemistry, Faculty of Agriculture, Yamaguchi University and Mizkan
CC   Group Corporation Central Research Institute.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..49961
FT                   /organism="Acetobacter pasteurianus IFO 3283-01"
FT                   /plasmid="pAPA01-030"
FT                   /strain="IFO 3283"
FT                   /sub_strain="IFO 3283-01"
FT                   /mol_type="genomic DNA"
FT                   /note="strain coidentity: IFO 3283 = NBRC 3283"
FT                   /db_xref="taxon:634452"
FT   CDS             501..1070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43530"
FT                   /product="DNA resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01140"
FT                   /db_xref="GOA:C7JJ66"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ66"
FT                   /protein_id="BAI01140.1"
FT                   /translation="MFTMAGQIVAYVRVSSADQNTDRQMFDGMTVDKTFTDKCSGGTRN
FT                   RPALTEMLGYVREGDTIVCHSIDRLARDLGDLMHLVQTMTRRGVGVRFMKEGLTFTGED
FT                   SPMQDLMMHIFGAVAQFERALIHERQKEGQIAARAKGKVPGRKPKLSPEQVTELYNRVA
FT                   THEPKAQIARDFGISRETLYAYLKAA"
FT   CDS             1194..1433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01141"
FT                   /db_xref="InterPro:IPR031914"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ67"
FT                   /protein_id="BAI01141.1"
FT                   /translation="MSTTRWNIAVSSEVDQSVRMFLAANGGGRKGDLSRFIEDAVRSYL
FT                   LEQAVEQAKAASEDMSEAELADLVNEAVQWARGH"
FT   CDS             1415..1855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01142"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ68"
FT                   /protein_id="BAI01142.1"
FT                   /translation="MGTWALMRVVLDTNILVSALIYPRGAPDAIYRAWRAHRFDLVTST
FT                   TQLEELRRVSRYPKLRSILPPHRVGAMINNMRKASVAEQLPTLPDDVTINDRDDVFLLT
FT                   MVLAFDADYLVTGDHRAGLLEKGRFQRARIVTPVDFCSIALD"
FT   CDS             complement(1949..2206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traD"
FT                   /locus_tag="APA01_43560"
FT                   /product="conjugal transfer protein TraD"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01143"
FT                   /db_xref="GOA:C7JJ69"
FT                   /db_xref="InterPro:IPR009444"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ69"
FT                   /protein_id="BAI01143.1"
FT                   /translation="MRDWAKARRERTHHLIELGGLVQKARLVDLTDDDRATLLGAFLDI
FT                   AGQLQGSNVTTPVDLKTRWRRAGLHAFDAEKEHVERKEQP"
FT   CDS             complement(2253..3143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43570"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01144"
FT                   /db_xref="GOA:C7JJ70"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ70"
FT                   /protein_id="BAI01144.1"
FT                   /translation="MTRFIEEHRQTYGVGSICRVLSIAPSAYYATVARQKNPCVRSQKD
FT                   KELCDDIRRVWNNNFCVYGARKVWHQLKREGVDVARCTVERLMRRMGLKGVIRGKGVRT
FT                   TRPDPQRPCPQDLVQRQFHAPAPNRLWVSDFTYVSTWQGFVYVAFIIDVFARVIVGWRV
FT                   SSTAHTDFVLDALEQALCQRRPEGKVTHHSDRGCQYVSILYTQRLAEAGLVASVGSVGD
FT                   SYDNALAETINGLYKTELIYRQGPWKNREAVELATLKWVDWFNNRRLLSSIGNIPPAEA
FT                   EARFYAQQKSHALAA"
FT   CDS             complement(3140..3463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43580"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43580"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01145"
FT                   /db_xref="GOA:C7JJ71"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ71"
FT                   /protein_id="BAI01145.1"
FT                   /translation="MSNKSKRFPPEFRERAARMVLEEEKNHPSRWSAVMMIAPKLDIHP
FT                   DTLSKWTRLHERANAPAVSELPDREKIRQLERENRELRQANDILRKASAYFAQAELDRI
FT                   FKP"
FT   CDS             3462..3941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01146"
FT                   /db_xref="GOA:C7JJ72"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ72"
FT                   /protein_id="BAI01146.1"
FT                   /translation="MNPSYLSGRSVSTKPGAIQPASRRLEGVFEKAIGEVRKERQALAS
FT                   IVGEANNRRDQWFYLIFIGLMAFLFGVGVAPLLFNHITWKNFDERVASFIVGGQDRWES
FT                   GAAMMRDARPEQWNSFMWEDRLVQDNMPKIRDCRIAATQVGQPKPCVITIKPDAQ"
FT   CDS             complement(4027..6345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43600"
FT                   /product="outer membrane protein"
FT                   /note="Adhesin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01147"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="InterPro:IPR030930"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ73"
FT                   /protein_id="BAI01147.1"
FT                   /translation="MDYWNDTSVSNGETLNDITLTSANDTHDRLFVSSGGVANNVHVGG
FT                   GAYAYIYGGTISTITVSSGGLVHMVSGGTVKDLHVLSGGIGYIPSGTLSGSVIDNGGLL
FT                   EVLVSGSATSVTVENNGVVKIRSGGLINASNILSGGSIIVSSGGQSIGTVISSGGSLTF
FT                   TGGGSGSYTSLLAGGTLNIGSGTTYDNQHTTSLTATSGAQINVLSGGVLTDADAAAFGN
FT                   IVVSKGGRGQDIIISSGGGLGVAGIASDTTVNNGGVIEINSGGVSNNNHVNNGGKIYAD
FT                   SGSILGLTSISSGGSAIVASGATISDVVTIQDGGTATIWNNTSGTIDLSGDTNHGLTIS
FT                   GLESGGTVSTVISGWSGSKPGNSDSIDLPGVSADGASYAYPSDDQVVVTLANGNTITLN
FT                   IPGVKNTGFVLSDDHHGGASAEVCFLSGSMIRTSEGDVAVEDIQIGDEVIAFDWRNDED
FT                   VVRQVVWVGKARATVRPDLPDDEAGWPVRILKDAIADGVPYKDMLITAEHCLFFRDRFV
FT                   PVRMLVNGVSIFYDKSITSYDYYHVETEQHSVITADGMLTESYLDTGNRSSFRQEGKIA
FT                   TLRGAVKNWADHAGAPLGVERSFVEPLFRALQWRENSVVGTKISTTKIETTTDPDLHLI
FT                   TQTGAVIRPMRKTAHHYSFMLPPNTESVRIVSRSSRPSDVIGPFVDDRRYMGVAVADVQ
FT                   LQCAKQQFDITSHLQDEKPSGWHDTDWTDCAWTNGNAELPLGDHLTHGKMGILSMTIRA
FT                   AGPYLLNTKPNSDMKKHSA"
FT   CDS             complement(6391..6555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43610"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01148"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ74"
FT                   /protein_id="BAI01148.1"
FT                   /translation="MTVTSNSQEVLSSGATGMQQTIEESQKSASITVTTLGDDSRPERR
FT                   VRWSERIDH"
FT   CDS             complement(6764..6991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43620"
FT                   /product="transposase"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01149"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ75"
FT                   /protein_id="BAI01149.1"
FT                   /translation="MRERIWDMGARPAIPAKRRDGPVACPKWAYRCRHLVENLWARLKE
FT                   WRAVATRYEKTATSFLVVIHIAAAADWIKP"
FT   CDS             complement(7135..7560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43630"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43630"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01150"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIE2"
FT                   /protein_id="BAI01150.1"
FT                   /translation="MEEGDRTGTFTDETWAIWEPLIEEVRPRGKTPPHDLRRTIAAIFW
FT                   RHENGAKWRSIPAELGPWWRAAQLFIRWAKLGVWERLLALVQEQQGVAFGMTFLDGTNI
FT                   RAHHKAAGAQKKGPLSKSETIVKHLAALAVAMAQKSA"
FT   CDS             7752..7907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43640"
FT                   /product="DNA resolvase"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01151"
FT                   /db_xref="GOA:C7JJ77"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ77"
FT                   /protein_id="BAI01151.1"
FT                   /translation="MQIQTLNSFECHKVFREKASGADVERVELRRLIKNLCHGDTVVIP
FT                   PFLVGH"
FT   CDS             complement(7916..8743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43650"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43650"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01152"
FT                   /db_xref="GOA:C7JE27"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JE27"
FT                   /protein_id="BAI01152.1"
FT                   /translation="MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAE
FT                   NDRIAALLVGLTQAHRRWGFGLCFLYLRNVQGQLWNHKRVYRIYRELEFNLRIKPRRRL
FT                   VREKPEKLSVPALPNTVWSMDFMADRLLDGRAFRLLNILDEFNREGLAIEVDFSLPACR
FT                   VVRCLEQVMEWRGRPEAIRMDNGPEYVSHTLVSWAEKQGITLIYTQPGNPQQNAYIERY
FT                   NRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA"
FT   CDS             complement(8740..9003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43660"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01153"
FT                   /db_xref="GOA:C7JJ79"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ79"
FT                   /protein_id="BAI01153.1"
FT                   /translation="MKSGRFTDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKY
FT                   GGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKK"
FT   CDS             9099..9491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43670"
FT                   /product="DNA resolvase"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01154"
FT                   /db_xref="GOA:C7JJ80"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ80"
FT                   /protein_id="BAI01154.1"
FT                   /translation="MARSTFDLFAIVKEIIQKGAQFYSLSEPWADTTTSTGRLMLAVLG
FT                   GLADVERDLIRTRTAEGRARAVQLGVKMGRPTKIADIQRQDIIKRRQNGEFLKDIAEDF
FT                   GISVGTVSRITTGADSHKSRKNKKGF"
FT   CDS             complement(9725..10318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43680"
FT                   /product="DNA resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01155"
FT                   /db_xref="GOA:C7JH73"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7JH73"
FT                   /protein_id="BAI01155.1"
FT                   /translation="MTHILIGYARCSTDKQDLAVQKQELLKLGVSADRIYTDKGFTGTN
FT                   RDRPGLDQALAAVRSGDTLVVPKLDRLARSVPDARAIGDSLAARGVKLQLGTSVHDPSD
FT                   PMGKLFFNILATFAEFEADLIKLRTREGMAVARAKGKLRGKKPKLSDRQQKELRRMYDT
FT                   GDYSISDLADLFSISRPTVYRTLGRQPVTSVLAA"
FT   CDS             10437..11936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43690"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01156"
FT                   /db_xref="GOA:C7JH74"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009004"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="UniProtKB/TrEMBL:C7JH74"
FT                   /protein_id="BAI01156.1"
FT                   /translation="MILYRTGAITMADDRVLGTDSTEVAMRMAVLRPYLIDNVPLTKIA
FT                   VDAAIPIRTVRRWIARYRLSGPAGLMRPTRPDAGTRTFPKEMVELIEGMALLKPQSSIA
FT                   TIHRRIVMLAAEQGWRKPSYGSVRSIVREINPAILTLAHEGSAAFRDKYELVHRHRASR
FT                   PNATWQADHTQLDILILDAGGKAARPWLTTVMDDYSRVVAGYMVMLGAPSALNTSLALR
FT                   QAIWRKADPMWPVCGIPDVLHVDHGSDFTSLHLEQASADLHFRLIYSGVARPQGRGKIE
FT                   RLFRTINTELLPELPGNLRNGKPSSPPRLSLAELDATIGDYIVSTYNTRPHSTIGVPPA
FT                   KAWCGDGWLPRMPETVDELDTLLVMVARPRTVHRDGIRFEGLRYFDPTLAAYVGEPVMI
FT                   RYDPRDMGEIRIFHRNTFLCRAVSADHAGDSITLKDIQTARIAHRRHLRNQIAERKARV
FT                   ADFFPSPVFRPTQPAVPVTLSGTEAKGRQKGRRLRIYSEGD"
FT   CDS             11936..12760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43700"
FT                   /product="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01157"
FT                   /db_xref="GOA:C7JJ83"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ83"
FT                   /protein_id="BAI01157.1"
FT                   /translation="MRTARTTSFIATQEHRRFSEFADAVRKHRYIGLCHGPAGVGKTLS
FT                   ARRYTHWHVVGKTLEEWGPRGSDQAKVNAHLAKSRAIFFTPTVSCSVQELRHDVPALIA
FT                   CAEICIDDHVRPHIQGQARIIDHTTRYIELLIVDEAERLSMTALEWLRDLFDRQGISLI
FT                   FIGMPGIDKRMARYPQLFSRVGFSHHYRPLQEQELTFVLTRRWRDLGLSLDGADFTDAQ
FT                   AVAAIVRLTGGNFRLLHRLFVQIERIMRLNELTVITEDVVEAARSTLVIGVT"
FT   CDS             12808..13455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43710"
FT                   /product="DNA resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43710"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01158"
FT                   /db_xref="GOA:C7JJ84"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ84"
FT                   /protein_id="BAI01158.1"
FT                   /translation="MHGGFSGRVQMGQRAVIYCRVSTADQSCARQKDELKRFAERAGYE
FT                   VLDVFMETGSGVRVDRAERRNVMALAQAREIDAILVTELSRWGRSTIDLISTLQELESY
FT                   RVSLIAITGMAFDLATPHGRMLATVLAGIAEFERDLISERVKSGLAAAKARGKVLGRQK
FT                   GERPKSDRLAPKVLALVAEKRSYRWIARDLGISKNTVAAIVQRDQVRPSLPS"
FT   CDS             13498..14133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="APA01_43720"
FT                   /product="plasmid partitioning family protein ParA/MinD"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43720"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01159"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ85"
FT                   /protein_id="BAI01159.1"
FT                   /translation="MKVLAVLSQKGGVGKTTLATCLAVAAEQAGKVAAIIDLDPQATAS
FT                   FWKDVRQLDTPAVASIQPIRLPAMLKACADAGTDLVIIDGAAVARDVAYEAARHADFVL
FT                   IPTKTAVFDTMSMTHTLDVVRQLDKAFAVVLTFVPPQGQETGDAIKAVTELGATVCPVT
FT                   VGNRKAFFRAQAAGQAVQEFETHGPAANEIKRLYEYTDIQLYKNREVV"
FT   CDS             14160..14411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01160"
FT                   /db_xref="GOA:C7JJ86"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ86"
FT                   /protein_id="BAI01160.1"
FT                   /translation="MLDRAKGSGEAMPTPSPKPDISSRKPTLNGRKGTKLIGGHFSPEV
FT                   STQLRIIAAEEGTTVQSLLGEALDDLFVKKGRIRIVSG"
FT   CDS             complement(14447..15547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="APA01_43740"
FT                   /product="plasmid replication initiator RepA"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01161"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ87"
FT                   /protein_id="BAI01161.1"
FT                   /translation="MKPRIKPDRQRNPELALIVSETPNVDGRSVLLPERYPTPDLFICD
FT                   VLDAIPKDDMASMEHPIFSLATKPDRRIFRYEHNGNTVEIVPSIKGLATIHDKDILIYC
FT                   ISQLIAKMNQGELPNRTLHLTARDLLVWTNRQTDGDGYKRLRSAFERLAGTRITTNIKA
FT                   DGEEVTEGFGLINEWRIVRKTNSGQMSEIKVTLSEWLFRMIEGRSVLTLHRDYFRLRKP
FT                   LERRIYELARKHCGAQEKWVVSIEILQKKTGASSHIRVFRSMLRDLAINNHLPDYAVEI
FT                   NSNTVTFRNRETMDTVKVIEPKLQKPFVDPEGFHDARGVAPGYDVYALYDEWVSWWNDS
FT                   GQPELQNPSAAFVGFCRNRHKRNPIR"
FT   CDS             16600..17007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43750"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01162"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ88"
FT                   /protein_id="BAI01162.1"
FT                   /translation="MANDMNYQTAREADTLHRATVPHAVSARLIRARRALHVTLSNGVE
FT                   MSVPVDLLQDLHGASLNDLAEIEITPLGNDLHWPRLDADVLVEGLIHGIYGSRSWMAAQ
FT                   MGRVGGSSASPAKAAAARRNGAKGGRPRNVA"
FT   CDS             17110..17337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mazE"
FT                   /locus_tag="APA01_43760"
FT                   /product="transcriptional regulator MazE"
FT                   /note="Antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43760"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01163"
FT                   /db_xref="GOA:C7JJ89"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR013432"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ89"
FT                   /protein_id="BAI01163.1"
FT                   /translation="MVELKVRKFGNSLGVVLPKEVISRLNTQDGAPLYLTEAPDGGYRL
FT                   VPYDPDFESKMTKAEDIMRRYRDTLHVLAQ"
FT   CDS             17334..17729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43770"
FT                   /product="death-on-curing protein"
FT                   /note="Prophage maintenance system killer protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43770"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01164"
FT                   /db_xref="GOA:C7JJ90"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ90"
FT                   /protein_id="BAI01164.1"
FT                   /translation="MTVFVWIDEREALILHDRLLGLHGGASGLRDAGLLKSALARPQQH
FT                   AAYADPLDPVHLAAVYTAGIVKNHPFIDGNKRTGFVLGVLFLELNGYRFTAAQEDAANA
FT                   VLALAAGQMDELGYAAFLTANVASERV"
FT   CDS             17857..18102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phd/yefM"
FT                   /locus_tag="APA01_43780"
FT                   /product="prevent-host-death protein Phd/YefM"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43780"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01165"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ91"
FT                   /protein_id="BAI01165.1"
FT                   /translation="MRTVNIHEAKTHLSRLIDAAMKGESFIIAKAGRPMVRVSPITAPE
FT                   ELQQRRLGFLAGKIRVPEDFDRMGQDDIVSLFDGPA"
FT   CDS             18099..18485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="APA01_43790"
FT                   /product="pilus retraction motor protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43790"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01166"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ92"
FT                   /protein_id="BAI01166.1"
FT                   /translation="MRLLLDTHLLLWAAGEPDKLSARARTLMEDPGNDLVFSAASLWEI
FT                   TIKTGLGRADFQVDPHLLRRGLIENGYEELPITSQHALAVGQLPDVHRDPFDRILVAQA
FT                   TVEGLLLLTHDPLVKAYPGPIEAV"
FT   CDS             18511..18687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43800"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01167"
FT                   /db_xref="InterPro:IPR022148"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ93"
FT                   /protein_id="BAI01167.1"
FT                   /translation="MPSLHSDEAAEDFVATVDLTRYDLSGFKPMRCEIEPKAAALNMRL
FT                   PASLLETDVAQTR"
FT   CDS             18772..19026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43810"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01168"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ94"
FT                   /protein_id="BAI01168.1"
FT                   /translation="MSRTYHHSRKYGRNHRWANQPDRCGYGGSREASESPNWYSHLHDI
FT                   RPGRHHDRHVARLIIKGDLDPVEAVFPYTGTRRPHEYYW"
FT   CDS             complement(19122..19298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43820"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01169"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ95"
FT                   /protein_id="BAI01169.1"
FT                   /translation="MTMTDLSDERAAKRDAIRKASNSTKPTVPADQVLALLDAELARIQ
FT                   AAIDTLPTPRPTD"
FT   CDS             complement(19295..19627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01170"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ96"
FT                   /protein_id="BAI01170.1"
FT                   /translation="MAPEYPSPEWFSDTINRHQWMWNLNARFVARAAKRMTDTDAFILL
FT                   NEAVNLEIAETAANLLREGVPEKIVADFVIAYSQTQRAELLDNVCDYAWRISAPVAATK
FT                   HEAMKT"
FT   CDS             complement(19731..19970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traD"
FT                   /locus_tag="APA01_43840"
FT                   /product="conjugal transfer protein TraD"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43840"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01171"
FT                   /db_xref="GOA:C7JJ97"
FT                   /db_xref="InterPro:IPR009444"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ97"
FT                   /protein_id="BAI01171.1"
FT                   /translation="MRDWAKARRERTHHLIELGGLVQKAGLVDLTDDDRATLLGAFLDI
FT                   AGQLQEGNETTPDDLKSRWRRAGLHAFDRHREHD"
FT   CDS             complement(20035..20394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43850"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01172"
FT                   /db_xref="GOA:C7JJ98"
FT                   /db_xref="InterPro:IPR009444"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ98"
FT                   /protein_id="BAI01172.1"
FT                   /translation="MSDAVLACVIKYATDQKNKGSIMRKPRDIDAELEELQKRARALKA
FT                   KRIVQFGELVEATGADTLSIEALAGVLLAAVEQADSKPEAVARWTERGAAFFQAGGKKG
FT                   SRKGTGNDQNGSAGA"
FT   CDS             20491..23577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traA"
FT                   /locus_tag="APA01_43860"
FT                   /product="conjugal transfer protein TraA"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01173"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="InterPro:IPR014136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ99"
FT                   /protein_id="BAI01173.1"
FT                   /translation="MAIYHLHAKVISRATGRSAVAAAAYRAASRLHDVRLDRDHDFSNK
FT                   SGVVHSEILLPDGAPERFLDRATLWNEVEAIEKRKDAQLAREVEFSIPREMTQAQGIAL
FT                   ARDFVREQFVERGMVADLNVHWDIGEDGQAKPHAHVMLSTRSVDENGFGAKERSWNDKE
FT                   LLLTWRERWASLANERLAELDLDVRIDHRSFAAQGIDLEPQNKIGPAGMRREERGEDAE
FT                   RVADHLEIARRNGERLLAEPHVALEALTRQQSTFTRQDMARFVDRQTVDAEQFTAVMVR
FT                   VEACPELVALGKDGHGRERFSTRAMIGVEQRLEEASLAMGQSQGHAVPLAVRRAAMQHS
FT                   GLGEEQALAVGEVTKSRDLSVVVGYAGTGKSTMLGVARAAWEEAGYRVRGAALSGIAAE
FT                   GLEAGSGIESRTLASLERAWERGFDLLERGDVLVVDEAGMVGSRQMERVLSVAREAGAK
FT                   VVLVGDPEQLQAIEAGGAFRAVAERVGSVEITTVRRQREGWQQAATKELATGRTEQALG
FT                   RYEAAGLVRGHDTLEEARAGVVAGWEEARQAAPEESQIMLAHRRVDVRALNEAAREIRR
FT                   DAGELGDDVLVPTAQGERVFANGERVYFLRNDRELGVKNGTLGTVRSIVGSAEAGDLAM
FT                   SVQLDGPGGAGTGRVVSVSVAEYDALDHGYAATIHKSQGVTVDRAHVLATGSMDRHGAY
FT                   VALSRHRESVSVHWGRDDVGDRDGLVRRLSCERLKDTTLDYPHVRDRDTGFARRRGLHV
FT                   PESEIVVEREKAASGPRQDRQAEGVPMPDPASAQQKRGMFDGLDLSVRPGRCTTEKDVS
FT                   AGLDAGAGKGESGIEREAPVSPFAGLRLPRVQREQVPAGLDGFVPGSDPLHQAVERYAR
FT                   AWVDAERMVRQELPVLEHQKKALLEAGRDLERIRRGGEADLRAALKHQPEIRQALYGLE
FT                   GPARARKLVEGLEHEDRVRKRPDLRAARFVKTWDGLSREQQGVAFKELKRDAQLESILR
FT                   EKSRELGIRKGSTLDHGLHPHQREQALSRSRSRGMDMGM"
FT   CDS             23628..23894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43870"
FT                   /product="plasmid stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01174"
FT                   /db_xref="GOA:C7JJA0"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJA0"
FT                   /protein_id="BAI01174.1"
FT                   /translation="MRSSVMSSVVIRNLPEETHRALKAQAMLHGRSTEAEIRTILEAAV
FT                   RPPQRVRLGSLLASIGREAGVREQDVTALQVRDQTPAEPLSFE"
FT   CDS             23891..24313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43880"
FT                   /product="plasmid stabilization protein"
FT                   /note="PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01175"
FT                   /db_xref="GOA:C7JJA1"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJA1"
FT                   /protein_id="BAI01175.1"
FT                   /translation="MILLDTNVISEPWKPVPEPRVLAWIDRQAIETLFLSAVTVAELRF
FT                   GIGAMPAGRRRSVLHERLEQEVLPLFAGRVLSFDLAASQAYAELMVRARSEGRAIGKAD
FT                   GYIAATAASRGYVVASRDVSPFEAAGVRVLNPWEDT"
FT   CDS             24313..24540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43890"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01176"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJA2"
FT                   /protein_id="BAI01176.1"
FT                   /translation="MSETDPAARAFEDLCAEMTVLRRSVEALPQAWRDNRPPDYTEDLA
FT                   RVVKAMNAVGMHMKAIDADFSHLRQFRVIL"
FT   CDS             complement(24683..26068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43900"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43900"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01177"
FT                   /db_xref="GOA:C7JI77"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI77"
FT                   /protein_id="BAI01177.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDIL
FT                   GLSRRFAACFRDKRHPAFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALATLFVTLFLDQHERAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYIFCGDHLLSATLRTADRDPGNEALAD
FT                   ISRIVEQIRNRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT   CDS             complement(26126..26365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43910"
FT                   /product="DNA resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01178"
FT                   /db_xref="GOA:C7JJA4"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJA4"
FT                   /protein_id="BAI01178.1"
FT                   /translation="MLVGYMRVSSADERQSVDLQRDALIAAGVDARHIHSDKASGARDD
FT                   RPGLKTCLAWLKEGDTLVVWKLDAEISQKGCTSG"
FT   CDS             complement(26520..26993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="APA01_43920"
FT                   /product="plasmid partitioning family protein ParA/MinD"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43920"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01179"
FT                   /db_xref="InterPro:IPR015223"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJA5"
FT                   /protein_id="BAI01179.1"
FT                   /translation="MKTGKIVVISKLKGGSGATTLTRELATSALDAGKSVAIIDLDAQG
FT                   SLTNWWNRRTAATPDAGPKLIQLSPENLPDMTEKLRGKFDLVLIDTPPSTHDALRKIAS
FT                   KADMAVIPTKPTPDDLDAVGPVIRQLRGVVPMAFVISQITNKGSVHRTGTDIR"
FT   CDS             complement(28082..28381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xre"
FT                   /locus_tag="APA01_43930"
FT                   /product="transcriptional regulator Xre"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43930"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01180"
FT                   /db_xref="GOA:C7JJ64"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ64"
FT                   /protein_id="BAI01180.1"
FT                   /translation="MAEQMNIADELLTSMEQAVGIAAGTVKPGRIWTPPEINVADIRKR
FT                   TGLSQVRFAARYGFSAAAVRDWEQKRRTPEKAARTLLMLIDKEPQAVERVLVGV"
FT   CDS             complement(28383..28721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relEB"
FT                   /locus_tag="APA01_43940"
FT                   /product="translation repressor RelE/RelB/StbE"
FT                   /note="Toxin-antitoxin stability DNA-damage-inducible
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43940"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01181"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ63"
FT                   /protein_id="BAI01181.1"
FT                   /translation="MHSVIETPIFTKRADALLSREERAELIRLLAENPRQGDVIPGTGG
FT                   VRKLRFAGSGRGKRGGVRVIWYVASDRIPVYALLIYGKNEQDDLTPDQKKAMASMAERI
FT                   KKSDQGGT"
FT   CDS             28802..29188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43950"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01182"
FT                   /db_xref="GOA:C7JJA8"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJA8"
FT                   /protein_id="BAI01182.1"
FT                   /translation="MLSHLKSPGKTTMQPLIHRGSGLSQSDYDLKGHIMSKSSSPYVRR
FT                   LLWIVACFVGGFALLCVSGWALVVNGSTQDSAMVTVLRWLPVATGAITVAAGFFLLFLP
FT                   VPEDPEDFFLPDDTDGELERTDGK"
FT   CDS             complement(29249..30058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43960"
FT                   /product="esterase/lipase"
FT                   /note="Oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43960"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01183"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJA9"
FT                   /protein_id="BAI01183.1"
FT                   /translation="MTEHLTKRWQTLPATPAPLASFKGQHAPINGCSLYYTEGGTGDDV
FT                   IIMLHGGMANSDYWGIQAAYLAKTHRVILVDSRGHGRSTLGDKPLSYAQMADDIIHLMN
FT                   HLEIPNASLVGWSDGGVQSIILASEHPDRIKRIFAYGPHMSASGLNLACSGNKVVNAFV
FT                   KRATEDYRELSPTPDKFDVFSKTLRGLWKWEHDAEFTEDRLNAIRCPAWVVGGDRDEMI
FT                   HRAHLEYLVAHIPDSSYMILPETSHFAFLQAPLLFNEALADFLSVKA"
FT   CDS             complement(30133..30960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43970"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43970"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01184"
FT                   /db_xref="GOA:C7JI80"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI80"
FT                   /protein_id="BAI01184.1"
FT                   /translation="MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAE
FT                   NDRIADLLVGLTQAHRRWGFGLCFLYLRNVQGHVWNHKRVYRIYRELELNLRIKPRRRL
FT                   VREKPEKLSVPALPNTVWSMDFMADRLLDGRAFRLLNILDEFNREGLAIEVDFSLPACR
FT                   VVRCLEQVMEWRGRPEAIRMDNGPEYVSHTLVSWAEKQGITLIYTQPGNPQQNAYIERY
FT                   NRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA"
FT   CDS             complement(30957..31220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43980"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01185"
FT                   /db_xref="GOA:C7JC92"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JC92"
FT                   /protein_id="BAI01185.1"
FT                   /translation="MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKY
FT                   GGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKK"
FT   CDS             complement(31330..32517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01186"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJB2"
FT                   /protein_id="BAI01186.1"
FT                   /translation="MAELSDEELLAELGVSLETKKKAALTAEEERIIAGFEDICRFYEE
FT                   HGHAPAHGEDRDIFERLYAVRLDRIRALEKCRSLLAQRDPHGLLSVSGKEAESPDPDTL
FT                   DDDALLAELGIEAEPAAESITVLKHVKSRAEVRAAEEIASREPCKDFETFRPFFAQVQE
FT                   DLKSGVRETRPFGQEAGIRQGEFFILKGQMVYVAHVGEEFETEYGRRDSRLRVIYDNGT
FT                   ESDVLLRSLQRALYKDEAGRRITDPTVGPLFGTTVEPDDLESGTIYVLRSLSDNPYIAQ
FT                   HRNLIHKIGVTGGDVKKRIANAKHDATYLLADVEVVATYKLFNINRTKLEKIFHRVLAP
FT                   AQIDLTIQDRFGHPVHPKEWFLVPINIVSQIVDKISDGSIDGFIYDPKTVGLVKA"
FT   CDS             complement(32510..34594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_44000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01187"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJB3"
FT                   /protein_id="BAI01187.1"
FT                   /translation="MTINPVIPAVSLRTGQTGLSARTNELGMRPMQEAVYEKRGEQYLL
FT                   IKSPPASGKSRALMFVALDKLAHQGVKKALIVVPERSIGGSFMNEPLSKFGFWADWIVQ
FT                   PKWNLCNAPGSDEGQVARSKVKAVGEFLKSKDQTLVCTHATFRFAAEELGIAAFDGCLV
FT                   AVDEFHHVSADPKNRLGYYLNQLIARGETHIIAMTGSYFRGDAVAVLSPEDEGKFETVT
FT                   YTYYQQLNGYQYLKELDLGYYFYTGSYLDAIDRVLDGTRKTIVHIPNVNSRESTTQKHK
FT                   EVEHILSVLGDWEGEDEETGFHLVRRTDGRVLRIADLVEDEPVRRNKVVSALKDPAQKN
FT                   NRDHVDIIIALGMAKEGFDWIWCEQALTVGYRSSLTEIIQIIGRATRDAPGKTRAEFIN
FT                   LIAEPDASQEKVTDAVNDMLKAIAASLLMEQVLTPRFEFTPKTEESAPLDGYDYGEEGY
FT                   KPNGTNVGFNAQTGQFHMEIKGLVSPKSPEAQRICREDLNEVVASFVQDKPSLEHGLFD
FT                   EETAPQELTQVRLGKIIRDRYPELSDEDQEAVRQHAVAAFNLTQKGQKAAEEVTQAAGG
FT                   EEKIGGNTALIEGMRKIAMNVRDLDIDLIDAINPFEEAYKILAKSMNAETLKQVQEVIA
FT                   GRHIALTIEEARDLAKRALLFKKERGRLPELTSPDAWERKMAEGVAVLARKTAEERANG
FT                   "
FT   CDS             complement(34598..37306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_44010"
FT                   /product="DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01188"
FT                   /db_xref="GOA:C7JJB4"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJB4"
FT                   /protein_id="BAI01188.1"
FT                   /translation="MNPVEIEEAVSRIAEAPFNPGEFPFEFLQAFGNRDVTIKRLRKDN
FT                   RSDVPGAVLQRNNIHLAVCPEGHVAQTLNLLRESPKTQSAKARFLLATDGVTFEAEDRT
FT                   EDEHITDVFTHLADRFGFFLPLAGITTVQKIKNNPIDVKATSRLNRLYVELLKENPDWA
FT                   TEERRHDMNHFMARLIFCFFAEDTGIFLNNLFTRTIQTMTEGATDQTHEVMAELFRTMD
FT                   LDTRNDDREKGGVKSWARDFPYVNGNLFSGTTDCPKFNKLARTYLLRAGELNWAQINPD
FT                   IFGSMIQAVADEGERGALGMHYTSVPNIRKVLNPLFLDGLREELEKAGQNTQKLHALKE
FT                   RLSGIRVFDPACGSGNFLVIAYKDMRDIQSEIDDRLKIERAERKSVIPLANFYGIEIRD
FT                   FAVEIARLSLLIAEFQSDEIHIDQKQARLNVLPLKDTGHIICGNALERDWFDVCAPQKS
FT                   SEIYICGNPPYKGSQWQSAEQKADLEQIFGQRTKSWKSLDYVAGWFMKAADYGQKTGSS
FT                   SAFVSTNSICQGRQVAILWPLIFGLNYEISFAHTSFKWANLAAHNAGVTVAIIGIAPVS
FT                   DCQKILFSNGNDGKTIRQETGHINAYLVPGSDVVVEKHSRPLSSVSDMDFGSMPNDGGH
FT                   LLLSWDDVERLRLTEHQKEKFIKPVYGSSEYIRGNMRFCIWVTDDLRNEAFQIPSLKER
FT                   FDNVCDQRIKSERLTTKELSKYPYKFGEVRQVGNEEIIAIPAISSENRPFLPVGVLPKG
FT                   NIVTNKIYALYDAPLWNMALIASRLHWVWIGTVCVRMRTDFSYSNTLGWNTFPVPTLTE
FT                   KNRADLTRCAEDILLAREAHFPATIADLYDPDKMPDNLRAAHDRNDEVLERIYIGRRFR
FT                   NDTERLEKLFDLYSKMIAKKGGKMKKKKDAA"
FT   CDS             complement(37346..38440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="APA01_44020"
FT                   /product="cell filamentation cAMP-inducing protein Fic"
FT                   /note="Yeast CDC2/30 and FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01189"
FT                   /db_xref="GOA:C7JJB5"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025758"
FT                   /db_xref="InterPro:IPR026287"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJB5"
FT                   /protein_id="BAI01189.1"
FT                   /translation="MLTPTYHIRPLPPQAEIETVPVLKALVEANKALAELKGRAATIPN
FT                   QGILIDTLALQEAKASSEIENIVTTQDELFQADLFPEGPDSMAAKEVALYRDALHLGFR
FT                   LLKETDGLILNKGLIAIFQRLKKRGDGFRNTPGTALKNERTGEVVFVPPQDGREIIGHM
FT                   SDLERFVNDDGLCDLDPLIKMALIHHQFESIHPFPDGNGRVGRILNVLYLTRTGLLDIP
FT                   ILYLSRYITRHKDEYYHLLQKVRDEGAWEVWILYMLRAVAETSRITLELIEGMRAQMAT
FT                   MKQRMRTELPKIYSQELLNNLFRHPYTKIEYVQSDLSIARQTAGKYLDQLSEKGLLSKH
FT                   RSGRSNYYINAPLVRLFLEVSGGA"
FT   CDS             complement(38767..39237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_44030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01190"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJB6"
FT                   /protein_id="BAI01190.1"
FT                   /translation="MKESRKRTGSTISGLVRKHLSEIEKRMIEGESRDQILDWLKEETG
FT                   REIERTTFFTVFYRARKWAEKNKIKAAYLAALSAQPVQSVAPEPAILTSSKKKPKKHVE
FT                   RAADKPEVRRENVLPENPTGQQRLRAALAIGKPPPVLDWEEDDRFAKYRNGK"
FT   CDS             39775..40191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_44040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01191"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJB7"
FT                   /protein_id="BAI01191.1"
FT                   /translation="MRERKYTVRFTEDEAEWLQEVALDGNVSGYIRDTVLRQSKSDRKL
FT                   VSMNERLVDLGQDMRLVTDLLHDLDQKVAGTPTAPDATGSQEPEGIPDELMAMVLEILL
FT                   LVRSFSAPHERQMAQADVAQIGLPIWRKANLRDR"
FT   CDS             complement(40261..40644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_44050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01192"
FT                   /db_xref="GOA:C7JJB8"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJB8"
FT                   /protein_id="BAI01192.1"
FT                   /translation="MRDRSVVASGRVFAPGEIVLADWRGDALPKEPNKLRPAVVVEDEL
FT                   FPPEWPNVMLVPLTDDENLVIPDLAVRIDPSADNGCSKSCWAISALLTTTSKHRLRITG
FT                   SKVRPDQLFTIRRQIALLVGADG"
FT   CDS             complement(40637..40972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_44060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01193"
FT                   /db_xref="GOA:C7JJB9"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJB9"
FT                   /protein_id="BAI01193.1"
FT                   /translation="MFGGDRLDLRVFLVVVEYIIVLQNQHTICMEEAMASPLSIRLDER
FT                   LRLNLEQEAAASGIPLSQLVRDLLETGAKRARRDRIRRDSARVARYVAATPSAQELFEE
FT                   TGGTHGA"
FT   CDS             complement(41074..41559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_44070"
FT                   /product="DNA resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01194"
FT                   /db_xref="GOA:C7JJC0"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJC0"
FT                   /protein_id="BAI01194.1"
FT                   /translation="MKVDKIFTDKCSGGTRNRPALTEMLRYVREGDTIICHSIDRLARD
FT                   LQDLLHLVETLTDRGVGVRFIKEAMTFEGNASPMQTMILQVMGSFAQFERSLIKERQRE
FT                   GQQAARARGKLPGRRKSLSPEQITELKARVSAHEPKARIARDLGISRETLYAYLKAA"
FT   CDS             complement(41753..43138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_44080"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01195"
FT                   /db_xref="GOA:C7JC93"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JC93"
FT                   /protein_id="BAI01195.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDIL
FT                   GLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKSTLNRLERSGQQADRYCRIIADHEALATLFVTLFLDQHEHAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTADRDPGKEALAD
FT                   IRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT   CDS             43256..43723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_44090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01196"
FT                   /db_xref="GOA:C7JJC2"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJC2"
FT                   /protein_id="BAI01196.1"
FT                   /translation="MTPQAYGQGIREEGLAASRRLEGVFEKAIGEVRKERQALASIVGE
FT                   ANNRRDQWFYLIFIGLMAFLFGVGVAPLLFNHITWKNFDERVASFIVGGQDRWESGAAM
FT                   MRDARPEQWNSFMWEDRLVQDNMPKIRDCRIAATQVGQPKPCVITIKPDAQ"
FT   CDS             complement(43809..45986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_44100"
FT                   /product="outer membrane protein"
FT                   /note="Adhesin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01197"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJC3"
FT                   /protein_id="BAI01197.1"
FT                   /translation="MSIVNPSNGTPYLTPGTTTFTSGQVVSGVTVPSNSKEVLSSGATG
FT                   MQQTIKEASGNTGGGEILVLSGAQLLQNTDAGVWLNEGKIIVHDGGFISGGAATAGGIT
FT                   TILSGGIAEEITAGNAGSIGTVIFSSGAILKGTTVARSGGTISGGTATSGAQIKVLSGG
FT                   VLTDADAAAFGNIVVSKGGRGQDIIISSGGGLGVAGIASDTTVNNGGVIEINSGGVSNN
FT                   NHVNNGGKIYADSGSILGLTSISSGGSAIVASGATISDVVTIQDGGTATIWNNTSGTID
FT                   LSGDTNHGLTISGLESGGTVSTVISGWSGSKPGNSDSIDLPGVSADGASYAYPSDDQVV
FT                   VTLANGNTITLNIPGVKNTGFVLSDDHHGGASAEVCFLSGSMIRTSEGDVAVEDIQIGD
FT                   EVIAFDWRNDEDVVRQVVWVGKARATVRPDLPDDEAGWPVRILKDAIADGVPYKDMLIT
FT                   AEHCLFFRDRFVPVRMLVNGVSIFYDKSITSYDYYHVETEQHSVITADGMLTESYLDTG
FT                   NRSSFRQEGKIATLRGAVKNWADHAGAPLGVERSFVEPLFRALQWRENSVVGTKISTTK
FT                   IETTTDPDLHLITQTGAVIRPMRKTAHHYSFMLPPNTESVRIVSRSSRPSDVIGPFVDD
FT                   RRYMGVAVADVQLQCAKQQFDITSHLQDEKPSGWHDTDWTDCAWTNGNAELPLGDHLTH
FT                   GKMGILSMTIRAAGPYLLNTKPNSDMKKHSA"
FT   CDS             46313..46576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_44110"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01198"
FT                   /db_xref="GOA:C7JC92"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JC92"
FT                   /protein_id="BAI01198.1"
FT                   /translation="MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKY
FT                   GGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKK"
FT   CDS             46573..47400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_44120"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01199"
FT                   /db_xref="GOA:C7JE27"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JE27"
FT                   /protein_id="BAI01199.1"
FT                   /translation="MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAE
FT                   NDRIAALLVGLTQAHRRWGFGLCFLYLRNVQGQLWNHKRVYRIYRELEFNLRIKPRRRL
FT                   VREKPEKLSVPALPNTVWSMDFMADRLLDGRAFRLLNILDEFNREGLAIEVDFSLPACR
FT                   VVRCLEQVMEWRGRPEAIRMDNGPEYVSHTLVSWAEKQGITLIYTQPGNPQQNAYIERY
FT                   NRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA"
FT   CDS             47575..47913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relEB"
FT                   /locus_tag="APA01_44130"
FT                   /product="translation repressor RelE/RelB/StbE"
FT                   /note="Toxin-antitoxin stability DNA-damage-inducible
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01200"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ63"
FT                   /protein_id="BAI01200.1"
FT                   /translation="MHSVIETPIFTKRADALLSREERAELIRLLAENPRQGDVIPGTGG
FT                   VRKLRFAGSGRGKRGGVRVIWYVASDRIPVYALLIYGKNEQDDLTPDQKKAMASMAERI
FT                   KKSDQGGT"
FT   CDS             47915..48214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xre"
FT                   /locus_tag="APA01_44140"
FT                   /product="transcriptional regulator Xre"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01201"
FT                   /db_xref="GOA:C7JJ64"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ64"
FT                   /protein_id="BAI01201.1"
FT                   /translation="MAEQMNIADELLTSMEQAVGIAAGTVKPGRIWTPPEINVADIRKR
FT                   TGLSQVRFAARYGFSAAAVRDWEQKRRTPEKAARTLLMLIDKEPQAVERVLVGV"
FT   CDS             49303..49938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="APA01_44150"
FT                   /product="plasmid partitioning family protein ParA"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_44150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01202"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ65"
FT                   /protein_id="BAI01202.1"
FT                   /translation="MKTGKIVVISKLKGGSGATTLTRELATSALDAGKSVAIIDLDAQG
FT                   SLTNWWNRRTAATPDAGPKLIQLSPENLPDMTEKLRGKFDLVLIDTPPSTHDALRKIAS
FT                   KADMAVIPTKPTPDDLDAVGPVIRQLRGVVPMAFVISQITNKRSPDAVEATELLSARAP
FT                   VIGRTVIRVGYYRAAGAGQSGFETDKTVREEIATVYDNLMALLGDYHA"
XX
SQ   Sequence 49961 BP; 11255 A; 13281 C; 13639 G; 11786 T; 0 other;
     attggccttg atctggacga tatagaggcc aagcccgcca gtggtcagaa agtagcagcc        60
     ttccatgagc aagcgcttac acagccgcca caggataaac caggggctta tgtcaaagac       120
     aaagcggtga atatgacggt ctatctcttg ccgcatgacc acaagcgact gaaacagctt       180
     gccgttgagc atgatactac cattcaagcg ttagtcatgg atgggctgga tgtgatctta       240
     aaggacaacg ggcaggaacc gctcacccgc tggaaaacta gacgtaagcc gagagggtga       300
     acaccttata agctggtcag cgtttcaccc gttcaagttt tcgggtgaat gggtgttaag       360
     ccgactgtca ggctagcata cttttctgga ctaatgaccg gggcagggaa ccaggctttt       420
     tgagtgtcaa gaaaacacat aaaactaatt aattgacata ttgtaagtat attccttaga       480
     tatttcatga catgtgagga gtgtttacca tggccggtca gattgtcgct tatgttcggg       540
     tgtcctcagc agatcagaac acagaccgcc agatgtttga cggcatgacc gtggacaaga       600
     ccttcactga caaatgtagt ggtggcacca gaaaccgtcc tgcccttact gagatgctgg       660
     gatatgtgag ggaaggcgat acaattgttt gtcactctat tgataggctg gcgcgagatc       720
     ttggcgacct gatgcatctg gtgcagacca tgacgagacg cggtgtcggt gtccggttca       780
     tgaaagaggg cctgactttc accggagaag acagccccat gcaggattta atgatgcata       840
     tttttggggc ggtcgcgcaa ttcgagcggg cgctcataca cgaacgtcag aaagaaggtc       900
     aaattgctgc ccgtgccaaa ggcaaggttc cgggccggaa gcctaaactg tcaccggaac       960
     aggtcaccga gctgtataac cgcgttgcca ctcacgaacc caaagctcag attgcccgtg      1020
     acttcggaat aagtcgggaa acgctttatg cgtatctaaa ggcagcctga agatcaggcc      1080
     acataagacc atccatacat cgccgcgcaa ggattttggt ctttactaga aagcaatatg      1140
     gaaactggca taatcggtgt ataggtgttt atctgcatat atggaggtaa gtcatgtcta      1200
     ctacccgttg gaatatcgcg gtttcatctg aagtggatca gtctgttcgc atgtttctag      1260
     ccgctaatgg gggggggcgc aaaggcgatc tatcccgttt tattgaggac gccgtacggt      1320
     cttacctgct ggaacaggct gtagagcagg ctaaagcggc gagtgaggat atgagcgaag      1380
     ctgaactggc cgacttggtg aatgaagccg tgcagtgggc acgtgggcac tgatgcgggt      1440
     tgttctggat accaatatcc ttgtttccgc tctgatatac cctcgaggtg cccctgatgc      1500
     gatttatcgt gcctggcggg cgcaccggtt cgatctggtc acgtccacaa cccagcttga      1560
     agaactcagg cgcgtcagtc gctatcccaa gctccgatcg attctgccac ctcaccgggt      1620
     cggagcgatg atcaacaaca tgcgcaaagc atctgtggcc gagcaactcc ctaccttgcc      1680
     ggatgacgtg accatcaacg atcgcgacga tgtctttctc ctgacaatgg tgctggcgtt      1740
     cgatgccgac tatcttgtga caggcgatca tcgtgccggt ctgctggaga aggggcgttt      1800
     ccagagagcg cgtattgtga cgcccgtaga tttctgttcc attgcccttg attgagcaat      1860
     ttcaggtcgg cgttcgggca ggcatgaaac atgcgctcat cagcatcagg attgtccggt      1920
     tcttcctgtc tgcctggaag gtcatccgtc atggctgttc tttcctttct acatgctctt      1980
     tttcggcatc gaaggcatga agccccgcgc gtctccagcg cgttttcaga tcaaccggag      2040
     tggtcacatt gctgccctga agctgtcccg caatgtccag aaacgccccg agcagggtgg      2100
     cacggtcatc atcagtcaga tcgaccagtc tagccttctg gaccaagcct cccagttcga      2160
     tcagatgatg ggtacgttcc cgtcgcgcct tcgcccagtc gcgcatgtcg gttgaattgc      2220
     cccgggtttt gtggagacat tttttatctg atttaagcgg ctaatgcatg tgatttttgt      2280
     tgcgcataaa aacgtgcttc agcttctgct ggggggatgt ttccaatgga ggacaggagc      2340
     cgccgattat tgaaccagtc gacccattta agtgttgcca gttcaacagc ttccctgttt      2400
     ttccatggcc cctgccgata gatgagttcg gttttgtaaa gtccgttaat ggtctctgcc      2460
     aaggcgttat cataggaatc cccaacactg ccgacagaag caacgagccc cgcttcagcc      2520
     agtctttgcg tgtagagaat ggacacatat tgacagccgc ggtcggaatg gtgggtcact      2580
     tttccctcag gtcgcctctg gcacagagcc tgctcgagag catccagcac gaagtcggta      2640
     tgggccgttg aggagacgcg ccagcccaca atcacgcggg caaacacatc aatgatgaag      2700
     gccacataaa caaagccctg ccatgtggaa acgtaagtaa aatccgaaac ccacagtctg      2760
     ttgggggcag gagcatgaaa ctggcgctgc accagatcct gcggacacgg acgttgcgga      2820
     tcaggccgtg tggttctgac ccccttgcca cgaatgacgc ctttcagccc catccggcgc      2880
     atcagccgct ctaccgtgca gcgggcgaca tccacgcctt cacgtttgag ctgatgccag      2940
     accttgcgcg ctccatagac gcagaaatta ttattccaca ctctacggat gtcatcgcac      3000
     agttctttgt ctttctggct gcgcacacac ggatttttct gtctggcaac agttgcataa      3060
     taggcagatg gtgcaatcga cagaaccctg cagattgacc cgacaccata tgtctgccgg      3120
     tgctcctcaa tgaagcgtgt catggcttga agatgcggtc gagctccgcc tgggcaaaat      3180
     atgccgacgc cttacgcagg atgtcattgg cctgccgcaa ttcgcggttc tctcgctcca      3240
     gttgcctgat cttctctcga tcaggcagct cactcaccgc aggcgcattg gcacgttcat      3300
     gcagacgggt ccattttgac agcgtgtcag gatgaatatc cagctttggc gctatcatca      3360
     tcaccgcgga ccagcgtgat ggatggttct tctcttcctc cagaaccatg cgggctgcac      3420
     gttcacgaaa ttcaggcgga aaacgcttcg atttgttgct catgaatcct tcttacctct      3480
     cgggtcgttc cgtctccaca aaacccgggg caattcagcc ggccagccgg agacttgaag      3540
     gggtcttcga aaaggcgatc ggagaagtcc ggaaagaacg gcaggcgctg gcgtcgattg      3600
     ttggtgaggc gaacaatcga cgtgatcaat ggttttacct gatttttatc ggtctcatgg      3660
     catttctgtt tggggtgggg gtcgcaccgc ttctatttaa tcacatcacc tggaagaatt      3720
     ttgatgagcg tgtggcttcg ttcattgttg gggggcagga tcggtgggag tccggagctg      3780
     cgatgatgcg agatgcacgg cccgagcaat ggaacagctt tatgtgggag gatcggctgg      3840
     tgcaggacaa tatgccgaaa atcagggact gtcggatcgc ggcgacacag gtcggacagc      3900
     cgaagccctg cgtgattacg attaagcctg atgcacagta gtatttgatg aggaataagt      3960
     tttcataagg aaagggcttt cccggcaaag ggaaagcccc aacattattt gtccggttaa      4020
     ccgagattaa gcagaatgtt ttttcatgtc agagtttggc tttgtgttca gcagataggg      4080
     gcctgcggca cgaatagtca tggagagaat acccattttc ccatgtgtca ggtgatcacc      4140
     taacgggagt tcagcattcc cattggtcca tgcgcagtcc gtccagtcgg tatcgtgcca      4200
     acccgaaggt ttttcgtcct gaaggtgaga agtaatatcg aactgctgtt tggcacattg      4260
     aagctgcaca tctgctacgg ccacgcccat atagcgacga tcatcgacaa acgggccaat      4320
     cacgtctgat ggacggctag aacgcgagac gatccgcaca gactctgtat ttggtggtag      4380
     catgaagctg tagtgatgcg cggtcttacg catgggacgg atcacagcgc ctgtctgagt      4440
     gataagatgt aggtcaggat ccgttgtcgt ttcgattttt gtcgtcgaga tcttggtgcc      4500
     cacaacactg ttttcacgcc attgcagagc ccggaagagc ggttctacaa aggagcgttc      4560
     cacgcccaat ggcgcaccgg catgatctgc ccagttcttt accgctccgc gcagagttgc      4620
     gattttgcct tcctgacgga aggatgaacg gttcccggta tcaagatagc tttcggtgag      4680
     catgccatca gcggtgatga cagaatgctg ttctgtttct acgtgatagt aatcgtaaga      4740
     agtaatggac ttgtcataga agatagacac accattgacc agcatacgaa cggggacaaa      4800
     acggtctctg aagaacaagc agtgttcagc cgtaatcagc atatccttat aaggtacgcc      4860
     atcggcaatg gcgtctttaa ggatacgcac aggccagcca gcttcatcat cgggaaggtc      4920
     aggacgtact gtcgcacgcg ctttacccac ccagacaacc tgacggacta cgtcttcatc      4980
     gtttctccaa tcaaaagcga ttacttcatc accaatctgg atatcttcga ccgcgacatc      5040
     cccttccgag gtacggatca tgctgccaga aagaaagcag acttcagcag atgcgccacc      5100
     atgatgatca tcggaaagga caaatccagt atttttgaca ccaggaatat tcagggtaat      5160
     ggtgttgcca ttggctagtg taaccacaac ctgatcatca gacggataag cataagatgc      5220
     tccatctgct gaaaccccag gcagatcgat actatcagaa tttcctggtt tgctgccgct      5280
     ccagccgctg atcacagtgc tgactgttcc cccgctttcc agaccagaaa tagtcaaacc      5340
     atgatttgtg tcgcctgaga gatcaatcgt accgctggta ttgttccaaa tcgtagcagt      5400
     tccaccgtct tgaatggtca cgacgtctga aatagtagcg ccactggcta caatagcaga      5460
     tccgccactc gatatggatg ttaatccaag tatacttcct gaatctgcat aaattttacc      5520
     accattatta acatgattat tatttgatac gccaccagaa ttgatttcta ttacgccgcc      5580
     attgttgaca gtcgtgtctg aggcaatgcc tgcaacccct aaaccgccac cactggaaat      5640
     aataatatct tggcctctgc cccctttgct gaccacaata ttaccaaatg cggctgcatc      5700
     ggcatcggtg agaaccccac cagatagaac attaatctgg gccccagagg tagcggtgag      5760
     agaggttgta tgctggttat cgtatgttgt tccggagcca atatttagtg tgcctcccgc      5820
     cagaaggctt gtgtaagatc cagatcctcc tcctgtgaaa gttaaggacc ctccactgga      5880
     gatgacggtg ccaatagatt ggccacccga tgatacaatt atgctgccgc cggataaaat      5940
     attagaggcg tttattaaac caccgctcct aatcttaact acaccattat tttctacagt      6000
     gacacttgta gctgacccag agactaaaac ttctaataat ccaccattat cgattacaga      6060
     accacttaag gttccgctag ggatataccc aattccacca cttaatacat gaagatcttt      6120
     aacagtacct ccgctcacca tatgaacgag cccgccagaa ctaactgtta tagttgaaat      6180
     cgttcctcca taaatatagg catatgcacc gcctcccaca tgaacattat tcgcaactcc      6240
     gccgctggag acaaacagtc tatcgtgtgt gtcgtttgct gaggttagag tgatatcatt      6300
     taatgtttca ccgttagaaa cactagtgtc gttccaatag tccattttcc acctgatatt      6360
     ttgtgtttat ttttatcaat aattagtgat ctaatgatca attctttcac tccaacgaac      6420
     cctgcgttca ggcctactgt catctcccaa tgtcgtcacg gtaatcgaag cgctcttttg      6480
     cgattcttca attgtttgct gcataccggt ggctccagaa gaaaggacct cctgagagtt      6540
     actggtaaca gtcactcctg aaacaacttg accggatgtg aaagttgttg tgcccggagt      6600
     aaggtaagac gttccattag aaggatatac aatactcatt ttatcacttt caaaaatggt      6660
     gatttgcgca aactctctct aggcggaaaa gtttgctctt agaaaacatt atctatttaa      6720
     agataccaat caatctaatc aagtatttta atattagggc ctgttagggc ttgatccagt      6780
     ctgctgcggc agcgatgtgg atgaccacga ggaacgacgt tgctgttttt tcatatctgg      6840
     ttgcgacagc gcgccactcc ttgaggcgag cccagaggtt ctcaacgaga tgccgacacc      6900
     gataggccca tttggggcag gcgaccgggc catcgcgtcg tttcgcggga atggctggcc      6960
     gtgctcccat gtcccatatc cgttcacgca tggcgttcga cgcgtagccc ttgtccgcta      7020
     ctacccacag gggagtggcg ggaaggctgt cgagcatggc tggtgccaga ggcagttcat      7080
     gagcctgtcc aggggccagc gcaaaaccga aggcttttcc atgtccatca gcgatcacgc      7140
     agacttttgt gccatagcca ccgcgagagc ggccaagtgc ttcacgatgg tctcgctctt      7200
     cgaaagaggc cccttttttt gggctcccgc cgctttgtgg tgagccctga tgtttgtgcc      7260
     atccagaaaa gtcattccga atgccactcc ctgttgttcc tgaaccagtg cgagcagccg      7320
     ctcccatacg ccgagcttcg cccagcggat gaaaagctgc gcagcccgcc accacggacc      7380
     cagttcagcg gggatactcc gccatttcgc gccattctca tgacgccaga aaatcgctgc      7440
     tatcgtccgc cgcagatcat gtggcggcgt cttgcccctc gggcgaacct cctcaatcag      7500
     aggttcccag atcgcccatg tctcgtccgt aaaggtgcct gttctgtctc cttcttccat      7560
     ccctacaata tgggaagaaa ttcaagatct aacaggccct aaaaataaac cccatacatg      7620
     aacgttttgc gcaaatcacc atttccaaaa aaatatcacc gtgaatatag cactctcctt      7680
     cattacgaag gacgaaacag gtgcgcagaa ttgggtatgc tcgtgtcagc acgattggcc      7740
     agactcttga tatgcaaatt caaacgctca atagctttga gtgtcataaa gtttttcgtg      7800
     agaaagcgag cggggcggat gttgagcgtg tggagttacg tcgtcttata aaaaaccttt      7860
     gtcatggaga tacagtggta atccccccat ttttagtggg gcattgaatg agaattcagg      7920
     cagctgtttt tagtttctgg gcgggggtta gcccgctgtt ccccatgttg ggtctgtcat      7980
     ggttatatgt ccagagccat tgtgttgcga cctcctgcac gtcctgaatg ctttcaaaca      8040
     gatactgctc cagccattcc tgccggacag ttctgttgta gcgttcaata taggcgttct      8100
     gctgcggatt acccggttgc gtatagatca gggtaatccc ctgtttttcg gcccatgaaa      8160
     ccaacgtatg actgacatat tcagggccat tatccattcg gatggcttct ggcctgccac      8220
     gccactccat aacctgttcc aggcagcgga caacccgaca ggccggcagg gaaaaatcaa      8280
     cctcgatcgc cagtccttca cgattgaact catccaggat gttcaggagc cgaaaagcgc      8340
     gtccatccaa aagcctgtcc gccatgaaat ccatggacca gaccgtgttg ggaagggccg      8400
     gaaccgacag cttttcaggc ttttcgcgaa ccagacgcct gcggggttta atccgcaggt      8460
     tgaactccag ttcccgatag atccgataaa cccgcttatg attccagagc tgtccctgca      8520
     cattgcgcag atacaggaaa cacagaccaa atccccatct cctgtgagcc tgggtcagtc      8580
     ccaccagaag agcggcaatc ctgtcattct ccgctgccag tcgcggacga tagcgaaagc      8640
     aggtctcgga tatcccaaaa atccgacagg ccagcgcaat gctgacccca tgatgcgcca      8700
     cagcctgtgc ggccagttcc cggcgctggg ctggccgctt catttttttc caagggcttc      8760
     cttcaggata tccgtctgca tgctcaaatc cgcatacatg cgcttcagcc gacggttctc      8820
     ctcttccaaa gccttcatct gactgatcat cgaagcatcc atgccgccat atttcgcgcg      8880
     ccaccggtaa aacgtggcgt tgctgatccc atgctcccgg cacaggtcag gaaccgggac      8940
     accgccctca gcctggcgga tcacacccat gatctgggcg tcagtaaagc gaccactctt      9000
     catcagaatc tcctcatcct tacgctgaga aaattctcat tcaaaagcca ctctttttat      9060
     ggggggatta cccagttatt gtcactcgga ttgacaggtt ggcgcgtagt acattcgacc      9120
     tctttgctat tgtaaaagaa atcatccaga agggagcgca gttttactct ttatcggaac      9180
     cttgggctga tacgactaca agtactggtc gtttaatgct tgctgtttta ggcggcttag      9240
     cggatgttga gcgtgatctg atccgaactc gtacggctga aggtcgtgcg agagcagtac      9300
     aactcggcgt aaaaatggga cgaccgacaa aaatagcgga tattcaacga caagatatta      9360
     ttaagcgtcg ccaaaatgga gaatttttaa aagatatagc tgaggatttt ggaattagtg      9420
     ttgggacagt ctcacggatt acaactggag cagacagtca caaaagccgt aaaaacaaaa      9480
     agggttttta agaaataatt acgagcaata ttcctgtgtt ggctaccgac gaaaaaaagt      9540
     taaccctttt cggggggaga gctatttatg taccttataa attatagtca tattggtaca      9600
     actcagagtc acggtgtatt gtaaatatca gcggtaaatg gcactgaatt gcagtgctaa      9660
     ttggcgtgcc tggctcgtat cggagcaatc gggcgatacg ttggacggct acgttttccg      9720
     taggtcatgc tgccagaacg gacgtaacag gctgacgccc aagtgtccga taaacggttg      9780
     gtcgcgagat cgaaaacaga tcagccaggt cactgatgga atagtcgcca gtatcgtaca      9840
     tgcggcgaag ctccttctgc tgccgatcag acagcttggg ttttttcccg cgtagtttgc      9900
     ccttggcacg tgcgactgcc atcccttcac gggtccggag cttgatgagg tctgcctcaa      9960
     attcggcaaa ggtggcgaga atgttgaaaa acagtttgcc cattggatcg gatgggtcgt     10020
     ggacactggt gccaagttgg agcttcacgc cacgggcggc cagactatct ccgatagcgc     10080
     gcgcgtccgg cacggatcgg gctagccggt ctagctttgg caccaccagt gtatccccgc     10140
     tgcgcacagc cgccagcgcc tgatcgagcc ctggccgatc ccggttcgtg ccggtgaagc     10200
     ccttatcggt gtagatccga tcagcagaaa caccgagctt gagcagttcc tgtttctgga     10260
     ctgcaagatc ctgtttgtct gtcgagcagc gggcataacc gatcaatatg tgtgtcatac     10320
     gggaaagtgt aacgtataag gccccgtgac tgcaaattat atggtaccat tcatatgaga     10380
     ctcagcaacc ggctgtttcc cgtgggttgc gtgaccggtg ggagcaagtc cgttcaatga     10440
     tcctctatcg gacaggggcg atcaccatgg cagatgatcg agtgctagga accgacagca     10500
     ccgaggtagc aatgcgtatg gccgtgttgc gaccatatct gattgataac gtgccgttga     10560
     cgaaaattgc agtggatgcg gccatcccga tccgcacagt ccggcgttgg attgcacgct     10620
     accgcctttc cggtcccgct ggtctcatgc gtccgacgcg acctgatgcc ggtacgcgca     10680
     cctttcctaa ggaaatggtc gaactgattg agggaatggc acttctcaag ccacagtcat     10740
     ctattgcaac tatccatcgg cgtatcgtta tgctggccgc cgagcaggga tggcggaaac     10800
     catcctatgg gagcgttcgg agtatcgtgc gcgaaatcaa tccggcaata ctgaccttgg     10860
     cacacgaagg gagtgcagcc ttccgggaca aatatgaact ggtgcatcgc catcgggcct     10920
     ctcggcccaa tgccacatgg caggctgatc atacccagct tgacatcctg atcctggatg     10980
     ctggcggcaa ggcagcgcgg ccatggctga cgacggtgat ggacgattat tcgcgggtgg     11040
     tcgccggcta catggtgatg ctgggcgcac catccgcgct caacacctcg ctcgcactcc     11100
     ggcaagcgat ttggcgcaag gccgatccga tgtggccggt atgcggcatc cccgacgttc     11160
     tgcacgtcga tcacggatcg gacttcacca gccttcatct cgaacaggca tcggctgacc     11220
     ttcacttccg tctgatctac tcaggcgttg cccgtccgca aggtcggggc aagatcgagc     11280
     ggttgttccg caccatcaat accgagttgc tgccggagct tccaggcaac ctgcggaacg     11340
     ggaaaccgtc ctcgccacct cgcttgtccc tcgccgaact ggacgccacg atcggggatt     11400
     acatcgtctc aacgtacaat actcgaccac atagcacgat cggggtgccc cccgccaaag     11460
     cgtggtgtgg cgatggatgg ctgccccgta tgcccgagac cgtggacgaa ctggatacgc     11520
     tactggtcat ggttgctagg ccccgcacag ttcatcggga cggcattcgt ttcgaaggac     11580
     tgcgatactt tgatccgaca ctcgcagcct atgtcggcga gcccgtgatg attcgttacg     11640
     atccccgcga tatgggtgag atccggattt ttcaccgcaa tacctttctc tgccgggccg     11700
     tgagtgcaga ccatgccgga gacagcatca ccctgaaaga catacagact gcccgcatag     11760
     cccatcgtcg gcatctacga aaccagattg cagaaagaaa ggcccgtgta gccgactttt     11820
     tcccctctcc tgtctttcgt cccactcagc cagcggtgcc ggtaacattg tccggcactg     11880
     aagccaaagg acggcagaaa gggagacgtc tgcgcattta cagcgagggg gactgatgcg     11940
     gacagcacgt actaccagct tcatagcgac ccaggagcat cgtcgcttca gtgagtttgc     12000
     agatgccgtt cgcaaacatc gctatattgg cctgtgtcat ggacctgccg gggtcgggaa     12060
     gacgctctct gcccgtcgat acacccattg gcacgtagtt gggaaaacct tggaggaatg     12120
     gggaccgcgc ggatcggacc aagcaaaggt caatgctcac ctcgcaaaat cccgagccat     12180
     cttcttcacc cccacggtca gttgcagcgt gcaggagttg agacatgacg tgccggcact     12240
     tattgcctgt gctgagatct gcattgatga tcatgtacgc ccccatatcc aaggccaagc     12300
     gaggatcatc gaccacacga cccgctatat cgaactgcta atcgtcgatg aggcggagcg     12360
     gttaagcatg acggcgctgg aatggttgcg tgacctgttc gatcgacaag gtatcagtct     12420
     tatcttcatc ggtatgcccg ggattgacaa acgaatggcg cgctacccac aacttttcag     12480
     tcgggtgggc ttttcccatc attatagacc cctccaagag caggaactga catttgtgct     12540
     gacaaggcgt tggcgcgacc ttggtctttc actcgacggt gctgatttta ccgacgctca     12600
     ggcggtcgct gcgatcgtgc ggctgaccgg gggtaatttc cgactgttgc atcgtctttt     12660
     tgtccagatc gaacgcatca tgcgcctcaa cgagctgacc gttattactg aagatgtggt     12720
     cgaggctgcc cgtagtaccc ttgtgatcgg tgtcacttag cactgacagt gcctgccatc     12780
     tatcgctgat atttacagta tcaagggttg catggtggtt tttccgggag ggttcaaatg     12840
     ggacagcgcg cggtcatcta ttgccgggtt tccacggccg atcagtcctg cgcgcgtcag     12900
     aaggacgagc tgaagcggtt tgccgaacgc gcgggctacg aagtgctgga tgttttcatg     12960
     gagaccggct ctggcgtccg ggtggatcgg gccgagcgtc gcaatgtcat ggcactggcc     13020
     caggcccgtg aaattgatgc cattctggtg acggagctgt cccgctgggg gcgctcgacc     13080
     attgatctca tctccacgct tcaggagctg gagagctatc gtgtttccct gatcgccata     13140
     acggggatgg cgttcgacct ggcgacgcca catggacgga tgctggcgac ggttctggcc     13200
     gggatcgctg agttcgagcg ggatctgatc agcgagcggg tgaagtccgg tctggccgct     13260
     gccaaggcgc gcgggaaggt tctcggccga cagaaaggag agcggccgaa gtctgaccgt     13320
     ctggctccga aggttctggc gttggtggct gaaaagcgga gttatcggtg gatcgcccgc     13380
     gatctgggaa tcagcaagaa cactgtcgct gccattgtgc agagagatca ggtgaggcct     13440
     tctcttccct cgtagaaagt gtatacaggt ataagattat acgtgtagag gtgtagcatg     13500
     aaggttctcg ctgttctttc gcagaagggc ggtgtcggaa aaacgacgct tgcaacctgt     13560
     ctcgctgtcg cggctgagca agcgggtaag gttgctgcta ttattgattt ggacccacag     13620
     gcgacagcct ctttctggaa agacgtacgc cagctcgata cgccggctgt ggcttcaatt     13680
     cagccgatac gtttgcctgc aatgctcaaa gcctgcgcgg atgcgggtac tgatcttgtg     13740
     attatcgacg gagctgctgt tgcgcgtgat gtagcttatg aagcggcgcg gcatgctgac     13800
     ttcgttctta ttccgacgaa gacggccgtg ttcgatacaa tgagtatgac acacacatta     13860
     gatgtggttc gtcagctcga taaagcgttc gctgtcgttt taacttttgt gccccctcag     13920
     gggcaggaga caggggatgc cattaaggcc gtgaccgaat tgggggcaac ggtctgtccg     13980
     gtgacagtag gaaaccgcaa ggcatttttc cgtgcacaag cggcaggaca ggctgtgcag     14040
     gaattcgaaa cacatgggcc agcagcaaac gaaattaagc ggttatacga gtatacagat     14100
     atacaattat acaaaaatcg ggaagtagtg tgatggcgaa aagcaatacg ctacaagcga     14160
     tgcttgatcg cgccaaaggt agtggtgagg caatgccaac cccttccccg aagccagata     14220
     tatcatcccg taaacctacg ctgaatggtc gtaaggggac caagttgatc ggtgggcatt     14280
     tttctcctga agtcagcacc cagcttcgta ttatcgcggc ggaagaggga acgacggttc     14340
     agagtttgct tggagaagca ctggacgatc tgtttgtgaa gaaaggacga atcaggatcg     14400
     ttagcggtta agtatacacg tgtacaacta tacgcgtagg ctgtgtctag cgtatagggt     14460
     tgcgtttatg tcggttgcgg cagaatccga caaatgcggc actggggttt tgcaactctg     14520
     gttgtccgct atcattccac catgacaccc attcatcata gagtgcgtag acatcatatc     14580
     ctggagcaac tcctctagcg tcatggaaac cctcgggatc gacaaatggt ttctggagtt     14640
     ttggctctat taccttgacg gtatccatcg tttcccgatt acggaaagta actgtgttgc     14700
     tgtttatttc aacagcataa tcaggcaaat ggttattgat tgccaagtca cggagcattg     14760
     agcgaaatac gcgaatatgg ctactggccc ccgttttttt ctgtaaaatt tctatagaaa     14820
     caacccattt ttcctgagcg ccacaatgct tgcgtgcaag ttcgtatatt ctccgttcaa     14880
     gtggtttgcg taaacgaaaa taatcgcgat gtaatgtcag tacacttcgg ccttcgatca     14940
     ttctgaacag ccattcggat agcgttacct tgatttcgga catttgtccg gaattggtct     15000
     tacggacaat tcgccattca ttgataaggc caaagccttc ggtgacttct tctccatcag     15060
     ctttgatgtt ggtggtgatc cgtgtgcctg ctaagcgctc aaatgcgctc cgaagccgct     15120
     tatagccatc accatcggtt tgacggttgg tccacaccaa taaatcgcgt gcggtaaggt     15180
     ggagagttcg atttggcagc tcaccttgat tcattttcgc gataagctgc gaaatgcaat     15240
     agataaggat atccttatca tggatcgtcg cgagcccttt gatgctcgga acgatctcaa     15300
     ctgtattgcc attgtgctcg tatcggaaaa tgcgtcgatc aggtttagtg gcaagcgaga     15360
     aaattggatg ttccatcgag gccatatcat ctttggggat ggcatcaagg acatcacaaa     15420
     taaaaagatc tggtgttgga tatcgttccg gaagaagaac tgaacgccca tcaacattcg     15480
     gggtttcact gacgataagt gccagttcgg ggtttcgctg acggtctggt ttgattcggg     15540
     gtttcattga cggctagttt agattcgggg tttcgttgac gcaagagata gattcggggt     15600
     ttcgttgacg cagattcggg gttctggagt cactagattc ggggtttcgt tgacgcaagc     15660
     gacccaaaaa cagtgttttt ttgttgtatt ttcagatggt tatgtgtctg tggaaaaccc     15720
     ataacactac ttttaacaca ttagttaaca cactaagcct gtggataact ttccattgct     15780
     tggaatttct taccaaattg aacccaagcg ccgcctctcg ggggcggagc ccccgccggc     15840
     tcgcggccta cggccgcccc aatcgcgcat agcgcgatct cccccccggc atccccctgc     15900
     tcgccctttc agggctgcgc caaacggaca cgcctacggc gcgaaatcat aatctgacga     15960
     tgcgttaccg tatcgtctct ccaccagcac cttcctctcc cgcgtcggcg ccttcggcgc     16020
     cctacggagc tcccgctccg cgctcgcccg acgcctgcaa caccagaaga accgggcaag     16080
     accataatct gctcaagacg caccggtgtt caggcgatca ttcagcagct cacgtgttgc     16140
     aacatacccg tcagacgcca caggatggcc gtacaggcgt tcccgtgtgt ggtggctggt     16200
     ttgggggcag taacgggaat tgcgctttgt gcggcctccc agggcgctct gcgggtcttg     16260
     ccggggattg ataggctggt catttcctgt tcgtccgtcc agatatcctc ctcctgactt     16320
     tcagcgggat ggttctgatt gaaaaaccca agcgttaggg atatggtgca ttatgccgac     16380
     gcttctacgc atcaatgaat tttgtgtcgt gatttacacg gcagatcatg tgcccaatgc     16440
     acgttcacgt tataaacgcg gatggagaag cggtgatcga aattggcagg aaagcccgcc     16500
     tgatatgggc aggtggcatg aaagataagg tcatacagga agcccttgtc atcgtgcagg     16560
     accacgctga gatgctggct gaagcatggg agacgataca tggcgaatga catgaactat     16620
     cagaccgctc gtgaagcaga cacgcttcat cgagcaacag ttcctcatgc ggtctccgca     16680
     cggttgatcc gtgcgcgccg cgcccttcat gtcaccctct ccaacggtgt tgaaatgagc     16740
     gtgccggtgg atctgctaca ggatctgcac ggcgcttcac tgaatgatct ggccgagatc     16800
     gagatcaccc cgctggggaa tgaccttcac tggccacgtc ttgatgctga tgtcctggtc     16860
     gaaggtctca tccacggtat ctacggttcc cgaagctgga tggcggcaca gatgggacgt     16920
     gtgggcggat catctgccag tcccgcaaaa gcggcggcgg ctcgccggaa tggtgcgaaa     16980
     ggcggtcgcc ccagaaacgt cgcgtaagga agactgctga tcactgtgag ctagacaggc     17040
     cggtgagcat ggtggttgct gaaactgcaa aaagttatta cattagtaat aacattaggg     17100
     ggattcacta tggtcgagct gaaagtgcga aaattcggga actcactcgg ggttgtactg     17160
     cccaaggaag tgatctcacg gctgaacacc caggacggcg cgcccctgta tctgaccgaa     17220
     gcaccagacg gcggatatcg gctcgtgccc tatgatcccg acttcgaaag caaaatgaca     17280
     aaggctgaag atattatgcg gcgctaccgt gatacgctgc atgttctggc ccaatgacag     17340
     tcttcgtctg gatagacgaa cgcgaagccc tgatcctgca tgaccggctg ttggggctgc     17400
     atggtggtgc ttccggctta cgggatgcag gtcttctgaa atccgcgctt gcccggccac     17460
     agcagcatgc ggcttatgcg gatccgctgg atccagtgca tctggcggcc gtctatacgg     17520
     cgggtatcgt caaaaaccat cctttcatcg acgggaacaa gcgtacgggc tttgtgctcg     17580
     gtgtgctgtt tttggaactg aacggctatc gtttcacggc agcccaggaa gatgcagcaa     17640
     atgcggttct cgcgctggcg gcaggtcaga tggacgaact gggctatgcg gcattcctga     17700
     ccgccaatgt cgcatccgaa agggtatgac ggtaaacgag gaacgcgatg agtgtgcttt     17760
     tttcgtttcc tgaggtggtt ctggcgacag ttgtcttgat ggaccagact aatatgacta     17820
     agtctttttt ttgagtaaac tccggaggct ttcgccatgc gcacggtcaa catccacgaa     17880
     gccaagaccc atctgtcccg gctgattgac gcggccatga aaggggaaag cttcatcatt     17940
     gccaaagccg gccggccgat ggtgcgggtc agcccgatta cggctcctga agagttacag     18000
     caacggcgtc tggggtttct tgctggaaaa atccgggtgc ccgaagattt tgatcgcatg     18060
     ggacaggacg atattgtgtc tctgttcgac ggtccagcat gaggcttctt ctggataccc     18120
     atctgctgct ctgggcagcc ggagagccag ataagctgtc agcacgggcg agaaccctga     18180
     tggaagatcc gggcaatgat ctggtcttca gtgcggccag tctctgggag atcaccatta     18240
     agaccgggct gggacgggca gacttccagg tcgatcctca tctgctgcga cgcggtctga     18300
     tcgaaaacgg ttatgaggag ttaccgatca ccagccagca cgccttggca gtcggacaac     18360
     tgccagatgt gcatcgggat ccctttgatc ggatccttgt ggcacaggcc acggtggaag     18420
     gattgcttct gctgacccat gatccgctgg taaaggctta tccaggcccg atcgaagccg     18480
     tctgaaggag atcgaccaaa aaataggtcc atgccctcgc tgcacagtga cgaagcggcc     18540
     gaggatttcg tcgcgaccgt cgatctgacc cggtatgacc tgtccggttt caagcccatg     18600
     cgctgtgaga tcgaacccaa ggcggccgcc ctcaacatgc gcctgccggc gtccctgctg     18660
     gagaccgatg tcgcacagac gcggtaaagt atattccgac cagaacagag gagatcgggc     18720
     gatgtaggta cgctcggaaa tcactctgcg cgtcatggag gggaagctcc catgtctcgc     18780
     acctatcatc acagccgcaa atacggtcgc aatcatcgct gggccaacca gccggatcgc     18840
     tgtggctatg gaggctcacg tgaagcctct gaatctccta actggtacag tcatctgcac     18900
     gatatccgtc ctggccgtca tcatgacagg catgttgccc gcctgatcat caagggcgac     18960
     ctcgatcctg tcgaggcggt ctttccgtat accggcaccc ggcgacccca cgaatattac     19020
     tggtaatctt cagcgcggga atgagggatc gttcccgcgt tccacgaggc catcagggac     19080
     gtggatttcg gggaggatcg ttcacgacac caacaccctc atcaatccgt ggggcgaggc     19140
     gtagggaggg tgtcaatggc cgcctgaatc cgggccagtt cggcgtccag aagagcaaga     19200
     acctgatcgg ccgggacagt gggtttcgtg ctgttgcttg ccttgcggat tgcatccctt     19260
     ttggcagccc gttcgtcgga aaggtccgtc atggtcatgt cttcatcgcc tcgtgtttcg     19320
     tggcagcgac aggggcagaa atccgccatg cgtaatcgca gacattatcc agcaattctg     19380
     ctcgttgtgt ctgactgtaa gctataacga aatcagcgac aattttttct ggcacacctt     19440
     cccgaagaag gttggcagcc gtttccgcta tttccagatt gaccgcctca ttgagcaaga     19500
     tgaaggcatc cgtatcggtc atacgctttg ccgcccgtgc aacgaaccga gcattcagat     19560
     tccacatcca ttgatgacgg ttgattgtat cagaaaacca ttctggagaa gggtattctg     19620
     gagccattag gtatcctctt gaagtgtttg tggcggtcag tttccagacc gtcaaattgt     19680
     tctgtggccg agattacaat ctgtccgttt cggatgatcg tgttttgcaa tcagtcatgt     19740
     tccctgtgcc tgtcgaaggc atgaagcccc gcgcgtctcc atcgtgattt aaggtcgtcc     19800
     ggggtggtct catttccctc ctgaagctgt cccgcaatat ccagaaaggc cccgagcagg     19860
     gtggcacggt catcatcggt cagatcgacc agccctgcct tctggaccag gcctcccagt     19920
     tcgatcagat gatgggtgcg ttcccgtcgc gccttcgccc agtcgcgcat gtcggtgcgt     19980
     gcctttcgtg cctgatggcg atggatcagg gctgtctgct tcctgatccg tctttcaagc     20040
     gccagcagat ccgttctgat cgtttccggt tcctttccgg ctgccctttt ttccgcctgc     20100
     ctgaaagaac gccgctcccc gttcggtcca cctcgcgacg gcttcgggtt tactatccgc     20160
     ctgttcaaca gccgcaagca gaacaccagc aagagcctcg atcgataagg tatcggctcc     20220
     tgtcgcctcg accagttcac cgaactggac aattctcttg gcctttaacg cacgtgcccg     20280
     tttctgaagt tcttctagtt ccgcatctat gtcccgtggt ttgcgcatta tcgatccctt     20340
     attcttctgg tctgtggcat actttatcac acaggcgaga accgcgtcac tcatccagag     20400
     taatcaatcc ttgtggcgca gtaaaatatg agtgcgcgct tatacgtcac tgcgtgacgt     20460
     gcgcttaaat agtgtgatag gatcgcgtcc atggcgatct atcacctaca tgcaaaggtc     20520
     atcagccgcg ccaccggccg gagcgccgtg gcagcggcgg cctatcgcgc ggcgtcccgc     20580
     ctgcatgatg tgcggctgga tcgcgaccat gacttttcca acaagagcgg cgtggtgcat     20640
     tccgagatcc tgctgcccga tggcgcgccg gaacggtttc tcgaccgtgc gaccctatgg     20700
     aatgaggtcg aggcgatcga gaaacgcaag gatgcccagc ttgcccgcga ggtggagttt     20760
     tcaatcccgc gcgaaatgac ccaggcgcag gggatcgcgc tggcacggga tttcgtgcgg     20820
     gagcagttcg tggaacgcgg catggtggcc gatctcaatg tgcattggga tattggtgag     20880
     gacggacagg cgaagcccca tgcccatgtg atgctgtcca cgcggtctgt cgatgagaac     20940
     gggtttggtg caaaagagcg gtcgtggaat gacaaagaac tcctgctgac atggcgggag     21000
     cgatgggcgt cacttgccaa tgaacggctg gccgagctgg acctagacgt gcggatcgat     21060
     catcggtcgt tcgcggcaca ggggattgac cttgagccgc agaacaagat tggtccggcc     21120
     gggatgcgcc gggaagagcg gggcgaggat gcggaacggg tcgctgatca tctggagatc     21180
     gcgcgacgca atggggaaag gttgctggcc gagccgcatg tggcgctgga ggcgctgacc     21240
     cggcagcaga gcacatttac ccggcaggac atggcgcggt ttgtggaccg gcagacggtg     21300
     gacgctgaac agtttacggc cgtcatggtt cgggtggagg cgtgtccgga gctggtcgcg     21360
     ctcgggaaag acgggcacgg gcgggagcgg ttctccacgc gcgcgatgat cggggtcgag     21420
     cagcgtctgg aagaagcgtc gctcgcgatg gggcagtctc aggggcatgc ggtgccgctg     21480
     gcggtgcgtc gggcagcgat gcagcattcc ggtcttggcg aggagcaggc gctggcggtg     21540
     ggcgaggtca cgaagtcccg cgacctgtcc gtggtggtcg ggtatgccgg gacggggaag     21600
     agcaccatgc tgggtgtggc ccgtgcggca tgggaagagg ccgggtaccg ggtacgcggg     21660
     gcggcgctgt cggggatcgc ggcggaaggg ctggaagcgg ggtctgggat tgagagccgg     21720
     acgctggcgt ccctggagcg ggcgtgggag cgagggttcg acttgctgga gcgcggggac     21780
     gtgctggtgg tggacgaggc tggcatggtg gggtcacggc agatggagcg ggttctgtct     21840
     gtcgcccgcg aagccggggc caaggtggtg ctggtgggtg atcccgagca gttgcaggcg     21900
     attgaggcgg gtggtgcgtt ccgggcggtg gccgagcggg tcgggtcggt ggaaatcacc     21960
     accgtacgcc ggcagcgtga aggctggcag caggcggcca cgaaggagct tgcgaccggg     22020
     cggacagagc aagcgctggg acgctatgag gcggctggcc tggtgcgcgg gcatgacacg     22080
     ctggaagagg cgcgggccgg ggtcgtggcc gggtgggagg aagcccgtca ggctgcgcca     22140
     gaagaaagtc agatcatgct ggcgcatcgg cgtgtcgatg tgcgggcgct gaacgaagcg     22200
     gcgcgcgaga tccgcaggga cgcgggtgag ctgggtgacg acgtgctggt gccgaccgcc     22260
     cagggcgagc gggtgttcgc gaacggggag cgtgtctact tcctgcgcaa tgaccgggag     22320
     ttgggggtga agaacggcac actgggcacg gtgcggagca tcgtggggtc ggctgaggct     22380
     ggggatctcg caatgtcagt gcaactcgac gggccgggtg gtgccgggac tggccgggtc     22440
     gtgtccgtgt cggtggcgga gtatgacgcg ctggatcatg gctatgcggc caccatccat     22500
     aaatcgcagg gtgtgacggt ggatcgggcg catgtgctgg cgacggggag catggatcgg     22560
     cacggggcct atgtggcgct atcgcggcat cgggagagcg tgtctgtgca ttggggccgg     22620
     gatgatgtgg gcgaccggga cgggctggtg cggcggctgt catgcgagcg gctgaaggac     22680
     accacgctgg attatccgca tgtccgggat cgggataccg ggttcgcgcg gcggcgcgga     22740
     ctgcatgtcc ccgagagcga gatcgtggtg gagcgtgaga aggccgcctc tggcccccgg     22800
     caggacaggc aggccgaagg tgtgcctatg ccagatcctg cgtcggcaca gcaaaaacgc     22860
     gggatgttcg atggactgga cctgtccgtg cggccggggc gttgcacgac ggaaaaagac     22920
     gtgtcggccg ggctggatgc cggggccggt aagggggaaa gtgggattga gcgtgaggct     22980
     cctgtctctc cctttgcggg tttgaggcta ccgcgtgtgc agcgcgagca ggtgccggcc     23040
     gggctggacg ggtttgtgcc ggggagtgac ccgctgcatc aggcggtgga gcggtatgcg     23100
     cgggcctggg tggatgccga gcgcatggtg cggcaggaat tgccagtgct ggagcaccag     23160
     aagaaggcgc tgcttgaggc cggtcgggat ctggaacgga taaggcgtgg cggtgaggcg     23220
     gatctgcggg cggcgctgaa gcatcagccg gagatccggc aggcgctgta tggtctggaa     23280
     ggtccggcac gggcgcgcaa actggtcgag gggctggagc atgaggacag ggtgcggaag     23340
     aggccggatc tgcgggcggc gcggtttgtg aagacgtggg acggattgag ccgcgagcag     23400
     cagggtgtgg cgttcaagga attgaagcgg gatgcgcagc ttgagtccat cctgcgggag     23460
     aaaagccgcg agctgggtat taggaaggga tcgacgctcg atcacgggtt gcatccccat     23520
     cagcgggagc aggccctctc acgctccagg tcgcgcggta tggatatggg gatgtagaat     23580
     ttttctggaa agatatcgct tttatgttta tgatatcatt ttaggaaatg aggagctctg     23640
     tcatgtcctc tgtggttatt cgcaatcttc cggaagagac acatcgggcg ctgaaggcgc     23700
     aggccatgct gcatgggcgc agcacggaag cggagatccg gaccattctg gaagcggccg     23760
     tccggccgcc gcagcgggtg cggttgggct cgctgctggc ttccatcggt cgagaggccg     23820
     gtgtgcgtga acaggatgtc acggccttgc aggttcgcga tcagaccccg gccgagccgc     23880
     tgtccttcga atgatcctgc tcgataccaa tgtgatctca gagccgtgga agcctgtccc     23940
     ggagccgcgt gttctggcct ggatcgatcg acaggcgatc gagacgcttt tcctgtcggc     24000
     cgtcacggtg gcggagctgc gtttcgggat tggggcgatg ccggctggtc ggcggcgttc     24060
     ggtgctgcat gaacggctgg aacaggaggt attgcccctg ttcgcggggc gcgtcctgtc     24120
     gttcgatctg gcggcgtctc aagcctatgc cgaactgatg gtgcgggcca ggtcagaggg     24180
     gcgggcgatt ggcaaggcag atggctatat tgccgcgact gccgcatccc gtggttatgt     24240
     cgtggccagt cgcgacgtgt cgcctttcga ggcggctggt gtgcgggttc tcaatccgtg     24300
     ggaggatacc tgatgtccga gacagatccg gcggcgcgtg cgtttgagga tctgtgcgcc     24360
     gaaatgacgg tgctccggcg tagcgtggaa gcgttgcccc aggcatggcg ggataacagg     24420
     ccaccggatt acacggagga tctggcccgt gtcgtgaagg ccatgaatgc ggtcgggatg     24480
     catatgaagg cgattgacgc ggatttctca cacttgaggc aatttcgggt tattttgtag     24540
     aattcagtca taccacagga gcccgatctg gaatattgac gatattgtgc ttctggcggc     24600
     gggttctgaa cgcagtgagg gtgtcacggc ctgagaaggc agtgttggtg gaagctatgt     24660
     ggtctgtgca ctgtctgttt cttcagatgg cctgccggag ccttcgcaat cgtgcatgag     24720
     cgagggcgaa ttcatgctga caggggaaca tgtccggcat ggacaggaca atccgacgga     24780
     cgctgagcgt tacacgtgtc gcgattttga gcagtcgtgc gcgtatggtg ccacaggtcg     24840
     ccgtctccag gctggtctgg ccaagggcca gtctttgcag agcggtcagc aggacatagg     24900
     ctgcggccga gaaccacagc cggagctggt tggcccggat ggtgtgggac gaggtcctgt     24960
     ctgagaacag atccatctgg cattccttga tgcggttttc catatccccg cgtgcgcagt     25020
     aaatctgttc gtagagatgg cgggggtcgg acattccctg cggtagggtg gtgacaatga     25080
     agcgatgata gcggttgccg tggcgccatt cggccttggc cacgacccgc ctgcggcgcg     25140
     tccagctgtc ctttgtgatc cagtcaaagg aggcgaaacc gcgcgcagct ctgcctgtcg     25200
     tggcggcttc gtcacgaacc tcagcggaca aagaggcaat ccggtcatac aggcgggtgt     25260
     tgcctgcaag cccgaacagg aagtcaacgt ggttgtcttc gcaccatgtc atcagactgt     25320
     cccgggcgaa accgctgtcc ccacgcacca ggatacgcac ccggggccag cggttcctaa     25380
     tctgctccac gatccggctg atgtctgcca gtgcttcgtt ccccgggtcc cggtctgccg     25440
     tgcgcagggt ggcgctcagg agatgatccc cgcaaaagat gtatagcggc agatagcagt     25500
     tatggccgta atacccatga aaggcacggc cttcctgatg gccatggata cggtcatcgg     25560
     tggcatccac atccagaacg atgcgggcgg gtgcgcgctc atgctggtcc agaaagagcg     25620
     tgacgaacag ggtcgccagg gcctcatgat cagcaatgat ccggcagtaa cgatctgcct     25680
     tgtgcccact gcgctccaac cggttcagtg tagatttgcc agccaatgct gcgcagtttg     25740
     cccggcctcc tgacagacgg cccgaggcca gaccaaagat caggtcatgc cgcagggcat     25800
     cgtgatcatt gagatcttca tagcccagtg ccaggcccat gatccgctga cggacaaggt     25860
     cttcaacccg gtattccaca aaggcaggat gccgcttatc gcgaaaacag gcagcaaagc     25920
     ggcggctgag acccagaatg tcatcagcct gcttcaccag aatgacgccc ccatccgaac     25980
     tcatgcgacc cccgtcaaaa cgggccacaa cacgccgtcc acaggaggct ggaaactcat     26040
     acgcgcctgc gctacactct gtctgcatcg ggttttctta tagcttacga aaatttcttt     26100
     tgtgcaaaac agactttttc ataatctaac ccgatgtaca acccttctgt gagatttccg     26160
     cgtcgagttt ccagaccacc agcgtatccc cttccttgag ccaggcgagg cacgtcttga     26220
     ggccagggcg atcgtcgcgg gcaccagagg ccttgtcgga atgaatgtgg cgtgcatcga     26280
     cgccagccgc gatcagcgca tcgcgctgga gatccactga ctggcgttcg tcggctgagg     26340
     acactcgcat ataaccgacc agcatgtacg acaaacctca tcagaagagt ttccgcacag     26400
     taatgcaaag cgacatggtt tgtcgtgcag tttttgctac cttggcggct atcttttccc     26460
     ggcaagaaaa aaatgacgga aaacacctgt tttccgtcat ataccctcag catccgacct     26520
     tagcgtatat ctgtgcccgt tctatgtacc gaccccttgt tggtgatctg gctaatcacg     26580
     aacgccatag gcacaacacc gcgcagctga cgaatgaccg gccccaccgc gtccagatcg     26640
     tccggcgtag gcttggtggg tatcacggcc atatctgcct tgctggcaat cttccgcaaa     26700
     gcgtcatggg tgcttggcgg cgtgtcgatc aggacaagat caaacttacc ccgtagcttt     26760
     tccgtcatgt caggcagatt ttcgggtgat aactggatta gtttagggcc agcgtctggc     26820
     gtggctgccg tccttctgtt ccaccaattc gttagactac cctgtgcatc aaggtcgatg     26880
     atagcaaccg attttcctgc atctagtgcc gacgtagcca gttcgcgggt gagtgttgtc     26940
     gcacctgaac cgcctttcag ctttgagatg accacaatct ttcccgtttt catggtttcg     27000
     ccttttcggg tgaatgtgtg ttcatgtgtt caatatcctg ttgagccggt aggcgaataa     27060
     agcaggcgtg atgtcacgtt acggcctgcc gtgacgttac attacctgtc ctgcccacaa     27120
     ctaacatgat attcttacgc cataaaaaga gacatacacc tgcaaattta gcgcaaacct     27180
     ttcgacaatc tccgacatat gtgctgcgaa ccttgcagca accttgaacg aactttcgat     27240
     acatctgttc gggctaagta aggccgagtt tatacccgtg cggtctcaca tgctccctat     27300
     tcctgagcca tacggtgctg gtttttggtg tgttggaaga agtgagacta ggtgctgccc     27360
     cgatatccta tgctctcaca ccatcgtatc aggtcattat gtgacattcc ggcgcctgaa     27420
     agcggttctg tattaaagaa attactctga atatgaggtt cgctgtcatt ttggcactta     27480
     gaaagaaacg cctgtttcct gcggctaagg gcttcacgta gctgttgcgt ataatgtacg     27540
     gcggcggctc tggcttgctc caatggcttg atgatcagac gataacgatt aacgccgtta     27600
     cagacgcgcc ctgacaccct ctgacgttgc cgcgtccgtg tgactatgcc cagccggtaa     27660
     gcggcctcta aggcccgtat aacggttcta acagagcaac cagatcggga tgcgatgctt     27720
     tcgtgcgacg gaaagagacc acgatatccc tgaaagctgg cgagcgcctg caagacaagg     27780
     tgtgttttac ctgtgatctg acgagattgt gtgagtgtcc agagagtaga agcgaaagag     27840
     gtcacaacca aaagcctttc aaaaaggcga ggcatcctct ctcctgctga tctaaggctt     27900
     gaaaccggct tcggttatcc ttacaatatc agcattggac gcaataggtg ttccaccacc     27960
     tcttgcatca agtccacctc gccgcgctat agcgagtttt tgaagccctt ggagttagta     28020
     gctccaaggg cttcgtcgtt tcaggcatta tgtatctgcg aagatgagtc tggcaagagc     28080
     atcacacgcc aacaagcaca cgctccaccg cctgcggttc tttgtcgata agcatcagca     28140
     acgtgcgggc agccttttct ggcgtccggc gcttctgctc ccagtcacgc acagcggcgg     28200
     cactgaaacc atatcgcgca gcaaaacgca cttggctaag ccccgttcgc ttccgaatat     28260
     cagcaacatt gatttcagga ggcgtccaga tacgaccggg cttcacagtt cctgcggcaa     28320
     tacctacggc ctgctccatg gaggtaagta gttcatcggc aatattcatt tgctctgcca     28380
     tgttaagttc ctccttgatc tgatttcttt atgcgttcag ccatagaagc catggctttc     28440
     ttctggtcag gcgtaagatc gtcctgttca ttcttgccgt agatcaacaa ggcataaaca     28500
     ggaatccgat cactcgcgac ataccagatg acccgaacac cgcccctctt gcctcgacct     28560
     gacccagcaa accttagctt tctaacgcca ccagttccgg ggataacgtc accttggcgt     28620
     gggttctcag caagcagcct aatgagttct gcccgttctt cacggctcaa aagagcatct     28680
     gccctcttgg taaagatcgg ggtttctata actgaatgca taactcttta tgcggcattg     28740
     ccgtattttt agcaagagat gataatgaaa gcgtctccag cgggacaact tcatagcccg     28800
     tatgttgtca catctgaaat ctcccggaaa aaccaccatg cagcccttga tacaccgtgg     28860
     ctccggtctg tcccaatctg actatgatct gaaaggtcac atcatgagca agtcttcgtc     28920
     tccttatgtg cgtcggttgc tctggattgt ggcctgtttt gtgggtggtt ttgcgctttt     28980
     gtgcgtgagt ggctgggcgc ttgtcgtcaa cggcagcacg caggactccg cgatggtgac     29040
     agtcctccgc tggctgcccg ttgcaacggg tgcgatcacg gtagccgcgg gatttttcct     29100
     gctgtttctg cccgtgccag aagacccgga agacttcttt ctgccggatg acaccgacgg     29160
     cgaacttgag agaacagacg ggaaataaaa agaggttcag cccgttatca gagctgaacc     29220
     cttctcgccc tgaccgtcag tgtgaccgtc aggctttgac ggacagaaag tcagccaacg     29280
     cttcgttaaa cagaagcggg gcctgcagga aggcgaagtg gctggtctcg ggcaggatca     29340
     tgtaagaact gtccggaata tgcgccacca gatattccag atgggcgcga tgaatcatct     29400
     cgtcccggtc cccacccaca acccatgcgg ggcagcggat ggcgttcagg cggtcttccg     29460
     tgaattcggc atcatgctcc catttccaca ggccccggag ggtttttgaa aagacatcaa     29520
     atttatccgg ggtcggggaa agctcgcggt agtcttctgt ggcgcgcttt acaaaagcgt     29580
     tgaccacctt atttccgcta cacgccagat tgaggccgga tgcggacata tgcggcccgt     29640
     aagcaaagat gcgtttgatg cgatccgggt gttcagaggc cagaataatg ctctgcacac     29700
     cgccatcgct ccacccgacg agactggcat tcggaatttc cagatggttc atcaggtgaa     29760
     tgatatcgtc tgccatctga gcgtagctga ggggtttatc ccctaacgtg ctgcggccat     29820
     gcccgcggct atccacgagg atgacacggt gcgttttggc cagataagcc gcctgtatgc     29880
     cccagtagtc agagtttgcc atgcccccat gcagcatgat gatgacatcg tcccctgtgc     29940
     cgccttccgt ataatagagc gagcatccgt taatgggggc gtgctgtcct ttaaaggagg     30000
     ccagaggggc cggggtggca ggcagggtct gccagcgttt tgttaaatgc tcagtcatat     30060
     cgtcaagcct cgtaaaagag cgtgttgtgg gtaggtaatc cccccatttt tagtggggca     30120
     ttgaatgaga attcaggcag ctgtttttag tttctgggcg ggggttagcc cgctgttccc     30180
     catgttgggt ctgtcatggt tatatgtcca gagccattgt gttgcgacct cctgcacgtc     30240
     ctgaatgctt tcaaacagat actgctccag ccattcctgc cggacagttc tgttgtagcg     30300
     ttcaatatag gcgttctgct gcggattacc cggttgcgta tagatcaggg taatcccctg     30360
     tttttcggcc catgaaacca acgtatgact gacatattca gggccattat ccattcggat     30420
     ggcttctggc ctgccgcgcc actccataac ctgttccaga cagcggacaa cccgacaggc     30480
     cggcagggaa aaatcaacct cgatcgccag tccttcacga ttgaactcat ccaggatgtt     30540
     caggagccga aaagcacgtc catccaaaag cctgtccgcc atgaagtcca tggaccagac     30600
     cgtgttggga agggccggaa ccgacagctt ttcaggcttt tcgcgaacaa gacgcctgcg     30660
     gggtttaatc cgcaggttga gttccagttc ccgatagatc cgataaaccc gcttatgatt     30720
     ccagacatgt ccctgcacat tgcgcagata caggaaacac agaccaaatc cccatctcct     30780
     gtgagcctgg gtcagtccca caagaagatc ggcaatcctg tcattctccg ctgccagtcg     30840
     cggacgatag cgaaagcagg tctcggatat cccaaaaatc cgacaggcca gcgcaatgct     30900
     gaccccatga tgcgccacag cctgtgcggc cagttcccgg cgctgggctg gccgcttcat     30960
     ttttttccaa gggcttcctt caggatatcc gtctgcatgc tcaaatccgc atacatgcgc     31020
     ttcagccgac ggttctcctc ttccaaagcc ttcatctgac tgatcatcga agcatccatg     31080
     ccgccatatt tcgcgcgcca ccggtaaaac gtggcgttgc tgatcccatg ctcccggcac     31140
     aggtcaggaa ccgggacacc gccctcagcc tggcggatca cacccatgat ctgggcgtca     31200
     ctaaagcgat cactcttcat cagaatctcc tcaattctta cgctgagaaa attctcattc     31260
     aaaagtcact ctttttatgg ggggattacc gtatgtctca taagaggcgg aagccgacat     31320
     catatgccat tatgctttca ccaaaccaac cgtctttgga tcataaatga aaccatcaat     31380
     acttccatct gatattttat ccactatttg agacacgata tttatcggaa ccagaaacca     31440
     ctctttcgga tgcacgggat ggccgaaccg atcctgaatc gtcaggtcaa tctgtgcagg     31500
     ggccagaacc ctatgaaaga tcttctccag cttcgtgcga ttgatgttga agagcttgta     31560
     ggtcgccacg acttccacat cagccagaag ataggttgca tcgtgcttgg cgttcgcgat     31620
     cctctttttc acatcgcctc ccgtcacccc aattttgtgg atcagattac gatgctgcgc     31680
     gatatacggg ttatctgaca gacttctcaa aacatagatc gtgccacttt ccagatcatc     31740
     cggctcaacg gttgtcccga acaaaggccc gacagtcgga tctgtaatcc ggcgaccagc     31800
     ctcatcctta tagagcgccc gctggagcga cctcagcagg acatcgcttt cagtcccgtt     31860
     gtcatagatg acccgcagac ggctgtctct gcgaccgtat tctgtctcga actcttctcc     31920
     gacatgggca acgtaaacca tctgcccttt caggataaag aattctccct gccgaatacc     31980
     ggcttcctgc ccaaagggac gtgtttcccg cacgccggat ttcagatctt cctgcacctg     32040
     agcgaagaaa ggccggaagg tttcaaaatc cttgcaaggc tcccggctgg caatttcttc     32100
     cgctgcccgc acttctgcgc gtgatttcac atgcttcagg acagtgatgg attcagccgc     32160
     tggctcggcc tcaatgccca gttccgccag aagcgcatca tcgtccagcg tatcgggatc     32220
     aggactctca gcctccttcc cggaaacact cagaagccca tgcggatcgc gctgtgccag     32280
     caatgaccgg catttttcca aagcccggat ccgatccaga cgcacggcat aaagccgttc     32340
     aaagatatcc ctgtcctctc catgcgcagg cgcatgcccg tgctcttcat agaaacgaca     32400
     gatatcctca aacccggcaa taattcgctc ttcctcagcc gtcagcgcag ccttcttttt     32460
     ggtctcaagc gagacaccaa gttcggccag aagctcttca tcacttagtt cagccattcg     32520
     cccgttcctc tgccgtctta cgcgccagaa cagccacacc ttcagccatc ttacgttccc     32580
     acgcatcggg agatgtcagc tccggaaggc gtcccctctc ttttttgaac agaagggcgc     32640
     gcttcgccag gtcccttgcc tcttcaatcg tcagagcaat atgacgaccg gcaatgacct     32700
     cctgaacctg tttgagggtc tctgcattca tgcttttggc caggatcttg taggcttcct     32760
     caaacggatt gatcgcatca atcaggtcga tatccagatc ccggacattc atggcaatct     32820
     tccgcatccc ctcaatcaga gctgtattgc caccaatctt ctcctctccc ccggctgcct     32880
     gcgtgacctc ttcagctgct ttctgcccct tctgggtcag attgaatgcc gccacggcat     32940
     gctggcgcac agcctcctga tcctcatccg aaagctcggg ataccgatcg cgaatgattt     33000
     tccccagcct gacctgtgtc agttcctgag gggccgtctc ctcgtcaaac agaccatgct     33060
     ccagggaagg cttgtcctgc acaaaggacg ccacaacttc gttcagatct tcccgacaga     33120
     tccgctgcgc ttcagggctt ttgggagaaa ccagcccctt gatctccata tggaactggc     33180
     cggtctgcgc attgaagcca acattcgtgc cgtttggctt gtagccttct tctccgtagt     33240
     cataaccatc caaaggcgca ctttcttcgg tcttcggcgt aaactcgaaa cgtggggtca     33300
     gcacctgttc cataagcagg ctggcggcaa tggccttgag catgtcattg accgcatccg     33360
     tgactttttc ctgggacgca tccggttcag caatcaggtt gatgaattcg gcccgtgtct     33420
     taccaggcgc atcacgggta gcacgaccaa tgatctgaat gatttcggtc aggctggaac     33480
     ggtatccgac cgtcagcgcc tgctcacacc agatccagtc aaacccttcc ttggccatac     33540
     ccagcgcaat gatgatgtcc acatggtctc ggttgttttt ctgcgccgga tccttcagag     33600
     cagacacaac cttgttgcgc cgaacaggct catcttccac cagatcagca atacgcagca     33660
     cccggccatc ggtacggcgc accagatgaa agcccgtttc ttcatcttct ccttcccaat     33720
     ctcccaggac ggacaggata tgctcgactt ccttgtgttt ctgagtcgtg ctttctcgtg     33780
     aattgacatt gggaatatgc acgatcgttt tgcgcgtacc atccagcacc cggtcaatcg     33840
     catccagata ggaacccgta tagaaataat atcccagatc cagctctttc agatactgat     33900
     acccgttcag ctgctgatag taggtgtagg taactgtctc gaatttccct tcatcttccg     33960
     gggacagcac agcaacggca tccccacgga aataggagcc ggtcatggca atgatgtgcg     34020
     tttccccacg ggcaatcagc tggttgagat aatatcccag cctgtttttc gggtcggcac     34080
     tgacatggtg aaattcatcc accgccacca gacacccatc aaatgccgca atacccagtt     34140
     cttccgccgc gaaccggaat gtcgcgtggg tgcaaaccag agtctggtct ttgctcttca     34200
     gaaactcacc aacagctttg accttggagc gtgcgacctg tccttcatcg gaccctggtg     34260
     cgttgcacag attccatttc ggctggacga tccagtcggc ccagaagccg aatttgctca     34320
     ggggttcgtt catgaagctc cccccgatcg agcgttccgg cacgacgatc agggcttttt     34380
     tcaccccctg atgcgccagc ttgtcgaggg caacaaacat cagggcacgg gatttaccag     34440
     aagcaggcgg tgacttgatg agaagatact gctcgccccg tttctcatag accgcttcct     34500
     gcataggccg catgcccagc tcattggtcc tggcagacag ccctgtctgg ccggtacgca     34560
     gagaaacagc agggataact ggattgatcg tcatggctca ggcagcgtcc ttcttctttt     34620
     tcatcttgcc gcccttcttg gcgatcatct tgctgtagag gtcgaacagc ttttccagac     34680
     gctccgtatc attgcggaaa cgccgaccga tatagatccg ctccagcact tcatcattgc     34740
     ggtcatgagc ggcccgcaga ttgtctggca ttttgtcagg gtcatacaga tcggcaatcg     34800
     tggccgggaa atgcgcctca cgcgccagaa gaatgtcctc ggcacaacgg gtcagatcag     34860
     cacggttctt ttccgtcaaa gtcggaacag gaaaggtgtt ccagcctaaa gtattggaat     34920
     atgaaaaatc cgtacgcata cgaacgcaaa ctgtaccaat ccacacccaa tgaaggcgag     34980
     aggcaatcag cgccatattc cagagagggg catcgtacaa agcatatatc ttgtttgtaa     35040
     cgatatttcc cttaggaagg acaccaacgg gtaaaaatgg tctattttca gagctaatag     35100
     ctggaatggc gattatttcc tcattcccca cctgtcgaac ttcaccaaat ttgtaaggat     35160
     atttggaaag ttctttcgtg gttaatcttt cagattttat tctttgatca cagacattat     35220
     caaaacgctc tttcaaagat ggaatttgaa atgcctcatt cctcaggtca tcagttaccc     35280
     aaatacaaaa tctcatattc ccacgaatat attcggaaga tccataaaca ggtttgataa     35340
     acttttcttt ctgatgttct gttaaacgca atctctcaac atcatcccaa gacagcaata     35400
     aatgcccacc gtcattcggc atactgccaa aatccatatc cgatacagaa gagaggggcc     35460
     tactgtgctt ctcgacaacg acatcagaac ccggaaccag ataagcatta atatgccctg     35520
     tctcctgtcg gattgttttc ccgtcatttc cattggaaaa gagaattttt tgacaatctg     35580
     aaacaggcgc aatcccaatg atagcgaccg tcacacccgc attatgcgct gccaaattgg     35640
     cccacttgaa cgacgtatgg gcgaaactga tctcatagtt cagcccaaaa atcagaggcc     35700
     agagaatagc tacctgccgc ccctgacaga tggaattcgt gctcacaaac gcactggaag     35760
     aacctgtttt ttggccataa tccgcagcct tcatgaacca tccggcgacg taatccagag     35820
     acttccagga tttcgtacgc tgcccgaaaa tctgctccag atccgctttc tgttcagcag     35880
     attgccactg actaccctta tacgggggat tgccacaaat atagatctca gaactcttct     35940
     gaggtgcgca gacatcaaac cagtcccgct ccagagcatt cccgcagatg atatgccccg     36000
     tatccttcag gggcagcaca ttcaggcggg cctgtttctg gtcgatatgg atttcgtcac     36060
     tctggaattc agcaatcaga agcgacagac gcgcgatttc caccgcaaaa tcacggatct     36120
     caatcccata gaaattggcc agaggaatga ccgatttccg ttccgcccgc tcgatcttca     36180
     gccggtcatc aatctcgctc tgaatatccc gcatgtcctt ataggcaatc acgagaaaat     36240
     tgcccgatcc acaggccgga tcaaacaccc gaatgccgga cagacgctct ttcaaggcat     36300
     gcagcttctg ggtattctgg cctgcctttt ccagttcctc acgcaggcca tccagaaaca     36360
     gcggattgag cactttgcgg atattgggca cgctggtgta gtgcatcccc agcgcaccgc     36420
     gctccccttc atcagccaca gcctggatca tggacccgaa gatatcgggg ttaatctgcg     36480
     cccagttcag ctccccggca cgcagaagat aggtgcgggc cagtttattg aatttcgggc     36540
     agtccgttgt cccggaaaac aggtttccgt ttacatacgg gaaatccctg gcccaggatt     36600
     tgaccccgcc cttttcgcga tcgtcattgc gcgtatccag atccatcgtc cggaacagct     36660
     cggccatgac ctcatgcgtt tgatccgtgg ccccttccgt catggtctgg atggttctgg     36720
     tgaacagatt gttcaggaag atcccggtat cctcggcaaa aaagcagaag atgaggcgcg     36780
     ccatgaaatg gttcatgtcg tggcggcgtt cttccgttgc ccagtcgggg ttttccttca     36840
     gaagttcgac ataaagacgg ttcaggcgag acgtggcctt aacatcaatc gggttgtttt     36900
     tgatcttctg gacggtcgta atgcccgcca ggggcaggaa aaacccgaac cgatcagcca     36960
     gatgcgtgaa cacatctgta atgtgctcat cttccgtacg gtcttccgcc tcaaacgtca     37020
     ccccatccgt ggccagcaga aaccgtgcct tggccgactg ggtcttgggg ctttccctga     37080
     gcagattgag ggtctgggca acatgcccct caggacaaac ggccagatgg atgttgttgc     37140
     gctgaagcac cgctccggga acgtccgagc ggttatcctt gcgaagccgc ttgatcgtga     37200
     catcgcggtt tccgaacgct tgcaggaact cgaaaggaaa ttccccggga ttaaaaggtg     37260
     cctcggcaat ccgggagaca gcttcttcaa tctcaacggg attcatgcgt aaaattccat     37320
     attttcgaaa aacagatcat acacttcatg cgccaccgga cacctccagg aagaggcgga     37380
     ccagaggtgc gttgatataa taattgctcc gccctgagcg gtgcttggac agcagacctt     37440
     tctctgacag ctgatcgaga tatttccctg ccgtctgacg cgcgatactc aggtccgact     37500
     ggacatactc gattttcgtg taaggatgcc gaaacagatt gttcagcagc tcctggctgt     37560
     aaattttggg cagttccgtc cgcatccgct gcttcatggt ggccatctgc gcccgcatgc     37620
     cctcaatcag ctccagggtg atcctggatg tctcggccac ggcacgcagc atgtagagga     37680
     tccacacttc ccatgcgcct tcatcccgca ccttctgtaa cagatgataa tactcatcct     37740
     tgtggcgtgt gatgtagcgc gacaggtaga ggatcgggat atccagaaga ccggtccggg     37800
     tcagatataa cacgttcagg atccgcccga cgcggccatt cccatcgggg aagggatgga     37860
     tgctctcaaa ctgatggtgg atcagggcca tcttgatgag cggatccagg tcacagagcc     37920
     cgtcatcatt cacgaaccgc tccagatccg acatatgccc gataatctcc cgcccgtcct     37980
     gcggcggcac aaaaactact tcccctgtac gctcgttctt cagagccgtt cccggggtgt     38040
     ttcgaaaccc gtctccccgc ttcttgagcc tctggaaaat cgcgatcagc cccttgttca     38100
     gaatcaggcc atcggtttcc ttcagcagcc gaaatcccag atgtaaggca tcgcgataaa     38160
     gggcaacttc cttggccgcc attgagtccg gcccctctgg aaacagatcc gcctggaaaa     38220
     gctcatcctg ggtggtgacg atattctcga tttccgaaga tgccttggct tcctgcaaag     38280
     ccagcgtatc aatcaggatc ccctgattgg ggatggttgc cgcccgcccc ttcagctctg     38340
     ccagagcctt attagcctcg accagcgcct tgagaaccgg aaccgtttct atctccgcct     38400
     gaggcggcaa aggccgaata tggtaggttg gcgttaacat gacatcctga cgtggtagcg     38460
     atatccattt tttctaacac gtcagaacaa tccgtcaaag aaatccggtt tctttgacat     38520
     atgacggtct tctggatcta cccagtcctt tcaggcccga gaaaaatcgg accgctcagg     38580
     cttcagtcag caatatctcc gcggcctaga gaaagggtcg aagcagatcc cgccttgttt     38640
     ggcgggattt gtttatcttt cccacgctga cagctaccat acgaggataa cccgacgcct     38700
     tctgagccgt tcagaagaca tcttctcaac cgtttgagca gcgttattca tggggcagcc     38760
     gtgtggctat ttcccatttc gatacttggc gaacctgtcg tcttcctccc aatcgaggac     38820
     tggggggggt tttccgattg cgagagcagc gcgaagacgc tgctgcccgg ttgggttttc     38880
     tgggaggacg ttttcgcgtc tgacttctgg tttgtctgcg gctcgttcga catgcttttt     38940
     cggtttcttc ttagaggacg tcaggatcgc tggttcaggt gctacagact ggactggctg     39000
     agccgataac gcggcgagat aggcagcttt gatcttgttt ttctcggccc attttctagc     39060
     cctgtaaaag acggtgaaga aagtcgttct ctctatctca cgccctgttt cctcttttag     39120
     ccaatcgagt atctgatctc ggctttcgcc ttcgatcata cgtttttcaa tttcggaaag     39180
     atgctttctt acaagtcccg aaattgtcga tccggttctc tttcgggatt ctttcaattt     39240
     cctttctcct ttttacgctg ccatttgacg tatcaggact tatgcggcct gtctaactat     39300
     gtgtgtatat tttttgtatg ttttttgtct tgtttttgta aatcccttct ttttgctcat     39360
     tatgttgtct attttctgta tgttttttgt ttgtttcatc tgatattttc cgcaattttt     39420
     ctacctcatt ttgtctattt tttgtgtatg ttatgtattt caatcgttaa ttttttgtat     39480
     attttcttgg tttcaaggtt tactcgctct cgctcgctga aaagaggacg aggttttaag     39540
     cataaaaaag ggtgtgagag gactttttct cctagtgttt cttgggtttt tgctccttaa     39600
     tctggctata cacatgacgc agtccgctgg actgcataac gtattgaaaa caaaaggctt     39660
     tattcgatct atacagtttg tgcgtccgac gcgcgtcgga cattttattg attttatggc     39720
     agttttctgc aataatacgt ccgacaaaat gatatccatt ggtctggaac cgtcatgcgc     39780
     gaacgcaaat acacggtgag attcaccgaa gacgaagctg agtggcttca ggaggttgct     39840
     cttgatggca acgtgtctgg ctatattcgg gacaccgttt tgagacagtc caaaagtgac     39900
     cgcaaactgg tcagcatgaa tgaaagattg gtggaccttg gtcaggatat gaggctggtc     39960
     accgaccttc tgcatgacct ggaccagaag gttgcgggca cacccacagc accggacgcg     40020
     accggctcac aggagccaga gggcatcccg gacgagctga tggctatggt gctggaaatc     40080
     ctgcttctgg tgcgctcatt cagtgcgcca catgagaggc aaatggccca ggcagatgtg     40140
     gcgcaaatcg gcctgccaat ttggaggaag gcaaatttgc gggaccgttg acctctgaca     40200
     tgctcaccgg cctgaaggcc ggtgagcatg tcaggtaaga ggaaagacag ctacgtcgat     40260
     ttaaccatca gctccaacca acaaagcaat ctgacgtctg attgtgaata attgatcagg     40320
     ccgtaccttg cttccggtta tgcggagacg atgcttggat gtggttgtca gcaaagcgct     40380
     aattgcccaa catgacttgg aacagccgtt atcagcgctc ggatcaatcc gaaccgccag     40440
     atcgggaata acgaggttct cgtcgtcggt taggggaaca agcatgacgt tcggccattc     40500
     aggcggaaat aattcatctt caacaacaac agcaggtcgg agtttgttcg gctcttttgg     40560
     caaggcatca ccccgccaat ctgcaagaac aatctcgcca ggagcgaaaa ctctcccgct     40620
     ggcgacaacc gaccgatcac gcaccatggg ttccgccggt ctcttcaaaa agttcctggg     40680
     cagaaggtgt tgccgcaacg tagcgggcaa cccgtgcact gtctctgcga atacgatcgc     40740
     ggcgcgcgcg ctttgctcct gtttccagga gatcacggac aagctgactc aaaggaatac     40800
     cgctcgctgc tgcttcctgt tcaagattga gacgtagacg ttcatctagc cggattgaaa     40860
     gcggagatgc catagcttcc tccatacaaa ttgtatgctg attttgtagc acaattatgt     40920
     attcaaccac aacaagaaac actctgagat caagcctatc tcccccgaac atgcaatttt     40980
     taacagatcg tggcttccag atatgcttta cggacgttct gcatgtcttg tggcgtgaac     41040
     ccggcggtat ggcaggcaat ggtggcctga gcctcaggca gccttgagat acgcataaag     41100
     cgtttcccga cttattccta agtcacgagc aatccgggct ttgggctcat gggcagaaac     41160
     gcgggccttt agttccgtga tctgttccgg tgacagggat ttcctgcgtc cgggtagctt     41220
     tcccctggct ctggcagcct gttgcccttc gcgctggcgt tccttgatta aagaccgctc     41280
     gaattgagcg aaagacccca tcacttgcag gatcatcgtc tgcatgggcg aagcgttccc     41340
     ctcgaacgtc atggcttctt tgataaaccg aacacctacg ccacggtctg tgagtgtctc     41400
     cacaagatgc aataggtctt gaaggtcacg cgcgagccgg tcgatgctgt ggcagattat     41460
     ggtgtcacct tcccttacat aacgaagcat ctcggtgagg gctggtctgt tacgcgtgcc     41520
     gccggagcat ttgtccgtga agatcttatc caccttcacc ccatcgacgc ggatttctca     41580
     cacttgaggc aatttcgggt cattttgtag aattcagtca taccacagga gcccgatctg     41640
     gaatattgac gatattgtgc ttctggcggc gggttctgaa cgcagtgagg gtgtcacggc     41700
     ctgagaaggc agtgttggtg gaagctatgt ggtctgtgca ctgtctgttt cttcagatgg     41760
     cctgccggag ccttcgcaat cgtgcatgag cgagggcgaa ttcatgctga caggggaaca     41820
     tgtccggcat ggacaggaca atccgacgga cgctgagcgt tacacgtgtc gcgattttga     41880
     gcagccgtgc gcgtatggtg ccacaggtcg ccgtctccag gctggtctgg ccaagggcca     41940
     gtctttgcag agcggtcagc aggacatagg ctgcggccga gaaccacagc cggagctggt     42000
     tggcccggat ggtgtgggac gaggtcctgt ctgagaacag atccatctgg cattccttga     42060
     tgcggttttc catatccccg cgtgcgcagt aaatctgttc gtagagatgg cgggggtcgg     42120
     acattccctg cggtagggtg gtgacaatga agcgatgata gcggttgccg tggcgccatt     42180
     cggccttggc cacgacccgc ctgcggcgcg tccagctgtc ctttgtgatc cagtcaaagg     42240
     aggcgaaacc gcgcgcagct ctgcctgtcg tggcggcttc gtcacgaacc tcagcggaca     42300
     aagaggcaat ccggtcatac aggcgggtgt tgcctgcaag cccgaacagg aagtcaacgt     42360
     ggttgtcttc gcaccatgtc atcagactgt cccgggcgaa accgctgtcc ccacgcacca     42420
     ggatacgcac ccggggccaa cggctcctga tctgctccac gatccggcgg atgtctgcca     42480
     gtgcttcctt ccccgggtcc ctgtctgccg tgcgcagggt agcgctgagg agatggtccc     42540
     cgcagaagac atacagggga agatagcagt tatggccgta atatccatga aaggcgcggc     42600
     cttcctgatg gccatggata cggtcatcgg tggcatccac atccagaacg atccgggcgg     42660
     gtgcgtgctc atgctggtca aggaagagcg tgacgaacag ggtagccagg gcctcatgat     42720
     cagcaatgat gcggcagtaa cgatctgcct gctgcccact gcgctccaac cggttcagtg     42780
     tagatttgcc agccaatgct gcgcagtttg cccggcctcc tgacagacga cccgaggcca     42840
     gaccaaagat caggtcatgc cgcagggcat cgtgatcatt gagatcttca tagcccagtg     42900
     ccaggcccat gatccgctga cggacaaggt cttcaacccg gtattccaca aagccgggat     42960
     gccgcttatc gcgaaaacag gcagcaaagc ggcggctgag acccagaatg tcatcagcct     43020
     gcttcaccag aattacgccc ccatccgaac tcatgcgacc cccgtcaaaa cgggccacaa     43080
     cacgccgtcc acaggaggct ggaaactcat acgcgcctgc gctacactct gtctgcatcg     43140
     ggttttcttg atgattatgg aaatttcttt tctacaaaac agactttttc ataatctaac     43200
     ccgatgtaca acccttctgt gagatttccg cgttgaggcc agcccgacgc tgaaaatgac     43260
     gccccaggcg tatgggcagg ggatacgaga ggaaggactg gccgccagcc ggagacttga     43320
     aggggtcttc gaaaaggcga tcggagaagt ccggaaagaa cggcaggcgc tggcgtcgat     43380
     tgttggtgag gcgaacaatc gacgtgatca atggttttac ctgattttta tcggtctcat     43440
     ggcatttctg tttggggtgg gggtcgcacc gcttctattt aatcacatca cctggaagaa     43500
     ttttgatgag cgtgtggctt cgttcattgt tggggggcag gatcggtggg agtccggagc     43560
     tgcgatgatg cgagatgcac ggcccgagca atggaacagc tttatgtggg aggatcggct     43620
     ggtgcaggac aatatgccga aaatcaggga ctgtcggatc gcggcgacac aggtcggaca     43680
     gccgaagccc tgcgtgatta cgattaagcc tgatgcacag tagtatttga tgaggaataa     43740
     gttttcataa ggaaagggct ttcccggcaa agggaaagcc ccaacattat ttgtccggtt     43800
     aaccgagatt aagcagaatg ttttttcatg tcagagtttg gctttgtgtt cagcagatag     43860
     gggcctgcgg cacgaatagt catggagaga atacccattt tcccatgtgt caggtgatca     43920
     cctaacggga gttcagcatt cccattggtc catgcgcagt ccgtccagtc ggtatcgtgc     43980
     caacccgaag gtttttcgtc ctgaaggtga gaagtaatat cgaactgctg tttggcacat     44040
     tgaagctgca catctgctac ggccacgccc atatagcgac gatcatcgac aaacgggcca     44100
     atcacgtctg atggacggct agaacgcgag acgatccgca cagactctgt atttggtggt     44160
     agcatgaagc tgtagtgatg cgcggtctta cgcatgggac ggatcacagc gcctgtctga     44220
     gtgataagat gtaggtcagg atccgttgtc gtttcgattt ttgtcgtcga gatcttggtg     44280
     cccacaacac tgttttcacg ccattgcaga gcccggaaga gcggttctac aaaggagcgt     44340
     tccacgccca atggcgcacc ggcatgatct gcccagttct ttaccgctcc gcgcagagtt     44400
     gcgattttgc cttcctgacg gaaggatgaa cggttcccgg tatcaagata gctttcggtg     44460
     agcatgccat cagcggtgat gacagaatgc tgttctgttt ctacgtgata gtaatcgtaa     44520
     gaagtaatgg acttgtcata gaagatagac acaccattga ccagcatacg aacggggaca     44580
     aaacggtctc tgaagaacaa gcagtgttca gccgtaatca gcatatcctt ataaggtacg     44640
     ccatcggcaa tggcgtcttt aaggatacgc acaggccagc cagcttcatc atcgggaagg     44700
     tcaggacgta ctgtcgcacg cgctttaccc acccagacaa cctgacggac tacgtcttca     44760
     tcgtttctcc aatcaaaagc gattacttca tcaccaatct ggatatcttc gaccgcgaca     44820
     tccccttccg aggtacggat catgctgcca gaaagaaagc agacttcagc agatgcgcca     44880
     ccatgatgat catcggaaag gacaaatcca gtatttttga caccaggaat attcagggta     44940
     atggtgttgc cattggctag tgtaaccaca acctgatcat cagacggata agcataagat     45000
     gctccatctg ctgaaacccc aggcagatcg atactatcag aatttcctgg tttgctgccg     45060
     ctccagccgc tgatcacagt gctgactgtt cccccgcttt ccagaccaga aatagtcaaa     45120
     ccatgatttg tgtcgcctga gagatcaatc gtaccgctgg tattgttcca aatcgtagca     45180
     gttccaccgt cttgaatggt cacgacgtct gaaatagtag cgccactggc tacaatagca     45240
     gatccgccac tcgatatgga tgttaatcca agtatacttc ctgaatctgc ataaatttta     45300
     ccaccattat taacatgatt attatttgat acgccaccag aattgatttc tattacgccg     45360
     ccattgttga cagtcgtgtc tgaggcaatg cctgcaaccc ctaaaccgcc accactggaa     45420
     ataataatat cttggcctct gccccctttg ctgaccacaa tattaccaaa tgcggctgca     45480
     tcggcatcgg tgagaacccc accagataaa accttaatct gggccccaga ggtagcggtt     45540
     cccccactga ttgttccccc agaccgtgcg actgtcgtac cctttaaaat agcgccagaa     45600
     gagaaaataa ctgtcccaat agatcctgca tttccggcag taatctcttc tgcgatgcct     45660
     ccactgagta tggtggttat acccccagca gtagcagctc ctcctgaaat aaaaccacca     45720
     tcatgtacga ttattttacc ttcgtttagc cagactccgg catcagtatt ctgaagcaat     45780
     tgtgctccgc taagaacaag tatttcccct cctccagtat taccagaagc ctctttaatt     45840
     gtttgctgca taccggtggc tccagaagaa aggacctcct tagagttact gggaacagtc     45900
     actcctgaaa caacttgacc ggatgtgaaa gttgttgtgc ccggagtaag gtaaggcgtt     45960
     ccattagaag gattgacaat actcatttta tcactttcaa aagttgtgat ttgcgcaaac     46020
     tctctctagg cggaaaagtt tgctcttaga aaacattatc tatttaaaga taccaatcaa     46080
     tctaatcaag tattttaata ttaaaaataa accccatgca ttgaacgttt gcgcaaatca     46140
     ccattcccaa aaaaatatca ccgtgaaata gcattctcct tcattacgaa ggacgaaaca     46200
     ggtgcgtaga attggttatg ctcgtgtcag cacgattggc caggtaatcc ccccataaaa     46260
     agagtgactt ttgaatgaga attttctcag cgtaagaatt gaggagattc tgatgaagag     46320
     tgatcgcttt agtgacgccc agatcatggg tgtgatccgc caggctgagg gcggtgtccc     46380
     ggttcctgac ctgtgccggg agcatgggat cagcaacgcc acgttttacc ggtggcgcgc     46440
     gaaatatggc ggcatggatg cttcgatgat cagtcagatg aaggctttgg aagaggagaa     46500
     ccgtcggctg aagcgcatgt atgcggattt gagcatgcag acggatatcc tgaaggaagc     46560
     ccttggaaaa aaatgaagcg gccagcccag cgccgggaac tggccgcaca ggctgtggcg     46620
     catcatgggg tcagcattgc gctggcctgt cggatttttg ggatatccga gacctgcttt     46680
     cgctatcgtc cgcgactggc agcggagaat gacaggattg ccgctcttct ggtgggactg     46740
     acccaggctc acaggagatg gggatttggt ctgtgtttcc tgtatctgcg caatgtgcag     46800
     ggacagctct ggaatcataa gcgggtttat cggatctatc gggaactgga gttcaacctg     46860
     cggattaaac cccgcaggcg tctggttcgc gaaaagcctg aaaagctgtc ggttccggcc     46920
     cttcccaaca cggtctggtc catggatttc atggcggaca ggcttttgga tggacgcgct     46980
     tttcggctcc tgaacatcct ggatgagttc aatcgtgaag gactggcgat cgaggttgat     47040
     ttttccctgc cggcctgtcg ggttgtccgc tgtctggaac aggttatgga gtggcgcggc     47100
     aggccagaag ccatccgaat ggataatggc cctgaatatg tcagtcatac gttggtttca     47160
     tgggccgaaa aacaggggat taccctgatc tatacgcaac cgggtaatcc gcagcagaac     47220
     gcctatattg aacgctacaa cagaactgtc cggcaggaat ggctggagca gtatctgttt     47280
     gaaagcattc aggacgtgca ggaggtcgca acacaatggc tctggacata taaccatgac     47340
     agacccaaca tggggaacag cgggctaacc cccgcccaga aactaaaaac agctgcctga     47400
     attctcattc aatgccccac taaaaatggg gggattaccg gtgtatcaag ggctgcatgg     47460
     tggtttttcc gggagatttc agatgtgaca acatgcgggc tatgaagttg tcccgctgga     47520
     gacgctttca ttatcatctc ttgctaaaaa tacggcaatg ccgcataaag agttatgcat     47580
     tcagttatag aaaccccgat ctttaccaag agggcagatg ctcttttgag ccgtgaagaa     47640
     cgggcagaac tcattaggct gcttgctgag aacccacgcc aaggtgacgt tatccccgga     47700
     actggtggcg ttagaaagct aaggtttgct gggtcaggtc gaggcaagag gggcggtgtt     47760
     cgggtcatct ggtatgtcgc gagtgatcgg attcctgttt atgccttgtt gatctacggc     47820
     aagaatgaac aggacgatct tacgcctgac cagaagaaag ccatggcttc tatggctgaa     47880
     cgcataaaga aatcagatca aggaggaact taacatggca gagcaaatga atattgccga     47940
     tgaactactt acctccatgg agcaggccgt aggtattgcc gcaggaactg tgaagcccgg     48000
     tcgtatctgg acgcctcctg aaatcaatgt tgctgatatt cggaagcgaa cggggcttag     48060
     ccaagtgcgt tttgctgcgc gatatggttt cagtgccgcc gctgtgcgtg actgggagca     48120
     gaagcgccgg acgccagaaa aggctgcccg cacgttgctg atgcttatcg acaaagaacc     48180
     gcaggcggtg gagcgtgtgc ttgttggcgt gtgatgctct tgccagactc atcttcgcag     48240
     atacataatg cctgaaacga cgaagccctt ggagctacta actccaaggg cttcaaaaac     48300
     tcgctatagc gcggcgaggt ggacttgatg caagaggtgg tggaacacct attgcgtcca     48360
     atgctgatat tgtaaggata accgaagccg gtttcaagcc ttagatcagc aggagagagg     48420
     atgcctcgcc tttttgaaag gcttttggtt gtgacctctt tcgcttctac tctctggaca     48480
     ctcacacaat ctcgtcagat cacaggtaaa acacaccttg tcttgcaggc gctcgccagc     48540
     tttcagggat atcgtggtct ctttccgtcg cacgaaagca tcgcatcccg atctggttgc     48600
     tctgttagaa ccgttatacg ggccttagag gccgcttacc ggctgggcat agtcacacgg     48660
     acgcggcaac gtcagagggt gtcagggcgc gtctgtaacg gcgttaatcg ttatcgtctg     48720
     atcatcaagc cattggagca agccagagcc gccgccgtac attatacgca acagctacgt     48780
     gaagccctta gccgcaggaa acaggcgttt ctttctaagt gccaaaatga cagcgaacct     48840
     catattcaga gtaatttctt taatacagaa ccgctttcag gcgccggaat gtcacataat     48900
     gacctgatac gatggtgtga gagcatagga tatcggggca gcacctagtc tcacttcttc     48960
     caacacacca aaaaccagca ccgtatggct caggaatagg gagcatgtga gaccgcacgg     49020
     gtataaactc ggccttactt agcccgaaca gatgtatcga aagttcgttc aaggttgctg     49080
     caaggttcgc agcacatatg tcggagattg tcgaaaggtt tgcgctaaat ttgcaggtgt     49140
     atgtctcttt ttatggcgta agaatatcat gttagttgtg ggcaggacag gtaatgtaac     49200
     gtcacggcag gccgtaacgt gacatcacgc ctgctttatt cgcctaccgg ctcaacagga     49260
     tattgaacac atgaacacac attcacccga aaaggcgaaa ccatgaaaac gggaaagatt     49320
     gtggtcatct caaagctgaa aggcggttca ggtgcgacaa cactcacccg cgaactggct     49380
     acgtcggcac tagatgcagg aaaatcggtt gctatcatcg accttgatgc acagggtagt     49440
     ctaacgaatt ggtggaacag aaggacggca gccacgccag acgctggccc taaactaatc     49500
     cagttatcac ccgaaaatct gcctgacatg acggaaaagc tacggggtaa gtttgatctt     49560
     gtcctgatcg acacgccgcc aagcacccat gacgctttgc ggaagattgc cagcaaggca     49620
     gatatggccg tgatacccac caagcctacg ccggacgatc tggacgcggt ggggccggtc     49680
     attcgtcagc tgcgcggtgt tgtgcctatg gcgttcgtga ttagccagat caccaacaag     49740
     cgtagccctg atgcagtgga ggcgaccgaa ttactttccg ccagagcgcc ggtcataggt     49800
     cgcaccgtca ttcgcgtggg ttactatcgg gcagccggtg cggggcaatc tgggttcgag     49860
     actgacaaga ctgtcagaga agaaattgcc accgtttatg ataacctcat ggccctgtta     49920
     ggagattacc acgcatgagc aagcggcctt cccttggttc c                         49961
//